U.S. patent application number 13/445435 was filed with the patent office on 2012-11-15 for kinase inhibitors useful for the treatment of proliferative diseases.
This patent application is currently assigned to DECIPHERA PHARMACEUTICALS, LLC. Invention is credited to Daniel L. Flynn, Michael D. Kaufman, William C. Patt, Peter A. Petillo.
Application Number | 20120289540 13/445435 |
Document ID | / |
Family ID | 39184593 |
Filed Date | 2012-11-15 |
United States Patent
Application |
20120289540 |
Kind Code |
A1 |
Flynn; Daniel L. ; et
al. |
November 15, 2012 |
KINASE INHIBITORS USEFUL FOR THE TREATMENT OF PROLIFERATIVE
DISEASES
Abstract
The present invention relates to novel kinase inhibitors and
modulator compounds useful for the treatment of various diseases.
More particularly, the invention is concerned with such compounds,
kinase/compound adducts, methods of treating diseases, and methods
of synthesis of the compounds. Preferrably, the compounds are
useful for the modulation of kinase activity of Raf kinases and
disease polymorphs thereof. Compounds of the present invention find
utility in the treatment of mammalian cancers and especially human
cancers including but not limited to malignant melanoma, colorectal
cancer, ovarian cancer, papillary thyroid carcinoma, non small cell
lung cancer, and mesothelioma. Compounds of the present invention
also find utility in the treatment of rheumatoid arthritis and
retinopathies including diabetic retinal neuropathy and macular
degeneration.
Inventors: |
Flynn; Daniel L.; (Lawrence,
KS) ; Petillo; Peter A.; (Lawrence, KS) ;
Kaufman; Michael D.; (Lawrence, KS) ; Patt; William
C.; (Lawrence, KS) |
Assignee: |
DECIPHERA PHARMACEUTICALS,
LLC
Lawrence
KS
|
Family ID: |
39184593 |
Appl. No.: |
13/445435 |
Filed: |
April 12, 2012 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
11854354 |
Sep 12, 2007 |
8188113 |
|
|
13445435 |
|
|
|
|
60844552 |
Sep 14, 2006 |
|
|
|
Current U.S.
Class: |
514/300 |
Current CPC
Class: |
A61P 9/00 20180101; A61P
17/06 20180101; A61K 31/519 20130101; A61P 1/04 20180101; A61P
19/08 20180101; A61P 11/00 20180101; A61P 19/02 20180101; A61P
31/04 20180101; A61P 35/00 20180101; A61K 31/4375 20130101; A61P
35/02 20180101; A61P 43/00 20180101; C07D 471/04 20130101; A61P
1/00 20180101; A61P 35/04 20180101; A61P 37/00 20180101; A61P 37/06
20180101; A61P 37/02 20180101; A61P 29/00 20180101; A61P 9/10
20180101; A61P 27/02 20180101; A61P 19/00 20180101; A61P 11/06
20180101 |
Class at
Publication: |
514/300 |
International
Class: |
A61K 31/4375 20060101
A61K031/4375; A61P 35/04 20060101 A61P035/04; A61P 9/00 20060101
A61P009/00; A61P 19/02 20060101 A61P019/02; A61P 11/00 20060101
A61P011/00; A61P 35/00 20060101 A61P035/00; A61P 29/00 20060101
A61P029/00 |
Claims
1-45. (canceled)
46. A method of treating an individual suffering from a condition
selected from the group consisting of cancer, hyperproliferative
diseases, secondary cancer growth arising from metastasis, diseases
characterized by hyper-vascularization, inflammation,
osteoarthritis, respiratory diseases, stroke, systemic shock,
immunological diseases, cardiovascular disease and diseases
characterized by angiogenesis, comprising administering to an
individual an effective amount of a compound or a salt thereof, of
the formula IIa: ##STR00103## wherein Q1 is N and Q2 is CR3;
wherein E1 is; wherein A is selected from the group consisting of
phenyl, naphthyl, C3-C8-carbocyclyl, --CHR4R8; pyridinyl, and
benzothienyl; when A has one or more substitutable sp2-hybridized
carbon atom, each respective sp2 hybridized carbon atom may be
optionally substituted with a R3 substituent; when A has one or
more substitutable sp3-hybridized carbon atom, each respective sp3
hybridized carbon atom may be optionally substituted with a R3
substituent; each Z3 is independently and individually selected
from the group consisting of H, methyl, ethyl, isopropyl, C3-C4
carbocyclyl, halogen, fluoroalkyl wherein the alkyl moiety can be
partially or fully fluorinated, and cyano; wherein each R3 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, branched C3-C7alkyl, and C3-C8carbocyclyl; each
R4 is independently and individually selected from the group
consisting of C1-C4alkyl, branched C3-C5alkyl and C3-C5carbocyclyl;
each R8 is independently and individually selected from the group
consisting of C3-C8carbocyclyl, and Z3-substituted phenyl; R16 is
independently and individually selected from the group consisting
of hydrogen, methyl, ethyl, halogen, fluoroalkyl wherein the alkyl
moiety can be partially or fully fluorinated, cyano, and
C2-C3alkynyl; and
47. The method of claim 46, wherein the compound has formula IIb.
##STR00104##
48-66. (canceled)
67. The method of claim 47, wherein the compound has formula IIv;
##STR00105## wherein R16 is methyl, ethyl, cyano, -ethynyl, or
halogen, and wherein the substituent Z3 can be in either of the
fused phenyl rings comprising the naphthyl ring.
68. The method of claim 67, wherein the compound has formula IIw:
##STR00106##
69. The method of claim 67, wherein the compound has formula IIx:
##STR00107## and wherein R16 is methyl, ethyl, cyano, -ethynyl or
halogen.
70. The method of claim 47, wherein the compound has formula IIy:
##STR00108## and wherein R16 is methyl, ethyl, cyano, -ethynyl, or
halogen.
71. The method of claim 70, wherein the compound has formula IIz:
##STR00109##
72. The method of claim 70, wherein the compound has formula IIaa:
##STR00110## wherein R16 is methyl, cyano, -ethynyl, or
halogen.
73. The method of claim 47, wherein the compound has formula IIbb:
##STR00111##
74. The method of claim 73, wherein the compound has formula IIcc:
##STR00112##
75. The method of claim 73, wherein the compound has formula IIdd:
##STR00113## wherein R16 is methyl, ethyl, cyano, -ethynyl or
halogen.
76. The method of claim 47, wherein the compound has formula IIee:
##STR00114## wherein R16 is methyl, ethyl, cyano, -ethynyl, or
halogen.
77. The method of claim 76, wherein the compound has formula IIff:
##STR00115##
78. The method of claim 76, wherein the compound has formula IIgg:
##STR00116## wherein R16 is methyl, ethyl, cyano, -ethynyl, or
halogen.
79. The method of claim 47, wherein the compound has formula IIhh:
##STR00117## wherein R16 is methyl, ethyl, cyano, -ethynyl, or
halogen.
80. The method of claim 79, wherein the compound has formula IIii:
##STR00118##
81. The method of claim 79, wherein the compound has formula IIjj
##STR00119## wherein R16 is methyl, cyano, -ethynyl, or halogen CCH
fluorine or chlorine.
82-91. (canceled)
92. A method of treating an individual suffering from a condition
selected from the group consisting of cancer, hyperproliferative
diseases, secondary cancer growth arising from metastasis, diseases
characterized by hyper-vascularization, inflammation,
osteoarthritis, respiratory diseases, stroke, systemic shock,
immunological diseases, cardiovascular disease and diseases
characterized by angiogenesis, comprising administering to an
individual an effective amount of a compound selected from the
group consisting of
1-(2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridi-
n-3-yl)phenyl)-3-(3-(trifluoromethyl)phenyl)urea,
1-(2-fluro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-nap-
hthyridin-3-yl)phenyl)-3-(3-(trifluoromethyl)phenyl)urea,
1-(4-chloro-3-(trifluoromethyl)phenyl)-3-(2-fluoro-4-methyl-5-(1-methyl-7-
-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(4-chloro-2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(3-(trifluoromethyl)phenyl)urea,
1-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2--
fluoro-4-methylphenyl)-3-(3-(trifluoromethyl)phenyl)urea,
1-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2--
fluoro-4-methylphenyl)-3-(naphthalen-1-yl)urea,
1-(2-fluoro-5-(1-isopropyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyr-
idin-3-yl)phenyl)-3-(3-(trifluoromethyl)phenyl)urea,
1-cyclohexyl-3-(2-fluoro-5-(1-isopropyl-7-(methylamino)-2-oxo-1,2-dihydro-
-1,6-naphthyridin-3-yl)phenyl)urea,
1-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2--
fluorophenyl)-3-(naphthalen-1-yl)urea,
1-(2-fluoro-5-(1-isopropyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyr-
idin-3-yl)phenyl)-3-(2-fluoro-5-(trifluoromethyl)phenyl)urea,
1-(4-chloro-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-
-3-yl)-2-fluorophenyl)-3-(3-(trifluoromethyl)phenyl)urea,
1-(4-chloro-3-(trifluoromethyl)phenyl)-3-(5-(1-ethyl-7-(methylamino)-2-ox-
o-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)urea,
1-(4-chloro-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-
-3-yl)-2-fluorophenyl)-3-phenylurea,
1-(4-chloro-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-
-3-yl)-2-fluorophenyl)-3-(2,3-difluorophenyl)urea,
7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)--
3-(3-(trifluoromethyl)phenyl)urea,
1-(2-fluoro-5-(1-isopropyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyr-
idin-3-yl)-2-fluorophenyl)-3-(naphthalen-1-yl)urea,
1-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2--
fluorophenyl)-3-(2-fluoro-5-(trifluoromethyl)phenyl)urea,
(4-chloro-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-
-yl)-2-fluorophenyl)-3-cyclohexylurea,
1-cyclohexyl-3-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-d-
ihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(4-chloro-2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-cyclohexylurea,
1-(4-chloro-2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-phenylurea,
1-(4-chloro-2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(naphthalen-1-yl)urea,
1-(4-chloro-2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2dihydro-1,6-nap-
hthyridin-3-yl)phenyl)-3-(4-chloro-3-(trifluoromethyl)phenyl)urea,
1-(4-chloro-2-fluoro-5-(1-methyl)-7-(methylamino)-2-oxo-1,2-dihydro-1,6-n-
aphthyridin-3-yl)phenyl)-3-(2-fluoro-5-(trifluoromethyl)phenyl)urea,
1-(4-chloro-2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(3-cyanophenyl)urea,
1-(4-chloro-2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl-3-(2,3-difluorophenyl)urea,
1-(4-chloro-3-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-
-3-yl)phenyl)-3-cyclohexylurea,
1-cyclopropyl-3-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2--
dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
(R)-1-(2-fluoro-4-(methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1-
,6-naphthyridin-3-yl)phenyl)-3-(1-phenylethyl)urea,
1-(2-flouro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(5-(trifluoromethyl)pyridin-3-yl))urea,
1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(4-methyl-5-(trifluoromethyl)pyridin-3-yl)urea,
1-(2,4-difluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthy-
ridin-3-yl)phenyl)-3-(5-(trifluoromethyl)pyridin-3-yl)urea,
1-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2--
fluorophenyl)-3-(5-(trifluoromethyl)pyridin-3-yl)urea,
1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(4-fluoro-5-(trifluoromethyl)pyridin-3-yl)urea,
1-(4-chloro-2-fluoro-5-(1-methyl-7-(methylamino-2-oxo-1,2-dihydro-1,6-nap-
hthyridin-3-yl)phenyl)-3-(5-(trifluoromethyl)pyridin-3-ylurea,
1-(5-(7-amino-1-methyl-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoro--
4-methylphenyl)-3-(3-(trifluoromethyl)phenyl)urea,
1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(2-fluoro-5-(trifluoromethyl)phenyl)urea,
1-cyclohexyl-3-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyr-
idin-3-yl)-2-fluoro-4-methylphenyl)urea,
1-cyclohexyl-3-(2-fluoro-5-(1-isopropyl-7-(methylamino)-2-oxo-1,2-dihydro-
-1,6-naphthyridin-3-yl)-4-methylphenyl)urea,
1-cyclohexyl-3-(5-(1-cyclopentyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)-2-fluorophenyl) urea,
1-cyclohexyl-3-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyr-
idin-3-yl)-2-fluorophenyl)urea,
1-cyclohexyl-3-(2,4-difluoro-5-(1-methyl-7-(methylamino-2-oxo-1,2-dihydro-
-1,6-naphthyridin-3-yl)phenyl)urea,
1-(4-cyano-2-fluoro-5-(1-methyl-7-(methylamino-2-oxo-1,2-dihydro-1,6-naph-
thyridin-3-yl)phenyl)-3-cyclohexylurea,
1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl-3-((1R,2R)-2-methylcyclohexyl)urea,
1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-((1S,2S)-2-methylcyclohexyl)urea, and
1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-((1r,4r)-4-methylcyclohexyl)urea.
93. (canceled)
94. (canceled)
95. The method of claims 46 or 92, wherein the compounds of claims
46 and 92 are combined with a pharmaceutically acceptable carrier,
said carrier including an additive selected from the group
including adjuvants, excipients, diluents, and stabilizers.
96-98. (canceled)
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of Provisional
Application 60/844,552 filed Sep. 14, 2006. This application is
incorporated by reference herein.
FIELD OF THE INVENTION
[0002] The present invention relates to novel kinase inhibitors and
modulator compounds useful for the treatment of various diseases.
More particularly, the invention is concerned with such compounds,
kinase/compound adducts, methods of treating diseases, and methods
of synthesis of the compounds. Preferrably, the compounds are
useful for the modulation of kinase activity of Raf kinases and
disease polymorphs thereof.
BACKGROUND OF THE INVENTION
[0003] Several members of the protein kinase family have been
clearly implicated in the pathogenesis of various proliferative
diseases and thus represent important targets for treatment of
these diseases. Some of the proliferative diseases relevant to this
invention include cancer, rheumatoid arthritis, atherosclerosis,
and retinopathies. Important examples of kinases which have been
shown to cause or contribute to the pathogenesis of these diseases
including, but not limited to, BRaf, CRaf, Abl, KDR(VEGF),
EGFR/HER1, HER2, HER3, cMET, FLT-3, PDGFR-a, PDGFR-b, p38, cKIT,
JAK2.
[0004] A major signaling pathway downstream of cell surface growth
factor receptor activation is the Ras-RAF-MEK-ERK-MAP kinase
pathway (Peyssonnaux, C. et al, Biol. Cell (2001) 93: 53-62,
Cancers arise when mutations occur in one or more of the proteins
involved in this signaling cascade. Cell proliferation and
differentiation become dysregulated and cell survival mechanisms
are activated which allow unregulated cancer cells to override
protective programmed cell death surveillance. Mutations in the
p21-Ras protein have been shown to be a major cause of
dysregulation of this signaling pathway, leading to the development
of human cancers. P21-Ras mutations have been identified in
approximately 30% of human cancers (Bolton et al, Ann. Rep. Med.
Chem. (1994) 29: 165-174). Cancer-causing mutations in the P21-Ras
protein lead to a constituitively active signaling cascade, causing
unregulated activation of the downstream components of the
RAF-MEK-ERK-MAP kinase pathway (Magnuson et al., Semin. Cancer
Biol. (1994) 5: 247-253). The three RAF kinases which participate
in this signaling cascade are known as ARAF, BRAF, and CRAF
(Peyssonnaux, C. et al, Biol. Cell (2001) 93: 53-62; Avruch, J.,
Recent Prog. Horm. Res. (2001) 56: 127-155; Kolch, W., Biochem. J.
(2000) 351: 289-305). These RAF kinase isoforms are all activated
by Ras, and thus are activated in cancers that result from mutated
and upregulated p21-Ras protein activity. In addition to activation
of this signaling cascade at the initial p21-Ras protein level,
mutations have also been found in BRAF kinase which results in
activation of the cascade downstream from p21-Ras (Davies, H., et
al, Nature (2002) 417: 949-954). A dominant single site mutation at
position 600 in the BRAF kinase was shown to be particularly
aggressive and linked to approximately 80% of the observed human
malignant melanomas. This mutation substitutes the negatively
charged amino acid glutamic acid for the normally occurring neutral
amino acid valine. This single site mutation is sufficient to
render the mutated BRAF kinase constituitively active, resulting in
signaling pathway dysregulation and human cancer. Hence small
molecule inhibitors of BRAF kinase are a rational approach to the
treatment of human malignancy, whether the signaling mutation is at
the level of the upstream p21-Ras protein or at the level of BRAF
kinase.
[0005] The majority of small molecule kinase inhibitors that have
been reported have been shown to bind in one of three ways. Most of
the reported inhibitors interact with the ATP binding domain of the
active site and exert their effects by competing with ATP for
occupancy. Other inhibitors have been shown to bind to a separate
hydrophobic region of the protein known as the
"DFG-in-conformation" pocket, and still others have been shown to
bind to both the ATP domain and the "DFG-in-conformation" pocket.
Examples specific to inhibitors of RAF kinases can be found in
Lowinger et al, Current Pharmaceutical Design (2002) 8: 2269-2278;
Dumas, J. et al, Current Opinion in Drug Discovery &
Development (2004) 7: 600-616; Dumas, J. et al, WO 2003068223 A1
(2003); Dumas, J., et al, WO 9932455 A1 (1999), and Wan, P. T. C.,
et al, Cell (2004) 116: 855-867.
[0006] Physiologically, kinases are regulated by a common
activation/deactivation mechanism wherein a specific activation
loop sequence of the kinase protein binds into a specific pocket on
the same protein which is referred to as the switch control pocket
(see WO 200380110049 for further details). Such binding occurs when
specific amino acid residues of the activation loop are modified
for example by phosphorylation, oxidation, or nitrosylation. The
binding of the activation loop into the switch pocket results in a
conformational change of the protein into its active form (Huse, M.
and Kuriyan, J. Cell (109) 275-282).
SUMMARY OF THE INVENTION
[0007] Compounds of the present invention find utility in the
treatment of mammalian cancers and especially human cancers
including but not limited to malignant melanoma, colorectal cancer,
ovarian cancer, papillary thyroid carcinoma, lung cancers, kidney
cancers, pancreatic cancer, glioblastomas, myeloproliferative
diseases, and mesothelioma. Compounds of the present invention also
find utility in the treatment of inflammatory diseases including
rheumatoid arthritis, retinopathies including diabetic retinal
neuropathy and macular degeneration, cardiovascular disease and
metabolic diseases.
DESCRIPTION OF THE PREFERRED EMBODIMENTS
[0008] The following descriptions refer to various compounds and
moieties thereof.
[0009] Carbocyclyl refers to carbon rings taken from cyclopropyl,
cyclobutyl, cyclopentyl, cyclohexyl, cycloheptanyl, cyclooctanyl,
norboranyl, norborenyl, bicyclo[2.2.2]octanyl, and
bicyclo[2.2.2]octenyl;
[0010] Halogen refers to fluorine, chlorine, bromine and
iodine;
[0011] Aryl refers to monocyclic or fused bicyclic ring systems
characterized by delocalized .pi. electrons (aromaticity) shared
among the ring carbon atoms of at least one carbocyclic ring;
preferred aryl rings are taken from phenyl, naphthyl,
tetrahydronaphthyl, indenyl, and indanyl;
[0012] Heteroaryl refers to monocyclic or fused bicyclic ring
systems characterized by delocalized it electrons (aromaticity)
shared among the ring carbon or heteroatoms including nitrogen,
oxygen, or sulfur of at least one carbocyclic or heterocyclic ring;
heteroaryl rings are taken from, but not limited to, pyrrolyl,
furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl,
imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl,
tetrazolyl, pyridinyl, pyrimidinyl, pyrazinyl, pyridazinyl,
triazinyl, indolyl, indolinyl, isoindolyl, isoindolinyl, indazolyl,
benzofuranyl, benzothienyl, benzothiazolyl, benzothiazolonyl,
benzoxazolyl, benzoxazolonyl, benzisoxazolyl, benzisothiazolyl,
benzimidazolyl, benzimidazolonyl, benztriazolyl, imidazopyridinyl,
pyrazolopyridinyl, imidazolonopyridinyl, thiazolopyridinyl,
thiazolonopyridinyl, oxazolopyridinyl, oxazolonopyridinyl,
isoxazolopyridinyl, isothiazolopyridinyl, triazolopyridinyl,
imidazopyrimidinyl, pyrazolopyrimnidinyl, imidazolonopyrimidinyl,
thiazolopyridiminyl, thiazolonopyrimidinyl, oxazolopyridiminyl,
oxazolonopyrimidinyl, isoxazolopyrimidinyl, isothiazolopyrimidinyl,
triazolopyrimnidinyl, dihydropurinonyl, pyrrolopyrimidinyl,
purinyl, pyrazolopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, benzisothiazoline-1,1,3-trionyl,
dihydroquinolinyl, tetrahydroquinolinyl, dihydroisoquinolyl,
tetrahydroisoquinolinyl, benzoazepinyl, benzodiazepinyl,
benzoxapinyl, or benzoxazepinyl;
[0013] Heterocyclyl refers to monocyclic rings containing carbon
and heteroatoms taken from oxygen, nitrogen, or sulfur and wherein
there is not delocalized .pi. electrons (aromaticity) shared among
the ring carbon or heteroatoms; heterocyclyl rings include, but are
not limited to, oxetanyl, azetadinyl, tetrahydrofuranyl,
pyrrolidinyl, oxazolinyl, oxazolidinyl, thiazolinyl, thiazolidinyl,
pyranyl, thiopyranyl, tetrahydropyranyl, dioxalinyl, piperidinyl,
morpholinyl, thiomorpholinyl, thiomorpholinyl S-oxide,
thiomorpholinyl S-dioxide, piperazinyl, azepinyl, oxepinyl,
diazepinyl, tropanyl, and homotropanyl;
[0014] Poly-aryl refers to two or more monocyclic or fused aryl
bicyclic ring systems characterized by delocalized .pi. electrons
(aromaticity) shared among the ring carbon atoms of at least one
carbocyclic ring wherein the rings contained therein are optionally
linked together;
[0015] Poly-heteroaryl refers to two or more monocyclic or fused
bicyclic systems characterized by delocalized .pi. electrons
(aromaticity) shared among the ring carbon or heteroatoms including
nitrogen, oxygen, or sulfur of at least one carbocyclic or
heterocyclic ring wherein the rings contained therein are
optionally linked together, wherein at least one of the monocyclic
or fused bicyclic rings of the poly-heteroaryl system is taken from
heteroaryl as defined broadly above and the other rings are taken
from either aryl, heteroaryl, or heterocyclyl as defined broadly
above;
[0016] Poly-heterocyclyl refers to two or more monocyclic or fused
bicyclic ring systems containing carbon and heteroatoms taken from
oxygen, nitrogen, or sulfur and wherein there is not delocalized
.pi. electrons (aromaticity) shared among the ring carbon or
heteroatoms wherein the rings contained therein are optionally
linked, wherein at least one of the monocyclic or fused bicyclic
rings of the poly-heteroaryl system is taken from heterocyclyl as
defined broadly above and the other rings are taken from either
aryl, heteroaryl, or heterocyclyl as defined broadly above;
[0017] Lower alkyl refers to straight or branched chain
C1-C6alkyls;
[0018] Substituted in connection with a moiety refers to the fact
that a further substituent may be attached to the moiety to any
acceptable location on the moiety.
[0019] The term salts embraces pharmaceutically acceptable salts
commonly used to form alkali metal salts of free acids and to form
addition salts of free bases. The nature of the salt is not
critical, provided that it is pharmaceutically-acceptable. Suitable
pharmaceutically-acceptable acid addition salts may be prepared
from an inorganic acid or from an organic acid. Examples of such
inorganic acids are hydrochloric, hydrobromic, hydroiodic, nitric,
carbonic, sulfuric and phosphoric acid. Appropriate organic acids
may be selected from aliphatic, cycloaliphatic, aromatic,
arylaliphatic, and heterocyclyl containing carboxylic acids and
sulfonic acids, examples of which are formic, acetic, propionic,
succinic, glycolic, gluconic, lactic, malic, tartaric, citric,
ascorbic, glucuronic, maleic, fumaric, pyruvic, aspartic, glutamic,
benzoic, anthranilic, mesylic, stearic, salicylic,
p-hydroxybenzoic, phenylacetic, mandelic, embonic (pamoic),
methanesulfonic, ethanesulfonic, 2-hydroxyethanesulfonic
benzenesulfonic, pantothenic, toluenesulfonic,
2-hydroxyethanesulfonic, sulfanilic, cyclohexylaminosulfonic,
algenic, 3-hydroxybutyric, galactaric and galacturonic acid.
Suitable pharmaceutically-acceptable salts of free acid-containing
compounds of the invention include metallic salts and organic
salts. More preferred metallic salts include, but are not limited
to appropriate alkali metal (group Ia) salts, alkaline earth metal
(group IIa) salts and other physiological acceptable metals. Such
salts can be made from aluminum, calcium, lithium, magnesium,
potassium, sodium and zinc. Preferred organic salts can be made
from primary amines, secondary amines, tertiary amines and
quaternary amnonium salts, including in part, tromethamine,
diethylamine, tetra-N-methylammonium, N,N'-dibenzylethylenediamine,
chloroprocaine, choline, diethanolamine, ethylenediamine, meglumine
(N-methylglucamine) and procaine.
[0020] The term prodrug refers to derivatives of active compounds
which revert in vivo into the active form. For example, a
carboxylic acid form of an active drug may be esterified to create
a prodrug, and the ester is subsequently converted in vivo to
revert to the carboxylic acid form. See Ettmayer et. al, J. Med.
Chem., 2004, 47(10), 2393-2404 and Lorenzi et. al, J. Pharm. Exp.
Therpeutics, 2005, 883-8900 for reviews.
1. FIRST ASPECT OF THE INVENTION
Compounds, Preparations and Methods
[0021] In the first aspect of the invention, compounds are of the
formula Ia
##STR00001##
wherein E1 is selected from the group consisting cyclopropyl,
cyclobutyl, cyclopentyl, cyclohexyl, pyrrolidinyl piperidinyl,
phenyl, thienyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl,
pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl, furyl, imidazolyl,
pyridyl, pyrimidinyl and naphthyl; wherein A is selected from the
group consisting of phenyl, naphthyl, C3-C8-carbocyclyl, indanyl,
tetralinyl, indenyl, G1, G2, G3, G4 and --CHR4R8;
[0022] G1 is a heteroaryl taken from the group consisting of
pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
triazolyl, tetrazolyl, pyrazinyl, pyridazinyl, triazinyl,
pyridinyl, and pyrimidinyl;
[0023] G2 is a fused bicyclic heteroaryl taken from the group
consisting of indolyl, indolinyl, isoindolyl, isoindolinyl,
indazolyl, benzofuranyl, benzothienyl, benzothiazolyl,
benzothiazolonyl, benzoxazolyl, benzoxazolonyl, benzisoxazolyl,
benzisothiazolyl, benzimidazolyl, benzimidazolonyl, benztriazolyl,
imidazopyridinyl, pyrazolopyridinyl, imidazolonopyridinyl,
thiazolopyridinyl, thiazolonopyridinyl, oxazolopyridinyt,
oxazolonopyridinyl, isoxazolopyridinyl, isothiazolopyridinyl,
triazolopyridinyl, imidazopyrimidinyl, pyrazolopyrimidinyl,
imidazolonopyrimidinyl, thiazolopyridiminyl, thiazolonopyrimidinyl,
oxazolopyridiminyl, oxazolonopyrimidinyl, isoxazolopyrimidinyl,
isothiazolopyrimidinyl, triazolopyrimidinyl, dihydropurinonyl,
pyrrolopyrimidinyl, purinyl, pyrazolopyrimidinyl, phthalimidyl,
phthalimidinyl, pyrazinylpyridinyl, pyridinopyrimidinyl,
pyrimnidinopyrimidinyl, cinnolinyl, quinoxalinyl, quinazolinyl,
quinolinyl, isoquinolinyl, phthalazinyl, benzodioxyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, and
benzoxazepinyl;
[0024] G3 is a non-fused bicyclic heteroaryl taken from the group
consisting of pyridylpyridiminyl pyrimidinylpyrimidinyl,
oxazolylpyrimidinyl, thiazolylpyrimidinyl, imidazolylpyrimidinyl,
isoxazolylpyrimidinyl, isothiazolylpyrimidinyl,
pyrazolylpyrimidinyl, triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, and
thiomorpholinylpyrimidinyl;
[0025] G4 is a heterocyclyl taken from the group consisting of
oxetanyl, azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, thiomorpholinyl S-oxide, thiomorpholinyl
S-dioxide, piperazinyl, azepinyl, oxepinyl, diazepinyl, tropanyl,
and homotropanyl;
the A ring may be optionally substituted with one or more --X1-A1
moieties;
[0026] X1 is selected from the group consisting of
--(CH.sub.2).sub.n--(O).sub.r(CH.sub.2).sub.n--,
--(CH.sub.2).sub.n--(NR3).sub.r--(CH.sub.2).sub.n--,
--(CH.sub.2).sub.n--(S).sub.r(CH.sub.2).sub.n--,
--(CH.sub.2).sub.n--(C.dbd.O).sub.r--(CH.sub.2).sub.n--,
--(CH.sub.2).sub.n--(C(.dbd.O)--NR3).sub.r--(CH.sub.2).sub.n--, and
--(CH.sub.2).sub.n--(SO.sub.2--NR3).sub.r(CH.sub.2).sub.n--,
wherein any of the alkylenes may be straight or branched chain;
[0027] X2 is selected from the group consisting of C1-C6alkyl,
branched C2-C6alkyl, and a direct bond wherein E1 is directly
linked to the NR3 group of formula Ia;
[0028] A1 is selected from the group consisting of hydrogen, aryl,
G1, G2, G3, G4, C1-C6 alkyl, branched C3-C8alkyl, R19 substituted
C3-C8-carbocyclyl, fluoroC1-C6alkyl wherein the alkyl is fully or
partially fluorinated, halogen, cyano, hydroxyl, --N(R4).sub.2,
--R5, --C(O)N(R4).sub.2, C(O)R5, C1-C6alkoxy, and fluoroC1-C6alkoxy
wherein the alkyl group is fully or partially fluorinated;
[0029] When A and A1 have one or more substitutable sp2-hybridized
carbon atom, each respective sp2 hybridized carbon atom may be
optionally substituted with a Z1 or Z3 substituent;
when A and A1 have one or more substitutable sp3-hybridized carbon
atom, each respective sp3 hybridized carbon atom may be optionally
substituted with a Z2 or R3 substituent; when A and A1 have one or
more substitutable nitrogen atom, each respective nitrogen atom may
be optionally substituted with a Z4 substituent; each Z1 is
independently and individually selected from the group consisting
of hydrogen, hydroxyC1-C6alkyl, C1-C6alkoxy, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl-,
C1-C6alkoxycarbonyl-, -carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2--, --SO.sub.2R3,
(R4).sub.2NSO.sub.2--, --SO.sub.2R3, --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2)N(R4)C(O)R8,
--(CH.sub.2).sub.n-G1, --(CH.sub.2).sub.n-G4, phenoxy,
--(CH.sub.2).sub.n--O--(CH.sub.2).sub.n-G1,
--(CH.sub.2).sub.n--O--(CH.sub.2).sub.n-G4,
--(CH.sub.2).sub.n--NR3-(CH.sub.2).sub.n-aryl,
--(CH.sub.2).sub.n--NR3-(CH.sub.2).sub.m-G1,
--(CH.sub.2).sub.n--NR3-(CH.sub.2).sub.n-G4, --S(O).sub.2R5,
--N.dbd.S(O)R6R8, --S(O)(.dbd.NR3)R6,
--(CH.sub.2).sub.nNHC(O)NHS(O).sub.2R8,
--(CH.sub.2).sub.nNHS(O).sub.2NHC(O)R5, --C(O)NHS(O).sub.2R8,
--S(O).sub.2NHC(O)R8, --(CH.sub.2).sub.nNHC(O)(CH.sub.2).sub.nR5,
--(CH.sub.2).sub.nNHS(O).sub.2(CH.sub.2).sub.nR5,
--(CH.sub.2).sub.nC(O)NH(CH.sub.2)R5, --(CH.sub.2).sub.nC(O)R5,
--(CH.sub.2).sub.nOC(O)R5,
--(CH.sub.2).sub.nS(O).sub.2NH(CH.sub.2).sub.qR5,
--CH(OH)(CH.sub.2).sub.pR5, --CH(OH)CH(OH)R4,
--(CH.sub.2).sub.nN(R4).sub.2, --(CH.sub.2).sub.nR5,
--C(.dbd.NH)R5, --C(.dbd.NH)N(R4).sub.2, --C(.dbd.NOR3)R5,
--C(.dbd.NOR3)N(R4).sub.2, and --NHC(.dbd.NH)R8; in the event that
Z1 contains an alkyl or alkylene moiety, such moieties may be
further substituted with one or more C1-C6alkyls; each Z2 is
independently and individually selected from the group consisting
of hydrogen, aryl, C1-C6alkyl, C3-C8-carbocyclyl, hydroxyl,
hydroxyC1-C6alkyl-, cyano, (R3).sub.2N--, (R4).sub.2N--,
(R4).sub.2NC1-C6alkyl-,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n--,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n--,
(R3).sub.2N--C(.dbd.O)--, (R4).sub.2N--C(.dbd.O)--,
(R4).sub.2N--CO--C1-C6alkyl-, carboxyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R3).sub.2NSO.sub.2--, (R4).sub.2NSO.sub.2--, --SO.sub.2R5,
--SO.sub.2R8, --(CH.sub.2).sub.nN(R4)C(O)R8, --C(O)R8, .dbd.O,
.dbd.NOH, .dbd.N(OR6), --(CH.sub.2).sub.n-G1,
--(CH.sub.2).sub.n-G4, --(CH.sub.2).sub.n--O--(CH.sub.2).sub.n-G1,
--(CH.sub.2).sub.n--O--(CH.sub.2).sub.n-G4,
--(CH.sub.2).sub.n--NR3-(CH.sub.2).sub.n-aryl,
--(CH.sub.2).sub.n--NR3-(CH.sub.2).sub.n-G1,
--(CH.sub.2).sub.n--NR3-(CH.sub.2).sub.n-G4,
--(CH.sub.2).sub.nNHC(O)NHS(O).sub.2R8,
--(CH.sub.2).sub.nNHS(O).sub.2NHC(O)R8, --C(O)NHS(O).sub.2R8,
--(CH.sub.2)NHC(O)(CH.sub.2).sub.nR5,
--(CH.sub.2).sub.nNHS(O).sub.2R5,
--(CH.sub.2).sub.nC(O)NH(CH.sub.2).sub.qR5,
--(CH.sub.2).sub.nC(O)R5, --(CH.sub.2).sub.nOC(O)R5, and
--(CH.sub.2).sub.nR5; in the event that Z2 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; each Z3 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, C3-C8-carbocyclyl, halogen, fluoroalkyl wherein the
alkyl moiety can be partially or fully fluorinated, cyano,
hydroxyl, methoxy, oxo, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, --N(R4)-C(.dbd.O)R8,
(R3).sub.2NSO.sub.2--, (R4).sub.2NSO.sub.2--, --N(R4)SO.sub.2R5,
--N(R4)SO.sub.2R8, --(CH.sub.2).sub.n--N(R3).sub.2,
--(CH.sub.2).sub.n--N(R4).sub.2,
--O--(CH.sub.2).sub.n--N(R4).sub.2, --O--(CH.sub.2).sub.q--O-alkyl,
--N(R3)-(CH.sub.2).sub.q--O-alkyl,
--N(R3)-(CH.sub.2).sub.q--N(R4).sub.2, --O--(CH.sub.2).sub.q--R5,
--N(R3)-(CH.sub.2).sub.q--R5, --C(.dbd.O)R5, --C(.dbd.O)R8, and
nitro; in the event that Z3 contains an alkyl or alkylene moiety,
such moieties may be further substituted with one or more
C1-C6alkyls; each Z4 is independently and individually selected
from the group consisting of H, C1-C6alkyl, hydroxyC2-C6alkyl,
C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C1-C6alkyl,
carboxyC1-C6alkyl, C1-C6alkoxycarbonylC1-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
--(CH.sub.2).sub.n-G, --(CH.sub.2).sub.n-G4,
--(CH.sub.2).sub.q--O--(CH.sub.2).sub.n-G1,
--(CH.sub.2).sub.q--O--(CH.sub.2).sub.n-G4,
--(CH.sub.2).sub.q--NR3-(CH.sub.2).sub.n-G1,
--(CH.sub.2).sub.q--NR3-(CH.sub.2).sub.nG4,
--(CH.sub.2).sub.qNHC(O)(CH.sub.2).sub.nR5,
--(CH).sub.qC(O)NH(CH.sub.2).sub.qR5, --(CH.sub.2).sub.qC(O)R5,
--(CH.sub.2).sub.qOC(O)R5, --(CH.sub.2).sub.qR5,
--(CH.sub.2).sub.qNR4(CH.sub.2).sub.qR5, and
--(CH.sub.2).sub.q--O--(CH.sub.2).sub.qR5; in the event that Z4
contains an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; each Z6 is independently
and individually selected from the group consisting of H,
C1-C6alkyl, branched C3-C7alkyl, hydroxyl, C1-C6alkoxy, --OR4,
C1-C6alkylthio, (R3).sub.2N--, (R4).sub.2N--, --R5, --N(R3)COR8,
--N(R4)COR8, --N(R3)SO.sub.2R6-, --CON(R3).sub.2, --CON(R4).sub.2,
--COR.sup.5, --SO.sub.2N(R4).sub.2, halogen, fluoroC1-C6alkyl
wherein the alkyl is fully or partially fluorinated, cyano,
fluoroC1-C6alkoxy wherein the alkyl is fully or partially
fluorinated, --O--(CH.sub.2).sub.q--N(R4).sub.2,
--N(R3)-(CH.sub.2).sub.q--N(R4).sub.2,
--O--(CH.sub.2).sub.q--O-alkyl, --N(R3)-(CH.sub.2).sub.q--O-alkyl,
--O--(CH.sub.2).sub.q--R5, --N(R3)-(CH.sub.2)--R5,
--(NR.sup.3).sub.r--(CH.sub.2).sub.n--R17, --(O).sub.rR17,
--(S).sub.r--R17, and --(CH.sub.2).sub.rR17; in the event that Z6
contains an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; wherein each R3 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, branched C3-C7alkyl, C3-C8-carbocyclyl, and
Z3-substituted phenyl; each R4 is independently and individually
selected from the group consisting of H, C1-C6alkyl,
hydroxyC1-C6alkyl, dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl,
branched C3-C7alkyl, branched hydroxyC1-C6alkyl, branched
C1-C6alkoxyC1-C6alkyl, branched dihydroxyC1-C6alkyl,
--(CH.sub.2).sub.p--N(R7).sub.2, --(CH.sub.2).sub.p--R5,
--(CH.sub.2).sub.p--C(O)N(R7).sub.2, --(CH.sub.2).sub.nC(O)R5,
--(CH.sub.2).sub.n--C(O)OR3, C3-C8-carbocyclyl, hydroxyl
substituted C3-C8-carbocyclyl, alkoxy substituted
C3-C8-carbocyclyl, dihydroxy substituted C3-C8-carbocyclyl, and
--(CH.sub.2).sub.n--R17; each R5 is independently and individually
selected from the group consisting of
##STR00002##
and wherein the symbol (##) is the point of attachment of the R5
moiety; each R6 is independently and individually selected from the
group consisting of C1-C6alkyl, branched C3-C7alkyl,
C3-C8-carbocyclyl, phenyl, G1, and G4; each R7 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, dihydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl,
branched C3-C7alkyl, branched hydroxyC2-C6 alkyl, branched
C1-C6alkoxyC2-C6alkyl, branched dihydroxyC2-C6alkyl,
--(CH.sub.2).sub.q--R5, --(CH.sub.2).sub.nC(O)R5,
--(CH.sub.2).sub.n--C(O)OR3, C3-C8-carbocyclyl, hydroxyl
substituted C3-C8-carbocyclyl, alkoxy substituted
C3-C8-carbocyclyl, dihydroxy substituted C3-C8-carbocyclyl, and
--(CH.sub.2).sub.n--R17; each R8 is independently and individually
selected from the group consisting of C1-C6alkyl, branched
C3-C7alkyl, fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C3-C8-carbocyclyl, Z3-substituted phenyl,
Z3-substituted phenyl C1-C6alkyl, Z3-substituted G1, Z3-substituted
G1-C1-C6alkyl, Z2-substituted G4, Z2-substituted G4-C1-C6alkyl, OH,
C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2, and R5; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
and --N(R4).sub.2;
[0030] R16 is independently and individually selected from the
group consisting of hydrogen, C1-C6alkyl, branched C3-C7alkyl,
C3-C8-carbocyclyl, halogen, fluoroalkyl wherein the alkyl moiety
can be partially or fully fluorinated, cyano, hydroxyl,
C1-C6alkoxy, C1-C6-fluoroalkoxy wherein the alkyl moiety can be
partially or fully fluorinated, --N(R3).sub.2, --N(R4).sub.2,
C2-C3alkynyl, and nitro;
each R17 is taken from the group comprising phenyl, naphthyl,
pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
triazolyl, tetrazolyl, pyrazinyl, pyridazinyl, triazinyl, oxetanyl,
azetadinyl, tetrahydrofuranyl, oxazolinyl, oxazolidinyl, pyranyl,
thiopyranyl, tetrahydropyranyl, dioxalinyl, azepinyl, oxepinyl,
diazepinyl, pyrrolidinyl, and piperidinyl; wherein R17 can be
further substituted with one or more Z2, Z3 or Z4 moieties;
[0031] R19 is H or C1-C6 alkyl;
wherein two R3 or R4 moieties are independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached to the
same nitrogen atom, said moieties may cyclize to form a C3-C7
heterocyclyl ring; and k is 1 or 2; n is 0-6; p is 1-4; q is 2-6; r
is 0 or 1; t is 1-3. 1.1 Compounds of Formula Ia which Exemplify
Preferred E1-X2 Moieties
[0032] In an embodiment of section 1, preferred compounds have the
structures of formula Ib
##STR00003##
1.2 Compounds of Formula Ia which Exemplify Preferred A
Moieties
[0033] In an embodiment of section 1.1, preferred compounds have
the structures of formula Ic
##STR00004##
1.3 Compounds of Formula Ia which Exemplify Preferred A1
Moieties
[0034] In an embodiment of section 1.2, preferred compounds have
the structures of formula Id
##STR00005##
wherein A1 is selected from the group consisting of branched
C3-C8alkyl, R19 substituted C.sub.3-C8-carbocyclyl, C1-C6alkyl,
fluoroC1-C6alkyl wherein the alkyl is fully or partially
fluorinated, Z3-substituted phenyl, and Z3-substituted G1; and
wherein R16 is C1-C6alkyl, cyano, --CCH, or halogen. 1.3a Compounds
of Formula Id which Exemplify More Preferred X2-E1 Moieties
[0035] In an embodiment of section 1.3, preferred compounds have
the structures of formula Ie
##STR00006##
1.3b Additional Compounds of Formula Id which Exemplify More
Preferred X2-E1 Moieties
[0036] In another embodiment of section 1.3, preferred compounds
have the structures of formula If
##STR00007##
wherein R16 is methyl, cyano, --CCH, fluorine or chlorine. 1.4
Compounds of Formula Ia which Exemplify Additional Preferred A1
Moieties
[0037] In a different embodiment of section 1.2, additional
preferred compounds have the structures of formula Ig
##STR00008##
wherein A1 is selected from the group consisting of branched
C3-C8alkyl, R19 substituted C3-C8-carbocyclyl, C1-C6alkyl,
fluoroC1-C6alkyl wherein the alkyl is fully or partially
fluorinated, Z3-substituted phenyl, and Z3-substituted G1; and
wherein R16 is C1-C6alkyl, cyano, --CCH, or halogen. 1.4a
Additional Compounds of Formula Ig which Exemplify More Preferred
X2-E1 Moieties
[0038] In an embodiment of section 1.4, preferred compounds have
the structures of formula Ih
##STR00009##
1.4b Additional Compounds of Formula Ig which Exemplify More
Preferred X2-E1 Moieties
[0039] In another embodiment of section 1.4, preferred compounds
have the structures of formula Ii
##STR00010##
wherein R16 is C1-C6alkyl, cyano, --CCH, fluorine or chlorine. 1.5
Compounds of Formula Ia which Exemplify Additionally Preferred A
Moieties
[0040] In a different embodiment of section 1.1, additional
preferred compounds have the structures of formula Ij
##STR00011##
wherein A1 is selected from the group consisting of branched
Z2-substituted C3-C8alkyl, R19 substituted C3-C8-carbocyclyl,
Z2-substituted C1-C6alkyl, fluoroC1-C6alkyl wherein the alkyl is
fully or partially fluorinated, Z3-substituted phenyl, and
Z3-substituted G1; and wherein R16 is C1-C6alkyl, cyano, --CCH, or
halogen. 1.5a Additional Compounds of Formula Ij which Exemplify
More Preferred X2-E1 Moieties
[0041] In an embodiment of section 1.5, preferred compounds have
the structures of formula Ik
##STR00012##
1.5b Additional Compounds of Formula Ij which Exemplify More
Preferred X2-E1 Moieties
[0042] In another embodiment of section 1.5, preferred compounds
have the structures of formula Il
##STR00013##
wherein R16 is C1-C6alkyl, cyano, --CCH, fluorine or chlorine. 1.6
Compounds of Formula Ia which Exemplify Additionally Preferred A
Moieties
[0043] In a different embodiment of section 1.1, additional
preferred compounds have the structures of formula Im
##STR00014##
wherein A1 is selected from the group consisting of hydrogen,
Z2-substituted branched C3-C8alkyl, R19 substituted
C3-C8-carbocyclyl, Z2-substituted C1-C6alkyl, fluoroC1-C6alkyl
wherein the alkyl is fully or partially fluorinated, Z3-substituted
phenyl, and Z3-substituted G1; and wherein R16 is C1-C6alkyl,
cyano, --CCH, or halogen. 1.6a Additional Compounds of Formula Im
which Exemplify More Preferred X2-E1 Moieties
[0044] In an embodiment of section 1.6, preferred compounds have
the structures of formula In
##STR00015##
1.6b Additional Compounds of Formula Im which Exemplify More
Preferred X2-E Moieties
[0045] In another embodiment of section 1.6, preferred compounds
have the structures of formula Io
##STR00016##
wherein R16 is C1-C6alkyl, cyano, --CCH, fluorine or chlorine. 1.7
Compounds of Formula Ia which Exemplify Additionally Preferred A
Moieties
[0046] In a different embodiment of section 1.1, additional
preferred compounds have the structures of formula Ip
##STR00017##
wherein A1 is selected from the group consisting of Z2-substituted
branched C3-C8alkyl, R19 substituted C3-C8-carbocyclyl,
Z2-substituted C1-C6alkyl, fluoroC1-C6alkyl wherein the alkyl is
fully or partially fluorinated, Z3-substituted phenyl, and
Z3-substituted G1; and wherein R16 is C1-C6alkyl, cyano, --CCH, or
halogen. 1.7a Additional Compounds of Formula Ip which Exemplify
More Preferred X2-E Moieties
[0047] In an embodiment of section 1.7, preferred compounds have
the structures of formula Iq
##STR00018##
1.7b Additional Compounds of Formula Ip which Exemplify More
Preferred X2-E1 Moieties
[0048] In another embodiment of section 1.7, preferred compounds
have the structures of formula Ir
##STR00019##
and wherein R16 is C1-C6alkyl, cyano, --CCH, fluorine or chlorine.
1.8 Compounds of Formula Ia which Exemplify Additionally Preferred
A Moieties
[0049] In a different embodiment of section 1.1, additional
preferred compounds have the structures of formula Is
##STR00020##
wherein the hashed bond is a saturated or unsaturated bond; and
wherein A1 is selected from the group consisting of hydrogen,
Z2-substituted branched C3-C5alkyl, R19 substituted
C3-C8-carbocyclyl, Z2-substituted C1-C6alkyl, halogen, cyano,
C1-C6alkoxy, fluoroC1-C6alkoxy, fluoroC1-C6alkyl wherein the alkyl
is fully or partially fluorinated, Z3-substituted phenyl, and
Z3-substituted G1; and wherein R16 is C1-C6alkyl, cyano, --CCH, or
halogen. 1.8a Additional Compounds of Formula Is which Exemplify
More Preferred X2-E1 Moieties
[0050] In an embodiment of section 1.8, preferred compounds have
the structures of formula It
##STR00021##
1.8b Additional Compounds of Formula Is which Exemplify More
Preferred X2-E1 Moieties
[0051] In another embodiment of section 1.8, preferred compounds
have the structures of formula Iu
##STR00022##
wherein R16 is C1-C6alkyl, cyano, --CCH, fluorine or chlorine. 1.9
Compounds of Formula Ia which Exemplify Additionally Preferred A
Moieties
[0052] In a different embodiment of section 1.1, additional
preferred compounds have the structures of formula Iv
##STR00023##
wherein the hashed bond is a saturated or unsaturated bond; and
wherein A1 is selected from the group consisting of hydrogen,
Z2-substituted branched C3-C8alkyl, R19 substituted
C3-C8-carbocyclyl, Z2-substituted C1-C6alkyl, halogen, cyano,
C1-C6alkoxy, fluoroC1-C6alkoxy, fluoroC1-C6alkyl wherein the alkyl
is fully or partially fluorinated, Z3-substituted phenyl, and
Z3-substituted G1; and wherein R16 is C1-C6alkyl, cyano, --CCH, or
halogen. 1.9a Additional Compounds of Formula Iv which Exemplify
More Preferred X2-E1 Moieties
[0053] In an embodiment of section 1.9, preferred compounds have
the structures of formula Iw
##STR00024##
1.9b Additional Compounds of Formula Iv which Exemplify More
Preferred X2-E1 Moieties
[0054] In another embodiment of section 1.9, preferred compounds
have the structures of formula Ix
##STR00025##
and wherein R16 is C1-C6alkyl, cyano, --CCH, fluorine or chlorine.
1.10 Compounds of Formula Ia which Exemplify Additionally Preferred
A Moieties
[0055] In a different embodiment of section 1.1, additional
preferred compounds have the structures of formula Iy
##STR00026##
wherein A1 is selected from the group consisting of Z2-substituted
branched C3-C8alkyl, R19 substituted C3-C8-carbocyclyl,
Z2-substituted C1-C6alkyl, fluoroC1-C6alkyl wherein the alkyl is
fully or partially fluorinated, Z3-substituted phenyl, and
Z3-substituted G1; and wherein R16 is C1-C6alkyl, cyano, --CCH, or
halogen. 1.10a Additional Compounds of Formula Iy which Exemplify
More Preferred X2-E1 Moieties
[0056] In an embodiment of section 1.10, preferred compounds have
the structures of formula Iz
##STR00027##
1.10b Additional Compounds of Formula Iy which Exemplify More
Preferred X2-E1 Moieties
[0057] In another embodiment of section 1.10, preferred compounds
have the structures of formula Iaa
##STR00028##
wherein R16 is C1-C6alkyl, cyano, --CCH, fluorine or chlorine. 1.11
Compounds of Formula Ia which Exemplify Additionally Preferred A
Moieties
[0058] In a different embodiment of section 1.1, additional
preferred compounds have the structures of formula Ibb
##STR00029##
wherein R16 is C1-C6alkyl, cyano, --CCH, or halogen. 1.11a
Additional Compounds of Formula Ibb which Exemplify More Preferred
X2-E1 Moieties
[0059] In an embodiment of section 1.11, preferred compounds have
the structures of formula Ice
##STR00030##
1.11b Additional Compounds of Formula Ibb which Exemplify More
Preferred X2-E1 Moieties
[0060] In another embodiment of section 1.11, preferred compounds
have the structures of formula Idd
##STR00031##
wherein R16 is C1-C6alkyl, cyano, --CCH, fluorine or chlorine. 1.12
Compounds of Formula Ia which Exemplify Additionally Preferred A
Moieties
[0061] In a different embodiment of section 1.1, additional
preferred compounds have the structures of formula Iee
##STR00032##
wherein Q1 and Q2 are individually and independently taken from the
group consisting of N and CH; and wherein R16 is C1-C6alkyl, cyano,
--CCH, or halogen. 1.12a Additional Compounds of Formula Iee which
Exemplify More Preferred X2-E1 Moieties
[0062] In an embodiment of section 1.12 preferred compounds have
the structures of formula Iff
##STR00033##
1.12b Additional Compounds of Formula Iee which Exemplify More
Preferred X2-E1 Moieties
[0063] In another embodiment of section 1.12, preferred compounds
have the structures of formula Igg
##STR00034##
wherein R16 is C1-C6alkyl, cyano, --CCH, fluorine or chlorine. 1.13
Compounds of Formula Ia which Exemplify Additionally Preferred A
Moieties
[0064] In a different embodiment of section 1.1, additional
preferred compounds have the structures of formula Ihh
##STR00035##
and wherein R16 is C1-C6alkyl, cyano, --CCH or halogen. 1.13a
Additional Compounds of Formula Ihh which Exemplify More Preferred
X2-E1 Moieties
[0065] In an embodiment of section 1.13, preferred compounds have
the structures of formula Iii
##STR00036##
1.13b Additional Compounds of Formula Ihh which Exemplify More
Preferred X2-E1 Moieties
[0066] In another embodiment of section 1.13, preferred compounds
have the structures of formula Ijj
##STR00037##
and wherein R16 is methyl, cyano, --CCH, fluorine or chlorine. 1.14
Compounds of Formula Ia which Exemplify Additionally Preferred A
Moieties
[0067] In a different embodiment of section 1.1, additional
preferred compounds have the structures of formula Ikk
##STR00038##
wherein Q6 is N or C-A1; wherein A1 is selected from the group
consisting of hydrogen, Z2-substituted branched C3-C8alkyl, R19
substituted C3-C8-carbocyclyl, Z2-substituted C1-C6alkyl,
fluoroC1-C6alkyl wherein the alkyl is fully or partially
fluorinated, Z3-substituted phenyl, and Z3-substituted G1; and
wherein R16 is C1-C6alkyl, cyano, --CCH, or halogen. 1.14a
Additional Compounds of Formula Ia which Exemplify More Preferred
X2-E1 Moieties
[0068] In an embodiment of section 1.14, preferred compounds have
the structures of formula III
##STR00039##
1.14b Additional Compounds of Formula Ikk which Exemplify More
Preferred X2-E1 Moieties
[0069] In another embodiment of section 1.14, preferred compounds
have the structures of formula Imm
##STR00040##
wherein R16 is C1-C6alkyl, cyano, --CCH, fluorine or chlorine. 1.15
Compounds of Formula Ia which Exemplify Additionally Preferred A
Moieties
[0070] In a different embodiment of section 1.1, additional
preferred compounds have the structures of formula Inn
##STR00041##
wherein A1 is selected from the group consisting of hydrogen,
Z2-substituted branched C3-CSalkyl, R19 substituted
C3-C8-carbocyclyl, Z2-substituted C1-C6alkyl, fluoroC1-C6alkyl
wherein the alkyl is fully or partially fluorinated, Z3-substituted
phenyl, and Z3-substituted G1; and wherein R16 is C1-C6alkyl,
cyano, --CCH, or halogen. 1.15a Additional Compounds of Formula Inn
which Exemplify More Preferred X2-E1 Moieties
[0071] In an embodiment of section 1.15, preferred compounds have
the structures of formula Ioo
##STR00042##
1.15b Additional Compounds of Formula Inn which Exemplify More
Preferred X2-E1 Moieties
[0072] In another embodiment of section 1.15, preferred compounds
have the structures of formula Ipp
##STR00043##
wherein R16 is C1-C6alkyl, cyano, --CCH, fluorine or chlorine. 1.16
Compounds of Formula Ia which Exemplify Additionally Preferred A
Moieties
[0073] In a different embodiment of section 1.1, additional
preferred compounds have the structures of formula Iqq
##STR00044##
wherein Q3, Q4 and Q5 are selected from the group consisting of
N-A1 and C-A1, and only one of Q3, Q4, or Q5 is N-A1; wherein A1 is
selected from the group consisting of hydrogen, Z2-substituted
branched C3-C8alkyl, R19 substituted C3-C8-carbocyclyl,
Z2-substituted C1-C6alkyl, fluoroC1-C6alkyl wherein the alkyl is
fully or partially fluorinated, Z3-substituted phenyl, and
Z3-substituted G1; wherein R16 is C1-C6alkyl, cyano, --CCH, or
halogen. 1.16a Additional Compounds of Formula Iqq which Exemplify
More Preferred X2-E1 Moieties
[0074] In an embodiment of section 1.16, preferred compounds have
the structures of formula Irr
##STR00045##
1.16b Additional Compounds of Formula Iqq which Exemplify More
Preferred X2-E1 Moieties
[0075] In another embodiment of section 1.16, preferred compounds
have the structures of formula Iss
##STR00046##
wherein R16 is C1-C6alkyl, cyano, --CCH, fluorine or chlorine.
1.17 Methods
1.17a Methods of Protein Modulation
[0076] The invention includes methods of modulating kinase activity
of RAF kinases and other kinases in the RAS-RAF-MEK-ERK-MAP kinase
pathway including, but not limited to, A-Raf, B-Raf, and C-Raf. The
kinases may be wildtype kinases, oncogenic forms thereof, aberrant
fusion proteins thereof or polymorphs of any of the foregoing. The
method comprises the step of contacting the kinase species with
compounds of the invention and especially those set forth in
sections 1.1-1.16. The kinase species may be activated or
unactivated, and the species may be modulated by phosphorylations,
sulfation, fatty acid acylations glycosylations, nitrosylation,
cystinylation (i.e. proximal cysteine residues in the kinase react
with each other to form a disulfide bond) or oxidation. The kinase
activity may be selected from the group consisting of catalysis of
phospho transfer reactions, kinase cellular localization, and
recruitment of other proteins into signaling complexes through
modulation ofkinase conformation.
1.17b Treatment Methods
[0077] The methods of the invention, especially those of sections
1.1-1.16, also include treating individuals suffering from a
condition selected from the group consisting of chronic myelogenous
leukemia, acute lymphocytic leukemia, gastrointestinal stromal
tumors, hypereosinophillic syndrome, glioblastomas, ovarian cancer,
pancreatic cancer, prostate cancer, lung cancers, breast cancers,
kidney cancers, cervical carcinomas, metastasis of primary solid
tumor secondary sites, ocular diseases characterized by
hyperproliferation leading to blindness including various
retinopathies including diabetic retinopathy and age-related
macular degeneration, rheumatoid arthritis, melanomas, colon
cancer, thyroid cancer, a disease caused by a mutation in the
RAS-RAF-MEK-ERK-MAP kinase pathway, human inflammation, rheumatoid
spondylitis, ostero-arthritis, asthma, gouty arthritis, sepsis,
septic shock, endotoxic shock, Gram-negative sepsis, toxic shock
syndrome, adult respiratory distress syndrome, stroke, reperfusion
injury, neural trauma, neural ischemia, psoriasis, restenosis,
chronic obstructive pulmonary disease, bone resorptive diseases,
graft-versus-host reaction, Chron's disease, ulcerative colitis,
inflammatory bowel disease, pyresis, and combinations thereof,
1.18 Pharmaceutical Preparations
[0078] The compounds of the invention, especially those of sections
1.1-1.16, may form a part of a pharmaceutical composition by
combining one or more such compounds with a pharmaceutically
acceptable carrier. Additionally, the compositions may include an
additive selected from the group consisting of adjuvants,
excipients, diluents, and stabilizers.
2. SECOND ASPECT OF THE INVENTION
Compounds, Methods, Preparations and Adducts Compounds of the
formula IIa
##STR00047##
[0079] wherein one of Q1 and Q2 is N and the other is CR3; wherein
E1 is selected from the group consisting cyclopropyl, cyclobutyl,
cyclopentyl, cyclohexyl, pyrrolidinyl piperidinyl, phenyl, thienyl,
oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl,
oxadiazolyl, thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl
and naphthyl; wherein A is selected from the group consisting of
phenyl, naphthyl, C3-C8-carbocyclyl, indanyl, tetralinyl, indenyl,
G1, G2, G3, G4 and --CHR4R8;
[0080] G1 is a heteroaryl taken from the group consisting of
pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
triazolyl, tetrazolyl, pyrazinyl, pyridazinyl, triazinyl,
pyridinyl, and pyrimidinyl;
[0081] G2 is a fused bicyclic heteroaryl taken from the group
consisting of indolyl, indolinyl, isoindolyl, isoindolinyl,
indazolyl, benzofuranyl, benzothienyl, benzothiazolyl,
benzothiazolonyl, benzoxazolyl, benzoxazolonyl, benzisoxazolyl,
benzisothiazolyl, benzimidazolyl, benzimidazolonyl, benztriazolyl,
imidazopyridinyl, pyrazolopyridinyl, imidazolonopyridinyl,
thiazolopyridinyl, thiazolonopyridinyl, oxazolopyridinyl,
oxazolonopyridinyl, isoxazolopyridinyl, isothiazolopyridinyl,
triazolopyridinyl, imidazopyrimidinyl, pyrazolopyrimidinyl,
imidazolonopyrimidinyl, thiazolopyridiminyl, thiazolonopyrimidinyl,
oxazolopyridiminyl, oxazolonopyrimidinyl, isoxazolopyrimidinyl,
isothiazolopyrimidinyl, triazolopyrimidinyl, dihydropurinonyl,
pyrrolopyrimidinyl, purinyl, pyrazolopyrimidinyl, phthalimidyl,
phthalimidinyl, pyrazinylpyridinyl, pyridinopyrimidinyl,
pyrimidinopyrimidinyl, cinnolinyl, quinoxalinyl, quinazolinyl,
quinolinyl, isoquinolinyl, phthalazinyl, benzodioxyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, and
benzoxazepinyl;
[0082] G3 is a non-fused bicyclic heteroaryl taken from the group
consisting of pyridylpyridiminyl pyrimidinylpyrimidinyl,
oxazolylpyrimidinyl, thiazolylpyrimidinyl, imidazolylpyrimidinyl,
isoxazolylpyrimidinyl, isothiazolylpyrimidinyl,
pyrazolylpyrimidinyl, triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, and
thiomorpholinylpyrimidinyl;
[0083] G4 is a heterocyclyl taken from the group consisting of
oxetanyl, azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, thiomorpholinyl S-oxide, thiomorpholinyl
S-dioxide, piperazinyl, azepinyl, oxepinyl, diazepinyl, tropanyl,
and homotropanyl;
the A ring may be optionally substituted with one or more --X1-A1
moieties;
[0084] X1 is selected from the group consisting of
--(CH.sub.2).sub.n--(O).sub.r(CH.sub.2).sub.n--,
--(CH.sub.2).sub.n--(NR3).sub.r--(CH.sub.2).sub.n--,
--(CH.sub.2).sub.n--(S).sub.r--(CH).sub.n--,
--(CH.sub.2).sub.n--(C.dbd.O).sub.r--(CH.sub.2).sub.n--,
--(CH.sub.2).sub.n--(C(.dbd.O)--NR3).sub.r(CH.sub.2).sub.n--, and
--(CH.sub.2).sub.n--(SO.sub.2--NR3).sub.r--(CH.sub.2).sub.n--,
wherein any of the alkylenes may be straight or branched chain;
[0085] X2 is selected from the group consisting of C1-C6alkyl,
branched C2-C6alkyl, and a direct bond wherein E1 is directly
linked to the NR3 group of formula Ia;
[0086] A1 is selected from the group consisting of hydrogen, aryl,
G1, G2, G3, G4, C1-C6 alkyl, branched C3-C8alkyl, R19 substituted
C3-C8-carbocyclyl, fluoroC1-C6alkyl wherein the alkyl is fully or
partially fluorinated, halogen, cyano, hydroxyl, --N(R4).sub.2,
--R5, --C(O)N(R4).sub.2, C(O)R5, C1-C6alkoxy, and fluoroC1-C6alkoxy
wherein the alkyl group is fully or partially fluorinated;
[0087] When A and A1 have one or more substitutable sp2-hybridized
carbon atom, each respective sp2 hybridized carbon atom may be
optionally substituted with a Z1 or Z3 substituent;
when A and A1 have one or more substitutable sp3-hybridized carbon
atom, each respective sp3 hybridized carbon atom may be optionally
substituted with a Z2 or R3 substituent; when A and A1 have one or
more substitutable nitrogen atom, each respective nitrogen atom may
be optionally substituted with a Z4 substituent; each Z1 is
independently and individually selected from the group consisting
of hydrogen, hydroxyC1-C6alkyl, C1-C6alkoxy, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl-,
C1-C6alkoxycarbonyl-, -carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2--, --SOR3,
(R4).sub.2NSO.sub.2--, --SO.sub.2R3, --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
--(CH.sub.2).sub.n-G1, --(CH.sub.2).sub.n-G4, phenoxy,
--(CH.sub.2).sub.n--O--(CH.sub.2).sub.n-G1,
--(CH.sub.2).sub.n--O--(CH).sub.n-G4,
--(CH.sub.2).sub.n--NR3-(CH.sub.2).sub.n-aryl,
--(CH.sub.2)--NR3-(CH.sub.2).sub.n-G1,
--(CH.sub.2).sub.n--NR3-(CH.sub.2).sub.n-G4, --S(O).sub.2R5,
--N.dbd.S(O)R6R8, --S(O)(.dbd.NR3)R6,
--(CH.sub.2).sub.nNHC(O)NHS(O).sub.2R8,
(CH.sub.2).sub.nNHS(O).sub.2NHC(O)R8, --C(O)NHS(O).sub.2R8,
--S(O).sub.2NHC(O)R8, --(CH.sub.2).sub.nNHC(O)(CH.sub.2).sub.nR5,
--(CH.sub.2).sub.nNHS(O).sub.2 (CH.sub.2).sub.nR5,
--(CH.sub.2).sub.nC(O)NH(CH.sub.2).sub.qR5,
--(CH.sub.2).sub.nC(O)R5, --(CH.sub.2).sub.nOC(O)R5,
--(CH.sub.2).sub.nS(O).sub.2NH(CH.sub.2).sub.qR5,
--CH(OH)(CH.sub.2).sub.nR5, --CH(OH)CH(OH)R4,
--(CH.sub.2).sub.nN(R4).sub.2, --(CH.sub.2).sub.nR5,
--C(.dbd.NH)R5, --C(.dbd.NH)N(R4).sub.2, --C(.dbd.NOR3)R5,
--C(.dbd.NOR3)N(R4).sub.2, and --NHC(.dbd.NH)R8; in the event that
Z1 contains an alkyl or alkylene moiety, such moieties may be
further substituted with one or more C1-C6alkyls; each Z2 is
independently and individually selected from the group consisting
of hydrogen, aryl, C1-C6alkyl, C3-C8-carbocyclyl, hydroxyl,
hydroxyC1-C6alkyl-, cyano, (R3).sub.2N--, (R4).sub.2N--,
(R4).sub.2NC1-C6alkyl-,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n--,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n--,
(R3).sub.2N--C(.dbd.O)--, (R4).sub.2N--C(.dbd.O)--,
(R4).sub.2N--CO--C1-C6alkyl-, carboxyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R3).sub.2NSO.sub.2--, (R4).sub.2NSO.sub.2--, --SO.sub.2R5,
--SO.sub.2R8, --(CH.sub.2).sub.nN(R4)C(O)R8, --C(O)R8, .dbd.O,
.dbd.NOH, .dbd.N(OR6), --(CH.sub.2).sub.n-G1,
--(CH.sub.2).sub.n-G4, --(CH.sub.2).sub.n--O--(CH.sub.2).sub.n-G1,
--(CH.sub.2).sub.n--O--(CH.sub.2).sub.n-G4,
--(CH.sub.2).sub.n--NR3-(CH.sub.2).sub.n-aryl,
--(CH.sub.2).sub.n--NR3-(CH.sub.2).sub.n-G1,
--(CH.sub.2).sub.n--NR3-(CH.sub.2).sub.n-G4,
--(CH.sub.2).sub.nNHC(O)NHS(O).sub.2R8,
--(CH.sub.2).sub.nNHS(O).sub.2NHC(O)R8, --C(O)NHS(O).sub.2R8,
--(CH.sub.2)NHC(O)(CH.sub.2).sub.nR5,
--(CH.sub.2).sub.nNHS(O).sub.2R5,
--(CH.sub.2).sub.nC(O)NH(CH.sub.2).sub.qR5,
--(CH.sub.2).sub.nC(O)R5, --(CH.sub.2).sub.nOC(O)R5, and
--(CH.sub.2).sub.nR5; in the event that Z2 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; each Z3 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, C3-C8-carbocyclyl, halogen, fluoroalkyl wherein the
alkyl moiety can be partially or fully fluorinated, cyano,
hydroxyl, methoxy, oxo, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, --N(R4)-C(.dbd.O)R8,
(R3).sub.2NSO.sub.2--, (R4).sub.2NSO.sub.2--, --N(R4)SO.sub.2R5,
--N(R4)SO.sub.2R8, --(CH.sub.2)--N(R3).sub.2,
--(CH.sub.2).sub.n--N(R4).sub.2,
--O--(CH.sub.2).sub.q--N(R4).sub.2, --O--(CH.sub.2).sub.q--O-alkyl,
--N(R3)-(CH.sub.2).sub.q--O-alkyl,
--N(R3)-(CH.sub.2).sub.q--N(R4).sub.2, --O--(CH.sub.2).sub.q--R5,
--N(R3)-(CH.sub.2).sub.n--R5, --C(.dbd.O)R5, --C(.dbd.O)R8, and
nitro; in the event that Z3 contains an alkyl or alkylene moiety,
such moieties may be further substituted with one or more
C1-C6alkyls; each Z.sup.4 is independently and individually
selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C1-C6alkyl,
carboxyC1-C6alkyl, C1-C6alkoxycarbonylC1-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
--(CH.sub.2).sub.n-G1, --(CH.sub.2).sub.n-G4,
--(CH.sub.2).sub.qO--(CH.sub.2).sub.n-G1,
--(CH.sub.2).sub.q--(CH.sub.2).sub.n-G4,
--(CH.sub.2).sub.q--NR3-(CH.sub.2).sub.n-G1,
--(CH.sub.2).sub.q--NR3-(CH.sub.2).sub.n-G4,
--(CH.sub.2).sub.qNHC(O)(CH.sub.2).sub.nR5,
--(CH.sub.2).sub.qC(O)NH(CH.sub.2).sub.qR5,
--(CH.sub.2).sub.qC(O)R5, --(CH.sub.2).sub.qOC(O)R5,
--(CH.sub.2).sub.qR5, --(CH.sub.2).sub.qNR4(CH.sub.2).sub.qR5, and
--(CH.sub.2).sub.q--O--(CH.sub.2).sub.qR5; in the event that Z4
contains an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; each Z6 is independently
and individually selected from the group consisting of H,
C1-C6alkyl, branched C3-C7alkyl, hydroxyl, C1-C6alkoxy, --OR4,
C1-C6alkylthio, (R3).sub.2N--, (R4).sub.2N--, --R5, --N(R3)COR8,
--N(R4)COR8, --N(R3)SO.sub.2R6-, --CON(R3).sub.2, --CON(R4).sub.2,
--COR5, --SO.sub.2N(R4).sub.2, halogen, fluoroC1-C6alkyl wherein
the alkyl is fully or partially fluorinated, cyano,
fluoroC1-C6alkoxy wherein the alkyl is fully or partially
fluorinated, --O--(CH.sub.2).sub.q--N(R4).sub.2,
--N(R3)-(CH.sub.2).sub.q--N(R4).sub.2,
--O--(CH.sub.2).sub.q--O-alkyl, --N(R3)-(CH.sub.2).sub.q--O-alkyl,
--O--(CH.sub.2).sub.q--R5, --N(R3)-(CH.sub.2).sub.q--R5, --(NR3),
(CH.sub.2).sub.n--R17, --(O).sub.rR17, --(S).sub.r--R17, and
--(CH.sub.2).sub.rR17; in the event that Z6 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein each R3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, C3-C8-carbocyclyl, and Z3-substituted phenyl;
each R4 is independently and individually selected from the group
consisting of H, C1-C6alkyl, hydroxyC1-C6alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, --(CH.sub.2).sub.p--N(R7).sub.2,
--(CH.sub.2).sub.n--R5, --(CH.sub.2).sub.p--C(O)N(R7).sub.2,
--(CH.sub.2).sub.nC(O)R5, --(CH.sub.2).sub.q--C(O)OR3,
C3-C8-carbocyclyl, hydroxyl substituted C3-C8-carbocyclyl, alkoxy
substituted C3-C8-carbocyclyl, dihydroxy substituted
C3-C8-carbocyclyl, and --(CH.sub.2)--R17; each R.sup.5 is
independently and individually selected from the group consisting
of
##STR00048## ##STR00049##
and wherein the symbol (##) is the point of attachmnent of the R5
moiety; each R.sup.6 is independently and individually selected
from the group consisting of C1-C6allyl, branched C3-C7alkyl,
C3-C8-carbocyclyl, phenyl, G1, and G4; each R7 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, dihydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl,
branched C3-C7alkyl, branched hydroxyC2-C6 alkyl, branched
C1-C6alkoxyC2-C6alkyl, branched dihydroxyC2-C6alkyl,
--(CH.sub.2).sub.q--R5, --(CH.sub.2).sub.n--C(O)R5,
--(CH.sub.2).sub.n--C(O)OR3, C3-C8-carbocyclyl, hydroxyl
substituted C3-C8-carbocyclyl, alkoxy substituted
C3-C8-carbocyclyl, dihydroxy substituted C3-C8-carbocyclyl, and
--(CH.sub.2).sub.n--R17; each R8 is independently and individually
selected from the group consisting of C1-C6alkyl, branched
C3-C7alkyl, fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C3-C8-carbocyclyl, Z3-substituted phenyl,
Z3-substituted phenyl C1-C6alkyl, Z3-substituted G1, Z3-substituted
G1-C1-C6alkyl, Z2-substituted G4, Z2-substituted G4-C1-C6alkyl, OH,
C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2, and R5; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
and --N(R4).sub.2;
[0088] R16 is independently and individually selected from the
group consisting of hydrogen, C1-C6alkyl, branched C3-C7alkyl,
C3-C8-carbocyclyl, halogen, fluoroalkyl wherein the alkyl moiety
can be partially or fully fluorinated, cyano, hydroxyl,
C1-C6alkoxy, C1-C6-fluoroalkoxy wherein the alkyl moiety can be
partially or fully fluorinated, --N(R3).sub.2, --N(R4).sub.2,
C2-C3alkynyl, and nitro;
each R17 is taken from the group comprising phenyl, naphthyl,
pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
triazolyl, tetrazolyl, pyrazinyl, pyridazinyl, triazinyl, oxetanyl,
azetadinyl, tetrahydrofuranyl, oxazolinyl, oxazolidinyl, pyranyl,
thiopyranyl, tetrahydropyranyl, dioxalinyl, azepinyl, oxepinyl,
diazepinyl, pyrrolidinyl, and piperidinyl; wherein R17 can be
further substituted with one or more Z2, Z3 or Z4 moieties; R19 is
H or C1-C6 alkyl; wherein two R3 or R4 moieties are independently
and individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen atom, said moieties may cyclize to form a
C3-C7 heterocyclyl ring; and k is 1 or 2; n is 0-6; p is 1-4; q is
2-6; r is 0 or 1; t is 1-3. 2.1 Compounds of Formula IIa which
Exemplify Preferred E1-X2 Moieties
[0089] In an embodiment of section 2, preferred compounds have the
structures of formula IIb
##STR00050##
2.2 Compounds of Formula IIa which Exemplify Preferred A
Moieties
[0090] In an embodiment of section 2.1, preferred compounds have
the structures of formula IIc
##STR00051##
2.3 Compounds of Formula IIa which Exemplify Preferred A1 Moieties
In an embodiment of section 2.2, preferred compounds have the
structures of formula IId
##STR00052##
wherein A1 is selected from the group consisting of branched
C3-C8alkyl, R19 substituted C3-C8-carbocyclyl, C1-C6alkyl,
fluoroC1-C6alkyl wherein the alkyl is fully or partially
fluorinated, Z3-substituted phenyl, and Z3-substituted G1; and
wherein R16 is C1-C6alkyl, --CCH, cyano, halogen. 2.3a Compounds of
Formula IId which Exemplify More Preferred X2-E1 Moieties
[0091] In an embodiment of section 2.3, preferred compounds have
the structures of formula IIe
##STR00053##
2.3b Additional Compounds of Formula IId which Exemplify More
Preferred X2-E1 Moieties
[0092] In another embodiment of section 2.3, preferred compounds
have the structures of formula IIf
##STR00054##
wherein R16 is methyl, cyano, --CCH, fluorine or chlorine. 2.4
Compounds of Formula IIa which Exemplify Additional Preferred A1
Moieties
[0093] In a different embodiment of section 2.2, additional
preferred compounds have the structures of formula IIg
##STR00055##
wherein A1 is selected from the group consisting of branched
C3-C8alkyl, R19 substituted C3-C8-carbocyclyl, C1-C6alkyl,
fluoroC1-C6alkyl wherein the alkyl is fully or partially
fluorinated, Z3-substituted phenyl, and Z3-substituted G1; and
wherein R16 is C1-C6alkyl, cyano, --CCH, or halogen. 2.4a
Additional Compounds of Formula Ig which Exemplify More Preferred
X2-E1 Moieties
[0094] In an embodiment of section 2.4, preferred compounds have
the structures of formula IIh
##STR00056##
2.4b Additional Compounds of Formula IIg which Exemplify More
Preferred X2-E1 Moieties
[0095] In another embodiment of section 2.4, preferred compounds
have the structures of formula IIi
##STR00057##
wherein R16 is methyl, cyano, --CCH, fluorine or chlorine. 2.5
Compounds of Formula IIa which Exemplify Additionally Preferred A
Moieties
[0096] In a different embodiment of section 2.1, additional
preferred compounds have the structures of formula IIj
##STR00058##
wherein A1 is selected from the group consisting of branched
Z2-substituted C3-C8alkyl, R19 substituted C3-C8-carbocyclyl,
Z2-substituted C1-C6alkyl, fluoroC1-C6alkyl wherein the alkyl is
fully or partially fluorinated, Z3-substituted phenyl, and
Z3-substituted G1; and wherein R16 is C1-C6alkyl, cyano, --CCH, or
halogen. 2.5a Additional Compounds of Formula IIj which Exemplify
More Preferred X2-E1 Moieties
[0097] In an embodiment of section 2.5, preferred compounds have
the structures of formula IIk
##STR00059##
2.5b Additional Compounds of Formula IIj which Exemplify More
Preferred X2-E1 Moieties
[0098] In another embodiment of section 2.5, preferred compounds
have the structures of formula III
##STR00060##
wherein R16 is methyl, cyano, --CCH, fluorine or chlorine. 2.6
Compounds of Formula IIa which Exemplify Additionally Preferred A
Moieties
[0099] In a different embodiment of section 2.1, additional
preferred compounds have the structures of formula IIm
##STR00061##
wherein A1 is selected from the group consisting of hydrogen,
Z2-substituted branched C3-C8alkyl, R19 substituted
C3-C8-carbocyclyl, Z2-substituted C1-C6alkyl, fluoroC1-C6alkyl
wherein the alkyl is fully or partially fluorinated, Z3-substituted
phenyl, and Z3-substituted G1; and wherein R16 is C1-C6alkyl,
cyano, --CCH, or halogen. 2.6a Additional Compounds of Formula IIm
which Exemplify More Preferred X2-E1 moieties In an embodiment of
section 2.6, preferred compounds have the structures of formula
IIn
##STR00062##
2.6b Additional Compounds of Formula IIm which Exemplify More
Preferred X2-E1 Moieties
[0100] In another embodiment of section 2.6, preferred compounds
have the structures of formula IIo
##STR00063##
wherein R16 is C1-C6alkyl, cyano, --CCH, fluorine or chlorine. 2.7
Compounds of Formula IIa which Exemplify Additionally Preferred A
Moieties
[0101] In a different embodiment of section 2.1, additional
preferred compounds have the structures of formula IIp
##STR00064##
wherein A1 is selected from the group consisting of Z2-substituted
branched C3-C8alkyl, R19 substituted C3-C8-carbocyclyl,
Z2-substituted C1-C6alkyl, fluoroC1-C6alkyl wherein the alkyl is
fully or partially fluorinated, Z3-substituted phenyl, and
Z3-substituted G1; and wherein R16 is C1-C6alkyl, cyano, --CCH, or
halogen. 2.7a Additional Compounds of Formula IIp which Exemplify
More Preferred X2-E1 Moieties
[0102] In an embodiment of section 2.7, preferred compounds have
the structures of formula IIq
##STR00065##
2.7b Additional Compounds of Formula Ip which Exemplify More
Preferred X2-E1 Moieties
[0103] In another embodiment of section 2.7, preferred compounds
have the structures of formula IIr
##STR00066##
and wherein R16 is methyl, cyano, --CCH, fluorine or chlorine. 2.8
Compounds of Formula IIa which Exemplify Additionally Preferred A
Moieties
[0104] In a different embodiment of section 2.1, additional
preferred compounds have the structures of formula IIs
##STR00067##
wherein the hashed bond is a saturated or unsaturated bond; and
wherein A1 is selected from the group consisting of hydrogen,
Z2-substituted branched C3-C8alkyl, R19 substituted
C3-C8-carbocyclyl, Z2-substituted C1-C6alkyl, halogen, cyano,
C1-C6alkoxy, fluoroC1-C6alkoxy, fluoroC1-C6alkyl wherein the alkyl
is fully or partially fluorinated, Z3-substituted phenyl, and
Z3-substituted G1; and wherein R16 is C1-C6alkyl, cyano, --CCH, or
halogen. 2.8a Additional Compounds of Formula IIs which Exemplify
More Preferred X2-E1 Moieties
[0105] In an embodiment of section 2.8, preferred compounds have
the structures of formula IIt
##STR00068##
2.8b Additional Compounds of Formula IIs which Exemplify More
Preferred X2-E1 Moieties
[0106] In another embodiment of section 2.8, preferred compounds
have the structures of formula IIu
##STR00069##
and wherein R16 is C1-C6alkyl, cyano, --CCH, fluorine or chlorine.
2.9 Compounds of Formula IIa which Exemplify Additionally Preferred
A Moieties
[0107] In a different embodiment of section 2.1, additional
preferred compounds have the structures of formula IIv
##STR00070##
wherein the hashed bond is a saturated or unsaturated bond; and
wherein A1 is selected from the group consisting of hydrogen,
Z2-substituted branched C3-C8alkyl, R19 substituted
C3-C8-carbocyclyl, Z2-substituted C1-C6alkyl, halogen, cyano,
C1-C6alkoxy, fluoroC1-C6alkoxy, fluoroC1-C6alkyl wherein the alkyl
is fully or partially fluorinated, Z3-substituted phenyl, and
Z3-substituted G1; and wherein R16 is C1-C6alkyl, cyano, --CCH, or
halogen. 2.9a Additional Compounds of Formula IIv which Exemplify
More Preferred X2-E1 Moieties
[0108] In an embodiment of section 2.9, preferred compounds have
the structures of formula IIw
##STR00071##
2.9b Additional Compounds of Formula IIv which Exemplify More
Preferred X2-E1 Moieties
[0109] In another embodiment of section 2.9, preferred compounds
have the structures of formula IIx
##STR00072##
and wherein R16 is C1-C6alkyl, cyano, --CCH, fluorine or chlorine.
2.10 Compounds of Formula IIa which Exemplify Additionally
Preferred A Moieties
[0110] In a different embodiment of section 2.1, additional
preferred compounds have the structures of formula IIy
##STR00073##
wherein A1 is selected from the group consisting of Z2-substituted
branched C3-C8alkyl, R19 substituted C3-C8carbocyclyl,
Z2-substituted C1-C6alkyl, fluoroC1-C6alkyl wherein the alkyl is
fully or partially fluorinated, Z3-substituted phenyl, and
Z3-substituted G1; and wherein R16 is C1-C6alkyl, cyano, --CCH, or
halogen. 2.10a Additional Compounds of Formula IIy which Exemplify
More Preferred X2-E1 Moieties
[0111] In an embodiment of section 2.10, preferred compounds have
the structures of formula IIz
##STR00074##
2.10b Additional Compounds of Formula IIy which Exemplify More
Preferred X2-E1 Moieties
[0112] In another embodiment of section 2.10, preferred compounds
have the structures of formula IIaa
##STR00075##
wherein R16 is methyl, cyano, --CCH, fluorine or chlorine. 2.11
Compounds of Formula IIa which Exemplify Additionally Preferred A
Moieties
[0113] In a different embodiment of section 2.1, additional
preferred compounds have the structures of formula IIbb
##STR00076##
wherein R16 is C1-C6alkyl, cyano, --CCH, or halogen. 2.11a
Additional Compounds of Formula IIbb which Exemplify More Preferred
X2-E1 Moieties
[0114] In an embodiment of section 2.11, preferred compounds have
the structures of formula IIcc
##STR00077##
2.11b Additional Compounds of Formula IIbb which Exemplify More
Preferred X2-E1 Moieties
[0115] In another embodiment of section 2.11, preferred compounds
have the structures of formula Idd
##STR00078##
wherein R16 is C1-C6alkyl, cyano, --CCH, fluorine or chlorine. 2.12
Compounds of Formula IIa which Exemplify Additionally Preferred A
Moieties
[0116] In a different embodiment of section 2.1, additional
preferred compounds have the structures of formula IIee
##STR00079##
wherein Q1 and Q2 are individually and independently taken from the
group consisting of N and CH; and wherein R16 is C1-C6alkyl, cyano,
--CCH, or halogen. 2.12a Additional Compounds of Formula IIee which
Exemplify More Preferred X2-E1 Moieties
[0117] In an embodiment of section 2.12 preferred compounds have
the structures of formula IIff
##STR00080##
2.12b Additional Compounds of Formula Iee which Exemplify More
Preferred X2-E1 Moieties
[0118] In another embodiment of section 2.12, preferred compounds
have the structures of formula IIgg
##STR00081##
wherein R16 is C1-C6allyl, cyano, --CCH, fluorine or chlorine. 2.13
Compounds of Formula IIa which Exemplify Additionally Preferred A
Moieties
[0119] In a different embodiment of section 2.1, additional
preferred compounds have the structures of formula IIhh
##STR00082##
and wherein R16 is C1-C6alkyl, cyano, --CCH, or halogen. 2.13a
Additional Compounds of Formula IIhh which Exemplify More Preferred
X2-E1 Moieties
[0120] In an embodiment of section 2.13, preferred compounds have
the structures of formula IIIi
##STR00083##
2.13b Additional Compounds of Formula IIhh which Exemplify More
Preferred X2-E1 Moieties
[0121] In another embodiment of section 2.13, preferred compounds
have the structures of formula IIjj
##STR00084##
and wherein R16 is methyl, cyano, --CCH, fluorine or chlorine. 2.14
Compounds of Formula IIa which Exemplify Additionally Preferred A
Moieties
[0122] In a different embodiment of section 2.1, additional
preferred compounds have the structures of formula IIkk
##STR00085##
wherein Q6 is N or C-A1; wherein A1 is selected from the group
consisting of hydrogen, Z2-substituted branched C3-C8alkyl, R19
substituted C3-C8-carbocyclyl, Z2-substituted C1-C6alkyl,
fluoroC1-C6alkyl wherein the alkyl is fully or partially
fluorinated, Z3-substituted phenyl, and Z3-substituted G1; and
wherein R16 is C1-C6alkyl, cyano, --CCH, or halogen. 2.14a
Additional Compounds of Formula IIkk which Exemplify More Preferred
X2-E1 Moieties
[0123] In an embodiment of section 2.14, preferred compounds have
the structures of formula IIll
##STR00086##
2.14b Additional Compounds of Formula IIkk which Exemplify More
Preferred X2-E1 Moieties
[0124] In another embodiment of section 2.14, preferred compounds
have the structures of formula IImm
##STR00087##
wherein R16 is C1-C6alkyl, cyano, --CCH, fluorine or chlorine. 2.15
Compounds of Formula IIa which Exemplify Additionally Preferred A
Moieties
[0125] In a different embodiment of section 2.1, additional
preferred compounds have the structures of formula IInn
##STR00088##
wherein A1 is selected from the group consisting of hydrogen,
Z2-substituted branched C3-C8alkyl, R19 substituted
C3-C8carbocyclyl, Z2-substituted C1-C6alkyl, fluoroC1-C6alkyl
wherein the alkyl is fully or partially fluorinated, Z3-substituted
phenyl, and Z3-substituted G1; and wherein R16 is C1-C6alkyl,
cyano, --CCH, or halogen. 2.15a Additional Compounds of Formula
IInn which Exemplify More Preferred X2-E1 Moieties
[0126] In an embodiment of section 2.15, preferred compounds have
the structures of formula IIoo
##STR00089##
2.15b Additional compounds of Formula IInn which Exemplify More
Preferred X2-E1 Moieties In another embodiment of section 2.15,
preferred compounds have the structures of formula IIpp
##STR00090##
wherein R16 is C1-C6alkyl, cyano, --CCH, fluorine or chlorine. 2.16
Compounds of Formula IIa which Exemplify Additionally Preferred A
Moieties
[0127] In a different embodiment of section 2.1, additional
preferred compounds have the structures of formula IIqq
##STR00091##
wherein Q3, Q4 and Q5 are selected from the group consisting of
N-A1 and C-A1, and only one of Q3, Q4, or Q5 is N-A1; wherein A1 is
selected from the group consisting of hydrogen, Z2-substituted
branched C3-C8alkyl, R19 substituted C3-C8-carbocyclyl,
Z2-substituted C1-C6alkyl, fluoroC1-C6alkyl wherein the alkyl is
fully or partially fluorinated, Z3-substituted phenyl, and
Z3-substituted G1; and wherein R16 is C1-C6alkyl, cyano, --CCH, or
halogen. 2.16a Additional compounds of Formula IIqq which Exemplify
More Preferred X2-E1 Moieties
[0128] In an embodiment of section 2.16, preferred compounds have
the structures of formula IIrr
##STR00092##
2.16b Additional Compounds of Formula IIqq which Exemplify More
Preferred X2-E1 Moieties
[0129] In another embodiment of section 2.16, preferred compounds
have the structures of formula IIss
##STR00093##
wherein R16 is C1-C6alkyl, cyano, --CCH, fluorine or chlorine.
2.17 Methods
2.17a Methods of Protein Modulation
[0130] The invention includes methods of modulating kinase activity
of RAF kinases and other kinases in the RAS-RAF-MEK-ERK-MAP kinase
pathway including, but not limited to, A-Raf, B-Raf, and C-Raf. The
kinases may be wildtype kinases, oncogenic forms thereof, aberrant
fusion proteins thereof or polymorphs of any of the foregoing. The
method comprises the step of contacting the kinase species with
compounds of the invention and especially those set forth in
sections 2.1-2.16. The kinase species may be activated or
unactivated, and the species may be modulated by phosphorylations,
sulfation, fatty acid acylations glycosylations, nitrosylation,
cystinylation (i.e. proximal cysteine residues in the kinase react
with each other to form a disulfide bond) or oxidation. The kinase
activity may be selected from the group consisting of catalysis of
phospho transfer reactions, kinase cellular localization, and
recruitment of other proteins into signaling complexes through
modulation of kinase conformation.
2.17b Treatment Methods
[0131] The methods of the invention, especially those of sections
2.1-2.16, also include treating individuals suffering from a
condition selected from the group consisting of chronic myelogenous
leukemia, acute lymphocytic leukemia, gastrointestinal stromal
tumors, hypereosinophillic syndrome, glioblastomas, ovarian cancer,
pancreatic cancer, prostate cancer, lung cancers, breast cancers,
kidney cancers, cervical carcinomas, metastasis of primary solid
tumor secondary sites, ocular diseases characterized by
hyperproliferation leading to blindness including various
retinopathies including diabetic retinopathy and age-related
macular degeneration, rheumatoid arthritis, melanomas, colon
cancer, thyroid cancer, a disease caused by a mutation in the
RAS-RAF-MEK-ERK-MAP kinase pathway, human inflammation, rheumatoid
spondylitis, ostero-arthritis, asthma, gouty arthritis, sepsis,
septic shock, endotoxic shock, Gram-negative sepsis, toxic shock
syndrome, adult respiratory distress syndrome, stroke, reperfusion
injury, neural trauma, neural ischemia, psoriasis, restenosis,
chronic obstructive pulmonary disease, bone resorptive diseases,
graft-versus-host reaction, Chron's disease, ulcerative colitis,
inflammatory bowel disease, pyresis, and combinations thereof,
2.18 Pharmaceutical Preparations
[0132] The compounds of the invention, especially those of sections
2.1-2.16, may form a part of a pharmaceutical composition by
combining one or more such compounds with a pharmaceutically
acceptable carrier. Additionally, the compositions may include an
additive selected from the group consisting of adjuvants,
excipients, diluents, and stabilizers.
3. SYNTHESIS OF COMPOUNDS OF THE PRESENT INVENTION
[0133] The compounds of Formulae Ia and IIa are prepared by the
general synthetic methods illustrated in the Schemes below and the
accompanying examples.
##STR00094## ##STR00095##
[0134] Compounds of Formula Ia are prepared as indicated in Scheme
1. In step 1, a suitable chloropyrimidine ester 1 is reacted with
an R4-substituted amine to provide compounds of formula 2.
Preferred conditions for Scheme 1, step 1, include polar solvents
such as DMF, THF, acetonitrile, dioxane, water or mixtures thereof
in the presence of optionally added bases such as triethylamine at
temperatures between 0.degree. C. and 100.degree. C. Reduction of
ester 2 provides alcohol 3. Preferred reagents for the
transformation of step 2 include lithium aluminum hydride in THF at
temperatures ranging from 0.degree. C. to room temp. As shown in
step 3, aldehyde 4 can be prepared by oxidation of alcohol 3 with
oxidants such as manganese dioxide. Condensation of aldehyde 4 with
ester 5 (step 4) provides pyridopyrimidinone 6. Preferred
conditions for step 4 include optional heating (30-150.degree. C.)
in DMF or DMAc in the presence of potassium carbonate or cesium
carbonate for a period of time ranging from 1 h to 4 days. Other
preferred conditions for Scheme 1, step 4 include combining
aldehyde 4, ester 5 and alumina-supported potassium fluoride in
DMAc with stirring and optional sonication and/or optional heating
(30-150.degree. C.) for a period of min to 48 h. The group "P" in
formula 5-8 represents a hydrogen atom or an optional amine
protecting group, such as tert-butyl carbamate (Boc), benzyl
carbamate (Cbz), acetamide or the like. It is understood by those
skilled in the art that the moiety R3-N--P--X2 in formulae 5-8
might also represent an amino surrogate such as nitro or cyano that
can be converted to an amino group or aminomethyl group in step 7
by reduction under suitable conditions.
[0135] In Scheme 1, step 5, the thiomethyl moiety of 6 can be
oxidized to a sulfoxide or sulfone to provide 7. Preferred reagents
for such transformations include peroxybenzoic acids, oxone,
oxaziridines, or other oxidants that will be recognized as standard
oxidants of sulfur atoms by those skilled in the art. In practice,
mixtures of sulfoxides and sulfones can be used in step 6 without
prior separation. In step 6, the sulfone or sulfoxide moiety of 7
can be converted to a Z6 moiety that is linked to the
pyridopyrimidinone through a heteroatom to provide 8 by the
contacting of 7 with moieties of Z6-H [for example NH(R4).sub.2,
HOR4 or HSR4] optionally in the presence of a base such as
potassium tert-butoxide, sodium hydride or the like or,
alternatively, in the presence of a strong acid such as
hydrochloric acid. Preferred solvents for such transformations
include dioxane, DMF, THF, alcoholic solvents or neat Z6-H at
temperatures ranging from 0.degree. C. to 200.degree. C. Those
skilled in the art will recognize that in certain instances,
compounds of formula 8 can be prepared directly from compounds of
formula 6 using the conditions of step 6. In the instance that Z6
is hydrogen, preferred methods include exposure of compounds of
formula 6 or 7 to hydrogen gas in the presence of a suitable
hydrogenation catalyst, for example Raney Nickel.RTM. or Pd on
carbon in a suitable solvent such as ethanol, methanol, ethyl
acetate or THF.
[0136] In Scheme 1, step 7, the optional protecting group P of
formula 8 can be removed, if necessary, by appropriate
de-protection conditions (for example, acidic hydrolysis for a Boc
or hydrogenation for a Cbz) to provide compounds of formrmula 9.
Step 7 may also encompass the conversion of amine surrogates (such
as nitro) into amines by appropriate chemistries (for example,
reduction of a nitro group with Zn/ammonium chloride or by
hydrogenation with a Pd catalyst). Finally, the conversion of
compounds of formula 9 to compounds of formula 10, an aspect of
formula Ia. can be accomplished in step 8 by reaction with
isocyanates of formula A-NCO, 11. It will be understood that the
isocycantes 11 may be either introduced into the reaction directly
or may be prepared in situ, for example, by the decomposition of
acyl azides (Curtius rearrangement) in the presence of 9. It will
be further understood by those skilled in the art that certain
carbamates, for example trichloroethyl carbamates (12) and
isopropenyl carbamates (131 also function as isocyanate equivalents
and will find use in step 8.
[0137] An alternative preparation of intermediate 6 is shown in
Scheme 2. Treatment of aldehyde 4 from Scheme 1 with ethyl
(triphenylphosphoranylidene)acetate provides compounds of formula
14. Bromination of 14 with N-bromosuccinimde (step 2) provides
bromide 15. In step 3, Suzuki-type couplings of 15 with boronic
acids 16 in the presence of palladium catalysts provide compounds
of formula 6, useful for the preparation of compounds of formula 10
as illustrated in Scheme 1.
##STR00096##
[0138] Non-commercially available pyrimidines 1 can be readily
prepared from known intermediate 17 [See Seto, et al. Biorg, Med,
Chem. Lett. 2005, 15, 1485]. (Scheme 3) Thus, lithiation of 17 with
LDA followed by CO.sub.2 quench provides acid 18. Conversion of
acid 18 to ester 19 provides a scaffold to introduce Z6 groups of
the invention. When the Z6 moiety is attached to the pyrimidine
ring through a Z6 nitrogen atom, a Z6 oxygen atom or a Z6 sulfur
atom, compounds of formula 1 can be prepared by contacting the
amine Z6-H, the alcohol Z6-H or the thiol Z6-H with compound 19,
either neat (Z6-H as solvent) or in a suitable solvent such as DMF,
DMSO or an alcoholic solvent at temperatures ranging from
-78.degree. C. to 200.degree. C. in the presence of suitable base
such as triethylamine, potassium carbonate, or potassium
tert-butoxide. When the Z6 moiety is attached to the pyrimidine
through a Z6 carbon atom, preferred methods include contacting
compound 19 with a species of formula Z6-M in the presence of a
palladium catalyst, wherein M is a species that participates in
transition-metal catalyzed cross-coupling reactions. Examples of
suitable M groups include but are not limited to, boronic acids and
boronic esters, zinc, copper, tin, silicon, magnesium, lithium, and
aluminum.
##STR00097##
[0139] Compounds of both Formulae Ia and IIa can be prepared by the
additional methods in Scheme 4, below. As shown in step 1, reaction
of R4-substituted amines with 5-bromo-2,6-dichloropyrimidine (22,
commercially available), 3-bromo-2,6-dichloropyridine (21,
available by the procedure of Pierrat et al. J. Comb. Chem. 2005,
7, 879-886) or 5-bromo-2,4-dichloropyridine 20, available by the
procedure of Schlosser et al, J. Org. Chem. 2004, 70, 2494-2502)
provides compounds 23-25 respectively. In step 2, treatment of
bromides 23-25 with tributylvinyltin in the presence of a palladium
catalyst provides compounds of formula 26-28. In step 3, oxidative
cleavage of the olefin moiety provides aldehydes of formula
29-31.
##STR00098## ##STR00099##
[0140] In Scheme 4, step 4, condensation of 29-31 with ester 5
provides 32-34. Preferred conditions for step 4 include optional
heating (30-150.degree. C.) in DMF or DMAc in the presence of
potassium carbonate or cesium carbonate for a period of time
ranging from 1 h to 4 days. Other preferred conditions for Scheme
4, step 4 include combining aldehyde 29-31, ester 5 and
alumina-supported potassium fluoride in DMAc with stirring and
optional sonication and/or optional heating (30-150.degree. C.) for
a period of 30 min to 48 h. As described in Scheme 1, the group "P"
present in formulas 32-37 represents a hydrogen atom or an optional
amine protecting group, such as tert-butyl carbamate (Boc), benzyl
carbamate (Cbz), acetamide or the like. It is understood by those
skilled in the art that the moiety R3-N--P--X2 in formula 32-37
might also represent an amino surrogate such as nitro or cyano that
can be converted to an amino group or an aminomethyl group in step
6 by reduction under suitable conditions.
[0141] As shown in Scheme 4, step 5, compounds of formula 32-34 can
be converted to compounds of formula 35-37 by replacement of the
chloride moiety of 32-34 with a Z6 moiety. There are several
methods through which this can be accomplished, depending on the
nature of the Z6. When the Z6 moiety is attached to the
Q1-containing ring through a Z6 nitrogen atom, preferred methods
include heating compounds of formula 32-34 with an excess of the
amine Z6-H either neat or in a solvent such as
N-methylpyn-olidinone, DMF, DMSO or an alcoholic solvent at
temperatures ranging from room temp to 200.degree. C. For the case
of aryl and heteroaryl amines Z6-H, additional preferred methods
include the heating of compounds 32-34 with an excess of the amine
Z6-H and an acid catalyst (for example, TsOH, HCl, HOAc or the
like) in a suitable solvent such as DMF, DMSO or an alcoholic
solvent. Additional preferred methods for aryl and heteroarylamines
Z6-H include heating with compounds 32-34 in the presence of a
transition metal catalyst such as a palladium catalyst in a
suitable solvent like 1,4-dioxane or DMF. When the Z6 moiety is
attached to the Q-containing ring through a Z6 oxygen or sulfur
atom, preferred methods include heating 32-34 with alcohol or thiol
Z6-H in the presence of a strong base (for example, NaH or
potassium tert-butoxide) either neat using Z6-H as the solvent, or
in a polar solvent such as DMF or DMSO at temperatures ranging from
room temp to 200.degree. C. When the Z6 moiety is attached to the
pyridopyrimidine through a Z6 carbon atom, preferred methods
include contacting compounds 32-34 with a species of formula Z6-M
in the presence of a palladium catalyst, wherein M is a species
that participates in transition-metal catalyzed cross-coupling
reactions. Examples of suitable M groups include but are not
limited to, boronic acids and boronic esters, zinc, trialkyltin,
silicon, magnesium, lithium, and aluminum. In the instance that Z6
is hydrogen, preferred methods include exposure of compounds of
formula 32-34 to hydrogen gas in the presence of a suitable
hydrogenation catalyst, for example Raney Nickel.RTM. or Pd on
carbon in a suitable solvent such as ethanol, ethyl acetate or
THF.
[0142] As shown in Scheme 4, step 6, removal of the optional
protecting group P provides compounds of formula 38-40 which can be
further converted (step 7) to compounds of formula 41-43 examples
of Formula Ia and IIa, by the methods described in Scheme 1.
[0143] Scheme 5 illustrates an alternate, preferred method for the
preparation of chloropyridine aldehydes 29, useful for the
preparation of amines 32 and compounds of general formula IIa.
Thus, by analogy to Scheme 1, ethyl 4,6-dichloronicotinate (44) is
reacted with an R4-substituted amine to provide a compound of
formula 45. Preferred conditions for Scheme 5, step 1, include
polar solvents such as DMF, THF, acetonitrile, dioxane, water or
mixtures thereof in the presence of optionally added bases such as
triethylamine at temperatures between 0.degree. C. and 100.degree.
C. Reduction of ester 45 provides alcohol 46. Preferred reagents
for the transformation of step 2 include lithium aluminum hydride
in THF at temperatures ranging from 0.degree. C. to room temp. As
shown in step 3, aldehyde 29 can be prepared by oxidation of
alcohol 46 with oxidants such as manganese dioxide. Condensation of
aldehyde 29 with ester 5 according to Scheme 4 provides 32, useful
for the preparation of compounds of Formula IIa.
##STR00100##
[0144] It will be recognized in the above Schemes and the
accompanying examples that some Z6 moieties may be introduced with
protecting groups that will require additional de-protection steps.
For example, Scheme 6 shows a preferred route to preparing
pyridopyridines of formula 48 wherein Z6 is NHMe. In Scheme 6, step
1, chloropyridine 32 is reacted with (4-methoxybenzyl)methylamine
to provide 47. Step 1 may be performed in neat
(4-methoxybenzyl)methylamine at temperatures between 150.degree. C.
and 200.degree. C. Or more preferably, step 1 can be conducted
using only a slight excess of (4-methoxybenzyl)methylamine and DBU
(1,8-diazabicyclo[5.4.0]undec-7-ene) in N-methylpyrrolidinone at
temperatures between 150.degree. C. and 200.degree. C. In step 2,
removal of the 4-methoxybenzyl protecting group from 47 with
trifluoroacetic acid provides amine 48.
##STR00101##
[0145] In addition to the methods of urea formation described in
Schemes 1 and 4 above, ureas of formulae Ia and IIa may also be
prepared as shown in Scheme 7. In Scheme 7, step 1, amines of
formulae 49-51 are reacted with isopropenyl chloroformate to afford
the corresponding isopropenyl carbamates 52-54. In step 2,
carbamates 52-54 are reacted with amines of formula A-NHR3 (55) to
provide ureas of formula 56-58. In the event that R3 is not H, the
mono-substituted ureas 56-58 can be optionally further transformed
into bis-R3-substituted ureas 59-61. Thus, in step 3, exposure of
the NH-ureas 56-58 to alkyl halides in the presence of a base, for
example potassium carbonate, NaH, potassium t-butoxide or BEMP, in
a suitable solvent such as DMF provides ureas 59-61 wherein the
newly incorporated R3 group is alkyl.
[0146] Alternatively, exposure of ureas 56-58 to copper(II) acetate
and phenylboronic acids [See: Chan et. al, Tetrahedron Lett. 2003,
44, 3863-3865; Chan et. al, Tetrahedron Lett. 1998, 39, 2933-2936;
Chan, D. M. T. Tetrahedron Lett. 1996, 37, 9013-9016] provides the
analogous compounds 59-61 wherein the newly incorporated R3 is
phenyl.
##STR00102##
[0147] General method A:
[0148] To a solution of the starting pyrazole amine (1 eq) in EtOAc
were added 2,2,2-trichloroethylchloroformate (1.1 eq) and saturated
NaHCO.sub.3 (2-3 eq) at 0.degree. C. After stirring for 3 h at RT,
the layers were separated and the aqueous layer extracted with
EtOAc. The combined organic extracts were washed with brine, dried
(Na.sub.2SO.sub.4) and concentrated in vacuo to yield the crude
TROC carbamate of the pyrazole amine. To the carbamate (1 eq) in
DMSO were added diisopropylethylamine (2 eq), the appropriate amine
(2 eq) and the mixture was stirred at 60.degree. C. for 16 h or
until all the starting carbamate was consumed. Water was added to
the mixture and the product was extracted with EtOAc (2.times.25
mL). The combined organic extracts were washed with brine solution,
dried (NaSO.sub.4) and concentrated in vacuo to yield crude
product, which was purified by column chromatography to yield the
target compound.
[0149] General Method B:
[0150] To a suspension of the amine (usually 0.67 mmol) in EtOAc (2
mL) was added aqueous 1N NaOH. The reaction mixture was cooled to
0.degree. C. and treated with isopropenyl chloroformate (0.1 mL,
0.94 mmol) over 30 sec. The reaction mixture was stirred 15 min at
0.degree. C. and 1 h at RT. The reaction was poured into THF-EtOAc
(1:1; 40 mL) and washed with H.sub.2O (2.times.10 mL) and brine
(2.times.10 mL). The organics were dried (Na.sub.2SO.sub.4),
concentrated in vacuo and the residue purified via column
chromatography to provide the target (prop-1-en-2-yl)carbamate.
[0151] To the carbamate (usually 0.26 mmol) was added the
appropriate amine (usually 0.26 mmol) in THF (2 mL) and
1-methylpyrrolidine (Catalytic amount) at 60.degree. C. for 18 h.
The mixture was diluted with CH.sub.2Cl.sub.2 (2 mL) and hexane
(0.5 mL) solution, and stirred for 10 min. The resultant solid was
filtered and dried and the resulting solid converted to the amine
hydrochloride salt by treatment with 0.1 N HCl solution and
lyophilization.
[0152] General Method C:
[0153] To a stirring solution of amine (2 mmol, 1.00 eq) and
pyridine (4 mmol, 2.00 eq) in CH.sub.2Cl.sub.2 (18 ml) at RT was
added Troc-Cl (1.87 mmol, 1.05 eq). After 4 hours the reaction was
washed with 3M HCl (1.times.), satd. NaHCO.sub.3 (1.times.), dried
(Na.sub.2SO.sub.4), filtered and evaporated to afford the target
2,2,2-trichloroethyl carbamate. The material was used as is in the
next reaction.
[0154] The 2,2,2-trichloroethyl carbamate (0.7 mmol, 1.00 eq), the
appropriate (0.7 mmol, 1.00 eq)and iPr.sub.2NEt (1.54 mmol, 2.20
eq) were combined in DMSO (3 ml) and stirred with heating at
70.degree. C. After 18 h, the completed reaction was diluted with
brine (30 ml) and extracted with EtOAc (3.times.). The combined
organics were washed with brine (2.times.), dried (MgSO.sub.4),
filtered and evaporated to give the crude product which was
purified via flash column chromatography.
[0155] General Method D:
[0156] To a stirring solution of carboxylic acid (0.50 mmol, 1.00
eq) and DPPA (0.75 mmol, 1.50 eq) in 1,4-dioxane (5.0 ml) at RT was
added Et.sub.3N (1.5 mmol, 3.00 eq). After stirring for 30 min at
RT, the appropriate amine (0.76 mmol, 1.50 eq) was added and the
mixture was heated at 100.degree. C. After 2 h, the completed
reaction was cooled to RT, diluted with brine and extracted with
EtOAc (2.times.). The combined organics were washed with 3M HCl
(1.times.), satd. NaHCO.sub.3 (2.times.), and brine (1.times.),
dried (MgSO.sub.4), filtered and evaporated to give the crude
product which was purified by flash column chromatography to afford
the target urea.
[0157] General Method E:
[0158] To a solution of aryl sulfone and/or aryl sulfoxide (0.4
mmol) in THF added the appropriate amine (2 mmol, 5 eq) and the
reaction was stirred for 2 h at RT. The mixture was diluted with
EtOAc (3 mL) and resultant solid filtered, washed and dried to
provide the desired product aryl amine.
[0159] General Method F:
[0160] To a stirring suspension of isocyanate (0.51 mmol, 1.00 eq)
and pyridine (0.0418 ml, 0.51 mmol, 1.00 eq) in CH.sub.2Cl.sub.2 (5
ml) at RT was added the appropriate amine (0.51 mmol, 1.00 eq). A
thick suspension gradually formed. After 3.5 h, the solids were
collected by filtration, rinsed well with CH.sub.2Cl.sub.2 and
dried on the filter to afford the desired urea.
[0161] General Method G:
[0162] To a solution of amine (11 mmol) in THF (100 mL) was added
LiHMDS (22 mmol) at -78.degree. C. under Ar. After 20 min,
prop-1-en-2-yl carbonochloridate (11 mmol) was added and the
reaction was stirred for 30 min. The mixture was quenched with 2N
HCl (15 mL) at -78.degree. C. and warmed to RT. It was diluted with
brine (50 mL) and EtOAc (50 mL), the organic layer was separated
and washed with brine, dried (Na.sub.2SO.sub.4) and concentrated in
vacuo. Purification by silica gel chromatography or
recrystallization provided the appropriate prop-1-en-2-yl
carbamate.
[0163] To the carbamate (usually 0.26 mmol) was added the
appropriate amine (usually 0.26 mmol) in THF (2 mL) and
1-methylpyrrolidine (Catalytic amount) at 60.degree. C. for 18 h.
The mixture was diluted with CH.sub.2Cl.sub.2 (2 mL) and hexane
(0.5 mL) solution, and stirred for 10 min. The resultant solid was
filtered and dried and the resulting solid converted to the amine
hydrochloride salt by treatment with 0.1 N HCl solution and
lyophilization.
Example A1
[0164] To a solution of Example A3 (6.0 g, 19 mmol) in
CH.sub.2Cl.sub.2 (50 mL) was added m-chloroperoxybenzoic acid
(mCPBA, 6.5 g, 38 mmol) in one portion. After stirring for 2 h at
RT, sat. aq NaHCO.sub.3 and aq NaHSO.sub.3 solution were added and
stirring was continued for a few minutes. The combined organic
layer was washed with brine, dried and concentrated in vacuo. The
residue was dissolved in DMSO (5 mL) and ammonia in dioxane (2 M,
200 mL, 400 mmol) was added. The resultant reaction mixture was
stirred overnight at RT. The solvent was removed under reduced
pressure and the residue was purified by reverse phase prep-HPLC to
provide
2-amino-6-(3-amino-4-fluorophenyl)-8-methylpyrido[2,3-d]pyrimidin-7(8H)-o-
ne (1.9 g, 35% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6), .delta.
8.63 (s, 1H), 7.80 (s, 1H), 7.39 (br s, 2H), 7.12 (d, J=6.0 Hz,
1H), 7.03 (t, J=12.0 Hz, 1H), 6.80 (m, 1H), 3.53 (s, 3H); MS (ESI)
m/z: 286.2 (M+H.sup.+).
Example A2
[0165] Using a procedure analogous to Example A1, Example A9 (3.50
g, 10.6 mmol) was oxidized with mCPBA (2.87 g, 11.7 mmol, 70% wt)
to afford the intermediate
6-(3-amino-4-fluorophenyl)-8-ethyl-2-(methylsulfinyl)pyrido[2,3-d]pyrimid-
in-7(8H)-one (2.35 g, 61% yield). The intermediate (1.40 g, 3.86
mmol) and 0.5 M ammonia in dioxane (15.5 mL, 2 eq) were combined
and purified by silica gel column chromatography to obtain
2-amino-6-(3-amino-4-fluorophenyl)-8-ethylpyrido[2,3-d]pyrimidin-7(8H)-on-
e (0.65 g, 56% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.63 (s, 1H), 7.79 (s, 1H), 7.27 (s, 1H), 7.10 (dd, J=2.4, 8.8 Hz,
1H), 7.00 (dd, J=8.8, 11.6 Hz, 1H), 6.75 (m, 1H), 5.14 (s, 2H),
4.31 (q, J=6.8 Hz, 2H), 1.18 (t, J=6.8 Hz, 3H); LC-MS (EI) m/z:
300.0 (M+H.sup.+).
Example A3
[0166] A mixture of Example C1 (15 g, 82 mmol), ethyl
2-(3-amino-4-fluorophenyl)acetate (19.4 g, 98 mmol; prepared by the
method of Kuse et al. Tetrahedron (2005), 61, 5754-5762) and
K.sub.2CO.sub.3 (34.0 g, 246 mmol) in DMF (100 mL) was heated at
110.degree. C. overnight. The mixture was poured into water and
product was extracted with ethyl acetate (3.times.200 mL). The
combined organics were washed with brine, dried (Na.sub.2SO.sub.4)
and concentrated in vacuo. Purification by silica gel
chromatography provided
6-(3-amino-4-fluorophenyl)-8-methyl-2-(methylthio)pyrido[2,3-d]pyrimidin--
7(8H)-one (13.0 g, 50% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6),
.delta. 8.91 (s, 1H), 7.99 (s, 1H), 7.15 (dd, J=8.7, 2.1 Hz, 1H),
7.04 (dd, J=11.4, 8.4, 1H), 6.80 (m, 1H), 5.21 (br s, 2H), 3.65 (s,
3H), 2.60 (s, 3H); MS (ESI) m/z: 317.2 (M+H.sup.+).
Example A4
[0167] Using general method E,
6-(3-amino-4-fluorophenyl)-8-ethyl-2-(methylsulfinyl)pyrido[2,3-d]pyrimid-
in-7(8H)-one from Example 2 (0.94 g, 2.73 nmol) and 2.0 M
methylamine/THF (2.73 mL, 5.5 mmol) were stirred overnight at RT.
Water (50 mL) was added and the product was extracted with EtOAc
(2.times.30 mL). The combined organic layers were washed with
brine, dried (Na.sub.2SO.sub.4) and concentrated to afford crude
product. This crude product was stirred with 60%
CH.sub.2Cl.sub.2/hexane solution (10 mL) for 10 min. The resultant
solid was filtered and washed with 60% CH.sub.2Cl.sub.2/hexane
solution and dried to afford
6-(3-amino-4-fluorophenyl)-8-ethyl-2-(methylamino)pyrido[2,3-d]pyrimidin--
7(8H)-one (0.32 g, 37% yield) as a solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.62 (s, 1H), 7.82-7.77 (m, 2H), 7.11 (dd,
J=8.8 Hz, 1.6 Hz, 1H), 7.00 (dd, J=11.2 Hz, 8.0 Hz, 1H), 6.78-6.74
(m, 1H), 5.14 (s, 2H), 4.39-4.35 (m, 2H), 2.89 (d, J=4.4 Hz, 3H),
1.26-1.22 (m, 3H); MS (ESI) m/z: 314.3 (M+H.sup.+).
Example A5
[0168] Using a two-step procedure analogous to Example A27, Example
A55 (1.3 g, 3.2 mmol) and 4-Methoxybenzylamine (10 mL) were
converted to
7-amino-3-(3-amino-4-fluorophenyl)-1-methyl-1,6-naphthyridin-2(1H)-one
(0.55 g, 54%, yield, two steps). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.34 (s, 1H), 7.77 (s, 1H), 7.07 (dd, J=9.2,
2.4 Hz, 1H), 6.97 (m, 1 H), 6.75 (m, 1H), 6.50 (s, 2H), 6.24 (s,
1H), 5.10 (s, 2H), 3.47 (s, 3H), MS (ESI) m/z (M+H.sup.+):
285.3.
Example A6
[0169] Using a procedure analogous to Example A1, Example A10
(0.200 g, 0.605 mmol) and N,N-dimethylethylenediamine (0.334 ml,
3.03 mmol) were combined to afford
6-(5-amino-4-fluoro-2-methylphenyl)-2-(2-(dimethylmnino)ethylamino)-8-met-
hylpyrido[2,3-d]pyrimidin-7(8H)-one (0.095 g, 42% yield) as a
yellow foam. .sup.1H NMR (400 MHz, CDCl.sub.3) .delta. 8.40 (s,
1H), 7.36 (s, 1H), 6.85 (d, J=11.6 Hz, 1H), 6.62 (d, J=9.2 Hz, 1H),
6.11 (s, 1H), 3.79 (s, 3H), 3.57 (q, J=5.6 Hz, 2H), 2.56 (t, J=6.0
Hz, 2H), 2.29 (s, 6H), 2.07 (s, 3H); MS (ESI) m/z: 371.2
(M+H.sup.+).
Example A7
[0170] The mixture of Example A11 (0.050 g, 0.16 mmol) and
N,N-dimethylethane-1,2-diamine (2.0 mL, 18 mmol) was heated at
175.degree. C. under N.sub.2 overnight. The reaction was cooled
down to RT and solvent was removed under reduced pressure. The
residue was quenched with satd. NaHCO.sub.3 (6 mL) and extracted
with EtOAc (2.times.10 mL). The combined organic layers were washed
with brine (6 mL), dried (MgSO.sub.4) and concentrated to afford
3-(5-amino-4-fluoro-2-methylphenyl)-7-(2-(dimethylamino)ethylamino)-1-met-
hyl-1,6-naphthyridin-2(1H)-one (0.050 g, 86% yield) as a light
yellow foam. .sup.1H NMR (400 MHz, CDCl.sub.3), .delta. 8.28 (s,
1H), 7.43 (s, 1H), 6.86 (d, J=12.0 Hz, 1H), 6.64 (d, J=9.2 Hz, 1H),
6.06 (s, 1H), 5.58 (m, 1H), 3.60 (s, 3H), 3.40 (q, J=5.2 Hz, 2H),
2.60 (t, J=6.0 Hz, 2H), 2.28 (s, 6H), 2.09 (s, 3H); MS (ESI) m/z:
370.2 (M+H.sup.+).
Example A8
[0171] Using procedures analogous to Example C2 and Example A2,
ethyl 4-chloro-2-(methylthio)pyrimidine-5-carb oxylate, cyclopropyl
amine, ethyl 2-(3-amino-4-fluorophenyl)acetate (prepared by the
method of Kuse et al. Tetrahedron (2005), 61, 5754-5762) and 0.5 M
ammonia in dioxane (2 ml) were combined to afford
2-amino-6-(3-amino-4-fluorophenyl)-8-cyclopropylpyrido[2,3-d]pyrimidin-7(-
8H)-one as an off-white solid (67 mg). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.57 (s, 1H), 7.73 (s, 1H), 7.15 (brs, 1H),
7.06 (dd, J=9.2 Hz, 2.4 Hz, 1H), 6.99 (dd, J=11.2 Hz, 11.6 Hz, 1H),
6.75-6.71 (m, 1H), 2.88-2.82 (m, 1H), 1.18-1.13 (m, 2H), 0.83-0.78
(m, 2H); MS (ESI) m/z: 312.0 (M+H.sup.+).
Example A9
[0172] Method 1: To a solution of Example C2 (8.0 g, 0.041 mol) and
ethyl 2-(3-amino-4-fluorophenyl)acetate (8.0 g, 0.041 mol) in DMAc
(200 mL) was added KF on Al.sub.2O.sub.3 (40 wt %, g, 0.275 mol)
and the mixture was stirred at RT for 1 h. The reaction mixture was
filtered and the filtrate was concentrated to dryness. The residue
was washed with ethyl ether to provide
6-(3-amino-4-fluorophenyl)-8-ethyl-2-(methylthio)pyrido[2,3-d]pyr-
imidin-7(8H)-one (10.9 g, 81% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.88 (s, 1H), 7.96 (s, 1H), 7.10 (dd, J=9.2,
2.4 Hz, 1H), 7.00 (dd, J=11.4, 8.6 Hz, 1H), 6.76 (m, 1H), 5.17 (s,
2H), 4.36 (q, J=6.8 Hz, 2H), 2.57 (s, 3H), 1.22 (t, J=6.8 Hz, 3H);
MS (ESI) m/z: 331.1 [M+H].sup.+.
[0173] Method 2: The compound from Example C2 (2.08 g, 10.5 mmol),
ethyl 2-(3-amrnino-4-fluorophenyl)acetate (2.29 g, 11.6 mmol) and
powdered K.sub.2CO.sub.3(4.37 g, 31.6 mmol) were combined in DMF
(15 mL) and vigorously stirred with heating at 110.degree. C. under
a N.sub.2 atmosphere.
[0174] The completed reaction was cooled partially and diluted with
H.sub.2O (60 mL) to precipitate product. The suspension was chilled
thoroughly in ice. The solid was filtered and washed with water
(100 mL) to obtain the crude product,
6-(3-amino-4-fluorophenyl)-8-ethyl-2-(methylthio)pyrido[2,3-d]pyrimidin-7-
(8H)-one (3.50 g, 100% yield).
Example A10
[0175] Nitrogen was bubbled though a solution of Example D4 (2 g,
8.0 mmol),
6-bromo-8-methyl-2-(methylthio)pyrido[2,3-d]pyrimidin-7(8H)-one
(2.5 g, 8.8 mmol) and potassium carbonate (3.3 g, 23.9 mmol) in DMF
(10 mL) for 20 min, then tetrakis(triphenyl phosphine) palladium
(460 mg, 0.4 mmol) was added and the nitrogen was continued for 30
min. The resulting mixture was heated at 80.degree. C. for 16 h.
The excess DMF was removed under reduced pressure and the residue
was partitioned between water and EtOAc. The organic layer was
washed with brine, dried, filtered concentrated and purified by
silica gel column chromatography to give
6-(5-amino-4-fluoro-2-methylphenyl)-8-methyl-2-(methylthio)pyrido[2,3-d]p-
yrimidin-7(8H)-one (1.1 g, 42.3% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.86 (s, 1H), 7.80 (s, 1H), 6.87 (d, J=12.0
Hz, 1H), 6.58 (d, J=8.0 Hz, 1H), 4.96 (br s, 2H), 3.62 (s, 3H),
2.59 (s, 3H), 1.95 (s, 3H). MS (ES1) m/z: 331.2 (M+H.sup.+).
[0176] Method 2: Example C1 (3 g, 16.4 mmol) and Example D1 (3.46
g, 16.4 mmol) were combined in DMAc (30 mL). KF/Al.sub.2O.sub.3 (40
wt %, 19 g. 130 mmol) was added and resulting slurry was stirred
vigorously at RT for 30 min. The solids were removed by filtration
and the filter cake was washed with DMAc. The combined organics
were concentrated in vacuo to give a residue which was slurried
with water and filtered to provide
6-(5-amino-4-fluoro-2-methylphenyl)-8-methyl-2-(methylthio)pyrido[2,3-d]p-
yrimidin-7(8H)-one (700 mg, 13% yield).
[0177] Method 3: Cs.sub.2CO.sub.3 (40.0 g, 123 mmol) was added to a
solution of Example D1 (10.00 g, 47 mmol, 1 eq) and Example C1 (8.0
g, 44 mmol, 0.92 eq) in DMF (100 mL). The reaction mixture was
stirred at RT for 15 hours. Water (800 mL) was added with stirring.
The precipitate was filtered and washed with water to provide the
crude product. The crude product was slurried in methanol with
heating to 50.degree. C. for 20 minutes. The hot suspension was
filtered and the collected solids were dried in vacuo to provide
6-(5-amino-4-fluoro-2-methylphenyl)-8-methyl-2-(methylthio)pyrido[2,3-d]p-
yrimidin-7(8H)-one (11.4 g, 73% yield).
Example A11
[0178] To a solution of Example C3 (2 g, 11.8 mmol) in DMAc (40 mL)
was added Example D1 (2.5 g, 11.8 mmol), followed by
KF/Al.sub.2O.sub.3 (40 wt %, 10 g, 68 mmol). The reaction mixture
was stirred at RT for 2 hours. The reaction mixture was filtered
and the filtrate was poured into water and the precipitate was
collected by filtration and dried to give
3-(5-amino-4-fluoro-2-methylphenyl)-7-chloro-1-methyl-1,6-naphthyridin-2(-
1H)-one (2.5 g, 69% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 8.72 (s, 1H), 7.90 (s, 1H), 7.62 (s, 1H), 6.88 (d, J=12.3
Hz, 1H), 6.60 (d, J=6 Hz, 1H), 4.95 (s, 2H), 3.60 (s, 3H), 1.95 (s,
3H); MS (ESI) m/z: 318.0 [M+H].sup.+.
Example A12
[0179] Using a procedure analogous to Example A1, Example A3 (4.0
g, 12.6 mmol), mCPBA (3.43 g, 13.9 mmol) and methylamine
hydrochloride (1.73 g, 25.3 mmol) were combined to afford
6-(3-amino-4-fluorophenyl)-8-methyl-2-(methylamino)pyrido[2,3-d]pyrimidin-
-7(8H)-one as a yellow solid (3.00 g, 79% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6) .delta. 8.70 and 8.62 (br s, 1H), 7.81 (s, 1H),
7.78 (m, 1H), 7.11 (dd, J=8.8, 2.0 Hz, 1H), 7.00 (dd, J=11.6, 8.0
Hz, 1H), 6.77 (m, 1H), 5.13 (s, 2H), 3.59 and 3.54 (s, 3H), 2.91
(d, J=4.4 Hz, 3H); MS (ESI) m/z: 300.3 [M+H].sup.+.
Example A13
[0180] A solution of Example A3 (2.5 g, 7.9 mmol) in EtOH (30 ml)
was treated with Raney Nickel.RTM. (50% slurry in water, 10 g, 85
mmol) and the mixture was refluxed for 3 h. The cooled reaction was
filtered and the filtrate was concentrated to give the crude
product, which was washed with cold MeOH (2 mL) to give
6-(3-amino-4-fluoro-phenyl)-8-methyl-8H-pyrido[2,3-d]pyrimidin-7-one
(1.0 g, 47% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6) .delta.
9.10 (s, 1H), 9.07 (s, 1H), 8.06 (s, 1H), 7.14 (dd, J=8.7, 2.1 Hz,
1H), 7.05 (dd, J=11.4, 8.4 Hz, 1H), 6.82 (m, 1H), 5.22 (s, 2H),
3.68 (s, 3H); MS (ESI) m/z: 271.3 (M+H.sup.+).
Example A14
[0181] A solution of Example A10 (500 mg, 1.5 mmol) in dioxane (1
mL) and NH.sub.3.H.sub.2O (5 mL) was heated to 180.degree. C. in a
steel bomb for 3 h. The solvent was removed under reduced pressure,
and the residue was purified by silica gel column chromatography to
afford
2-amino-6-(5-amino-4-fluoro-2-methylphenyl)-8-methylpyrido[2,3-d]pyrimidi-
n-7(8H)-one (110 mg, 24% yield). .sup.1H NMR (300 Hz,
DMSO-d.sub.6): .delta. 8.58 (s, 1H), 7.59 (s, 1H), 7.25 (s, 2H),
6.85 (d, J=12.6 Hz, 1H), 6.57 (d, J=9.3 Hz, 1H), 4.88 (s, 2H), 3.53
(s, 3H), 1.95 (s, 3H); MS (ESI) m/z: 300.3 [M+H].sup.+.
Example A15
[0182] By analogy to Example
A3,4-amino-2-(methylthio)pyrimidine-5-carbaldehyde (1 g, 5.9 mmol,
prepared according to Barvian et. al. J. Med. Chem. (2000), 43,
4606-4616), K.sub.2CO.sub.3 (2.4 g, 17.4 mmol) and
(3-amino-4-fluoro-phenyl)-acid ethyl ester (1.4 g, 7.1 mmol) were
combined to provide
6-(3-amino-4-fluorophenyl)-2-(methylthio)pyrido[2,3-d]pyrimidin-7(8H)-one
(1.1 g, 56%, yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6), .delta.
12.51 (br s, 1H), 8.87 (s, 1H), 7.95 (s, 1H), 7.12 (dd, J=9.0, 2.1
Hz, 1H), 7.02 (dd, J=11.4, 8.4 Hz, 1H), 6.80 (m, 1H), 5.19 (s, 2
H), 2.55 (s, 3H); MS (ESI) m/z: 303.2 [M+H].sup.+.
Example A16
[0183] A mixture of Example C1 (2.4 g, 13 mmol), Example D2 (2.8 g,
13 mmol) and KF/Al.sub.2O.sub.3 (40 wt %, 10 g, 69 mmol) in DMAc
was stirred at RT for 10 min. The reaction mixture was poured into
water and the mixture was extracted with EtOAc (3.times.). The
combined organic extracts were washed with brine, dried
(Na.sub.2SO.sub.4), concentrated in vacuo and chromatographed to
give
6-(5-amino-2,4-difluorophenyl)-8-methyl-2-(methylthio)pyrido[2,3-d]pyrimi-
din-7(8H)-one (2.5 g, 58% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 8.91 (s, 1H), 7.98 (s, 1H), 7.13-7.06 (t,
J=10.8 Hz, 1H), 6.86-6.80 (t, J=7.8 Hz, 1H), 5.10 (s, 2H), 3.62 (s,
3H), 2.59 (s, 3H); MS (ESI) m/z: 335.0 [M+H].sup.+.
Example A17
[0184] To a solution of Example D3 (3 g, 13 mmol) and Example C1
(2.4 g, 13 mmol) in DMAc (50 mL) was added KF/A.sub.2O.sub.3 (40 wt
%, 10 g, 69 mmol). The resultant mixture was stirred at RT for 1
hour. The reaction was filtered and the filtrate was concentrated
in vacuo and poured into water. The precipitate was collected by
filtration and washed with Et.sub.2O to provide
6-(5-amino-2-chloro-4-fluoro-phenyl)-8-methyl-2-methysulfanyl-8H-pyrido[2-
,3-d]pyrimidin-7-one (2.9 g, 64% yield). .sup.1H NMR (400 MHz,
CDCl.sub.3): .delta. 8.59 (s, 1H), 7.58 (s, 1H), 7.09 (d, J=10.4
Hz, 1H), 6.73 (d, J=9.2 Hz, 1H), 3.75 (s, 3H), 3.72 (br s, 2H),
2.62 (s, 3H); MS (ESI) m/z: 351.2 [M+H].sup.+.
Example A18
[0185] A solution of Example C2 (2.0 g, 10.2 mmol), Example D3 (2.3
g, 10.2 mmol) and KF/Al.sub.2O.sub.3 (40 wt %, 4 g, 27 mmol) in
anhydrous DMAc (50 mL) was stirred at RT for 10 min. The reaction
mixture was poured into water and extracted with EtOAc (3.times.100
mL). The combined organic layers were washed with brine, dried
(Na.sub.2SO.sub.4), concentrated in vacuo and purified by silica
gel chromatography to give
6-(5-amino-2-chloro-4-fluorophenyl)-8-ethyl-2-(methylthio)pyrido[2,3-d]py-
rimidin-7(8H)-one (2.5 g, 67.6% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6), .delta. 8.89 (s, 1H), 7.91 (s, 1H), 7.23 (d, J=11.1
Hz, 1H), 6.75 (d, J=9.3 Hz, 1H), 5.40 (s, 2H), 4.35 (q, J=6.6 Hz,
2H), 2.59 (s, 3H), 1.22 (t, J=6.6 Hz, 3H); MS (ESI) m/z: 365.2
[M+H].sup.+.
Example A19
[0186] Example C4 (1 g, 4.2 mmol) in DMAc (10 mL), ethyl
(3-amino-4-fluoro-phenyl)-acetate (0.83 g, 4.2 mmol) and
KF/Al.sub.2O.sub.3 (40 wt %, 2 g, 34 mmol) in DMAc (10 mL) were
combined by the procedure of Example A17 to provide
6-(3-amino-4-fluorophenyl)-8-cyclopentyl-2-(methylthio)pyrido[2,3-d]pyrim-
idin-7(8H)-one (1 g, 64% yield). .sup.1H NMR (400 MHz, CDCl.sub.3):
.delta. 8.63 (s, 1H), 7.60 (s, 1H), 7.13 (dd, J=8.4, 2.0 Hz, 1H),
7.03 (dd, J=10.8, 8.4 Hz, 1H), 6.92 (m, 1H), 6.05 (m, 1H), 2.64 (s,
3H), 2.41-2.32 (m, 2H), 2.13-2.05 (m, 2H), 1.95-1.87 (m, 2H),
1.72-1.65 (m, 2H); MS (ESI) m/z: 371.0 [M+H].sup.+.
Example A20
[0187] To a solution of Example A10 (1.30 g, 3.93 mmol) in ethanol
(20 mL) was placed Raney Nickel.RTM. (50% slurry in water, 5.08 g,
43.3 mmol). The reaction mixture was refluxed overnight. The
mixture was filtered through Celite and washed with EtOH. The
combined filtrates were evaporated. The residue was treated with
EtOAc and the solid was filtered to obtain
6-(5-amino-4-fluoro-2-methylphenyl)-8-methylpyrido[2,3-d]pyrrid-
in-7(8H)-one (0.65 g, 58% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.10 (s, 1H), 9.08 (s, 1H), 7.91 (s, 1H),
6.90 (d, J=12.8 Hz, 1H), 6.61 (d, J=9.2 Hz, 1H), 4.00 (brs, 2H),
3.67 (s, 3H), 1.97 (s, 3H); MS (ESI) m/z: 285.0 (M+H.sup.+).
Example A21
[0188] Example C4 (2 g, 8.4 mmol) and Example D1 (1.78 g, 8.4 mmol)
were combined by the procedure of Example A19 to give
6-(5-amino-4-fluoro-2-methylphenyl)-8-cyclopentyl-2-(methylthio)pyrido[2,-
3-d]pyrimidin-7(8H)-one (0.9 g, 27% yield). .sup.1H NMR (400 MHz,
CDCl.sub.3): .delta. 8.53 (s, 1H), 7.39 (s, 1H), 6.82 (d, J=11.6
Hz, 1H), 6.59 (d, J=8.8 Hz, 1H), 5.98 (m, 1H), 2.57 (s, 3H), 2.26
(m, 2H), 2.03-1.97 (m, 5H), 1.85-1.83 (m, 2H), 1.62-1.60 (m, 2H);
MS (ESI) m/z: 385.0 [M+H].sup.+.
Example A22
[0189] Example A25 (2.0 g, 6.3 mmol) in methanol (50 mL) was
hydrogenated (45 psi) overnight at 50.degree. C. in the presence of
10% Pd(OH).sub.2 (Pearlman's catalyst, 0.5 g, 0.35 mmol). The
reaction mixture was filtered, concentrated under reduced pressure
and purified by silica gel column chromatography to provide
3-(3-amino-4-fluorophenyl)-1-ethyl-1,6-naphthyridin-2(1H)-one (0.81
g, 45% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.91
(s, 1H), 8.54 (d, J=6.0 Hz, 1H), 8.06 (s, 1H), 7.51 (d, J=6.4 Hz,
1H), 7.14 (dd, J=8.8, 2.0 Hz, 1H), 7.02 (dd, J=11.6, 8.4 Hz, 1H),
6.81 (m, 1H), 5.18 (s, 2H), 4.27 (q, 7.2 Hz, 2H), 1.21 (t, J=7.2
Hz, 3H), MS (ESI) m/z (M+H.sup.+): 284.2.
Example A23
[0190] A steel bomb was charged with Example A25 (2.5 g, 7.8 mmol)
and 4-methoxy-benzylamine (20 mL). The bomb was sealed and the
mixture was heated to 180.degree. C. for 6 hours. The cooled
reaction mixture was poured into a solution of AcOH (15 mL) in
ice-water (100 mL) and then extracted with EtOAc (3.times.100 mL).
The combined extracts were washed with brine (3.times.50 mL), dried
(MgSO.sub.4) and concentrated in vacuo. The crude product was
purified by silica gel column chromatography to provide
7-(4-methoxybenzylamino)-3-(3-amino-4-fluorophenyl)-1-ethyl-1,6-n-
aphthyridin-2(1H)-one (2.8 g, 85% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.39 (s, 1H), 7.76 (s, J=6.0 Hz, 1H), 7.45
(br s, 1H), 7.28 (d, J=7.6 Hz, 2H), 7.07 (d, J=8.0 Hz, 1H), 6.96
(m, 1H), 6.86 (d, J=8.4 Hz, 2H), 6.74 (m, 1H), 6.27 (s, 1H), 5.08
(s, 2H), 4.46 (d, J=5.6 Hz, 2H), 4.08 (q, J=7.2, 14.0 Hz, 2H), 3.69
(s, 3H), 1.12 (t, J=7.2 Hz, 3H), MS (ESI) m/z 419.3
(M+H.sup.+).
[0191] To a solution of TFA in CH.sub.2Cl.sub.2 (10%, 50 mL) was
added
3-(3-amino-4-fluoro-phenyl)-1-ethyl-7-(4-methoxy-benzylamino)-1H-[1,6]nap-
hthyridin-2-one (2.0 g, 4.78 mmol). The resulting mixture was
stirred at 50.degree. C. overnight. The reaction mixture was poured
saturated aq NaHCO.sub.3 solution (100 mL), and was extracted with
CH.sub.2Cl.sub.2 (3.times.75 mL). The combined organic layer was
dried (MgSO.sub.4) and concentrated in vacuo. The residue was
purified by silica gel column chromatography to give
7-amino-3-(3-amino-4-fluorophenyl)-1-ethyl-1,6-naphthyridin-2(1H)-one
(0.45 g, 32% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
8.35 (s, 1H), 7.76 (s, 1H), 7.09 (dd, J=9.0, 2.1 Hz, 1H), 6.97 (dd,
J=11.4, 8.4 Hz, 1H), 6.75 (m, 1H), 6.44 (s, 2H), 6.31 (s, 1H), 5.09
(s, 2H), 4.08 (q, J=7.2 Hz, 2H), 1.20 (t, J=7.2 Hz, 3H), MS (ESI)
m/z (M+H.sup.+): 299.3.
Example A24
[0192] Using the 2-step procedure of Example A23, Example A25 (0.85
g, 2.7 mmol) and 4-methoxybenzylmethylamine (10 mL) were combined
to provide
3-(3-amino-4-fluorophenyl)-1-ethyl-7-(methylamino)-1,6-naphthyridin-2(1H)-
-one (0.45 g, 32% yield, 2 steps). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 8.40 (s, 1H), 7.77 (s, 1H), 7.11 (d, J=9.0
Hz, 1H), 6.95 (m, 2H), 6.76 (m, 1H), 6.19 (s, 1H), 5.09 (s, 2H),
4.14 (m, 2H), 2.85 (br s, 3H), 1.20 (t, J=6.0, 3H); MS (ESI) m/z
(M+H.sup.+): 313.3.
Example A25
[0193] A solution of Example C5 (6.0 g, 0.033 mol), ethyl
2-(3-amino-4-fluorophenyl)acetate (6.4 g, 0.033 mol) and
K.sub.2CO.sub.3 (9.17 g, 0.066 mol) in DMF (100 mL) was heated to
80.degree. C. overnight. The reaction mixture was poured into the
water and extracted with EtOAc (3.times.200 mL). The combined
extracts were washed with saturated brine (3.times.100 mL), dried
(MgSO.sub.4), concentrated in vacuo and purified by chromatography
to provide
3-(3-amino-4-fluorophenyl)-7-chloro-1-ethyl-1,6-naphthyridin-2(1H)-one
(7.0 g, 67.9% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.75 (s, 1H), 8.07 (s, 1H), 7.67 (s, 1H), 7.13 (dd, J=8.8, 2.0 Hz,
1H), 7.02 (dd, J=11.6, 8.4 Hz, 1H), 6.80 (m, 1H), 5.20 (s, 2H),
4.25 (q, J=6.8 Hz, 2H), 1.19 (t, J=6.8 Hz, 3H; MS (ESI) m/z: 318.2
[M+H].sup.+.
Example A26
[0194] Example A11 (1.36 g, 4.28 mmol, 1.00 eq),
4-methoxy-N-methylbenzylanine (0.971 g, 6.42 mmol, 1.50 eq) and DBU
(0.960 ml, 6.42 mmol, 1.50 eq) were combined in NMP (20 ml) and
stirred with heating at 180.degree. C. under Ar overnight. The
completed reaction was cooled to RT and poured onto H.sub.2O (200
mil). Solids immediately separated which were collected by
filtration and rinsed very well with H.sub.2O. The solids were
dried on the filter to dampness and then dissolved in EtOAc. The
solution was dried (MgSO.sub.4), filtered and evaporated to afford
7-((4-methoxybenzyl)(methyl)amino)-3-(5-amino-4-fluoro-2-methylphenyl)-1--
methyl-1,6-naphthyridin-2(1H)-one (1.86 g, 100% yield) as a brittle
brown foam which was used as is in the next reaction. .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 8.45 (s, 1H), 7.63 (s, 1H), 7.16
(d, J=8.8 Hz, 2H), 6.85 (d, J=8.8 Hz, 2H), 6.86-6.82 (m, 1H), 6.57
(d, J=9.6 Hz, 1H), 6.29 (s, 1H), 4.88 (brs, 2H), 4.85 (s, 2H), 3.69
(s, 3H), 3.52 (s, 3H), 3.07 (s, 3H), 1.94 (s, 3H); MS (ESI) m/z:
433.3 (M+H.sup.+).
[0195]
7-((4-methoxybenzylmethyl)amino)-3-(5-amino-4-fluoro-2-methylphenyl-
)-1-methyl-1,6-naphthyridin-2(1H)-one (1.86 g, 4.3 mmol, 1.0 eq)
and CF.sub.3CO.sub.2H (9.5 ml, 13.8 g, 121 mmol, 28 eq) were
combined and stirred at RT overnight. The completed reaction was
treated slowly with 2M Na.sub.2CO.sub.3 until the mixture was just
faintly basic. The resulting suspension was stirred at RT for 1 h.
The solids were collected by filtration, washed thoroughly with
H.sub.2O, dried partially in the air and then under high vacuum at
65.degree. C. The crude product was purified by flash column
chromatography (100% EtOAc to 25% THF/EtOAc) to afford
3-(5-amino-4-fluoro-2-methylphenyl)-1-methyl-7-(methylamino)-1,6-n-
aphthyridin-2(1H)-one (0.86 g, 64% yield) as an off-white solid.
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.35 (s, 1H), 7.58 (s,
1H), 6.99 (q, J=4.8 Hz, 1H), 6.56 (d, J=12.0 Hz, 1H), 6.56 (d,
J=9.2 Hz, 1H), 6.15 (s, 1H), 4.87 (brs, 2H), 3.48 (s, 3H), 2.84 (d,
J=5.2 Hz, 3H), 1.94 (s, 3H); MS (ESI) m/z: 313.2 (M+H.sup.+).
Example A27
[0196] A solution of Example A11 (2.2 g, 6.9 mmol) in
4-methoxybenzylamine (30 ml) was refluxed at 140.degree. C. for two
hours. After cooling to RT, the reaction mixture was poured into
20% aq. solution of acetic acid and stirred for 30 min. The mixture
was filtered to provide
7-(4-methoxybenzylamino)-3-(5-amino-4-fluoro-2-methylphenyl)-1-methyl-1,6-
-naphthyridin-2(1H)-one (2.3 g, 79% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 8.81 (s, 1H), 7.99 (s, 1H), 7.81-7.78 (d,
J=9 Hz, 2H), 7.35-7.32 (d, J=9 Hz, 2H), 7.26 (d, J=12 Hz, 1H), 7.14
(d, J=9 Hz, 1H), 6.79 (s, 1H), 5.05-5.02 (d, J=9 Hz, 2H), 4.86 (m,
1H), 4.20 (s, 3H), 3.85 (s, 3H), 2.52 (s, 3H); MS (ESI) m/z: 419.1
[M+H].
[0197] Trifluoroacetic acid (2 mL, 26.9 mmol) was added to a
solution of
7-(4-methoxybenzylamino)-3-(5-amino-4-fluoro-2-methylphenyl)-1-methyl-1,6-
-naphthyridin-2(1H)-one (0.8 g, 1.9 mmol) in DCM (10 mL) and the
reaction mixture was refluxed at 50.degree. C. for 2 hour. After
cooling to RT, the reaction mixture was washed with water and the
combined aqueous layers were neutralized with saturated aq
NaHCO.sub.3 to pH 7-8. Then the aqueous layer was extracted with
EtOAc (3.times.50 mL), the extracts were dried (Na.sub.2SO.sub.4)
and concentrated to give
7-amino-3-(5-amino-4-fluoro-2-methylphenyl)-1-methyl-1,6-naphthyridin-2(1-
H)-one (0.3 g, 53% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 8.29 (s, 1H), 7.57 (s, 1H), 6.83 (d, J=12.4 Hz, 1H), 6.56
(d, J=9.6 Hz, 1H), 6.48 (s, 2H), 6.24 (s, 1H), 4.87 (s, 2H), 3.45
(s, 3H), 1.94 (s, 3H); MS (ESI) m/z: 299.0 [M+H].sup.+.
Example A28
[0198] Example D3 (3 g, 12.9 mmol), Example C3 (2.2 g, 12.9 mmol)
and KF/Al.sub.2O.sub.3 (40%, 6 g, 41 mmol) were combined in DMAc
(40 mL) and the resultant mixture was stirred at RT for about 1
hour. The reaction mixture was filtered and the filtrate was
concentrated in vacuo. The residue was washed with Et.sub.2O to
give
3-(5-amino-2-chloro-4-fluorophenyl)-7-chloro-1-methyl-1,6-naphthyridin-2(-
1H)-one (2.6 g, 59.6% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 8.74 (s, 1H), 8.00 (s, 1H), 7.63 (s, 1H), 7.23 (d, J=11.2
Hz, 1H), 6.75 (d, J=9.2 Hz, 1H), 5.40 (s, 2H), 3.60 (s, 3H); MS
(ESI) m/z: 338.1[M+H].sup.+.
[0199] A mixture of
3-(5-amino-2-chloro-4-fluorophenyl)-7-chloro-1-methyl-1,6-naphthyridin-2(-
1H)-one (2.5 g, 7.4 mmol) and 4-methoxy-N-methylbenzylamine (4 mL)
was heated to 180.degree. C. under N.sub.2 for about 3 hour. After
cooling, the reaction mixture was diluted with Et.sub.2O. The
precipitate was filtered, washed with water, and dried to give
7-((4-methoxybenzyl)(methyl)amino)-3-(5-amino-2-chloro-4-fluorophenyl)-1--
methyl-1,6-naphthyridin-2(1H)-one (3 g, 89% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 8.47 (s, 1H), 7.77 (s, 1H) 7.22
(m, 2H), 7.17 (d, J=8.0 Hz, 2H), 6.86 (d, J=8.4 Hz, 2H), 5.86 (d,
J=9.6 Hz, 1H), 6.30 (s, 1H), 5.32 (s, 2H) 4.87 (s, 1H), 3.72 (s,
3H), 3.52 (s, 3H), 3.09 (s, 3H); MS (ESI) m/z:
453.2[M+H].sup.+.
[0200] A solution of
7-((4-methoxybenzyl)(methyl)aino)-3-(5-amino-2-chloro-4-fluorophenyl)-1-m-
ethyl-1,6-naphthyridin-2(1H)-one (3 g, 6.6 mmol) in
CH.sub.2Cl.sub.2 (50 mL) was treated with TFA (20 mL) and the
mixture was heated to reflux overnight. The mixture was
concentrated under reduced pressure, the residue was dissolved in
10% aq. of HCl (50 mL) and the aqueous layer was washed with EtOAc.
The aqueous layer was neutralized with NaHCO.sub.3 aq. solution to
pH 8, and then extracted with EtOAc (3.times.50 mL). The combined
organics were washed with brine, dried (Na.sub.2SO.sub.4) and
concentrated in vacuo to give
3-(5-amino-2-chloro-4-fluorophenyl)-1-methyl-7-(methylamino)-1,6-naphthyr-
idin-2(1H)-one (1.6 g, 72% yield) .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 8.36 (s, 1H), 7.66 (s, 1H), 7.17 (d, J=10.8
Hz, 1H), 7.05 (m, 1 H), 6.71 (d, J=9.6 Hz, 1H), 6.15 (s, 1H), 5.30
(s, 2H), 3.47 (s, 3H), 3.42 (s, 1H), 2.84 (d, J=4.4 Hz, 3H); MS
(ESI) m/z: 333.1 [M+H].sup.+
Example A29
[0201] Example C3 (2 g, 9.3 mmol), Example D2 (1.6 g, 9.3 mmol) and
KF/Al.sub.2O.sub.3 (40%, 5 g, 34.4 mmol) were combined in DMAc and
stirred for 10 min. The reaction mixture was poured into water and
extracted with ethyl acetate. The combined organic layers were
washed with brine, dried (Na.sub.2SO.sub.4) and concentrated in
vacuo. The residue was purified by chromatography to give
3-(5-amino-2,4-difluorophenyl)-7-chloro-1-methyl-1,6-naphthyridin-2(1H)-o-
ne (2 g, 68% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
8.41 (s, 1H), 7.73 (s, 1H), 7.06-7.03 (m, 1H), 6.81-6.75 (m, 1H),
6.15 (s, 1H), 4.98 (s, 2H), 3.48 (s, 3H); MS (ESI) m/z: 322.7
[M+H].sup.+.
[0202]
3-(5-Amino-2,4-difluorophenyl)-7-chloro-1-methyl-1,6-naphthyridin-2-
(1H)-one (2.4 g, 7.5 mmol) and 4-methoxy-N-methylbenzylamine (10
mL) were combined in a sealed vessel and heated to 200.degree. C.
overnight. The volatiles were removed in vacuo and the residue was
purified by column chromatography to give
7-((4-methoxybenzyl)(methyl)amino)-3-(5-amino-2,4-difluorophenyl)-1-methy-
l-1,6-naphthyridin-2(1H)-one (3 g, 91% yield), which was used in
the next step without further purification.
[0203] To a solution of
7-((4-methoxybenzyl)(methyl)amino)-3-(5-amino-2,4-difluorophenyl)-1-methy-
l-1,6-naphthyridin-2(1H)-one (3 g, 6.8 mmol) in DCM (100 mL) was
added CF.sub.3COOH (20 mL) and the resulting mixture was stirred at
25.degree. C. for 6 h. Water was added and the mixture was
extracted with water. The combined aqueous layers were neutralized
with NH.sub.3.H.sub.2O to pH 7. The precipitate was collected by
filtration and dried to give
3-(5-amino-2,4-difluorophenyl)-1-methyl-7-(methylamino)-1,6-naphthyridin--
2(1H)-one (661 mg, 30% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 8.39 (s, 1H), 7.78 (s, 1H), 7.08-6.93 (m, 2H), 6.80 (dd,
J=10.2, 8.1 Hz, 1H), 6.16 (s, 1H), 5.00 (s, 2H), 3.50 (s, 3H), 2.84
(d, J=4.8 Hz, 3H); MS (ESI) m/z: 317.0 [M+H].sup.+.
Example A30
[0204] In a manner analogous to that described for the preparation
of Example A26, Example A34 (1.61 g, 4.85 mmol) was converted to
3-(5-amino-4-fluoro-2-methylphenyl)-1-ethyl-7-(methylamino)-1,6-naphthyri-
din-2(1H)-one (1.16 g, 73% yield for two steps). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 8.36 (s, 1H), 7.58 (s, 1H), 6.94-6.92
(brm, 1H), 6.83 (d, J=12.0 Hz, 1H), 6.57 (d, J=9.6 Hz, 1H), 4.87
(brs, 2H), 4.12 (q, J=6.8 Hz, 2H), 2.84 (d, J=4.8 Hz, 3H), 1.94 (s,
3H), 1.185 (t, J=7.2 Hz, 3H); MS (ESI) m/z: 327.2 (M+H).
Example A31
[0205] Example A34 (2.5 g, 7.5 nmol) and 4-methoxybenzylamine (30
ml) were combined by the 2-step procedure of Example A27 to provide
7-amino-3-(5-amino-4-fluoro-2-methylphenyl)-1-ethyl-1,6-naphthyridin-2(1H-
)-one (0.9 g, 46% yield, 2 steps). .sup.1H-NMR (300 MHz,
DMSO-d.sub.6): .delta. 8.30 (s, 1H), 7.56 (s, 1H), 6.83 (d, J=12.3
Hz, 1H), 6.57 (d, J=9.6 Hz, 1H), 6.40 (s, 2H), 6.32 (s, 1H), 4.85
(s, 2H), 4.07 (q, J=6.9 Hz, 2H), 1.94 (s, 3 H), 1.19 (t, J=6.9 Hz,
3H); MS (ESI) m/z: 313.3 [M+H]*.
Example A32
[0206] Example C5 (3.5 g, 19 mmol), Example D3 (4.4 g, 19 mmol) and
KF/Al.sub.2O.sub.3 (40 wt %, 10 g, 69 mmol) were combined by the
procedure of Example A17 to give
3-(5-amino-2-chloro-4-fluorophenyl)-7-chloro-1-ethyl-1,6-naphthyridin-2(1-
H)-one (4 g, 60% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 8.75 (s, 1H), 8.01 (s, 1H), 7.72 (s, 1H), 7.24 (d, J=10.8
Hz, 1H), 6.76 (d, J=9.2 Hz, 1H), 5.40 (s, 2H), 4.26-4.24 (m, 2H),
1.18 (t, J=6.8 Hz, 3H); MS (ESI) m/z: 352.1 [M+H].sup.+.
Example A33
[0207] Using the procedure of Example A28, steps 2 and 3, Example
A32 (3 g, 8.5 mmol) was converted to
3-(5-amino-2-chloro-4-fluorophenyl)-1-ethyl-7-(methylamino)-1,6-naphthyri-
din-2(1H)-one (1 g, 32% yield over two steps). .sup.1HNMR (400 MHz,
DMSO-d.sub.6): .delta. 8.46 (s, 1H), 7.75 (s, 1H), 7.1 (d, J=11.2
Hz, 1H), 6.73 (d, J=9.6 Hz, 1H), 6.43 (s, 1H), 4.95 (br s, 1H),
4.14 (m, 2H), 2.92 (s, 3H), 1.14 (t, J=6.8 Hz, 3H); MS (ESI) m/z:
347.2 [M+H].sup.+.
Example A34
[0208] Example D1 (1.32 g, 6.25 mmol, 1.00 eq), Example C5 (1.15 g,
6.25 mmol, 1.00 eq) and KF/Al.sub.2O.sub.3 (40.00 wt %, 9.08 g,
62.5 mmol, 10.00 eq) were combined in DMAc (35 ml) and sonicated
for 2 h. The completed reaction was filtered through Celite,
rinsing forward with EtOAc (3.times.35 ml). The combined filtrates
were washed with H.sub.2O (3.times.50-75 ml). The combined aqueous
layers were extracted with EtOAc (1.times.). The combined organics
were washed with brine (2.times.), dried (MgSO.sub.4), filtered and
evaporated. The crude product was purified by flash column
chromatography (5% EtOAc/hexanes to 100% EtOAc) to afford
3-(5-amino-4-fluoro-2-methylphenyl)-7-chloro-1-ethyl-1,6-naphth-
yridin-2(1H)-one (1.61 g, 78% yield) as a brittle foam. MS (ESI)
m/z: 332.0 (M+H), 334.0 (M+2+H).
Example A35
[0209] A solution of ethyl 4,6-dichloronicotinate (16 g, 73 mmol),
aniline (8.2 g, 88 mmol) and cone. HCl (0.5 mL) in EtOH (100 mL)
was heated at reflux overnight. The solvent was removed under
reduced pressure. Water was added and the solution was basified to
pH 8 and extracted with EtOAc. The combined extracts were washed
with brine, dried (MgSO.sub.4), and concentrated in vacuo. The
residue was purified by chromatography to give ethyl
6-chloro-4-(phenylamino)nicotinate (10 g, 50% yield). .sup.1H NMR
(40 MHz, DMSO-d.sub.6): .delta. 9.73 (s, 1H), 8.67 (s, 1H),
7.50-7.46 (m, 2H), 7.36-7.31 (m, 3H), 6.78 (s, 1H), 4.37 (q, J=7.2
Hz, 2H), 1.35 (t, J=7.2 Hz, 3H).
[0210] A solution of ethyl 6-chloro-4-(phenylamino)nicotinate (19
g, 89 mmol) in anhydrous THF (40 mL) was added dropwise to a
0.degree. C. suspension of LiAlH.sub.4 (8.5 g, 223 mmol) in
anhydrous THF (80 mL). After complete addition, the reaction
mixture was stirred at RT for 3 h. The mixture was quenched by the
addition of 10% aq NaOH (8.5 mL) and water (8.5 mL). The solids
were removed by filtration and the organic phase was concentrated
in vacuo to provide (6-chloro-4-(phenylamino)pyridin-3-yl)methanol
(12 g, 80% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.09 (s, 1H), 8.08 (s, 1H), 7.39-7.10 (m, 5H), 6.73 (s, 1H), 5.37
(s, 1H), 4.52 (s, 2H).
[0211] MnO.sub.2 (39 g, 448 mmol) was added to a solution of
(6-chloro-4-phenylamino-pyridin-3-yl)-methanol (13 g, 56 mmol) in
CH.sub.2Cl.sub.2 (100 ml) and the mixture was stirred at RT
overnight. The solids was removed by filtration and the filtrate
was concentrated to give 6-chloro-4-(phenylamino)nicotinaldehyde
(11 g, 86% yield). .sup.1H-NMR (400 MHz, DMSO-d.sub.6): .delta.
10.18 (s, 1 H), 9.99 (s, 1H), 8.62 (s, 1H), 7.49-7.31 (m, 5H), 6.80
(s, 1H).
[0212] A mixture of 6-Chloro-4-(phenylamino)nicotinaldehyde (3 g,
13 mmol), ethyl 2-(3-amino-4-fluorophenyl)acetate (2.6 g, 13 mmol),
and KF/Al.sub.2O.sub.3 (40 wt %, 10 g, 69 mmol) in DMAc (30 mL) was
stirred at RT for 2 hours. The solids were removed by filtration
and the filtrtate was concentrated in vacuo. Recrystallization
(EtOAc) provided
3-(3-amino-4-fluorophenyl)-7-chloro-1-phenyl-1,6-naphthyridin-2(1H)-one
(2.6 g, 55% yield). .sup.1H NMR (400 MHz, DMSO-dC): .delta. 8.81
(s, 1H), 8.20 (s, 1H), 7.62-7.56 (m, 3H), 7.40 (d, J=7.2 Hz, 2H),
7.13 (d, J=7.6 Hz, 1H), 7.02 (t, J=10.0 Hz, 1H), 6.82 (m, 1H), 6.26
(s, 1H), 5.19 (s, 2H); MS (ESI) m/z: 366.2 [M+H].sup.+.
Example A36
[0213] A suspension of Example A35 (2.5 g, 7 mmol) in
4-methoxybenzylmethylamine (5 mL) was heated at 160.degree. C. for
3 h. The reaction mixture was cooled to RT and diluted with ether.
The resultant white precipitate was collected by filtration and
dried to obtained
7-((4-methoxybenzyl)(methyl)amino)-3-(3-amino-4-fluorophenyl)-1--
phenyl-1,6-naphthyridin-2(1H)-one (3 g, 77%), which was used in the
next step without further purification.
[0214] A suspension of
7-((4-methoxybenzyl)(methyl)amino)-3-(3-amino-4-fluoroplienyl)-1-phenyl-1-
,6-naphthyridin-2(1H)-one (3.0 g, 6 mmol) in mixture of
CF.sub.3CO.sub.2H and CH.sub.2Cl.sub.2 (3:7, 30 mL) was heated at
reflux overnight. Then the solvent was removed under reduced
pressure and the residue was recrystallized (EtOAc-petroleum ether)
to give
3-(3-amino-4-fluorophenyl)-7-(methylamino)-1-phenyl-1,6-naphthyridin-2(1H-
)-one (1 g, 45% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 8.43 (s, 1H), 7.88 (s, 1H), 7.60-7.50 (m, 3H), 7.31-7.29
(m, 2H), 7.10-6.75 (m, 4H), 5.26 (s, 1H), 5.08 (s, 2H), 2.63 (br s,
3H); MS (ESI) m/z: 361.3 [M+H].sup.+.
Example A37
[0215] A mixture of Example A60 (1.1 g, 3.7 mmol) and 28% ammonium
hydroxide (6.0 mL) in a sealed-vessel was heated at 160.degree. C.
for 2 h. After cooling to RT, the reaction mixture was filtered and
the solid was washed with cold EtOAc to provide
2-amino-6-(3-aminophenyl)-8-methylpyrido[2,3-d]pyrimidin-7(8H)-one
(440 mg, 45% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): 8.61 (s,
1H), 7.77 (s, 1H), 7.24 (br s, 2H), 7.02 (t, J=8.0 Hz, 1H), 6.84
(s, 1H), 6.73 (d, J=7.8 Hz, 1H), 6.51 (d, J=8.0 Hz, 1H), 5.05 (br
s, 2H), 3.54 (s, 3H). MS (ESI) m/z: 268.1 (M+H.sup.+).
Example A38
[0216] Using a procedure analogous to Example A28, Example A55 was
converted to
3-(3-amino-4-fluorophenyl)-1-methyl-7-(methylamino)-1,6-naphthyridin-2(1H-
)-one (1.6 g, 59% yield). .sup.1HNMR (300 MHz, DMSO-d.sub.6):
.delta. 8.39 (s, 1H), 7.78 (s, 1H), 7.07 (d, J=8.7 Hz, 1H),
7.05-6.93 (m, 2H), 6.75 (m, 1H), 6.13 (s, 1H), 5.10 (s, 2H), 3.50
(s, 3H), 2.84 (d, J=4.8 Hz, 3H); MS (ESI) m/z: 299.2
(M+H.sup.+).
Example A39
[0217] Using a procedure analogous to Example A1, Example A10
(1.500 g, 4.54 mmol, 1.0 eq), 3-chloroperbenzoic acid (70 wt %, 269
mg, 1.090 mmol, 1.20 eq) and 2.0M MeNH.sub.2 in THF (11.400 ml,
22.80 mmol, 5.00 eq) were combined to afford crude
6-(5-amino-4-fluoro-2-methylpheyll)-8-methyl-2-(methylamino)pyrido[2,3-d]-
pyrimidin-7(8H)-one (1.56 g, 105% yield) as an orange foam which
was used as is. MS (ESI) m/z: 314.3 (M+H).
Example A40
[0218] In dimethylacetamide (30 mL) was placed
4-aminoncotinaldehyde (1.50 g, 12.3 mmol) and ethyl
2-(3-amino-4-fluorophenyl)acetate (2.42 g, 12.3 mmol). To this was
added 40% KF/alumina (8.92 g, 61.4 mmol) and the mixture was
stirred at RT for 48 hrs. The mixture was filtered through a Celite
pad and the pad was washed with ethyl acetate (2.times.30 mL). The
filtrate was diluted with water (100 mL) and the biphasic mixture
was set aside to precipitate.
[0219] The solid was collected by filtration, washed with water
(2.times.25 mL) and dried on high vac line at 65.degree. C. for 3
hrs in the abderhalden and identified as
3-(3-amino-4-fluorophenyl)-1,6-naphthyridin-2(1H)-one (1.55 g, 49%
yield). Used as is. MS (ESI) m/z: 256.0 (M+H.sup.+).
Example A41
[0220] Example C2 (5.0 g, 25 mmol), Example D1 (5.8 g, 27 mmol) and
Cs.sub.2CO.sub.3 (22.7 g, 70 mmol) were combined DMF (150 mL) and
stirred at 60.degree. C. overnight. The resulting mixture was
concentrated under reduced pressure and the residue was washed with
ethyl ether to give
6-(5-amino-4-fluoro-2-methylphenyl)-8-ethyl-2-(methylthio)pyrido[2,3-d]py-
rimidin-7(8H)-one (3.59 g, 42% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.88 (s, 1H), 7.82 (s, 1H), 6.89 (d, J=12.4
Hz, 1H), 6.61 (d, J=9.6 Hz, 1H), 4.96 (s, 2H), 4.38 (q, J=6.8 Hz,
2H), 2.61 (s, 3H), 1.96 (s, 3H), 1.24 (t, J=6.8 Hz, 3H); MS (ESI)
m/z: 345.2 [M+H].sup.+.
Example A42
[0221] Example C6 (4.2 g, 19.9 mmol), Example D1 (4.2 g, 20 mmol),
and Cs.sub.2CO.sub.3 (16.86 g, 51.74 mmol) were combined in DMF (80
mL) and heated at reflux overnight. The reaction mixture was poured
into water and the mixture was extracted with ethyl acetate. The
combined extracts were washed with brine, dried (Na.sub.2SO.sub.4),
and concentrated in vacuo. Purification by chromatography on silica
gel gave
6-(5-amino-4-fluoro-2-methylphenyl)-8-isopropyl-2-(methylthio)pyrido[2,3--
d]pyrimidin-7(8H)-one (1.47 g, 20% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.83 (s, 1H), 7.75 (s, 1H), 6.86 (d, J=12.4
Hz, 1H), 6.58 (d, J=9.2 Hz, 1H), 5.71 (m, 1H), 4.92 (s, 2H), 2.58
(s, 3H), 1.93 (s, 3H), 1.53 (d, J=7.2 Hz, 6H); MS (ESI) m/z: 359.0
[M+H].sup.+.
Example A43
[0222] Using a procedure analogous to Example A1, Example A10
(0.200 g, 0.605 mmol) and N',N'-dimethylpropane-1,3-diamine (0.378
ml, 3.03 mmol) were combined to afford
6-(5-amino-4-fluoro-2-methylphenyl)-2-(3-(dimethylamino)propylamino)-8-me-
thylpyrido[2,3-d]pyrimidin-7(8H)-one (0.076 g, 33% yield) as yellow
solid. MS (ESI) m/z: 385.2 (M+H.sup.+)
Example A44
[0223] In methylene chloride (50 mL) was placed
2-methyl-5-nitrobenzoic acid (3.00 g, 16.6 mmol) and 1 microdrop of
dimethylformamide. The solution was cooled to 0.degree. C. and to
this was added oxalyl chloride (3.15 g, 24.8 mmol). After 15
minutes the mixture was allowed to warm to RT and stirred a further
2 hours. The mixture evaporated at reduced pressure. This residue
was dissolved in THF (60 mL) and cooled to 0.degree. C. To this was
added the 2.00N TMS-diazomethane (18.6 mL, 37.3 nmol) and the
mixture stirred at 0.degree. C. for 5 hrs. The solution was
evaporated at reduced pressure and the new residue was treated with
benzyl alcohol (15 mL) and 2,4,6-collidine (10 mL) and warmed to
180.degree. C. for 15 min. After cooling to RT and diluting with
ethyl acetate (100 mL), the resulting solution was washed
successively with water (2.times.100 mL), 5% citric acid (100 mL,
till pH of aqueous phase is acidic), water (100 mL) and brine (100
mL).
[0224] The solvent was removed at reduced pressure and the
resultant oil was dried on the high vacuum line at 65.degree. C. to
remove most excess benzyl alcohol. The oil was purified by
chromatography (Biotage Si-40 column, 10-40% ethyl acetate/Hex-1398
mL) to give benzyl 2-(2-methyl-5-nitrophenyl)acetate as an oil
(2.465 g, 52% yield) which was used as is.
[0225] In a solution of THF:ethanol (1:1, 100 mL) was placed the
crude benzyl 2-(2-methyl-5-nitrophenyl)acetate (2.46 g, 8.62 mmol)
and ammonium chloride (4.61 g, 86.2 mmol). To this was added zinc
dust (5.64 g, 86.2 mmol) and the resulting slurry was stirred at RT
for 4 hrs. The slurry was filtered through Celite and washed with
ethanol (2.times.50 mL). The combined filtrates were evaporated at
reduced pressure to give an oily mass. This was dissolved in a
mixture of ethyl acetate (75 mL) and brine (75 mL). The organic
phase dried (Na.sub.2SO.sub.4) and evaporated at reduced pressure
to give benzyl 2-(5-amino-2-methylphenyl)acetate as an oil, which
appears to be 6:4 mix of product:non-homologated compound. Used as
is.
[0226] In dimethylacetamide (35 mL) was placed Example C1 (1.31 g,
7.13 mmol) and the crude benzyl 2-(5-amino-2-methylphenyl)acetate
(2.00 g, 5.09 mmol). To this was added KF/Alumina (11.1 g, 76.4
mmol) and the mixture sonicated at RT for 1.5 hrs. The reaction
mixture was diluted with CH.sub.2Cl.sub.2 (100 mL) and filtered
free of insolubles. The filtrate was washed with water (100 mL) and
brine (100 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo
to remove dimethylacetamide to give an oil. The oil was treated
with ethyl acetate (30 mL), forming a precipitate overnight. The
solid was collected by filtration, washed with ethyl acetate
(2.times.10 mL) and then dried in vacuo. The isolated solid was
warmed to reflux in methanol (15 mL), filtered and dried on high
vacuum line to give
6-(5-amino-2-methylphenyl)-8-methyl-2-(methylthio)pyrido[2,3-d]pyrimidin--
7(8H)-one (879 mg, 55% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 1.93 (s, 3H), 2.48 (s, 3H), 2.60 (s, 3H), 4.89 (br. s, 1H),
6.39 (s, 1H), 6.48-6.50 (m, 1H), 6.86-6.88 (m, 1H), 7.79 (s, 1H),
8.87 (s, 2H); MS (ESI) m/z: 313.0 (M+H.sup.+).
Example A45
[0227] Following the procedure of Example A60, Example C2 (0.42 g,
2.1 mmol), ethyl 2-(3-aminophenyl)acetate (0.38 g, 2.1 mmol), and
K.sub.2CO.sub.3 (0.44 g, 3.2 mmol) were combined to give
6-(3-aminophenyl)-8-ethyl-2-(methylthio)pyrido[2,3-d]pyrimidin-7(8H)-one
(0.44 g, 66% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.93 (s, 1H), 7.99 (s, 1H), 7.08 (t, J=8.0 Hz, 1H), 6.91 (t, J=2.0
Hz, 1H), 6.78 (dt, J=7.6, 1.2 Hz, 1H), 6.60 (m, 1H), 5.14 (s, 2H),
4.04 (q, J=7.2 Hz, 2H), 2.62 (s, 3H), 1.26 (t, J=3H); MS (ESI) m/z:
313.2 [M+H].sup.+.
Example A46
[0228] To stirring fuming HNO.sub.3 (15 mL) at -15.degree. C. was
added 2-bromo-4-fluorophenylacetic acid (10 g, 43 mmol) in portions
such that the internal temperature remained below -10.degree. C.
After completing the addition the reaction was stirred with wanning
to +5.degree. C. over 15 min. The mixture was poured onto ice (500
g). Product separated as a slightly sticky solid which on
manipulation with a spatula became powdery. The suspension was
stirred vigorously until the ice had completely melted. While still
very cold, the solids were collected by filtration, rinsed very
well with H.sub.2O (1 L). The solid was dried under vacuum to
afford 2-(2-bromo-4-fluoro-5-nitrophenyl)acetic acid (6.04 g, 51%
yield) as a pale yellow solid which was used as is in the next
reaction.
[0229] 2-(2-bromo-4-fluoro-5-nitrophenyl)acetic acid (6.04 g, 21.7
mmol) and cone. H.sub.2SO.sub.4 (1.2 mL) were combined in EtOH (100
mL) and stirred with heating at 85.degree. C. After 1.5 h, the
completed reaction was cooled to RT and concentrated as completely
as possible. The residue was dissolved in MTBE (50 mL) and washed
with H.sub.2O (2.times.), and brine (2.times.), dried (MgSO.sub.4),
filtered and evaporated to afford a dark orange oil. The crude was
purified by silica gel column chromatography to obtain ethyl
2-(2-bromo-4-fluoro-5-nitrophenyl)acetate (5.8 g, 87% yield).
[0230] Ethyl 2-(2-bromo-4-fluoro-5-nitrophenyl)acetate (1.00 g,
3.27 mmol), PdCl.sub.2 (PPh.sub.3).sub.2 (115 mg, 0.16 mmol), CuI
(44 mg, 0.23 mmol), and trimethylsilylacetylene (0.7 mL, 4.9 mmol)
were dissolved in Et.sub.3N (5 mL). The mixture was immediately
degassed by vacuum, and the flask was charged with N.sub.2. The
mixture was heated overnight at 50.degree. C. Water was added and
then the solution was extracted with EtOAc (3.times.). The organic
was washed with NH.sub.4Cl, brine and dried (MgSO.sub.4). The
solvent was removed and then the residue was purified by silica gel
column chromatography to obtain ethyl
2-(4-fluoro-5-nitro-2-(2-(trimethylsilyl)ethynyl)phenyl)acetate
(0.66 g, 62% yield).
[0231] To a stirring suspension of ethyl
2-(4-fluoro-5-nitro-2-(2-(trimethylsilyl)ethynyl)phenyl)acetate
(0.66 g, 2.04 mmol) in MeOH/THF (1:1, 20 mL) was added NH.sub.4Cl
(1.09 g, 20.4 mmol), followed by Zn dust (1.33 g, 20.4 mmol). After
stirring 1.5 h, the mixture was filtered through Celite, and rinsed
forward with MeOH. The combined filtrates were concentrated,
diluted with brine and extracted with THF (2.times.). The combined
organic layers were washed with brine (1.times.), dried
(MgSO.sub.4), filtered and concentrated to afford ethyl
2-(5-amino-4-fluoro-2-(2-(trimethylsilyl)ethynyl)phenyl)acetate
(0.54 g, 90% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
6.86 (d, J=12.0 Hz, 1H), 6.47 (d, J=8.8 Hz, 1H), 5.47 (brs, 2H),
3.88 (d, J=6.8 Hz, 2H), 3.43 (s, 2H), 1.00 (d, J=6.8 Hz, 3H), 0.00
(s, 9H); MS (ESI) m/z: 294.0 (M+H.sup.+).
[0232] To a solution of ethyl
2-(5-amino-4-fluoro-2-(2-(trimethylsilyl)ethynyl)phenyl)acetate
(0.30 g, 1.02 mmol) and Example C1 (0.19 g, 1.02 mmol) in 4 mL of
DMF was added cesium carbonate (0.87 g, 2.66 mmol) and then the
reaction mixture was stirred overnight at RT. The mixture was
diluted with water (50 ml) stirred, filtered and washed with water
to provide the crude product. The crude was filtered and dried
under vacuum to provide
6-(5-amino-2-ethynyl-4-fluorophenyl)-8-methyl-2-(methylthio)pyrido[2,3-d]-
pyrimidin-7(8H)-one (300 mg, 71% yield) which was used for the next
reaction. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.87 (s,
1H), 7.90 (s, 1H), 7.15 (d, J=12.0 Hz, 1H), 6.69 (d, J=9.2 Hz, 1H),
5.65 (s, 2H), 3.77 (s, 1H), 3.60 (s, 3H), 2.57 (s, 3H); MS (ESI)
m/z: 341.0 (M+H.sup.+).
[0233] Using a procedure analogous to Example A1,
6-(5-amino-2-ethynyl-4-fluorophenyl)-8-methyl-2-(methylthio)pyrido[2,3-d]-
pyrimidin-7(SH)-one (0.250 g, 0.734 mmol), MCPBA (0.217 g, 0.881
mmol) and 2 M methylamine (1.5 mL, 2.95 mmol) were combined to
obtain
6-(5-amino-2-ethynyl-4-fluorophenyl)-8-methyl-2-(methylamino)pyrido[2,3-d-
]pyrimidin-7(8H)-one (140 mg, 59% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.59 (s, 1H), 7.82 (m, 1H), 7.73 (s, 1H),
7.15 (d, J=12.0 Hz, 1H), 6.71 (d, J=9.2 Hz, 1H), 5.61 (s, 2H), 3.78
(s, 1H), 3.58 (s, 3H), 2.90 (d, J=4.4 Hz, 1H); MS (ESI) m/z: 324.2
(M+H.sup.+).
Example A47
[0234] Ethyl
2-(4-fluoro-5-nitro-2-(2-(trimethylsilyl)ethynyl)phenyl)acetate
(0.85 g, 2.6 mmol) and K.sub.2CO.sub.3 (3.6 g) were dissolved in
THF/MeOH (5:1, 30 mL) and the mixture was stirred overnight at RT.
The reaction mixture was diluted with Et.sub.2O and washed with
sat'd NH.sub.4Cl solution. The organic layer was dried
(MgSO.sub.4), filtered, and concentrated. The residue was purified
by silica gel column chromatography to obtain ethyl
2-(2-ethynyl-4-fluoro-5-nitrophenyl)acetic acid.
[0235] Ethyl 2-(2-ethynyl-4-fluoro-5-nitrophenyl)acetic acid and
conc. H.sub.2SO.sub.4 were combined in EtOH (5 mL) and stirred with
heating at 85.degree. C. After 4 h, the completed reaction was
cooled to RT and concentrated as completely as possible. The
residue was dissolved in MTBE (50 mL) and washed with HzO
(2.times.), and brine (2.times.), dried (MgSO.sub.4), filtered and
evaporated to afford desired product as a dark orange oil. The
crude was purified by silica gel column chromatography to obtain
ethyl 2-(2-ethynyl-4-fluoro-5-nitrophenyl)acetate (160 mg, 21%
yield). MS (ESI) m/z: 252.0 (M+H*).
[0236] Ethyl 2-(2-ethynyl-4-fluoro-5-nitrophenyl)acetate (160 mg,
0.64 mmol) was dissolved in MeOH (5 mL) and EtOAc (5 mL) and then
Pd--C (20 mg) was added. The reaction mixture was shaken in a Parr
hydrogenator (46 psi) overnight at RT. The reaction mixture was
filtered, washed with methanol, and concentrated to obtain ethyl
2-(5-amino-2-ethyl-4-fluorophenyl)acetate (135 mg, 93% yield). MS
(ESI) m/z: 226.2 (M+H.sup.+).
[0237] To a solution of ethyl
2-(5-amino-2-ethyl-4-fluorophenyl)acetate (135 mg, 0.6 mmol) and
Example C1 (110 mg, 0.6 mmol) in DMF (2 mL) was added cesium
carbonate (500 mg, 1.5 mmol) and stirred overnight at RT. The
reaction mixture was diluted with water (50 mL) stirred, filtered
and washed to provide the crude product. The crude product was
stirred in EtOH overnight at RT. The solid was filtered, washed and
dried to provide
6-(5-amino-2-ethyl-4-fluorophenyl)-8-methyl-2-(methylthio)pyrido[2,3-d]py-
rimidin-7(8H)-one (100 mg, 48% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6, major isomers): .delta. 8.87 (s, 1H), 7.81 (s, 1H),
6.91 (d, J=12.8 Hz, 1H), 6.54 (d, J=9.2 Hz, 1H), 4.98 (s, 2H), 3.63
(s, 3H), 2.60 (s, 3H), 2.26 (q, J=7.2 Hz, 2H), 0.97 (t, J=7.2 Hz,
3H), MS (ESI) m/z: 345.0 (M+H.sup.+).
Example A48
[0238] Ethyl 2-(2-bromo-4-fluoro-5-nitrophenyl)acetate (1.0 g, 3.27
mmol) and zinc cyanide (0.77 g, 6.54 mmol) were combined in DMF (8
mL), de-gassed under vacuum and backfilled with argon (4.times.).
Palladium tetrakis(triphenylphosphine) (380 mg, 0.32 mmol) was
added and the reaction was heated at 160.degree. C. under microwave
for 30 min. The solution was diluted with EtOAc and then the solid
was filtered. The filtrate was washed with brine (3.times.) and
dried (Na.sub.2SO.sub.4), concentrated in vacuo and the residue was
purified by silica gel column chromatography to obtain ethyl
2-(2-cyano-4-fluoro-5-nitrophenyl)acetate (0.3 g, 37% yield).
[0239] To a solution of ethyl
2-(2-cyano-4-fluoro-5-nitrophenyl)acetate in methanol and EtOAc
(1:1, 10 mL) was added 10% Pd/C. The solution was stirred under
H.sub.2 (1 atm) at RT for 3 days. The solution was filtered and
evaporated to obtain ethyl
2-(5-amino-2-cyano-4-fluorophenyl)acetate (0.21 g, 81% yield).
[0240] To a solution of ethyl
2-(5-amino-2-cyano-4-fluorophenyl)acetate (0.21 g, 0.95 mmol) and
Example C1 (0.17 g, 0.95 mmol) in 4 mL of DMF was added cesium
carbonate (0.80 g, 2.46 mmol) and then the reaction mixture was
stirred overnight at RT. The reaction mixture was diluted with
water (50 ml) stirred, filtered and washed with water to provide
the crude product. The crude was filtered and dried under vacuum to
provide
4-amino-5-fluoro-2-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d-
]pyrimidin-6-yl)benzonitrile (125 mg, 39% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 8.94 (s, 1H), 8.07 (s, 1H), 7.61 (d,
J=11.6 Hz, 1H), 6.82 (d, J=8.8 Hz, 1H), 6.35 (s, 2H), 3.65 (s, 3H),
2.62 (s, 3H); MS (ESI) m/z: 342.0 (M+H.sup.+).
Example A49
[0241] Using a procedure analogous to example A1, Example A59 (0.18
g, 0.52 mmol), MCPBA (0.1 g, 0.57 mmol) and 2 M Methylamine in THF
(1 ml) were combined to afford
6-(3-amin-4-fluorophenyl)-8-isopropyl-2-(methylamino)pyrido[2,3-d]pyrimid-
in-7(8H)-one as a light yellow solid (105 mg, 61% yield). .sup.1H
NMR (400 MHz, DMSO-d.sub.6): .delta. 8.57 (s, 1H), 7.72 (s, 1H),
7.06 (dd, J=8.8 Hz, 2.0 Hz, 1H), 6.97 (dd, J=11.2 Hz, 8.4 Hz, 1H),
6.72-6.68 (m, 1H), 5.77-5.74 (m, 1H), 5.11 (brs, 2H), 2.88 (d,
J=4.8 Hz, 3H), 1.57-1.51 (m, 6H); MS (ESI) m/z: 328.3
(M+H.sup.+).
Example A50
[0242] Using a procedure analogous to Example A1, Example A41 (0.6
g, 1.7 mmol) and 2M methylamine in THF (3 eq) were combined to
afford
6-(5-amino-4-fluoro-2-methylphenyl)-8-ethyl-2-(methylamino)pyrido[2,3-d]p-
yrimidin-7(8H)-one as a white solid (0.31, 54% yield). .sup.1H NMR
(400 MHz, Acetone-dr): .delta. 8.53 (s, 1H), 7.55 (s, 1H),
6.85-6.82 (m, 2H), 6.70 (d, J=9.6 Hz, 1H), 4.46-4.43 (m, 2H), 3.05
(d, J=4.8 Hz, 3H), 1.31-1.27 (m, 3H); MS (ESI) m/z: 328.0
(M+H.sup.+).
Example A51
[0243] Using a procedure analogous to Example A1, Example A42 (0.5,
1.4 mmol), MCPBA (0.26 g, 1.5 mmol) and 2 M methylamine in THF (3
eq) were combined to provide
6-(5-amino-4-fluoro-2-methylphenyl)-8-isopropyl-2-(methylamino)pyrido[2,3-
-d]pyrimidin-7(8H)-one as a foam (0.33 g, 69% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 8.62-8.54 (m, 1H), 7.72-7.69 (m,
1H), 7.54 (s, 1H), 6.84 (d, J=12.0 Hz, 1H), 6.57 (d, J=9.6 Hz, 1H),
5.74 (brs, 2H), 4.90 (brs, 2H), 2.88 (d, J=4.4 Hz, 1H), 1.94 (s,
3H), 1.56-1.50 (m, 6H); MS (ESI) m/z: 342.0 (M+H.sup.+).
Example A52
[0244] To a degassed solution of
6-bromo-8-isopropyl-2-(methylthio)pyrido[2,3-d]pyrimidin-7(8H)-one
(0.78 g, 2 mmol; J. Med. Chem., 48, 2371, 2005) in DME (10 ml) was
added Pd(PPh.sub.3).sub.4 (0.1 g, 5% mol),
4-fluoro-3-nitrophenylboronic acid (0.5 g, 3 mmol) and 2M
Na.sub.2CO.sub.3 solution (3 ml, 6 mmol) and the mixture was heated
to 80.degree. C. for 16 h. The mixture was poured into water (40
mL), and product was extracted with EtOAc (3.times.25 mL). The
combined organics were washed with brine, dried (Na.sub.2SO.sub.4)
and concentrated in vacuo afforded crude product. Purification by
silica gel chromatography provided
6-(4-fluoro-3-nitrophenyl)-8-isopropyl-2-(methylthio)pyrido[2,3-d]pyrimid-
in-7(8H)-one as off-white solid (0.82 g, 88% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 8.94 (s, 1H), 8.52 (dd, J=7.2 Hz,
2.4 Hz, 1H), 8.28 (s, 1H), 8.15-8.12 (m, 1H), 7.70 (dd, J=11.6 Hz,
8.8 Hz, 1H), 5.81-5.78 (m, 1H), 2.63 (s, 3H), 1.60 (d, J=6.8 Hz,
6H); MS (ESI) m/z: 375.0 (M+H.sup.+).
[0245] Using a procedure analogous to Example A1,
6-(4-fluoro-3-nitrophenyl)-8-isopropyl-2-(methylthio)pyrido[2,3-d]pyrimid-
in-7(8H)-one (0.82 g, 2.2 mmol), MCPBA (0.38 g, 2.2 mmol) and 0.5 M
ammonia in dioxane (8 mL) were combined to afford
2-amino-6-(4-fluoro-3-nitrophenyl)-8-isopropylpyrido[2,3-d]pyrimidin-7(8H-
)-one as a yellow solid (0.52 g, 69% yield). .sup.1H NMR (400 MHz,
MeOH-d.sub.4): .delta. 8.61 (s, 1H), 8.44 (dd, J=7.6 Hz, 2.4 Hz,
1H), 8.03-8.00 (m, 1H), 7.95 (s, 1H), 7.48 (dd, J=10.8 Hz, 7.6 Hz,
1H), 5.96-5.92 (m, 1H), 2.63 (s, 3H), 1.64 (d, J=6.4 Hz, 6H); MS
(ESI) m/z: 344.3 (M+H.sup.+).
[0246] To a solution of
2-amino-6-(4-fluoro-3-nitrophenyl)-8-isopropylpyrido[2,3-d]pyrimidin-7(8H-
)-one (0.52 g, 1.5 mmol) in EtOAc and methanol (5:1, 30 mL) was
added palladium on carbon (50 mg of 10% mol) and mixture was
stirred under a hydrogen atmosphere at RT for 16 h. The mixture was
filtered over a Celite pad and the pad was washed with EtOAc
(2.times.10 mL). The combined filtrate was concentrated in vacuo to
provide crude product. Purification by silica gel chromatography
afforded
2-amino-6-(3-amino-4-fluorophenyl)-8-isopropylpyrido[2,3-d]pyrimidin-7(8H-
)-one as an off-white solid (0.34 g, 72% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 8.60 (s, 1H), 7.73 (s, 1H), 7.22 (s,
2H), 7.08 (dd, J=9.2 Hz, 1.2 Hz, 1H), 6.99 (dd, J=10.8 Hz, 8.4 Hz,
1H), 6.74-6.70 (m, 1H), 5.78-5.76 (m, 1H), 5.13 (s, 2H), 1.53 (d,
J=6.8 Hz, 6H); MS (ESI) m/z: 314.0 (M+H.sup.+).
Example A53
[0247] Using a procedure analogous to Example A7,
N,N-dimethylpropane-1,3-diamine (3.27 g, 32 mmol) and Example A11
(100 mg, 0.32 nmol) were combined to provide
3-(5-amino-4-fluoro-2-methylphenyl)-7-(3-(dimethylamino)propylamino)-1-me-
thyl-1,6-naphthyridin-2(1H)-one (93 mg, 77% yield). MS (ESI) m/z:
384.2 (M+H.sup.+).
Example A54
[0248] A solution of Example A11 (0.200 g, 0.629 imoI), KOAc (0.093
g, 0.944 mmol) and 10% Pd/C (0.33 g, 0.031 mmol) in THF/MeOH (2:1,
15 mL) was stirred at RT under a H.sub.2 atmosphere overnight. The
mixture was filtered on Celite and rinsed forward with MeOH. The
combined filtrates were concentrated, diluted with satd.
NaHCO.sub.3 and extracted with EtOAc (2.times.). The combined
organic layers were washed with brine (1.times.), dried
(MgSO.sub.4), filtered and concentrated to afford
3-(5-amino-4-fluoro-2-methylphenyl)-1-methyl-1,6-naphthyridin-2(1H)-one
(0.161 g, 90%) as a yellow solid. MS (ESI) m/z: 284.0
(M+H.sup.+).
Example A55
[0249] A mixture of ethyl (3-amino-4-fluorophenyl)acetate (3.5 g,
17.6 mmol) and K.sub.2CO.sub.3 (6.1 g, 44.1 mmol) in DMF (20 mL)
was stirred at RT for 30 min. Example C3 (2.5 g, 14.7 mmol) was
added to the above mixture and the resulting mixture was stirred at
80.degree. C. for 10 h. The DMF was removed under reduced pressure
and the crude residue was suspended in H.sub.2O and extracted with
EtOAc (3.times.20 mL). The organics were washed with brine, dried
(MgSO.sub.4) and concentrated to give
3-(3-amino-4-fluorophenyl)-7-chloro-1-methyl-1,6-naphthyridin-2(1H)--
one (4 g, 90% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
8.75 (s, 1H), 8.07 (s, 1H), 7.61 (s, 1 H), 7.13-7.00 (m, 2H), 6.80
(m, 1H), 5.21 (s, 2H), 3.61 (s, 3H). MS (ESI) m/z: 304.2
(M+H.sup.+).
Example A56
[0250] Using a procedure analogous to Example A7,
N,N-dimethylethane-1,2-diamine (6.0 mL, 55 mmol) and Example A55
(150 mg, 0.49 mmol) were combined to afford
3-(3-amino-4-fluorophenyl)-7-(2-(dimethylamino)ethylamino)-1-methyl-1,6-n-
aphthyridin-2(1H)-one (151 mg, 86% yield) as a yellow solid. MS
(ESI) m/z: 356.3 (M+H.sup.+).
Example A57
[0251] A mixture of Example A60 (1.1 g, 3.7 mmol) and 25%
CH.sub.3NH.sub.2/EtOH solution (10 mL) was heated at 160.degree. C.
in a steel bomb for 2 h. The cooled reaction mixture was filtered
and the solid was recrystallized (EtOH) to give
6-(3-amino-phenyl)-8-methyl-2-methylamino-8H-pyrido[2,3-d]pyrimidin-7-one
(610 mg, 59% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): 8.69 and
8.61 (s, 1H), 7.78 (m, 2H), 7.01 (t, J=7.8 Hz, 1H), 6.85 (br s,
1H), 6.73 (d, J=7.8 Hz, 1H), 6.51 (d, J=7.8 Hz, 1H), 5.05 (br s,
2H), 3.56 and 3.52 (s, 3H), 2.88 (m, 3H). MS (ESI) m/z: 282.2
(M+H.sup.+).
Example A58
[0252] KF/Al.sub.2O.sub.3 (40 wt %, 10 g, 69 mmol) was added to a
solution of Example C7 (6 g, mmol) and ethyl
(3-amino-4-fluorophenyl)acetate (6 g, 30 mmol) in DMAc (80 mL). The
reaction mixture was stirred at RT for 1 hour. The mixture was
filtered and the filtrate was concentrated under vacuum. The
residue was poured into water, and the precipitate was collected by
filtration, washed with ethyl ether, and dried in vacuo to give
3-(3-amino-4-fluorophenyl)-7-chloro-1-isopropyl-1,6-naphthyridin-2(1-
H)-one (7 g, 70% yield). .sup.1H NMR (400 Hz, DMSO-d.sub.6):
.delta. 8.71 (s, 1H), 8.00 (s, 1H), 7.76 (s, 1H), 7.11 (dd, J=9.2,
2.4 Hz, 1H), 7.05 (dd, J=11.6, 8.4 Hz, 1H), 6.76 (m, 1H), 5.18 (s,
2H), 5.15 (m, 1H), 1.52 (d, J=7.2 Hz, 1H); MS (ESI) m/z: 332.0
[M+H].sup.+.
[0253] A mixture of
3-(3-amino-4-fluorophenyl)-7-chloro-1-isopropyl-1,6-naphthyridin-2(1H)-on-
e (4 g, 12.1 mmol) and (4-methoxybenzyl)methylamine (15 mL) was
degassed under reduced pressure and heated to 180.degree. C. under
N.sub.2 for 4 h. After cooling, the reaction mixture was diluted
with Et.sub.2O. The precipitate was filtered, washed with ether and
dried in vacuo to give
3-(3-amino-4-fluoro-phenyl)-1-isopropyl-7-[(4-methoxybenzyl)-methyl-amino-
]-1H-[1,6]naphthyridin-2-one (5.3 g) as a solid contaminated with
(4-methoxybenzyl)methylamine HCl salt.
[0254] The above prepared
3-(3-amino-4-fluoro-phenyl)-1-isopropyl-7-[(4-methoxy-benzyl)-methyl-amin-
o]-1H-[1,6]naphthyridin-2-one (5.3 g) was combined in DCM (150 mL)
with TFA (50 mL) and the resultant mixture was heated at reflux
overnight. The volatiles were removed under reduced pressure, and
the residue was dissolved in 10% HCl aqueous solution. The aqueous
layer was washed with EtOAc (3.times.100 mL) and the aqueous layer
was basified to pH 11, and extracted with EtOAc. The combined
extracts were dried (Na.sub.2SO.sub.4) and concentrated to give
3-(3-amino-4-fluoro-phenyl)-1-isopropyl-7-methylamino-1H-[1,6]naphthyridi-
n-2-one (1.26 g, 32% yield for two steps). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.36 (s, 1H), 7.70 (s, 1H), 7.06 (dd, J=8.4,
2.0 Hz, 1H), 6.94 (dd, J=11.6, 8.4 Hz, 1H), 6.88 (m, 1H), 6.72 (m,
1H), 6.39 (s, 1H), 5.07 (m, 1H), 5.06 (s, 2H), 2.83 (d, J=4.8 Hz,
1H), 1.51 (d, J=6.8 Hz, 6H); MS (ESI) m/z: 327.1 [M+H].sup.+.
Example A59
[0255] Method 1: To a solution of Example A15 (0.5 g, 1.7 mmnal) in
DMF (5 mL) was added NaH (0.048 g, 2.0 mmol) at RT. After stirring
for 30 min, 2-iodopropane (0.56 g, 3.3 mmol) was added and the
mixture was stirred for 3 h at RT. Sat. NH.sub.4Cl solution was
added, and the product was extracted with ethylacetate (2.times.35
mL). The combined organics were washed with brine solution, dried
(Na.sub.2SO.sub.4) and concentrated in vacuo to provide crude
residue. Purification by silica gel chromatography provided
6-(3-amino-4-fluorophenyl)-8-isopropyl-2-(methylthio)pyrido[2,3--
d]pyrimidin-7(8H)-one as a light orange solid (0.18 g, 32% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.88 (s, 1H), 7.93 (s,
1H), 7.10 (dd, J=8.8 Hz, 2.0 Hz, 1H), 7.02 (dd, J=11.2 Hz, 8.4 Hz,
1H), 6.77-6.73 (m, 1H), 5.78-5.74 (m, 1H), 5.19 (br s, 2H), 2.60
(s, 3H), 1.56 (d, J=7.2 Hz, 6H); MS (ESI) m/z: 345.2
(M+H.sup.+).
[0256] Method 2: Example C6 (3.0 g, 14.2 mmol), ethyl
2-(3-amino-4-fluorophenyl)acetate (2.8 g, 14.2 mmol), and
KF/Al.sub.2O.sub.3 (40 wt %, 9 g, 62 mmol) were combined in DMAc
(30 mL) and stirred at RT for 12 hours. The reaction mixture was
filtered and the filtrate was concentrated under reduced pressure,
washed with ethyl ether and dried in vacuo to give
6-(3-amino-4-fluorophenyl)-8-isopropyl-2-(methylthio)pyrido[2,3-d]pyrimid-
in-7(8H)-one (2.1 g, 42.9% yield).
Example A60
[0257] Chlorotrimethylsilane (13.3 g, 122 mmol was added to a
solution of 2-(3-nitrophenyl)acetonitrile (10 g, 61.2 mmol) in EtOH
(100 mL) and the mixture was refluxed overnight. The reaction
mixture was concentrated under reduced pressure. Water was added
and the mixture was neutralized to pH=7 with saturated aq
Na.sub.2CO.sub.3 solution and extracted with EtOAc (3.times.70 mL).
The combined organics were washed with brine, dried (MgSO.sub.4)
and concentrated to give ethyl 2-(3-nitrophenyl)acetate (12 g, 94%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.15 (s, 1H),
8.10 (d, J=8.4 Hz, 1H), 7.71 (d, J=7.6 Hz, 1H), 7.61 (t, J=8.0 Hz,
1H), 4.06 (q, J=7.2 Hz, 2H), 3.85 (s, 2H), 1.15 (t, J=7.2 Hz,
3H).
[0258] A mixture of ethyl 2-(3-nitrophenyl)acetate (12 g, 57.4
mmol) and Pd/C (1.2 g, 10%) in methanol (100 mL) was hydrogenated
(45 psi) at RT for 12 h. The mixture was filtered and the filtrate
was concentrated to afford ethyl 2-(3-aminophenyl)acetate (10 g,
97% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 6.91 (t,
J=7.6 Hz, 1H), 6.42-6.40 (m, 2H), 6.35 (d, J=7.6 Hz, 1H), 5.00 (s,
2H), 4.03 (q, J=7.2 Hz, 2H), 3.41 (s, 2H), 1.15 (t, J=7.2 Hz,
3H).
[0259] Example C1 (5.1 g, 27.9 mmol), ethyl
2-(3-aminophenyl)acetate (5.0 g, 29.3 mmol), and K.sub.2CO.sub.3
(7.7 g, 55.8 mmol) were combined in DMF (60 mL) and the resulting
mixture was stirred at 100.degree. C. for 10 hours. The reaction
mixture was concentrated under reduced pressure, diluted with water
(100 mL), and the aqueous layer was extracted with EtOAc
(3.times.70 mL). The combined organic layers were washed with
brine, dried (MgSO.sub.4) and concentrated in vacuo. The residue
was purified by column chromatography on silica gel to give
6-(3-aminophenyl)-8-methyl-2-(methylthio)pyrido[2,3-d]pyrimidin-7(8H)-one
(5.2 g, 62.7% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.89 (s, 1H), 7.97 (s, 1H), 7.05 (t, J=8.0 Hz, 1H), 6.87 (s, 1H),
7.76 (d, J=7.6 Hz, 1H), 6.57 (d, J=8.4 Hz, 1H), 5.11 (s, 2H), 3.64
(s, 3H), 2.59 (s, 3H); MS (ESI) m/z: 299.2 [M+H].sup.+.
Example A61
[0260] Example C3 (3.2 g, 18.8 mmol), Example D6 (4.0 g, 18.8 mmol)
and Cs.sub.2CO.sub.3 (12.3 g, 37.6 mmol) were combined in DMF (80
mL) and heated to 80.degree. C. with stirring for 4 h. The reaction
mixture was poured into water (600 mL) and precipitate was
collected by filtration and dried under reduced pressure to give
3-(5-amino-2-chlorophenyl)-7-chloro-1-methyl-1,6-naphthyridin-2(1H)-one
(5.0 g, 83% yield). .sup.1H-NMR (400 MHz, DMSO-d.sub.6): .delta.
8.74 (s, 1H), 7.97 (s, 1H), 7.63 (s, 1H), 7.09 (d, J=8.4 Hz, 1H),
6.57 (dd, J=8.4 Hz, 2.8 Hz, 1H), 6.52 (s, 1 H), 5.31 (s, 2H), 3.60
(s, 3H).
[0261] A mixture of
3-(5-amino-2-chlorophenyl)-7-chloro-1-methyl-1,6-naphthyridin-2(1H)-one
(5 g, 15.67 mmol), 4-Methoxybenzylmethylamine (3.6 g, 23.5 mmol)
and DBU (3.7 g, 23.5 mmol) in NMP (80 mL) was heated at 180.degree.
C. under N.sub.2 for 4 h. The reaction was cooled to room
temperature and poured into water (600 mL). The precipitate was
collected by filtration and dried in vacuo to give
7-((4-methoxybenzyl)(methyl)amino)-3-(5-amino-2-chlorophenyl)-1-methyl-1,-
6-naphthyridin-2(1H)-one (6.5 g, 95% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.46 (s, 1H), 7.68 (s, 1H), 7.16 (d, J=8.8
Hz, 2H), 7.06 (d, J=8.4 Hz, 1H), 6.85 (d, J=8.8 Hz, 2H), 6.54-6.51
(m, 2H), 6.29 (s, 1H), 5.23 (s, 2H), 4.85 (s, 2H), 3.69 (s, 3H),
3.51 (s, 3H), 3.07 (s, 3H).
[0262] Trifluoroacetic acid (10 mL, 134 mmol) was added to a
solution of
7-((4-methoxybenzyl)(methyl)amino)-3-(5-amino-2-chlorophenyl)-1-methyl-1,-
6-naphthyridin-2(1H)-one (4 g, 9.2 mmol) in CH.sub.2Cl.sub.2 (50
mL). The mixture was heated to reflux for 3 trs. The reaction
mixture was concentrated under reduced pressure, dissolved in aq
HCl solution and washed with EtOAc (3.times.50 mL). The aqueous
layer was neutralized with saturated Na.sub.2CO.sub.3 solution to
pH 8, and was extracted with EtOAc (3.times.50 mL). The combined
extracts were washed with brine, dried over Na.sub.2SO.sub.4 and
concentrated under reduced pressure. The residue was purified by
chromatography to give
3-(5-amino-2-chlorophenyl)-1-methyl-7-(methylamino)-1,6-naphthyridin-2(1H-
)-one (1.7 g, 58% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 8.36 (s, 1H), 7.63 (s, 1H), 7.06-7.00 (m, 2H), 6.54-6.50
(m, 2H), 6.14 (s, 1H), 5.21 (s, 2H), 3.48 (s, 3H), 2.84 (d, J=4.8
Hz, 3H); MS (ESI) m/z: 314.9 [M+H].sup.+.
Example A62
[0263] Using the three-step procedure of Example 61, Example C5
(3.5 g, 18.8 mmol), Example D6 (4.0 g, 18.8 mmol), Cs.sub.2CO.sub.3
(12.3 g, 37.6 mmol), 4-methoxybenzylmethylamine (3.6 g, 23.5 mmol)
and trifluoroacetic acid (10 mL, 134 mmol) were combined to provide
3-(5-amino-2-chlorophenyl)-1-ethyl-7-(methylamino)-1,6-naphthyridin-2(1H)-
-one (1.68 g, 27% yield over 3 steps). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.36 (s, 1H), 7.62 (s, 1H), 7.05 (dd, J=7.2,
2.0 Hz, 1H), 6.96 (q, J=4.8 Hz, 1H), 6.54-6.50 (m, 2H), 6.21 (s,
1H), 5.21 (s, 2H), 4.11 (q, J=7.2 Hz, 2H), 2.84 (d, J=4.8 Hz, 3H),
1.18 (t, J=7.2 Hz, 3H); MS (ESI) m/z: 329.2[M+H].sup.+.
Example A63
[0264] Using a procedure analogous to Example A1, Example A18 (1.01
g, 2.77 mmol) and 2M Methylamine in THF (6 mL1) were combined and
purified by silica gel chromatography to afford
6-(5-amino-2-chloro-4-fluorophenyl)-8-ethyl-2-(methylamino)pyrido[2,3-d]p-
yrimidin-7(8H)-one as orange colored solid (0.55 g, 57% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.59 (s, 1H),
7.84-7.81 (m, 1H), 7.67 (s, 1H), 6.20 (d, J=11.2 Hz, 1H), 6.72 (d,
J=9.6 Hz, 1H), 5.33 (s, 2H), 4.35-4.30 (m, 2H), 2.89 (d, J=6.0 Hz,
3H), 1.21 (t, J=6.8 Hz, 3H); MS (ESI) m/z: 348.0 (M+H.sup.+).
Example A64
[0265] Example D6 (1.0 g, 4.68 mmol), Example C1 (0.858 g, 4.68
mmol) and Cs.sub.2CO3 (3.96 g, 12.2 mmol) were combined in DMF (18
mL) by the procedure of Example A10, method 3, to provide
6-(5-amino-2-chlorophenyl)-8-methyl-2-(methylthio)pyrido[2,3-d]pyrimidin--
7(8H)-one (1.37 g, 88% yield). .sup.1H NMR (400 MHz, DMSO-d6):
.delta. 8.90 (s, 1H), 7.90 (s, 1H), 7.10 (d, J=8.0 Hz, 1H), 6.58
(dd, J=8.8, 2.4 Hz, 1H), 6.53 (d, J=2.4 Hz, 1H), 5.33 (s, 2H), 3.64
(s, 3H), 2.61 (s, 3H); MS (ESI) m/z: 330.0 (M+H).
[0266]
6-(5-amino-2-chlorophenyl)-8-methyl-2-(methylthio)pyrido[2,3-d]pyri-
mlidin-7(8H)-one (0.500 g, 1.5 mmol), mCPBA (0.481 g, 1.953 mmol)
and methylamine (0.76 mL. 2.0 M in THF, 1.52 mmol) were combined by
analogy to Example A1 to provide
6-(5-amino-2-chlorophenyl)-8-methyl-2-(methylamino)pyrido[2,3-d]pyrimidin-
-7(8H)-one (0.378 g, 80% yield). MS (ESI) m/z: 316.0
(M+H.sup.+).
Example A65
[0267] Example C5 (1.8 g, 10 mmol) and ethyl
2-(5-amino-2-methylphenyl)acetate (1.9 g, 10 mmol, and
KF/Al.sub.2O.sub.3 (40%, 5.4 g, 37 mmol) were combined in DMAc (40
mL) by the procedure of Example A11 to give
3-(5-amino-2-methylphenyl)-7-chloro-1-ethyl-1,6-naphthyridin-2(1H)-one
(1.9 g, 61% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.73 (s, 1H), 7.88 (s, 1H), 7.68 (s, 1H), 6.87 (d, J=8.4 Hz, 1H),
6.49 (d, J=8.4 Hz, 1H), 6.41 (m, 1H), 4.89 (s, 2H), 4.24 (q, J=7.2
Hz, 2H), 1.92 (s, 3H), 1.16 (t, J=7.2 Hz, 3H).
[0268] Using a procedure analogous to Example A26,
3-(5-amino-2-methylphenyl)-7-chloro-1-ethyl-1,6-naphthyridin-2(1H)-one
(1.9 g, 6.4 mmol), 4-methoxybenzylmethylanmine (1.5 g, 9.6 mmol),
DBU (1.6 g, 9.6 mmol), and trifluoroacetic acid (10 mL, 134 mmol)
were combined to give
3-(5-amino-2-methylphenyl)-1,6-ethyl-7-(methylamino)-1,6-naphthyridin-2(1-
H)-one (0.84 g, 43% yield, 2 steps). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 8.36 (s, 1H), 7.56 (s, 1H), 6.91-6.82 (m,
2H), 6.47-6.39 (m, 2H), 6.22 (s, 1H), 4.80 (s, 2H), 4.13 (q, J=6.9
Hz, 2H), 2.84 (d, J=4.8 Hz, 3H), 1.92 (s, 3H), 1.19 (t, J=6.9 Hz,
3H); MS (ESI) m/z: 308.9 [M+H].sup.+.
Example B1
[0269] Phenyl hydrazine and 4,4-dimethyl-3-oxopentanenitrile were
combined according to literature procedures to yield
3-tert-butyl-1-phenyl-1H-pyrazol-5-amine. See WO 2006/071940.
Example B2
[0270] Methyl hydrazine and 4,4-dimethyl-3-oxopentanenitrile were
combined according to literature procedures to yield
3-tert-butyl-1-methyl-1H-pyrazol-5-amine. See WO 2006/071940.
Example B3
[0271] 3-(2-amino-2-oxoethyl)phenyl hydrazine and
4,4-dimethyl-3-oxopentanenitrile were combined according to
literature procedures to yield
2-(3-(5-amino-3-tert-butyl-1H-pyrazol-1-yl)phenyl)acetamide. See WO
2006/071940.
Example B4
[0272] A mixture of 5-nitro-1H-indazole (25 g, 0.153 mmol) and 10%
Pd/C (2.0 g) in MeOH was stirred under H.sub.2 (1 atm) overnight.
After filtration, the filtrate was concentrated to yield
1H-indazol-5-ylamine (20 g, 97% yield) as a yellow solid. .sup.1H
NMR (300 MHz, DMSO-d.sub.6): .delta. 12.50 (brs, 1H), 7.70 (s, 1H),
7.21 (d, J=8.7 Hz, 1H), 6.77 (d, J=8.7 Hz, 1H), 6.74 (s, 1H), 4.71
(brs, 1H), 3.15 (d, J=4.8 Hz, 2H); MS (ESI) m/z: 134
(M+H.sup.+).
[0273] To a solution of 1H-indazol-5-ylamine (20 g, 153 mmol) in
cone. HCl (50 mL) was added an aqueous solution (50 mL) of
NaNO.sub.2 (19 g, 158 mmol) at 0.degree. C. and the resulting
mixture was stirred for 1 h. A solution of SnCl.sub.2.2H.sub.2O (90
g, 306 mmol) in cone. HCl (70 mL), pre-cooled to 0.degree. C., was
then added. The reaction solution was stirred for 2 h at RT. The
precipitate was filtered and washed with ether to yield
(1H-indazol-5-yl)-hydrazine hydrochloride as a yellow solid, which
was used for the next reaction without further purification.
[0274] A mixture of (1H-indazol-5-yl)-hydrazine hydrochloride and
4,4-dimethyl-3-oxo-pentanenitrile (19 g, 1.05 eq) in EtOH (200 mL)
was heated at reflux overnight. The reaction was concentrated and
the residue purified by column chromatography to yield
3-t-butyl-1-(1H-indazol-5-yl)-1H-pyrazol-5-amine (23 g, 60% for two
steps). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 8.24 (s, 1H),
8.06 (s, 1H), 7.75 (d, J=9.0 Hz, 1H), 7.45 (dd, J=9.0 Hz, 1.8 Hz,
1H), 5.7 (s, 1 H), 1.31 (s, 9H); MS (ESI) m/z: 256 (M+H.sup.+).
[0275] To a solution of
3-t-butyl-1-(1H-indazol-5-yl)-1H-pyrazol-5-amine (14 g, 48 mmol) in
dioxane (100 mL) was added 10% NaOH (50 mL) at RT and the mixture
stirred for 0.5 h. Boc anhydride (12 g, 1.2 eq) was added to the
mixture and the solution stirred for 3 h. The mixture was extracted
with CH.sub.2Cl.sub.2 (3.times.100 mL). The combined organic
extracts were concentrated and purified by column chromatography to
yield t-butyl
5-(5-amino-3-t-butyl-1H-pyrazol-1-yl)-1H-indazole-1-carboxylate
(7.8 g, 46%). .sup.1H NMR (300 MHz, DMSO-d.sub.6): 8.44 (s, 1H),
8.10 (d, J=9.0 Hz, 1H), 8.00 (s, 1H), 7.82 (d, J=9.0 Hz, 1H), 5.39
(s, 1H), 5.24 (br s, 2H), 1.65 (s, 9H), 1.21 (s, 9 H); MS (ESI)
m/z: 356 (M+H.sup.+).
Example B5
[0276] Phenyl hydrazine and 3-oxo-3-(thiophen-2-yl)propanenitrile
were combined according to literature procedures to yield
1-phenyl-3-(thiophen-2-yl)-1H-pyrazol-5-amine. See WO
2006/071940.
Example B6
[0277] Methyl hydrazine (0.35 g, 7.6 mmol) and 2-thionyl
acetonitrile (1.1 g, 7.6 mmol) were heated to 80.degree. C. in
ethanol in the presence of conc. HCl (1 drop) for 18 h. Solvents
were removed; sat. NaHCO.sub.3 solution (35 ml) was added and the
product was extracted with ethyl acetate (2.times.30 ml). The
combined organic layers were washed with brine, dried
(Na.sub.2SO.sub.4) and concentrated to afford
1-methyl-3-(thiophen-2-yl)-1H-pyrazol-5-amine (1.25 g, 92% yield)
as a solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 7.34 (dd,
J=4.8 Hz, 1.2 Hz, 1H), 7.19 (dd, J=3.6 Hz, 1.2 Hz, 1H), 7.00 (dd,
J=4.8 Hz, 3.6 Hz, 1H), 5.80 (s, 1H), 5.29 (s, 2H), 3.51 (s, 3H); MS
(ESI) m/z: 180.0 (M+H.sup.+).
Example B7
[0278] 3-Fluorophenylboronic acid (0.70 g, 5.0 mmol), ethyl
3-tert-butyl-1H-pyrazole-5-carboxylate (0.981 g, 5.0 mmol),
Cu(OAc).sub.2 (0.908 g, 5.0 mmol), pyridine (2.45 ml, 30 mmol) and
4A MS (1.9 g) were combined in CH.sub.2Cl.sub.2 (48 ml) and stirred
open to air at RT for 4 d. The reaction mixture was diluted with
EtOAc (150 mL), washed with 3M HCl (2.times.50 mL), H.sub.2O (50
mL) and brine (50 mL), dried (MgSO.sub.4) and concentrated in
vacuo. The crude product was purified by chromatography to afford
ethyl 3-tert-butyl-1-(3-fluorophenyl)-1H-pyrazole-5-carboxylate
(0.786 g, 54% yield) as colorless oil. MS (ESI) m/z: 291
(M+H.sup.+).
[0279] To a stirring solution of ethyl
3-tert-butyl-1-(3-fluorophenyl)-1H-pyrazole-5-carboxylate (0.786 g,
2.71 mmol) in 1:1:1 THF/EtOH/HO0 (36 ml) at RT was added
LiOHH.sub.2O (0.568 g, 13.5 mmol). After stirring at RT overnight,
the reaction mixture was diluted with 3M HCl (30 mL) and extracted
with EtOAc (3.times.50 mL). The combined organic layers were washed
with brine (2.times.30 mL), dried (MgSO.sub.4) and concentrated to
afford 3-tert-butyl-1-(3-fluorophenyl)-1H-pyrazole-5-carboxylic
acid (0.602 g, 85% yield) as white solid. MS (ESI) m/z: 263
(M+H.sup.+).
[0280] To a stirring solution of
3-tert-butyl-1-(3-fluorophenyl)-1H-pyrazole-5-carboxylic acid (0.26
g, 0.60 mmol) and TEA (0.13 ml, 0.90 mmol) in 1,4-dioxane (9 ml)
was added DPPA (0.16 ml, 0.75 mmol). After stirring for 30 min at
RT, 2,2,2-trichloroethanol (0.58 ml, 6.0 mmol) was added and the
reaction was heated at 100.degree. C. for 2 h. The reaction mixture
was diluted with brine (10 ml) and extracted with EtOAc (3.times.20
ml). The combined organic phases were washed with 5% citric acid
(10 ml), satd. NaHCO.sub.3 (10 ml), dried (MgSO.sub.4), filtered
and evaporated. The crude product was purified by chromatography to
afforded 2,2,2-trichloroethyl
3-tert-butyl-1-(3-fluorophenyl)-1H-pyrazol-5-ylcarbamate (0.180 g,
73% yield) as colorless oil. MS (ESI) m/z: 410 (M+H.sup.+).
Example B8
[0281] Method 1: To a solution of quinolin-6-ylamine (5 g, 35 mmol)
in cone. HCl (12 mL) was added dropwise an aqueous solution (4 mL)
of NaNO.sub.2 (2.42 g, 35 mmol) at 0.degree. C. The resulting
mixture was stirred for 1 h and then treated dropwise with a
solution of SnCl.sub.22H.sub.2O (15.8 g, 70 mmol) in cone. HCl (15
mL) at 0.degree. C. The reaction mixture was stirred for 2 h at RT.
The precipitate was collected and washed with EtOH and Et.sub.2O to
yield 1-(quinolin-6-yl)hydrazine hydrochloride (4.3 g, 77% yield)
as a yellow powder, which was used for the next reaction without
further purification.
[0282] A mixture of 1-(quinolin-6-yl)hydrazine hydrochloride (4.0
g, 20.5 mmol) and 4,4-dimethyl-3-oxo-pentanenitrile (3.6 g, 30 mol)
in EtOH (50 mL) and cone. HCl (5 mL) was heated at reflux
overnight. After removal of the solvent, the residue was purified
by column chromatography to yield
3-t-butyl-1-(quinolin-6-yl)-1H-pyrazol-5-amine (2.8 g, 51% yield).
.sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 8.84 (d, J=4.2 Hz,
1H), 8.37 (d, J=7.5 Hz, 1H), 8.09 (s, 1H), 8.04 (s, 2H), 7.52 (m,
1H), 5.46 (s, 1H), 5.40 (brs, 2H), 1.29 (s, 9H). MS (ESI) m/z
(M+H.sup.+): 267.2.
[0283] Method 2: A solution of triflic anhydride (42.8 g, 0.15 mol)
in methylene chloride (100 mL) was added dropwise to a 0.degree. C.
solution of 6-hydroxyquinoline (20.00 g, 0.138 mol) and pyridine
(23 g, 0.277 mol) in methylene chloride (500 mL). The cooling bath
was removed and the resulting solution was stirred at RT for 4 h.
The reaction mixture was washed with water (3.times.300 mL) and the
organics were dried (MgSO.sub.4) and concentrated under vacuum to
afford crude quinolin-6-yl trifluoromethanesulfonate (40 g,
>100% yield) as an oil. .sup.1H-NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.00 (d, 1H, J=2.8 Hz), 8.50 (d, 1H, J=8.0 Hz), 8.21 (d,
J=2.8 Hz, 1H), 8.18 (d, J=9.2 Hz, 1H), 7.80 (m, 1H), 7.64 (m, 1H);
MS (ESI) m/z: 277.9 (M+H.sup.+).
[0284] To a suspension of quinolin-6-yl trifluoromethanesulfonate
(40 g, 0.14 mol), benzophenone hydrazone (35.6 g, 0.18 mol), cesium
carbonate (74 g, 0.23 mol) and 1,1'-bis(diphenylphosphino)ferrocene
(2.5 g, 4.5 mmol) in degassed toluene (1 L) was added palladium
acetate (0.013 g, 0.058 mmol). The resultant mixture was heated to
90.degree. C. under a nitrogen atmosphere. After 16 h, the mixture
was concentrated in vacuo and the residue was purified through
silica gel column chromatography (20-30% EtOAc in pet ether) to
provide 1-(diphenylmethylene)-2-(quinolin-6-yl)hydrazine (32 g,
68.6% yield). .sup.1H-NMR (300 MHz, DMSO-d.sub.6): .delta. 9.22 (s,
1H), 8.58 (t, J=1.8 Hz, 1H), 8.13 (d, J=3.6 Hz, 1H), 7.80 (d, J=3.6
Hz, 1H), 7.61 (d, J=3.9 Hz, 1H), 7.59-7.51 (m, 4H), 7.50 (d, J=3.6
Hz, 2H), 7.33-7.39 (m, 6 H); MS (ESI) m/z: 324 (M+H.sup.+).
[0285] A solution of
1-(diphenylmethylene)-2-(quinolin-6-yl)hydrazine (32 g, 99 mmol)
and 4,4-dimethyl-3-oxo-pentanenitrile (26 g, 0.15 mol) in ethanol
(500 mL) was treated with cone HCl (80 ml, 12 N, 0.96 mol) and the
mixture was heated to reflux overnight. The cooled reaction mixture
was concentrated under vacuum and the residue was washed with
Et.sub.2O to remove the diphenylketone. The crude product was
dissolved in EtOAc and neutralized (pH 8) with saturated
Na.sub.2CO.sub.3 solution. The organic layer was dried
(Na.sub.2SO.sub.4) and concentrated in vacuo. The residue was
further purified by silica gel chromatography to give
3-t-butyl-1-(quinolin-6-yl)-1H-pyrazol-5-amine (23 g, 87% yield).
.sup.1H-NMR (300 MHz, DMSO-d.sub.6): .delta. 8.86 (m, 1H), 8.39 (d,
J=5.7 Hz, 1H), 8.11-8.02 (m, 3H), 7.54 (m, 1H), 5.46 (s, 1H), 5.42
(br s, 2 H), 1.23 (s, 9H); MS (ES1) m/z (M+H.sup.+): 267.2.
Example B9
[0286] Methyl hydrazine (0.46, 10 nmol) and 2-fluorophenyl
acetonitrile (1.63 g, 10 nmol) were heated to 80.degree. C. in
presence of cone. HCl (1 drop) in ethanol (30 mL) for 18 h.
Solvents were removed; sat. NaHCO.sub.3 solution (35 ml) was added
and the product was extracted with ethyl acetate (2.times.30 mL).
The combined organic layers were washed with brine, dried
(Na.sub.2SO.sub.4) and concentrated to afford crude product which
was purified by chromatography (methanol/CH.sub.2Cl.sub.2) to
afford 3-(2-fluorophenyl)-1-methyl-1H-pyrazol-5-amine (1.25 g, 65%
yield) as a thick residue. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 7.86 (td, J=8.8 Hz, 2.4 Hz, 1H), 7.28-7.15 (m, 3H), 5.71
(d, J=4.4 Hz, 1H), 5.28 (brs, 2H), 3.58 (s, 3H); MS (ESI) m/z:
192.0 (M+H.sup.+).
[0287] To a biphasic solution of
3-(2-fluorophenyl)-1-methyl-1H-pyrazol-5-amine (1.19 g, 6.22 mmol)
in ethyl acetate (30 mL) and NaHCO.sub.3 solution (30 mL) was added
isopropenylchloroformate (1.28 g, 10.6 mmol) and mixture was
stirred at RT for 24 h. Both layers were separated; the aqueous
layer was extracted with ethyl acetate (1.times.30 mL) and the
combined organic layers were washed with brine, dried
(Na.sub.2SO.sub.4) and concentrated to afford crude product which
was purified by chromatography (ethyl acetate/hexane) to afford
prop-1-en-2-yl 3-(2-fluorophenyl)-1-methyl-1H-pyrazol-5-ylcarbamate
(1.15 g, 82% yield) as a pasty mass. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 10.09 (brs, 1H), 7.90 (td, J=8.0 Hz, 1.6 Hz,
1H), 7.38-7.22 (m, 3H), 6.54 (d, J=3.6 Hz, 1H), 4.79-4.77 (m, 2H),
3.76 (s, 3H), 1.96 (s, 3H); MS (ESI) m/z: 276.0 (M+H.sup.+).
Example B10
[0288] A mixture of 5-hydrazinyl-2-methylpyridine hydrochloride
from Example B27 (5.0 g, 31.4 mmol) and
4,4-dimethyl-3-oxopentanenitrile (8.3 g, 66.3 mmol) in EtOH (50 mL)
was heated at reflux overnight. The reaction was concentrated and
the residue was dissolved in EtOAc and neutralized with saturated
Na.sub.2CO.sub.3 solution. The organic layer was dried
(Na.sub.2SO.sub.4), concentrated in vacuo and purified by column
chromatography to yield
3-tert-butyl-1-(6-methylpyridin-3-yl)-1H-pyrazol-5-amine (5.2 g,
71% yield). .sup.1HNMR (400 MHz, CDCl.sub.3) .delta. 8.72 (s, 1H),
7.81 (dd, J=8.0, 2.4 Hz, 1H), 7.23 (d, J=8.4 Hz, 1H), 5.54 (s, 1H),
3.71 (br s, 1H), 2.58 (s, 3H), 1.29 (s, 9H); MS (ESI) m/z: 231.2
(M+H.sup.+).
Example B11
[0289] To a stirring solution of Example B35, 0.240 g, 0.86 mmol)
in dry THF (8.0 mL) at RT was added LiAlH.sub.4 (1.0 M in THF, 2.6
mL, 2.6 mmol) and the resulting mixture was stirred at RT for 1 h.
The reaction was carefully quenched by the addition of H.sub.2O
(0.10 mL), 3M NaOH (0.10 mL) and H.sub.2O (0.20 mL), and the
mixture was stirred at RT overnight. The suspension was filtered
through Celite and rinsed with EtOAc (20 mL). The filtrate was
dried (MgSO.sub.4) and concentrated to afford
2-(5-amino-1-phenyl-1H-pyrazol-3-yl)-2-methylpropan-1-ol (0.208,
105% yield) as a yellow oil. MS (ESI) m/z: 232.2 (M+H.sup.+).
[0290] To a solution of
2-(5-amino-1-phenyl-1H-pyrazol-3-yl)-2-methylpropan-1-ol (0.208 g,
0.85 mmol) in DMF (2.0 mL) was added imidazole (0.32 g, 4.7 mmol)
and TBSCl (0.39 g, 2.6 mmol). The resulting mixture was stirred at
RT for 5 h. Solvent was removed under reduced pressure. The residue
was diluted with H.sub.2O (10 mL) and extracted with EtOAc
(2.times.20 mL). The combined organic layers were dried
(MgSO.sub.4) and concentrated. The crude product was purified by
chromatography to afford
3-(1-(tert-butyldimethylsilyloxy)-2-methylpropan-2-yl)-1-phenyl-1H-pyrazo-
l-5-amine (0.125 g, 42% yield) as a light yellow oil. MS (ESI) m/z:
346.3 (M+H.sup.+).
Example B12
[0291] Using a procedure analogous to Example B11, Example B36 was
converted to
3-(1-(tert-butyldimethylsilyloxy)-2-methylpropan-2-yl)-1-methyl-1H-pyrazo-
l-5-amine in 42% yield. .sup.1H NMR (400 MHz, CDCl.sub.3): .delta.
5.59 (s, 1H), 3.69 (s, 3H), 3.55 (s, 2H), 1.26 (s, 6H), 0.89 (s,
9H), 0.00 (s, 6H); MS (ESI) m/z: 284.2 (M+H.sup.+).
Example B13
[0292] Potassium t-butoxide (0.51 g, 4.5 mmol) was dissolved in
DMSO (10 mL) and to this solution was added ethyl
3-(thiophen-2-yl)-1H-pyrazole-5-carboxylate (1.01 g, 4.5 mmol) in
small portions and stirred under Ar for 15 min. To this solution
was added 2-iodopropane (1.2 g, 6.8 mmol) slowly and stirred for 1
h at RT. Sat. NH.sub.4Cl solution was added, the product was
extracted with EtOAc (2.times.40 mL). The combined organics were
washed with brine, dried (Na.sub.2SO.sub.4) and concentrated in
vacuo. Purification by silica gel chromatography provided ethyl
1-isopropyl-3-(thiophen-2-yl)-1H-pyrazole-5-carboxylate as a pasty
mass (0.88 g, 73% yield). .sup.1H NMR (400 MHz, Acetone-drl):
.delta. 7.47 (dd, J=3.2 Hz, 1.2 Hz, 1H), 7.42 (dd, J=4.8 Hz, 1.2
Hz, 1H), 7.12-7.09 (m, 2H), 5.57-5.51 (m, 1H), 4.37 (q, J=7.2 Hz,
2H), 1.50 (d, J=6.8 Hz, 6H), 1.38 (t, J=7.2 Hz, 3H); MS (ESI) m/z:
265.0 (M+H.sup.+).
[0293] To a solution of ethyl
1-isopropyl-3-(thiophen-2-yl)-1H-pyrazole-5-carboxylate (0.88 g,
3.3 mmol) in THF (10 mL) was added aq. LiOH solution (0.42 g, 10
mmol, 5 mL) and the mixture was stirred for 16 h at RT. Solvents
were removed and the thick liquid was diluted with water (5 mL) and
acidified with 3M HCl solution to pH 4-5. The product precipitated
and was filtered, washed with water and dried to afford
1-isopropyl-3-(thiophen-2-yl)-1H-pyrazole-5-carboxylic acid as a
white solid (0.69 g, 88% yield).
[0294] To a solution of
1-isopropyl-3-(thiophen-2-yl)-1H-pyrazole-5-carboxylic acid (0.68
g, 2.9 mmol) in dioxane (10 mL) was added with triethylamine (0.44
g, 4.3 mmol), diphenylphosphorylazide (0.95 g, 3.5 mmol) and
trichloroethanol (0.86 g, 5.8 mmol) and the mixture was heated to
90.degree. C. for 4 h. The mixture was poured into 3 M HCl (40 mL)
solution and the product was extracted with EtOAc (2.times.40 mL).
The combined organics were washed with brine, dried
(Na.sub.2SO.sub.4) and concentrated in vacuo. Purification by
silica gel chromatography provided 2,2,2-trichloroethyl
1-isopropyl-3-(thiophen-2-yl)-1H-pyrazol-5-ylcarbamate (0.88 g, 80%
yield) as a white solid. .sup.1H NMR (400 MHz, Acetone-d): .delta.
7.36-7.34 (m, 3H), 7.07 (dd, J=5.6 Hz, 4.0 Hz, 1H), 6.52 (s, 1H),
5.83 (t, J=7.2 Hz, 3H), 4.95 (s, 2H), 4.66-4.62 (m, 1H), 1.45 (d,
J=6.8 Hz, 6H); MS (ESI) m/z: 382.0 (M+H.sup.+).
Example B14
[0295] In a procedure analogous to Example B8 (method 1),
2-methylquinoline-6-amine (1.00 g, 6.32 mmol) and
4,4-dimethyl-3-oxopentanenitrile (1.03 g, 8.22 mmol) were combined
to provide
3-tert-butyl-1-(2-methylquinolin-6-yl)-1H-pyrazol-5-amine (428 mg,
24% yield) as a solid. .sup.1H NMR (300 MHz, DMSO-d.sub.6), .delta.
1.24 (s, 9H), 2.66 (s, 3H), 5.37 (s, 2H), 5.43 (s, 1 H), 7.44 (d,
J=8.4, 1H), 7.97 (s, 2H), 8.05 (s, 1H), 8.28 (d, J=8.4, 1H); MS
(ESI) m/z: 281.2 (M+H.sup.+).
Example B15
[0296] To a suspension of KCN (1.90 g, 29.1 mmol) in MeOH (35 mL)
was added dropwisely 3-bromo-1,1,1-trifluoropropan-2-one oxime
(5.00 g, 24.3 mmol) in MeOH (72 mL) at RT. The reaction mixture was
stirred at RT for 3 hours. The solution was evaporated and then the
residue was dissolved in EtOAc and stirred at RT. The solid was
filtered and the filtrate was evaporated to obtain the crude
product. The crude product was purified by silica gel column
chromatography (Biotage: 25M, 10% to 60% EtOAc/hexane: 550 mL) to
obtain 3-(trifluoromethyl)isoxazol-5-amine (1.38 g, 37% yield). MS
(ESI) m/z: 153.0 (M+H.sup.+).
[0297] Using general method G, 3-(trifluoromethyl)isoxazol-5-amine
(1.38 g, 9.1 mmol) and isopropenyl chloroformnate (1.1 g, 9.1 mmol)
in presence of LiHMDS (1.0M, 18 mL, 18.2 mmol) were combined to
afford prop-1-en-2-yl 3-(trifluoromethyl)isoxazol-5-ylcarbamate
(0.82 g, 38% yield)). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
12.3 (s, 1H), 6.48 (s, 1H), 4.83 (m, 1H), 4.80 (m, 1H), 1.93 (s,
3H); MS (ESI) m/z: 237.0 (M+H.sup.+).
Example B16
[0298] Potassium t-butoxide (0.29 g, 2.5 mmol) was dissolved in
DMSO (5 mL) and to this solution was added Example B37 (0.50 g, 2.5
mmol) in small portions under argon atmosphere. After 15 minutes,
2-iodoethane (0.31 mL, 3.8 mmol) was added slowly. After stirring
for 1.5 hours, LC-MS showed disappearance of starting material and
formation of product. Sat. NH.sub.4Cl solution was added, product
was extracted with ethyl acetate (2.times.40 ml), the combined
organic layers were washed with brine, dried (Na.sub.2SO.sub.4) and
concentrated to afford crude product. The crude product was
purified by silica gel column chromatography (Biotage: 25M, 5% to
35% EtOAc/hexane: 340 mL, 35% to 100% EtOAc/hexane: 300 mL) to
afford ethyl 3-tert-butyl-1-ethyl-1H-pyrazole-5-carboxylate (0.35
g, 61% yield). MS (ESI) m/z: 225.3 (M+H.sup.+).
[0299] To a solution of ethyl
3-tert-butyl-1-ethyl-1H-pyrazole-5-carboxylate (0.35 g, 1.6 mmol)
in a mixture of ethanol:dioxane:water (1:1:1, 6 mL) was added
lithium hydroxide (0.15 g, 6.2 mmol). The reaction mixture was
stirred overnight at RT. The solution diluted with EtOAc (50 mL)
and 5% citric acid (50 mL). The organic phase separated, washed
with brine (20 mL), dried (Na.sub.2SO.sub.4) and evaporated under
reduced pressure to afford
3-tert-butyl-1-ethyl-1H-pyrazole-5-carboxylic acid (0.30 g, 98%
yield) as a yellow solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 6.64 (s, 1H), 4.40 (q, J=7.2 Hz, 2H), 1.27 (t, J=7.2 Hz,
3H), 1.22 (s, 9H); MS (ESI) m/z: 197.3 (M+H.sup.+).
Example B17
[0300] Potassium t-butoxide (2.6 g, 23 mmol) was dissolved in DMSO
(10 mL) and to this solution was added Example B37 (4.5 g, 23
Imnol) in small portions and stirred under Ar for min. To this
solution was added t-butyl-bromoacetate (5.4 g, 28 mmol) slowly at
0.degree. C. with stirring for 45 min at RT. Sat. NH.sub.4Cl
solution was added and product was extracted with ethylacetate
(3.times.50 mL). The combined organic layers were washed with
brine, dried (Na.sub.2SO.sub.4) and concentrated to afford (7.0 g)
coupled product as a pasty mass. The above pasty mass was dissolved
in TFA (10 mL) and stirred for 3 h at RT. Solvents were removed, to
the residue water (100 mL) was added and product was extracted with
DCM (3.times.50 ml). The combined organic extracts were washed with
brine solution, dried (Na.sub.2SO.sub.4) and concentrated to yield
2-(3-tert-butyl-5-(ethoxycarbonyl)-1H-pyrazol-1-yl)acetic acid (5.8
.mu.m, 100%) as a pasty mass. .sup.1H NMR (400 MHz,
Acetone-d.sub.6): .delta. 6.78 (s, 1H), 5.25 (s, 2H), 4.30 (q,
J=7.2 Hz, 2H), 1.35-1.30 (m, 12H); MS (ESI) m/z: 255.2
(M+H.sup.+).
[0301] To a solution of acid (0.41 g, 1.6 mmol) in DMF (5 mL) was
added PyBop (0.84 g, 1.6 mmol), DIEA (0.42 g, 3.2 mmol) and
dimethylamine hydrochloride (0.26 g, 3.2 mmol). After stirring the
mixture for 1 h at RT, water (50 mL) was added, and the product was
extracted with ethylacetate (2.times.30 ml). The combined organic
layers were washed with 3M HCl solution (1.times.30 mL), dried
(Na.sub.2SO.sub.4) and concentrated to afford crude product which
was purified by chromatography (EtOAc/DCM) to afford ethyl
3-tert-butyl-1-(2-(dimethylamino)-2-oxoethyl)-1H-pyrazole-5-carboxylate
(0.25 g, 55%) as a thick paste. .sup.1H NMR (400 MHz,
Acetone-d.sub.6): .delta. 6.73 (s, 1H), 5.35 (s, 2H), 4.27 (q,
J=7.2 Hz, 2H), 3.15 (s, 3H), 2.90 (s, 3H), 1.33-1.28 (m, 12H); MS
(ESI) m/z: 282.3 (M+H.sup.+).
[0302] To a solution of ethyl
3-tert-butyl-1-(2-(dimethylamino)-2-oxoethyl)-1H-pyrazole-5-carboxylate
(1.16 g, 4 mmol) in THF (10 mL) was added 1M borane/THF (12 ml, 12
mmol) at 0.degree. C. under Ar and stirring continued for 12 h at
60.degree. C. The mixture was cooled to 0.degree. C., quenched with
3M HCl solution and heated to 60.degree. C. for 30 min. The mixture
was basified with solid NaHCO.sub.3 to pH around 8 and the product
was extracted with CHCl.sub.3(2.times.30 ml). The combined organics
were washed with brine, dried (Na.sub.2SO.sub.4) and concentrated
in vacuo provided crude product. Purification by silica gel
chromatography provided ethyl
3-tert-butyl-1-(2-(dimethylamino)ethyl)-1H-pyrazole-5-carboxylate
as a pasty mass (0.47 g, 43% yield). .sup.1H NMR (400 MHz,
MeOH-d.sub.4): .delta. 6.73 (s, 1H), 4.66 (t, J=6.8 Hz, 2H), 4.35
(q, J=7.2 Hz, 2H), 2.80 (t, J=7.2 Hz, 2H), 2.34 (s, 6H), 1.38 (t,
J=7.2 Hz, 3H), 1.31 (s, 9H); MS (ESI) m/z: 268.2 (M+H.sup.+).
[0303] To a solution of ethyl
3-tert-butyl-1-(2-(dimethylamino)ethyl)-1H-pyrazole-5-carboxylate
(0.47 g, 1.8 mmol) in THF (10 mL) was added aqueous LiOH (0.22 g,
5.3 mmol, 5 mL) and mixture was stirred for 16 h at RT. Solvents
were removed, the thick liquid was diluted with water (5 mL) and
acidified with 50% aq. acetic acid solution to pH 5-6. The product
was extracted with EtOAc (2.times.50 ml) and the combined organics
were washed with brine, dried (Na.sub.2SO.sub.4) and concentrated
in vacuo to afford
3-tert-butyl-1-(2-(dimethylamino)ethyl)-1H-pyrazole-5-carboxylic
acid as a pasty mass (0.12 g, 29% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 6.56 (s, 1H), 4.66 (t, J=6.0 Hz, 2H), 3.17
(t, J=6.0 Hz, 2H), 2.53 (s, 6H), 1.17 (s, 9H); MS (ESI) m/z: 240.3
(M+H.sup.+).
Example B18
[0304] 3-t-butylisoxazol-5-amine was prepared according to the
method disclosed in WO 99/32111, 0.250.
Example B19
[0305] A mixture of 1,1,3,3-tetramethoxypropane (37 g, 226 mmol),
tert-butyl-hydrazine hydrochloride (28 g, 226 mmol) and cone HCl
(60 mL, 720 mmol) in EtOH (300 mL) was heated at reflux overnight.
The mixture was poured into water and the resulting mixture was
extracted with ether. The combined organics were washed with brine,
dried (MgSO.sub.4) and concentrated in vacuo to give
1-tert-butyl-1H-pyrazole (25 g, 89% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 7.73 (s, 1H), 7.38 (s, 1H), 6.17 (s, 1H),
1.47 (s, 9H); MS (ESI) m/z: 125.1 [M+H].sup.+.
[0306] HNO.sub.3 (11.7 g, 185 mmol)was added dropwise to a mixture
of 1-tert-butyl-1H-pyrazole (23 g, 185 mmol) in cone.
H.sub.2SO.sub.4 (30 mL) at 0.degree. C. The resulting mixture was
stirred at 0.degree. C. for min and was poured onto crashed ice.
The aqueous mixture was extracted with EtOAc. The combined organics
were washed with brine, dried (MgSO.sub.4) and concentrated in
vacuo to give 1-tert-butyl-4-nitro-1H-pyrazole (20 g, 64% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.85 (s, 1 H), 8.23
(s, 1H), 1.52 (s, 9H).
[0307] A mixture of 1-tert-butyl-4-nitro-1H-pyrazole (20 g, 118
mmol) and Pd/C (10%, 2 g, 1.9 mmol) in MeOH (100 mL) was
hydrogenated under 1 atmosphere of hydrogen at RT for 16 h. The
reaction mixture was filtered and the filtrate was concentrated in
vacuo to give 1-tert-butyl-1H-pyrazol-4-ylamine (15 g, 93%).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 7.08 (s, 1H), 6.90 (s,
1 H), 3.70 (s, 2H), 1.41 (s, 9H); MS (ESI) m/z: 140.1
[M+H].sup.+t.
Example B20
[0308] Prepared according to the method disclosed in WO
99/32111.
Example B21
[0309] 4,4,4-Trifluoro-3-oxo-butyronitrile and phenylhydrazine were
combined by the procedure of Example B22 to provide
1-phenyl-3-(trifluoromethyl)-1H-pyrazol-5-amine. .sup.1H-NMR (400
MHz, DMSO-d.sub.6) .delta. 7.59-7.50 (m, 4H), 7.42 (m, 1H), 5.78
(s, 1H), 5.73 (br s, 2H).
Example B22
[0310] A solution of ethyl trifluoroacetate (14.2 g, 0.1 mol) and
anhydrous acetonitrile (5.0 g, 0.12 mol) in THF (100 mL) was added
dropwise to a suspension of NaH (60%, 6.0 g, 0.15 mol) in THF (100
mL) at 80.degree. C. The resulting mixture was heated to reflux
overnight, and then cooled to RT. The reaction mixture was
concentrated in vacuo and the residue was diluted with EtOAc and
10% aq HCl. The organic layer was washed with water and brine,
dried (MgSO.sub.4) and concentrated in vacuo to yield crude
4,4,4-Trifluoro-3-oxo-butyronitrile (15 g), which was used without
further purification.
[0311] A solution of methylhydrazine (5.0 g, 60 mmol) and
4,4,4-trifluoro-3-oxo-butyronitrile (9.8 g, 71 mmol) in EtOH (50
mL) was treated with cone. HCl (5 mL) and the resultant mixture was
heated to reflux overnight. The solvent was removed in vacuo and
the crude product was dissolved in EtOAc washed with saturated aq.
Na.sub.2CO.sub.3 solution until the washings were pH 8. The
organics were concentrated and purified by pre-HPLC to provide
2-methyl-5-trifluoromethyl-2H-pyrazol-3-ylamine (2.07 g, 21%
yield). .sup.1HNMR (300 MHz, DMSO-d.sub.6), .delta. 5.57 (s, 1H),
5.54 (br s, 2H), 3.55 (s, 3H); MS (ESI) m/z: 166.1 (M+H.sup.+).
Example B23
[0312] Example B37 (3.3 g, 17 mmol) was added to a solution of
potassium t-butoxide (1.9 g, 17 mmol) in DMSO (40 mL) and the
reaction was stirred under argon for 15 min. 2-Bromopropane (2.9 g,
24 mmol) was added and the reaction was stirred 2 h at RT. Water
was then added and the solution was extracted with EtOAc
(3.times.50 mL). The organics were washed with water and brine,
dried (MgSO.sub.4) and concentrated under reduced pressure.
Chromatography provided ethyl
3-tert-butyl-1-isopropyl-1H-pyrazole-5-carboxylate (1.65 g, 41%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): 6.64 (s, 1H), 5.31 (m,
1H), 4.22 (q, J=7.2 Hz, 2 H), 1.37 (d, J=6.4 Hz, 6H), 1.24 (t,
J=7.2 Hz, 3H), 1.14 (s, 9H). MS (ESI) m/z: (M+H.sup.+) 239.2.
[0313] A solution comprised of LiOH (2.3 g, 9 mmol) in water (12
mL) was added to a solution of ethyl
3-tert-butyl-1-isopropyl-1H-pyrazole-5-carboxylate (2.3 g, 9 mmol)
in THF (24 mL) and the reaction mixture was heated to 50.degree. C.
overnight. The reaction was concentrated under reduced pressure and
diluted with water. The solution pH was adjusted to pH 5 and the
solution was extracted with EtOAc. The organics were washed with
water and brine, dried (MgSO.sub.4) and concentrated under reduced
pressure to give 3-tert-butyl-1-isopropyl-1H-pyrazole-5-carboxylic
acid (1.85 g, 93% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): 6.62
(s, 1H), 5.37 (m, 1H), 1.35 (d, J=6.6 Hz, 6H), 1.22 (s, 9H). MS
(ESI) m/z: (M+H.sup.+) 211.2
[0314] To a stirring solution of
3-tert-butyl-1-isopropyl-1H-pyrazole-5-carboxylic acid (7.92 g, 38
mmol) and triethylamine (5.7 g, 56 mmol) in 1,4-dioxane (80 mL) was
added diphenylphosphoryl azide (12 g, 44 mmol). The resultant
reaction mixture was stirred 30 min at RT. 2,2,2-Trichloroethanol
(78 g, 527 mmol) was added and the reaction was heated to
100.degree. C.
[0315] After 4 h, the completed reaction was diluted with brine and
extracted with EtOAc. The organic layer was washed with water,
dried (MgSO.sub.4), and concentrated in vacuo. Purification of the
residue by chromatography provided 2,2,2-trichloroethyl
3-tert-butyl-1-isopropyl-1H-pyrazol-5-ylcarbamate (4.0 g, 31%
yield). .sup.1H-NMR (400 MHz, DMSO-d.sub.6): 9.85 (s, 1H), 5.94 (s,
1H), 4.90 (s, 2H), 4.37 (m, 1H), 1.27 (d, J=7.2 Hz, 6H), 1.18 (s,
9H). MS (ESI) m/z: 356.1 (M+H.sup.+).
Example B24
[0316] 4-Fluorophenylboronic acid (1.0 g, 7.15 mmol) was reacted
with Example B38 (1.56 g, 10.7 mmol) in presence of copper (II)
acetate (1.95 g, 10.7 mmol) at 80.degree. C. for 3 hours in
pyridine (15 mL) to provide the product, ethyl
1-(4-fluorophenyl)-3-isopropyl-1H-pyrazole-5-carboxylate (0.95 g,
48% yield). .sup.1HNMR (400 MHz, DMSO-d.sub.6): .delta. 7.45 (m,
2H), 7.30 (m, 2H), 6.9 (s, 1H), 4.17 (q, J=6 Hz, 2H), 2.9 (m, 1H),
1.25 (d, J=6 Hz, 6H), 1.18 (d, J=6 Hz, 3H); MS (ESI) m/z: 277.0
(M+H.sup.+). The ethyl ester (0.9 g, 3.3 mmol) was hydrolyzed with
lithium hydroxide monohydrate (0.67 g, 16.0 mmol) in a
THF/ethanol/water mixture to provide
1-(4-fluorophenyl)-3-isopropyl-1H-pyrazole-5-carboxylic acid (0.71
g, 88% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 7.47
(m, 2H), 7.30 (m, 2H), 6.89 (s, 1H), 2.97 (m, 1H), 1.25 (d, J=6 Hz,
6H), 1.17 (t, J=6 Hz, 3H); MS (ESI) m/z: 249.0 (M+1H).
Example B25
[0317] 3-Cyanophenylboronic acid (0.4 g, 2.74 mmol), was reacted
with Example B38 (0.5 g, 2.74 mmol) in the presence of copper (II)
acetate (0.5 g, 2.74 mmol) at 80.degree. C. for 3 hours in pyridine
(3.5 ml) to provide ethyl
1-(3-cyanophenyl)-3-isopropyl-H-pyrazole-5-carboxylate (0.18 g, 24%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.06 (m, 1H),
7.92 (m, 1H), 7.83 (m, 1H), 7.69 (m, 1H), 7.02 (s, 1H), 4.20 (q,
J=6 Hz, 1H), 3.00 (m, 1H), 1.26 (d, J=6 Hz, 6H), 1.20 (t, J=6 Hz,
3H); MS (ESI) m/z: 284.2 (M+H.sup.+). Hydrolysis of the ester with
lithium hydroxide monohydrate provided
1-(3-cyanophenyl)-3-isopropyl-1H-pyrazole-5-carboxylic acid in 94%
yield. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.02 (m, 1H),
7.89 (m, 1H), 7.83 (m, 1H), 7.67 (m, 1H), 6.97 (s, 1H), 3.00 (m,
1H), 1.26 (q, J=6 Hz, 6H); MS (ESI) m/z: 256.0 (M+H.sup.+).
Example B26
[0318] 6-(2-(Diphernylmethylene)hydrazinyl)quinoline (4.0 g, 12.3
mmol) and 4-methyl-3-oxo-pentanenitrile (1.5 g, 13.5 mmol) were
combined by the procedure of Example B8 (method 2) to give
5-isopropyl-2-quinolin-6-yl-2H-pyrazol-3-ylamine (1.1 g, 35.5%
yield). .sup.1H NMR (400 MHz, CDCl.sub.3) .delta. 8.93 (dd, J=4.4,
1.6 Hz, 1H), 8.21-8.18 (m, 2H), 8.05-8.02 (m, 2H), 7.44 (dd, J=8.4,
4.4 Hz, 1H), 5.56 (s, 1H), 3.85 (br s, 2H), 2.97 (m, 1H), 1.31 (d,
J=6.8 Hz, 6H); MS (ESI) m/z: 253.2 (M+H.sup.+).
Example B27
[0319] To a 0.degree. C. solution of 6-methylpyridin-3-amine (12 g,
0.11 mol) in cone HCl (40 mL) was added a solution of NaNO.sub.2
(7.7 g, 110 mmol) in water (30 mL) and the resulting mixture was
stirred at 0.degree. C. for 1 h. A solution of SnCl.sub.2 (50 g,
0.22 mol) in conc HCl (60 mL) was added at 0.degree. C. The
reaction solution was warmed to RT and stirred for 2 hours. The
precipitate was collected by filtration to provide
5-hydrazinyl-2-methylpyridine hydrochloride (10 g, 57% yield) which
was used without further purification.
[0320] A mixture of 5-hydrazinyl-2-methylpyridine hydrochloride
(5.0 g, 31 mmol) and 4,4,4-trifluoro-3-oxo-butyronitrile (9.0 g, 65
mmol) in ethanol (50 mL) was treated with cone HCl (5.0 mL, 60
mmol) and the resultant mixture was heated to reflux overnight. The
solvent was removed in vacuo and the residue was dissolved in EtOAc
and neutralized with saturated Na.sub.2CO.sub.3 solution. The
organic layer was dried (Na.sub.2SO.sub.4), concentrated in vacuo
and purified by pre-HPLC to give
2-(6-methyl-pyridin-3-yl)-5-trifluoromethyl-2H-pyrazol-3-ylamine
(1.3 g, 10% yield over 2 steps). .sup.1HNMR (400 MHz, CDCl.sub.3)
.delta. 9.17 (d, J=1.6 Hz, 1H), 8.40 (dd, J=8.4, 2.4 Hz, 1H), 7.62
(d, J=8.4 Hz, 1H), 5.97 (s, 1H), 2.80 (s, 3H); MS (ESI) m/z: 243.2
(M+H.sup.+).
Example B28
[0321] A solution of ethyl cyclopentanecarboxylate (prepared by
esterification of commercially available Cyclopentanecarboxylic
acid, 30 g, 0.21 mol) and acetonitrile (10.1 g, 0.25 mtool) in dry
THF (80 mL) was added dropwise to a suspension of NaH (12.5 g, 0.31
mol) in dry THF (80 mL) and the resulting mixture was refluxed
overnight. The reaction mixture was concentrated under reduced
pressure and partitioned between water and EtOAc. The aqueous layer
was separated, adjusted to pH 8 and extracted with EtOAc. The
combined extracts were washed with brine, dried (MgSO.sub.4), and
concentrated to give 3-cyclopentyl-3-oxopropanenitrile (26 g, 90%
yield), which was used in the next step without further
purification. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 4.06 (s,
2H), 2.92 (m, 1H), 1.41-1.77 (m, 8H).
[0322] Hydroxylamine hydrochloride (6 g, 86 mmol) and
3-cyclopentyl-3-oxopropanenitrile (10 g, 73 mmol) were added to a
solution of NaOH (9 g, 225 mmol) in water (100 mL) and the
resulting mixture was heated at 50.degree. C. overnight. The
precipitate was collected by filtration, washed with water, and
dried to give 3-cyclopentylisoxazol-5-amine (6.7 g, 61% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 6.43 (s, 2H), 4.77 (s,
1H), 2.84 (m, 1H), 1.87-1.51 (m, 8H); MS (ESI) m/z: 153.1
(M+H.sup.+).
Example B29
[0323] A solution of nBuLi in hexanes (242 mL, 387 mmol) was added
to a -78.degree. C. solution of diisopropylamine (39.1 g, 387 mmol)
in anhydrous THF (300 mL) and the resultant mixture was stirred for
30 min at -78.degree. C. A solution of ethyl
cyclopentanecarboxylate (50 g, 352 mmol) in anhydrous THF (150 mL)
was added dropwise into the mixture and the reaction mixture was
stirred at -78.degree. C. for 1 h. Iodomethane (79.2 g, 558 mmol)
was added dropwise and the resulting mixture was warmed to RT and
stirred overnight. The mixture was poured into water and extracted
with ethyl ether. The combined extracts were washed with brine,
dried (MgSO.sub.4) and concentrated in vacuo to give ethyl
1-methylcyclopentanecarboxylate (47 g, 85%). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 4.03 (q, J=7.2 Hz, 2H), 1.37-2.03 (m, 8H),
1.15-1.12 (m, 6H).
[0324] Ethyl 1-methylcyclopentanecarboxylate (47 g, 301 mmol),
acetonitrile (14.5 g, 363 mmol), NaH (18 g, 450 mmol), NaOH (6.8 g,
170 mmol) and hydroxylamine hydrochloride (4 g, 57 mmol) were
sequentially combined by a procedure analogous to Example B28 to
provide 3-(1-methylcyclopentyl)isoxazol-5-amine (7 g, 70% yield
over 2 steps). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 6.41
(s, 2H), 4.81 (s, 1H), 1.91-1.86 (m, 2H), 1.67-1.48 (m, 6H), 1.19
(s, 3 H); MS (ESI) m/z: 167.1 (M+H.sup.+).
Example B30
[0325] To a suspension of Na.sub.2CO.sub.3 (36 g, 339 mmol) in
CH.sub.2Cl.sub.2 (300 mL) was added 1-t-butyl-1H-pyrazole from
Example B19 (21 g, 170 mmol) and Br.sub.2 (9 mL), and the resulting
mixture was stirred at RT overnight. The solid was removed by
filtration and the filter cake was washed with CH.sub.2Cl.sub.2.
The filtrates were washed with water and brine, dried (MgSO.sub.4),
and concentrated to give crude 4-bromo-1-t-butyl-1H-pyrazole (29 g,
85%), used without further purification. .sup.1H NMR (300 MHz,
CDCl.sub.3): .delta. 7.49 (s, 1H), 7.45 (s, 1H), 1.53 (s, 9H); MS
(ESI) m/z: 203 [M+H].sup.+.
[0326] To a -78.degree. C. solution of
4-bromo-1-t-butyl-1H-pyrazole (15 g, 74.3 mmol) in anhydrous THF
(100 mL) was added n-BuLi (2.5 M in hexane, 53 mL, 132 mmol) under
N.sub.2, and the resulting mixture was stirred at -78.degree. C.
for 30 min. Excess dry ice was added at -78.degree. C., and the
mixture was warmed slowly to RT and stirred overnight. The reaction
was concentrated in vacuo, water was added and the pH was adjusted
to pH 3 by the addition of 2N aq HCl. The aqueous solution was
extracted with EtOAc. The extracts were washed with brine, dried
(MgSO.sub.4) and concentrated in vacuo. The residue was
recrystallized (EtOAc-pet. ether) to give
1-t-butyl-1H-pyrazole-4-carboxylic acid (8.0 g, 67% yield). .sup.1H
NMR (300 MHz, CDCl.sub.3): .delta. 8.10 (s, 1H), 8.03 (s, 1H), 1.64
(s, 9H); MS (ESI) m/z: 168.9 [M+H].sup.+.
Example B31
[0327] Cyclopentyl-3-oxopropanenitrile (8 g, 0.058 mol),
methylhydrazine (40% aqueous, 32.5 g, 0.29 mol) and cone. HCl (40
mL, 0.48 mol) were combined in EtOH (200 mL) and the reaction
mixture was heated at reflux overnight. The mixture was
concentrated in vacuo, poured into water and washed with EtOAc
(3.times.100 mL). The aqueous portion was basified to pH 8 with aq
NaHCO.sub.3 and the mixture was extracted with EtOAc (3.times.100
mL). The extracts were washed with brine, dried (Na.sub.2SO.sub.4)
and concentrated in vacuo. Crystallization firom EtOAc afforded
5-cyclopentyl-2-methyl-2H-pyrazol-3-ylamine (2.1 g, 22% yield).
.sup.1HNMR (400 MHz, DMSO-d.sub.6): .delta. 5.05 (s, 1H), 4.95 (s,
2H), 3.39 (s, 3H), 2.75 (m, 1H), 1.78 (m, 2H), 1.62-1.50 (m, 6H);
MS (ESI) m/z: 166.2 [M+H].sup.+.
Example B32
[0328] In a mixture of saturated sodium bicarbonate:toluene:ethanol
(1:2:1) (20 mL) was dissolved methyl
2-tert-butyl-4-chloropyrimidine-5-carboxylate (2.71 g, 11.85 mmol),
phenylboronic acid (2.88 g, 23.7 mmol) and to this was added
tetrakis-(triphenylphosphine)palladium(0) (300 mg). The reaction
stirred at 75.degree. C., under Ar, overnight. After dilution with
ethyl acetate (75 mL) and water (75 mL), the mixture was filtered
through Celite and the organic phase separated. The organic phase
was washed with 5% citric acid (75 mL), brine (75 mL), dried
(Na.sub.2SO.sub.4) and evaporated at reduced pressure to give a
semi solid/oil. The solid was purified by chromatography (Biotage
Si-40 column, 5-30% ethyl acetate/Hex-900 mL) to give a clear thick
oil, which solidified to a white solid identified as methyl
2-tert-butyl-4-phenylpyrimidine-5-carboxylate (2.58 g, 81% yield).
.sup.1H NMR (300 MHz, DMSO-d.sub.6), .delta. 1.39 (s, 9H), 3.70 (s,
3H), 7.49-7.52 (m, 3H), 7.61-7.63 (m, 2H), 9.04 (s, 1H); MS (ESI)
m/z: 271.3 (M+H.sup.+).
[0329] In a 1:1:1 mix of methanol:dioxane:water (15 mL) was placed
methyl 2-tert-butyl-4-phenylpyrimidine-5-carboxylate (2.58 g, 9.54
mmol) and lithium hydroxide hydrate (1.20 g, 28.6 mmol). The
solution was stirred at RT overnight. The mix was diluted with
ethyl acetate (70 mL) and washed with 5% citric acid (100 mL). The
organic phase washed with brine, dried (Na.sub.2SO.sub.4) and
evaporated at reduced pressure to give a white solid, identified as
2-tert-butyl-4-phenylpyrimidine-5-carboxylic acid (2.31 g, 94%
yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6), .delta. 1.38 (s, 9H),
7.48-7.50 (m, 3H), 7.64-7.67 (m, 2H), 9.01 (s, 1H), 12.75 (s, 1H);
MS (ESI) m/z: 257.3 (M+H.sup.+).
Example B33
[0330] In ethanol (25 mL) was placed pivalamidine hydrochloride
(1.138 g, 8.33 mmol). This was treated with 21% sodium ethoxide in
ethanol (2.70 g, 8.33 mmol) and stirred at RT for min. To this was
added ethyl 2-(ethoxymethylene)-4,4,4-trifluoro-3-oxobutanoate
(2.00 g, 8.33 mmol) in ethanol (10 mL) and stirred at RT overnight.
The mix was warmed to reflux for 1 hr, cooled to RT and evaporated
at reduced pressure to give a slurry. The slurry was dissolved in a
mix of ethyl acetate (75 mL) and 5% citric acid (75 mL). The
organic phase was washed with brine, dried (Na.sub.2SO.sub.4) and
evaporated at reduced pressure to give a thick oil identified as
ethyl 2-tert-butyl-4-(trifluoromethyl)pyrimidine-5-carboxylate
(1.67 g, 72% yield). MS (ESI) m/z: 277.0 (M+H.sup.+).
Example B34
[0331] Using a procedure analogous to Example B32, methyl
2-tert-butyl-4-chloropyrimidine-5-carboxylate (0.849 g, 3.71 mmol),
N-methylindole-5-boronic acid (1.30 g, 7.43 mmol) and
tetrakis-(triphenylphosphine)palladium(0) (86 mg) were combined to
give methyl
2-tert-butyl-4-(1-methyH-indol-H-indol-5-yl)pyrimidine-5-carboxyla-
te (898 mg, 74% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 1.40 (s, 9H), 3.70 (s, 3H), 3.82 (s, 3H), 6.57 (s, 1H),
7.41-7.44 (m, 2H), 7.53 (d, J=8.6 Hz, 1H), 7.92 (s, 1H), 8.94 (s,
1H); MS (ESI) m/z: 324.0 (M+H.sup.+).
[0332] Using a procedure analogous to Example B32, methyl
2-tert-butyl-4-(1-methyl-1H-indol-5-yl)pyrimidine-5-carboxylate
(898 mg, 2.78 mmol) and lithium hydroxide hydrate (466 mg, 11.11
mmol) were combined to give
2-tert-butyl-4-(1-methyl-1H-indol-5-yl)pyrimidine-5-carboxylic acid
(833 mg, 97% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
1.39 (s, 9H), 3.82 (s, 3 H), 6.54 (s, 1H), 7.40 (s, 1H), 7.52 (m,
2H), 7.94 (s, 1H), 8.91 (s, 1H), 12.70 (s, 1H); MS (ESI) m/z: 310.0
(M+H.sup.+).
Example B35
[0333] A solution of anhydrous acetonitrile (2.3 g, 56 mmol) in THF
(100 mL) was added dropwise at 80.degree. C. to a mixture of NaH
(60%, 2.8 g, 70 mmol) and methyl 2-cyano-2-methylpropanoate (6 g,
47 mmol)in THF (100 mL). The resultant reaction mixture was heated
at reflux for 8 hours. The solvent was removed in vacuo and the
residue was diluted with EtOAc and washed with 10% HCl, water and
brine. The organics were dried (MgSO.sub.4) and concentrated in
vacuo to obtain crude 2,2-dimethyl-3-oxopentanedinitrile (4 g),
which was used for the next step reaction without further
purification.
[0334] A solution of 2,2-dimethyl-3-oxopentanedinitrile (4.0 g, 29
mmol) and phenyl-hydrazine HCl salt (4.6 g, 31 mmol) in EtOH (50
mL) was treated with 2 N HCl solution (10 mL, 20 mmol). The
reaction mixture was heated at reflux for 4 h. After cooling down,
the mixture was neutralized with NaHCO.sub.3 to pH 7-8 and then
extracted with EtOAc (3.times.100 mL). The organics were
concentrated and the residue was purified by chromatography to give
2-(5-amino-1-phenyl-1H-pyrazol-3-yl)-2-methylpropanenitrile (3.5 g,
33% yield, 2 steps). .sup.1HNMR (300 MHz, DMSO-d.sub.6): .delta.
7.56-7.31 (m, 5H), 5.52 (s, 1H), 5.45 (br s, 2H), 1.61 (s, 6H); MS
(ESI) m/z: 227.1 (M+H.sup.+).
[0335] A solution of
2-(5-amino-1-phenyl-1H-pyrazol-3-yl)-2-methyl-propionitrile (1.0 g,
7.4 mmol) and aq NaOH (2 M, 11 mL, 22 mmol) in EtOH (10 mL) was
heated to 70.degree. C. for 12 h. The reaction mixture was
partitioned between ether and water and the aqueous solution was
acidified with HCl to pH 4-5. The aqueous was extracted with EtOAc
(3.times.50 mL) and the extracts were concentrated in vacuo to give
crude 2-(5-amino-1-phenyl-1H-pyrazol-3-yl)-2-methylpropanoic acid
(0.7 g, 39% yield) which was used without further purification.
[0336] Conc. H.sub.2SO.sub.4 (0.5 mL) was added to a solution of
2-(5-amino-1-phenyl-1H-pyrazol-3-yl)-2-methylpropanoic acid (0.7 g,
28.5 mmol) in EtOH (10 mL) and the reaction was heated at
45.degree. C. for 2 h. The reaction solution was neutralized with
aq NaHCO.sub.3 and then extracted with EtOAc (3.times.20 mL). The
combined extracts were washed with aq NaHCO.sub.3 solution, dried
(Na.sub.2SO.sub.4), and concentrated in vacuo to give ethyl
2-(5-amino-1-phenyl-1H-pyrazol-3-yl)-2-methylpropanoate (710 mg,
91% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 7.62 (d,
J=7.6 Hz, 2H), 7.52 (t, J=7.6 Hz, 2H), 7.35 (t, J=7.6 Hz, 1H), 5.47
(s, 1H), 5.35 (br s, 2H), 4.12 (q, J=7.2 Hz, 2H), 1.50 (s, 6H),
1.22 (t, J=7.2 Hz, 3H); MS (ESI) m/z; 274.1 (M+H.sup.+).
Example B36
[0337] A solution of 2,2-dimethyl-3-oxo-pentanedinitrile (9 g, 66
mmol) and methyl-hydrazine (3 g, 66 mmol) in EtOH (100 mL) was
treated with cone HCl (16.5 mL, 198 mmol) and the resulting mixture
was refluxed overnight. The solvent was removed under reduced
pressure and the residue was purified by chromatography to give
2-(5-amino-1-methyl-1H-pyrazol-3-yl)-2-methylpropanenitrile (2.7 g,
25% yield). .sup.1H NMR (300 MHz, CDCl.sub.3): .delta. 5.56 (s,
1H), 3.63 (s, 3H), 1.67 (s, 6H); MS (ESI) m/z: 165.2
[M+H].sup.+.
[0338] A mixture of
2-(5-amino-1-methyl-1H-pyrazol-3-yl)-2-methylpropanenitrile (1.4 g,
8.5 mmol) in EtOH (30 mL) was treated with cone. H.sub.2SO.sub.4 (3
mL) and the resulting mixture was refluxed for 10 days. The
reaction mixture was neutralized with saturated aq NaHCO.sub.3
solution, and the mixture was extracted with EtOAc. The organics
were washed with brine, dried (MgSO.sub.4) and concentrated in
vacuo. Recrystallization (EtOAc/petroleum ether) provided ethyl
2-(5-amino-1-methyl-1H-pyrazol-3-yl)-2-methylpropanoate (0.8 g, 44%
yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 5.13 (s, 1H),
5.04 (s, 2H), 4.00 (q, J=6.9 Hz, 2H), 3.41 (s, 3H), 1.11 (t, J=6.9
Hz, 6H); MS (ESI) m/z: 212.0 [M+H].sup.+.
Example B37
[0339] Sodium metal (13.8 g, 0.5 mol) was added portionwise to
ice-cold anhydrous EtOH (700 mL). After complete dissolution of the
Na, a mixture of 3,3-dimethylbutan-2-one (50 g, 0.5 mol) and oxalic
acid diethyl ester (77 ml, 0.5 mol) was added drop-wise. The
reaction mixture was stirred in ice-salt bath and until TLC
indicated completion of the reaction. Acetic acid (38.1 ml, 0.5
mol) was added and the mixture was stirred at RT for 30 min. The
reaction mixture was cooled in an ice-salt bath and treated with
hydrazine hydrate (29.4 g, 0.5 mol). After complete addition, the
mixture was warmed to RT and stirred until judged complete by TLC.
The reaction mixture was concentrated under reduced pressure and
re-dissolved in EtOAc. The EtOAc solution was washed with
NaHCO.sub.3, brine and water, dried (MgSO.sub.4) and concentrated
in vacuo. The resultant solid was washed with cold petroleum ether
to give ethyl 3-tert-butyl-1H-pyrazole-5-carboxylate (49 g, 50%
yield over two steps) as a white solid. .sup.1H NMR (400 MHz,
CDCl.sub.3): .delta. 6.65 (s, 1H), 4.38 (q, J=6.8 Hz, 2H), 1.39 (t,
J=6.8 Hz, 3H), 1.35 (s, 1 H); MS (ESI) m/z: 197.2 (M+H.sup.+).
Example B38
[0340] Using a procedure analogous to Example B37,
3-methylbutan-2-one (100 g, 1.16 mol) was converted to ethyl
3-isopropyl-1H-pyrazole-5-carboxylate (90 g, 42% yield, two steps)
as an off-white solid. .sup.1H NMR (300 MHz, CDCl.sub.3): .delta.
12.00 (s, 1H), 6.57 (s, 1H), 4.30 (q, J=7.2 Hz, 2H), 3.00 (m, 1H),
1.46 (t, J=7.2 Hz, 3H), 1.28 (d, J=6.8 Hz, 6H); MS (ESI) m/z: 183.3
(M+H.sup.+).
Example B39
[0341] Nitric acid (2 mL) was added to a stirred solution of
indazole (5.0 g, 42 mmol) in acetic acid (40 mL) at 0.degree. C.
The resulting mixture was stirred at RT for 30 min. Acetic
anhydride (6 mL) was added in one portion and the mixture was
stirred at RT overnight. The solvent was removed under reduced
pressure and the residue was purified by chromatography to give
3-nitro-1H-indazole (3.4 g, 49% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 14.46 (s, 1H), 8.12 (m, 1H), 7.76 (m, 1H),
7.57 (m, 1H), 7.48 (m, 1H).
[0342] Conc. H.sub.2SO.sub.4 (2 mL) was added to a suspension of
3-nitro-1H-indazole (3.4 g, 21 mmol) in 2-methyl-propan-2-ol (30
mL) and the resulting mixture was heated to 180.degree. C. in a
steel bomb. The reaction mixture was cooled to RT and diluted with
EtOAc. The organic phase was washed with brine, dried (MgSO.sub.4)
and concentrated to give 1-tert-butyl-3-nitro-1H-indazole (3.4 g,
76%). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.18-8.15 (m,
2H), 7.59-7.49 (m, 2H), 1.76 (s, 9H).
[0343] A mixture of 1-tert-butyl-3-nitro-1H-indazole (3.0 g, 14
mmol) and Pd/C (1 g) in MeOH (50 mL) was hydrogenated (1 atm) at RT
for 2 h. The reaction mixture was filtered and the filtrate was
concentrated and purified by chromatography to give
1-tert-butyl-1H-indazol-3-ylamine (1.7 g, 68% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 7.67 (m, 1H), 7.52 (m, 1H), 7.19
(m, 1H), 6.89 (m, 1H), 5.32 (s, 2H), 1.58 (s, 9H); MS (ESI) m/z:
190.1 [M+H.sup.+].
Example B40
[0344] In ethanol (40 mL) was placed t-butylcarbamidine
hydrochloride (3.71 g, 27.2 mmol). This was treated with 21% sodium
ethoxide in ethanol (8.80 g, 27.2 mmol) and stirred at RT for 15
min. To this was added the diethyl ethoxymethylenemalonate (5.87 g,
27.2 mmol) and the reaction mixture was stirred overnight at RT.
The reaction mixture was refluxed for 1 hour and then cooled to RT.
The solution was evaporated and the residue was dissolved in water
(100 mL) and the pH adjusted to 3-4 (wet litmus) with acetic acid.
The mixture formed a precipitate. The solid collected by
filtration, washed with water (50 mL) and dried under vacuum to
obtain ethyl 2-tert-butyl-4-hydroxypyrimidine-5-carboxylate (2.18
g, 36% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 12.6
(brs, 1H), 8.44 (s, 1H), 4.20 (q, J=7.2 Hz, 2H), 1.25 (s, 9H), 1.23
(t, J=7.2 Hz, 3H); MS (ESI) m/z: 225.0 (M+H.sup.+).
[0345] In cold (.about.0.degree. C.) POCl.sub.3 (20 mL) was dropped
triethylamine (0.55 mL) with stirring. To this was added in parts
of ethyl 2-tert-butyl-4-hydroxypyrimidine-5-carboxylate (2.18 g,
9.72 mmol). The mixture then warmed to 40.degree. C. and stirred
under Argon for 1 hour. The mixture was evaporated until free of
POCl.sub.3, diluted with CHCl.sub.3 (100 mL) and poured carefully
into ice (300 mL). The solution was stirred at RT to melt. The
organic phase was separated, washed with sodium bicarbonate (100
mL), water (100 mL) and dried (Na.sub.2SO.sub.4). The solvents
evaporated to give ethyl
2-tert-butyl-4-chloropyrimidine-5-carboxylate (2.0 g, 85% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.12 (s, 1H), 4.34 (q,
J=6.8 Hz, 2H), 1.33 (s, 9H), 1.27 (t, J=6.8 Hz, 3H); MS (ESI) m/z:
243.0 (M+H.sup.+).
[0346] To a solution of ethyl
2-tert-butyl-4-chloropyrimidine-5-carboxylate (0.30 g, 1.24 mmol)
in NMP (3 mL) was added morpholine (0.54 g, 6.16 mmol) and it was
heated at 80.degree. C. for 1.5 hour. The reaction was checked by
LC-MS, water was added and the solution was extracted with ethyl
acetate (3.times.). The organic layer was washed with brine, dried
(Na.sub.2SO.sub.4) and solvent was removed to obtain tert-butyl
4-(5-(3-tert-butyl-5-(ethoxycarbonyl)-1H-pyrazol-1-yl)pyridin-2-yl)pipera-
zine-1-carboxylate. MS (ESI) m/z: 294.0 (M+H.sup.+).
[0347] To a stirring suspension of ethyl
2-tert-butyl-4-morpholinopyrimidine-5-carboxylate (0.36 g, 1.24
mmol) in 1:1:1 THF/EtOH/H.sub.2O (9 ml) at RT was added
LiOH.H.sub.2O (130 mg, 4.95 mmol) and the mixture was stirred
overnight at RT. The reaction mixture was checked by LC-MS and the
completed reaction was concentrated to an aqueous residue,
acidified (pH 3-4) with 3M HCl and the solution was extracted with
EtOAc (3.times.). The combined organics were washed with brine
(1.times.), dried (MgSO4), filtered and concentration. The crude
was dissolved in isopropanol and the solid (LiCl and NaCl) was
filtered and washed with isopropanol. The filtrate was concentrated
to obtain the desired product
2-tert-butyl-4-morpholinopyrimidine-5-carboxylic acid (0.15 g, 46%
yield). MS (ESI) m/z: 266.0 (M+H.sup.+).
Example B41
[0348] In a mix of sat'd NaHCO.sub.3:toluene:ethanol (1:2:1) (8 mL)
was dissolved ethyl 2-tert-butyl-4-chloropyrimidine-5-carboxylate
from Example B40 (300 mg, 1.24 mmol), 3-fluorophenylboronic acid
(350 mg, 2.47 mmol) and to this was added
tetrakis(triphenylphosphine)palladium(0) (29 ing). The mixture was
heated overnight at 75.degree. C. under Ar. The mixture was diluted
with EtOAc (25 mL) and water (25 mL). The mixture was filtered to
remove insolubles and the organic phase separated, washed with 5%
citric acid (25 mL), then saturated sodium bicarbonate (25 mL) and
brine (25 mL). The solvents evaporated at reduced pressure and the
residue purified by silica gel column chromatography (Biotage: 25M,
5-50% EtOAc/Hex-550 mL) to give ethyl
2-tert-butyl-4-(3-fluorophenyl)pyrimidine-5-carboxylate (0.27 g,
72% yield).
[0349] Using a procedure to Example B40,
2-tert-butyl-4-(3-fluorophenyl)pyrimidine-5-carboxylate (0.27 g,
0.89 mmol) was treated with LiOH.H.sub.2O (86 mg, 3.57 mmol) to
afford 2-tert-butyl-4-morpholinopyrimidine-5-carboxylic acid (0.23
g, 92% yield). MS (ESI) m/z: 275.0 (M+H.sup.+).
Example B42
[0350] Using a procedure analogous to Example B41, ethyl
2-tert-butyl-4-chloropyrimidine-5-carboxylate from Example B40
(0.30 g, 1.24 mmol) and pyridin-3-ylboronic acid (1.8 g, 1.48 mmol)
in presence of tetrakis(triphenylphosphine)palladium(0) (71 mg,
0.062 mmol) were combined to afford ethyl
2-tert-butyl-4-(pyridin-3-yl)pyrimidine-5-carboxylate (0.10 g, 28%
yield).
[0351] Using a procedure analogous to Example B39, ethyl
2-tert-butyl-4-(pyridin-3-yl)pyrimidine-5-carboxylate (0.17 g, 0.60
mmol) was treated with LiOH.H.sub.2O (57 mg, 2.38 mmol) to afford
2-tert-butyl-4-(pyridin-3-yl)pyrimidine-5-carboxylic acid (0.11 g,
72% yield). MS (ESI) m/z: 258.0 (M+H.sup.+).
Example B43
[0352] Using a procedure analogous to Example B40, ethyl
2-tert-butyl-4-chloropyrimidine-5-carboxylate from Example B40
(0.30 g, 1.24 mmo) and 1-methylpiperazine (0.62 g, 6.18 mmol) in
presence of NMP (catalytic amount) were combined to afford
2-tert-butyl-4-(4-methylpiperazin-1-yl)pyrimidine-5-carboxylic acid
(0.11 g, 32% yield). MS (ESI) m/z: 279.0 (M+H.sup.+).
Example B44
[0353] Using a procedure analogous to Example B40,
2-tert-butyl-4-chloropyrimidine-5-carboxylate from Example B40
(0.30 g, 1.24 mmo) and tert-butyl piperazine-1-carboxylate (1.15 g,
6.18 mmol) in presence of NMP (catalytic amount) were combined to
afford
4-(4-(tert-butoxycarbonyl)piperazin-1-yl)-2-tert-butylpyrimidine-5-carbox-
ylic acid (0.36 g, 80% yield). MS (ESI) m/z: 365.0 (M+H.sup.+).
Example B45
[0354] In ethanol (10 mL) was placed the tert-butylhydrazine
hydrochloride (1.35 g, 10.8 mmol) and ethyl
2-((dimethylamino)methylene)-3-oxobutanoate (2.00 g, 10.8 mmol).
The mixture warmed to reflux and stirred for 2 hrs, cooled to RT
and stirred overnight. The mixture was evaporated at reduced
pressure to give an oil which was dissolved in ether (25 mL) and
washed successively with water (25 mL), saturated sodium
bicarbonate (25 mL) and brine (25 mL), dried (Na.sub.2SO.sub.4),
evaporated at reduced pressure and purified by chromatography
(Biotage S1-25 column, 10-40% ethyl acetate/Hex) to give ethyl
1-tert-butyl-5-methyl-1H-pyrazole-4-carboxylate (1.48 g, 65% yield)
as an oil. MS (ESI) m/z: 211.0 (M+H.sup.+).
[0355] In a mixture of ethanol:water:dioxane (1:1:1, 21 mL) was
placed ethyl 1-tert-butyl-5-methyl-1H-pyrazole-4-carboxylate (1.48
g, 7.04 mmol) and lithium hydroxide hydrate (886 mg, 21.12 mmol).
The reaction was stirred at 40.degree. C. for 3 hrs and then at RT
overnight. The reaction was diluted with water (25 mL) and ether
(25 mL). The ether layer was discarded and the aqueous phase made
acidic (pH.about.=4) with 1N HCl. The acidic phase was then
extracted with ethyl acetate (2.times.25 mL) and the combined ethyl
acetate layers were washed with brine, dried (Na.sub.2SO.sub.4),
evaporated at reduced pressure to give
1-tert-butyl-5-methyl-1H-pyrazole-4-carboxylic acid as a white
solid (1.12 g, 87% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 1.56 (s, 9H), 2.67 (s, 3H), 7.65 (s, 1H), 12.13 (s, 1H); MS
(ESI) m/z: 183.0 (M+H.sup.+).
Example B46
[0356] Using a procedure analogous to Example B45, ethyl
1-tert-butyl-5-(trifluoromethyl)-1H-pyrazole-4-carboxylate (750 mg,
2.84 mmol) was converted to
1-tert-butyl-5-(trifluoromethyl)-1H-pyrazole-4-carboxylic acid (646
mg, 94% yield) using lithium hydroxide hydrate (357 mg, 8.51 mmol).
.sup.1H NMR (300 MHz, DMSO-d.sub.6), .delta. 1.63 (s, 9H), 7.92 (s,
1H); MS (ESI) m/z: 259.0 (M+Na.sup.+).
Example B47
[0357] Using a procedure analogous to Example B 17,
1-(2-(dimethylamino)-2-oxcethyl)-5-isopropyl-1H-pyrazole-3-carboxylic
acid was synthesized from ethyl
3-isopropyl-1H-pyrazole-5-carboxylate as a white solid (0.35 g).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 6.56 (s, 1H), 5.21 (s,
2H), 3.10 (s, 3H), 2.92-2.88 (m, 4H), 1.31 (t, J=7.2 Hz, 3H), 1.20
(d, J=6.8 Hz, 6H); MS (ESI) m/z: 240.0 (M+H.sup.+).
Example B48
[0358] NaH (6.8 g, 0.17 mol) was added portionwise to a 0.degree.
C. solution of 1H-pyrazole (10 g, 0.15 mol) in DMF (150 mL) and the
resulting mixture was stirred at room temperature for min.
2-Iodopropane (30 mL, 0.3 mol) was added dropwise to the above
mixture at 0.degree. C., then the reaction mixture was stirred at
room temperature for 10 h. H.sub.2O was added and the mixture was
extracted with ethyl ether (3.times.100 mL). The combined organic
layers were washed with brine, dried over Na.sub.2SO.sub.4, and
concentrated in vacuo. The residue was distilled under reduced
pressure to afford 1-isopropyl-1H-pyrazole (6.6 g, 40% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 7.68 (d, J=1.6 Hz,
1H), 7.38 (d, J=1.2 Hz, 1H), 6.17 (t, J=2.0 Hz, 1H), 4.46 (m, 1H),
1.37 (d, J=6.8 Hz, 6H).
[0359] To a solution of 1-isopropyl-1H-pyrazole (5 g, 45.5 mmol) in
conc.H.sub.2SO.sub.4 (50 mL) was added KNO.sub.3 (5.0 g, 50 mmol)
portion wise at 0.degree. C. After the addition, the resulting
mixture was heated to 50 0.degree. C. for 8 h. The reaction mixture
was cooled to room temperature and poured into ice water, and the
mixture was extracted with EtOAc. The combined organics were washed
with saturated Na.sub.2CO.sub.3 solution, brine, and were dried
over Na.sub.2SO.sub.4, and concentrated in vacuo. Chromatography on
silica gel provided 1-isopropyl-4-nitro-1H-pyrazole (3.2 g, 46%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.99 (s, 1H),
8.32 (s, 1H), 4.65 (m, 1H), 1.51 (d, J=6.8 Hz, 6 H).
[0360] A solution of 1-isopropyl-4-nitro-1H-pyrazole (3 g, 19 mmol)
in EtOH (30 mL) was stirred under a hydrogen atmosphere for 2 h in
the presence of 10% Pd/C (300 mg). The catalyst was removed by
filtration and the filtrate was concetrated under reduced pressure
to afford 1-isopropyl-1H-pyrazol-4-ylamine (1.8 g, 75.0% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 6.99 (s, 1H), 6.84 (s,
1H), 4.23 (m, 1H), 3.70 (s, 2H), 1.28 (d, J=6.8 Hz, 6H); MS (ESI)
m/z: 126.2[M+H].sup.+.
Example B49
[0361] In cold (.about.0.degree. C.) phosphorous oxychloride (40
mL) was carefully added triethylamine (1.87 mL) with stirring. To
this was added, in parts, ethyl
4-hydroxy-2-methylpyrimidine-5-carboxylate (5.00 g, 27.4 mmol). The
mixture then warmed to 40.degree. C. and stirred under Argon for 2
hours. The mixture was evaporated free of phosphorous oxychloride,
diluted with chloroform (150 mL) and poured carefully into ice
(.about.400 mL) and allowed to warm to RT. The organic phase was
separated, washed with saturated sodium bicarbonate (75 mL), then
brine (100 mL) and dried over sodium sulfate. The solvents
evaporated to give a thick oil which was purified by chromatography
(Biotage Si-40 column, 15-40% ethyl acetate/hexane) to give ethyl
4-chloro-2-methylpyrimidine-5-carboxylate as a clear oil (2.96 g,
53% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 1.31 (t,
3H), 2.66 (s, 3H), 4.34 (q, 2H), 9.06 (s, 1H); MS (ESI) m/z: 201.0
(M+H.sup.+).
[0362] In a mixture of saturated NaHCO.sub.3:toluene:ethanol
(1:2:1) (12 mL) was dissolved ethyl
4-chloro-2-methylpyrimidine-5-carboxylate (500 mg, 2.49 mmol),
N-methylindole-5-boronic acid (872 mg, 4.98 mmol) and to this was
added tetrakis(triphenylphosphine)-palladium(0) (58 mg). The
reaction stirred at 75.degree. C., under Ar, overnight. The
reaction was allowed to cooled to RT, diluted with ethyl acetate
(25 mL) and water (25 mL) and filtered free of insolubles. The
organic phase was washed with 5% citric acid (25 mL), saturated
sodium bicarbonate (25 mL) and brine (25 mL), evaporated at reduced
pressure to give a reddish thick foam, and purified by
chromatography (Biotage Si-25 column, 15-40% ethyl acetate/hexane)
to give ethyl
2-methyl-4-(1-methyl-1H-indol-5-yl)pyrimidine-5-carboxylate as a
thick clear oil. The oil solidified overnight (391 mg, 53% yield).
MS (ESI) m/z: 296.0 (M+H.sup.+).
[0363] In a mix of ethanol:water:dioxane (1:1:1, 9 mL) was placed
ethyl 2-methyl-4-(1-methyl-1H-indol-5-yl)pyrimidine-5-carboxylate
(391 mg, 1.324 mmol) and lithium hydroxide hydrate (222 mg, 5.30
mmol). The mix stirred at RT overnight. The mix was diluted with
ethyl acetate (25 mL) and 5% citric acid (20 mL). The organic phase
was separated, washed with brine (20 mL) and dried over sodium
sulfate. The solvent was evaporated at reduced pressure to give
2-methyl-4-(1-methyl-1H-indol-5-yl)pyrimidine-5-carboxylic acid as
a tan solid (132 mg, 37% yield). MS (ESI) m/z: 268.0
(M+H.sup.+).
Example B50
[0364] A mixture of 1,1,3,3-tetramethoxypropane (13.6 g, 83 mmol)
and N2-cyclopentyl-N-(tert-butoxycarbonyl)hydrazine (16.6 g, 83
nmol, see Ranatunge et al., J. Med. Chem. (2004), 47, p2180-2193)
in water (150 mL) was treated with cone. HCl (21 mL, 252 mmol). The
resulting mixture was heated at reflux overnight. The completed
reaction mixture was extracted with ether and the extracts were
washed with brine, dried over anhydrous MgSO.sub.4, and
concentrated in vacuo to give 1-cyclopentyl-1H-pyrazole (8.0 g, 71%
yield. .sup.1H NMR (400 MHz, CDCl.sub.3): .delta. 7.52 (s, 1H),
7.43 (s, 1H), 6.24 (s, 1H), 4.68 (m, 1H), 2.20-1.71 (m, 8H). MS
(ESI) m/z: 137.1 [M+H].sup.+.
[0365] To a suspension of Na.sub.2CO.sub.3 (13 g, 124 mmol) in
CH.sub.2CL.sub.2 (100 mL) was added 1-cyclopentyl-1H-pyrazole (8.35
g, 62 mmol) and Br.sub.2 (3.2 mL). The resulting mixture was
stirred at RT overnight. The solid was removed by filtration and
the filter cake was washed with DCM. The combined filtrates were
washed with water, brine and dried over anhydrous MgSO.sub.4. The
solvent was concentrated to dryness to give
4-bromo-1-cyclopentyl-1H-pyrazole (14 g, 93%). .sup.1H NMR (300
MHz, CDCl.sub.3): .delta.7.46 (s, 1H), 7.44 (s, 1H), 4.64 (m, 1H),
2.18-1.67 (m, 8H); MS (ESI) m/z: 215.0 [M+H].sup.+.
[0366] Using the procedure of Example B30,
4-bromo-1-cyclopentyl-1H-pyrazole (9.0 g, 42 mmol), n-BuLi (2.5 M,
18.5 mL, 46.2 mmol) and CO.sub.2 were combined to provide
1-cyclopentyl-1H-pyrazole-4-carboxylic acid (3.5 g, 47% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.31 (s, 1H), 7.85 (s,
1H), 4.78 (m, 1H), 1.70-2.56 (m, 8H); MS (ESI) m/z: 181.1
[M+H].sup.+.
Example C1
[0367] A solution of ethyl
4-chloro-2-(methylthio)pyrimidine-5-carboxylate (42 g, 181 mmol) in
EtOH (400 mL) was treated with a solution of methylamine (12.3 g,
397 mmol) in EtOH (100 mL) at 0.degree. C. and the mixture was
stirred for 3 h. The mixture was concentrated and then partitioned
between H.sub.2O (200 mL) and CH.sub.2Cl.sub.2 (500 mL). The
organic layer was washed with brine, dried (Na.sub.2SO.sub.4) and
concentrated in vacuo to give ethyl
4-(methylamino)-2-(methylthio)pyrimidine-5-carboxylate as a white
solid (36.0 g, 88% yield). .sup.1H NMR (300 MHz, CDCl.sub.3): 8.59
(s, 1H), 8.18 (br s, 1H), 4.31 (q, J=7.2 Hz, 2H), 3.05 (d, J=4.8
Hz, 3H), 2.52 (s, 3H), 1.34 (t, J=7.2 Hz, 3H); MS (ESI) m/z: 228.1
(M+H.sup.+).
[0368] To a solution of ethyl
4-(methylamino)-2-(methylthio)pyrimidine-5-carboxylate (30 g, 132
mmol) in THF (300 mL) was added LiAlH.sub.4 (7.5 g, 198 mmol). The
reaction mixture was stirred for 1 h at RT. The reaction was
carefully quenched with 10 mL water and 7 mL of 10% aq NaOH. The
mixture was stirred for 1 h, filtered and the filtrate was
concentrated to give
(4-(methylamino)-2-(methylthio)pyrimidin-5-yl)methanol (22.0 g, 90%
yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): 7.79 (s, 1H), 6.79 (m,
1H), 5.04 (t, J=5.4 Hz, 1H), 4.27 (d, J=5.4 Hz, 2 H), 2.83 (d,
J=4.8 Hz, 3H), 2.40 (s, 3H). MS (ESI) m/z: 186.1 (M+H.sup.+).
[0369] A mixture of
(4-(methylamino)-2-(methylthio)pyrimidin-5-yl)methanol (22.0 g, 119
mmol) and MnO.sub.2 (44 g, 506 mmol) in CHC.sub.3 (300 mL) was
stirred at RT for 3 h. The reaction was filtered and the filtrate
was concentrated to give
4-(methylamino)-2-(methylthio)pyrimidine-5-carbaldehyde as a pale
solid (20 g, 92% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): 9.71
(s, 1H), 8.60 (br s, 1H), 8.49 (s, 1H), 2.96 (d, J=4.8 Hz, 3H),
2.48 (s, 3H) MS (ESI) m/z: 184.0 (M+H.sup.+).
Example C2
[0370] To a 0.degree. C. solution of ethyl
4-chloro-2-(methylthio)pyrimidine-5-carboxylate (19 g, 82 mmol) in
CH.sub.3CN (100 mL) was added a solution of aqueous ethylamine
(70%, 8.1 g, 126 mmol). The resulting mixture was stirred at RT for
8 h. The organic solution was removed under reduced pressure, and
the residue was partitioned between EtOAc and H.sub.2O. The aqueous
layer was extracted with ethyl acetate (3.times.30 mL) and the
combined organics were washed with brine, dried (MgSO.sub.4) and
concentrated to give ethyl
4-(ethylamino)-2-(methylthio)pyrimidine-5-carboxylate (19.5 g,
99.1% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.49 (s,
1H), 8.26 (t, J=4.8 Hz, 1H), 4.23 (q, J=7.2 Hz, 2H), 3.48 (q, J=7.2
Hz, 2H), 2.44 (s, 3H), 1.26 (t, J=7.2 Hz, 3H), 1.13 (t, J=7.2 Hz,
3H).
[0371] To a solution of ethyl
4-(ethylamino)-2-(methylthio)pyrimidine-5-carboxylate (19.5 g, 81.9
mmol) in anhydrous THF (100 mL) was added LiAlH.sub.4 (12.3 g,
327.6 mmol) in portions at 0.degree. C. under N.sub.2 atmosphere.
After stirring for 30 min, the reaction was quenched with water and
then 2N aqueous NaOH as added. The suspension was filtered and the
filtrate was concentrated to afford
(4-(ethylamino)-2-(methylthio)pyrimidin-5-yl)methanol (15 g, 92.0%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 7.78 (s, 1H),
6.74 (t, J=4.8 Hz, 1H), 5.05 (t, J=5.2 Hz, 1H), 4.26 (d, J=5.2 Hz,
2H), 3.36 (m, 2H), 2.37 (s, 3H), 1.10 (m, 3H).
[0372] Activated MnO.sub.2 (52 g, 0.6 mol) was added to a solution
of (4-(ethylamino)-2-(methylthio)pyrimidin-5-yl)methanol (15 g,
0.075 mol) in CH.sub.2CL.sub.2 (300 mL) and the reaction mixture
was stirred overnight at RT. The reaction solution was filtered and
the filtrate was concentrated to give
4-(ethylamino)-2-(methylthio)pyrimidine-5-carbaldehyde (14 g, 93%
yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 9.71 (s, 1H),
8.67 (br s, 1H), 8.49 (s, 1H), 3.51 (m, 2H), 2.48 (s, 3H), 1.17 (t,
J=7.2 Hz, 3H).
Example C3
[0373] To a solution of ethyl 4,6-dichloronicotinate (5 g, 22.8
mmol) in CH.sub.3CN (30 mL) was added dropwise aqueous methylamine
(65%, 5.2 g, 45.6 mmol) at 0.degree. C. The resulting mixture was
stirred at RT for 8 h. The organic solution was removed under
reduced pressure to give the crude product, which was suspended in
H.sub.2O and extracted with EtOAc (3.times.20 mL).
[0374] The combined extracts were washed with brine, dried
(MgSO.sub.4) and concentrated to give ethyl
6-chloro-4-(methylamino)nicotinate (4 g, 82% yield), which was used
in the next step without further purification. .sup.1HNMR (300 MHz,
DMSO-d.sub.6): .delta. 8.48 (s, 1H), 8.04 (d, J=4.5 Hz, 1H), 6.71
(s, 1H), 4.27 (q, J=6.9 Hz, 2H), 2.85 (d, J=5.1 Hz, 3H), 1.29 (t,
J=6.9 Hz, 3H).
[0375] To a 0.degree. C. solution of ethyl
6-chloro-4-(methylamino)nicotinate (4 g, 18.7 mmol) in THF (40 mL)
was added LiAlH.sub.4 (1.4 g, 37.4 mmol) portionwise under N.sub.2
atmosphere. After stirring for 20 min, the reaction was quenched by
cautious addition of water followed by aqueous solution of 2 N
NaOH. The suspension was filtered and the filtrate was concentrated
to afford (6-chloro-4-(methylamino)pyridin-3-yl)methanol (2.9 g,
90.6% yield), which was used in next step without purification.
.sup.1HNMR (400 MHz, DMSO-d.sub.6): .delta. 7.96 (s, 1H), 6.63 (s,
1H), 6.46 (s, 1H), 5.04 (s, 1H), 4.39 (m, 2H), 2.81-2.68 (m,
3H).
[0376] A mixture of (6-chloro-4-(methylamino)pyridin-3-yl)methanol
(2.9 g, 16.7 mmol) and MnO.sub.2 (11.7 g, 133.6 nmol) in anhydrous
DCM (25 mL) was stirred at 30.degree. C. for 6 h. The reaction
mixture was cooled to RT, and filtered. The filtrate was
concentrated in vacuo to give
6-chloro-4-(methylamino)nicotinaldehyde (2.5 g, 87% yield).
.sup.1HNMR (400 MHz, DMSO-d.sub.6): .delta. 9.83 (s, 1H), 8.52 (br
s, 1H), 8.40 (s, 1H), 6.75 (s, 1H), 2.87 (d, J=5.8 Hz, 3H); MS
(ESI) m/z: 171.0 [M+H].sup.+.
Example C4
[0377] Ethyl 4-chloro-2-(methylthio)pyrimidine-5-carboxylate (17 g,
73 mmol) and cyclopentylamine (12.4 g, 146 mmol) were combined by
the 3-step procedure of Example C1 to provide
4-cyclopentylamino-2-methylsulfanyl-pyrimidine-5-carbaldehyde (8.5
g, 49% yield over 3 steps). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.73 (s, 1H), 8.55 (d, J=6.4 Hz, 1H), 8.51 (s, 1H), 4.43
(m, 1H), 2.50 (s, 3H, obscured by DMSO), 2.03-1.98 (m, 2H),
1.69-1.48 (m, 6H); MS (ESI) m/z: 238.3 [M+H].sup.+.
Example C5
[0378] To a solution of ethyl 4,6-dichloronicotinate (4.4 g, 20
mmol) in CH.sub.3CN (50 mL) was added dropwise a solution of
ethylamine in water (65%, 2.7 g, 39 mmol) at 0.degree. C., then the
resulting mixture was stirred at RT overnight. The reaction was
concentrated and the residue was washed with water to give ethyl
6-chloro-4-(ethylamino)nicotinate (3.9 g, 91% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 8.51 (s, 1H), 8.08 (s, 1H), 6.53
(m, 1H), 4.19 (q, J=7.2 Hz, 2 H), 2.78 (q, J=7.2 Hz, 2H), 1.28 (t,
J=7.2 Hz, 3H), 1.13 (t, J=7.2 Hz, 3H); MS (ESI) m/z: 229.1
[M+H].sup.+.
[0379] To a solution of ethyl 6-chloro-4-(ethylamino)nicotinate
(3.9 g, 17 nmol) in anhydrous THF (50 mL) was added LiAH.sub.4 (3.6
g, 95 mmol) at -50.degree. C., then the resulting mixture was
allowed to warm to 0.degree. C. and stirred for 1 h. Then the
mixture was quenched by the addition of 10% aq NaOH solution (3.6
mL). The mixture was filtered and the filtrate was partitioned
between water and EtOAc. The aqueous layer was extracted with EtOAc
(3.times.100 mL). The combined organics were washed with brine,
dried (MgSO.sub.4) and concentrated in vacuo to provide to
(6-chloro-4-(ethylamino)pyridin-3-yl)methanol (2.5 g, 79% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 7.84 (s, 1H), 76.55
(s, 1H), 6.17 (m, 1H), 5.25 (t, J=5.2 Hz, 1H), 4.44 (q, J=7.2 Hz,
2H), 3.23 (m, 2H), 1.23 (t, J=7.2 Hz, 3H).
[0380] To a solution of
(6-chloro-4-(ethylamino)pyridin-3-yl)methanol (2.5 g, 13.4 mmol) in
DCM (30 mL) was added MnO.sub.2 (5.8 g, 67 mmol), then the reaction
mixture was stirred at RT overnight. The reaction mixture was
filtered and the filtrate was concentrated in vacuo to give
6-chloro-4-(ethylamino)nicotinaldehyde (2.2 g, 89% yield).
.sup.1H-NMR (400 MHz, CDCl.sub.3): .delta. 9.82 (s, 1H), 8.51 (br
s, 1H), 8.27 (s, 1H), 6.56 (s, 1H), 3.28 (m, 2H), 1.31 (t, J=7.2
Hz, 3H); MS (ESI) m/z: 185.0 [M+H].sup.+.
Example C6
[0381] To a solution of ethyl
4-chloro-2-(methylthio)pyrimidine-5-carboxylate (15 g, 64.7 mmol)
in CH.sub.3CN (100 mL) was added dropwise a solution of
isopropylamine in water (7.6 g, 0.13 mol) at 0.degree. C. The
resulting mixture was stirred at RT for 8 h. The organic solution
was removed under reduced pressure and the residue was partitioned
between water and EtOAc, and the aqueous layer was extracted with
EtOAc (3.times.50 mL). The combined organic layers were washed with
brine, dried (MgSO.sub.4) and concentrated to give ethyl
4-(isopropylamino)-2-(methylthio)pyrimidine-5-carboxylate (16.4 g,
99.6% yield), which was used in the next step without further
purification. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.51 (s,
1H), 8.05 (d, J=7.6 Hz, 1H), 4.31-4.22 (m, 3H), 2.46 (s, 3H), 1.27
(t, J=7.2 Hz, 3H), 1.20 (d, J=6.4 Hz, 6H).
[0382] To a solution of ethyl
4-(isopropylamino)-2-(methylthio)pyrimidine-5-carboxylate (16.4 g,
64.4 mmol) in anhydrous THF (100 mL) was added LAH (6.1 g, 0.16
mol) in portions at 0.degree. C. under N.sub.2 atmosphere, then the
reaction mixture was stirred at r.t. for 30 min. The reaction was
quenched by the addition of water (6 mL) followed by aqueous
solution of 2N NaOH (6 mL). The suspension was filtered and the
filtrate was concentrated to give
(4-(isopropylamino)-2-(methylthio)pyrimidin-5-yl)methanol (13.5 g,
98.4% yield), which was used in next step without further
purification. .sup.1HNMR (400 MHz, DMSO-d.sub.6): .delta. 7.79 (s,
1H), 6.37 (d, J=7.6 Hz, 1H), 5.10 (t, J=5.6 Hz, 1H), 4.28-4.20 (m,
3H), 2.38 (s, 3H), 1.13 (d, J=6.4 Hz, 6H).
[0383] To a solution of
(4-(isopropylamino)-2-(methylthio)pyrimidin-5-yl)methanol (13.5 g,
63.4 mmol) in DCM (100 mL) was added manganese (IV) oxide (45 g,
0.5 mol), and the mixture was stirred at RT overnight. The reaction
mixture was filtered and the filtrate was concentrated to give the
4-(isopropylamino)-2-(methylthio)pyrimidine-5-carbaldehyde (12.2 g,
91% yield), which was used in the next step without further
purification. .sup.1HNMR (400 MHz, DMSO-d.sub.6): .delta. 9.71 (s,
1H), 8.50 (s, 1H), 8.41 (d, J=7.2 Hz, 1H), 4.33 (m, 1H), 2.47 (s,
3H), 1.21 (d, J=6.4 Hz, 6H).
Example C7
[0384] Using the three-step procedure of Example C5, ethyl
4,6-dichloronicotinate (20 g, 91 mmol) and isopropylamine (60% in
water, 18 g, 182 mmol) were converted to
6-chloro-4-(isopropylamino)nicotinaldehyde (16 g, 81% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.82 (s, 1H),
8.43-8.39 (m, 2H), 6.83 (s, 1H), 3.84 (m, 1H), 1.17 (d, J=6.4 Hz,
6H).
Example D1
[0385] To stirring fuming HNO.sub.3 (90.00 wt %, 30.0 ml, 45 g, 643
mmol, 7.21 eq) at -15.degree. C. was added
4-fluoro-2-methylphenylacetic acid (15.00 g, 89.2 mmol, 1.00 eq) in
portions such that the internal temperature remained below
-10.degree. C. After completing the addition the reaction was
stirred with warming to +5.degree. C. over 15 min. The mixture was
poured onto ice (400 g). Product separated as a slightly sticky
solid which on manipulation with a spatula became powdery. The
suspension was stirred vigorously until the ice had completely
melted. While still very cold, the solids were collected by
filtration, rinsed very well with H.sub.2O and dried on the filter
to afford crude 2-(4-fluoro-2-methyl-5-nitrophenyl)acetic acid
(18.43 g, 97% yield) as a pale yellow solid which was used as is in
the next reaction. .sup.1H NMR (400 MHz, acetone-d.sub.6): .delta.
8.06 (d, J=7.6 Hz, 1H), 7.36 (d, J=12.0 Hz), 3.84 (s, 2H), 2.44 (s,
3H)
[0386] 2-(4-Fluoro-2-methyl-5-nitrophenyl)acetic acid (18.43 g,
86.5 mmol, 1.00 eq) and cone. H.sub.2SO.sub.4 (4.00 ml) were
combined in EtOH (300 ml) and stirred with heating at 85.degree. C.
After 2.5 h, the completed reaction was cooled to RT and
concentrated as completely as possible. The residue was dissolved
in MTBE (250 ml) and washed with H.sub.2O (2.times.) and brine
(2.times.), dried (MgSO.sub.4), filtered and evaporated to afford
ethyl 2-(4-fluoro-2-methyl-5-nitrophenyl)acetate (16.79 g, 81%
yield) as a dark orange oil which was used as is in the next
reaction. MS (ESI) m/z: 242.0 (M+H).sup.+.
[0387] Ethyl 2-(4-fluoro-2-methyl-5-nitrophenyl)acetate (16.79 g,
69.6 mmol, 1.00) in EtOH (60 ml) was shaken with 10% Pd/C (50%
H.sub.2O) (7.41 g, 3.48 mmol, 0.050 eq) under H.sub.2 (3.5 atm) at
RT for 2 h until H.sub.2 uptake was complete. The completed
reaction was filtered on Celite, rinsing forward with EtOH. The
cake was washed well with EtOH and the combined filtrates were
concentrated and pumped on to afford ethyl
2-(5-amino-4-fluoro-2-methylphenyl)acetate (13.18 g, 90% yield) as
a brown oil. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 6.80 (d,
J=12.4 Hz, 1H), 6.59 (d, J=9.6 Hz, 1H), 4.86 (s, 2H), 4.05 (q,
J=7.2 Hz, 2H), 3.46 (s, 2H), 2.05 (s, 3H), 1.17 (t, J=7.2 Hz, 3H);
MS (ESI) m/z: 212.2 (M+H) t.
Example D2
[0388] To a solution of (2,4-difluoro-phenyl)acetic acid (14.5 g,
0.084 mol) in H.sub.2SO.sub.4 (60 mL) at 0.degree. C. was added
dropwise 69% HNO.sub.3 (6 mL). After stirring at 0.degree. C. for
35 min, the reaction mixture was poured into ice water. The aqueous
layer was extracted with EtOAc, and the organic extracts were
washed with brine, dried (Na.sub.2SO.sub.4), and concentrated in
vacuo. The residue was purified by chromatography to give
(2,4-difluoro-5-nitro-phenyl)acetic acid (16 g, 87.5% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.30 (t, J=8.0 Hz,
1H), 7.68 (m, 1H), 3.75 (s, 2H).
[0389] A solution of (2,4-difluoro-5-nitro-phenyl)acetic acid (16
g, 74 mmol) in EtOH (200 mL) and 98% H.sub.2SO.sub.4 (14 mL) was
refluxed at 80.degree. C. for 2.5 h under a N.sub.2 atmosphere. The
reaction mixture was poured into ice-water, and the resultant
solution was extracted with ether. The combined organic extracts
were washed with brine, dried (Na.sub.2SO.sub.4) and concentrated
in vacuo. The residue was purified by column chromatography to give
ethyl 2-(2,4-difluoro-5-nitrophenyl)acetate (16 g, 89% yield).
.sup.1H NMR (300 MHz, DMSO-d.sub.6): c 8.22 (t, J=8.1 Hz, 1H), 7.55
(t, J=11.1 Hz, 1H), 4.06 (m, 2H), 3.77 (s, 2H), 1.13 (t, J=6.9 Hz,
3H).
[0390] A mixture of ethyl 2-(2,4-difluoro-5-nitrophenyl)acetate (16
g, 130 mmol) and 10% Pd/C (1.6 g, 1.5 mmol) in EtOAc was
hydrogenated at 30 psi at RT for 12 h. The catalyst was filtered
off and the filtrate was evaporated. Then the residue was purified
by column chromatography to give ethyl
2-(5-amino-2,4-difluorophenyl)acetate (14 g, 99% yield). .sup.1H
NMR (300 MHz, DMSO-d.sub.6): .delta. 6.98 (t, J=9.9 Hz, 1H), 6.70
(t, J=7.8 Hz, 1H), 4.50 (s, 2H), 4.06 (m, 2H), 3.53 (s, 2H), 1.16
(t, J=6.9 Hz, 3H); MS (ESI) m/z: 216.2 [M+H].sup.+.
Example D3
[0391] HNO.sub.3 (10.35 g, 98.6 mmol) was added dropwise to a
stirred solution of 2-(2-chloro-4-fluorophenyl)acetic acid (16.9 g,
89.6 mmol) in conc.H.sub.2SO.sub.4 (60 mL) at -10.degree. C. After
complete addition, the resulting mixture was stirred at 0.degree.
C. for 10 min, and was carefully poured into ice water. The
off-white solid was collected by filtration and dried to give
2-(2-chloro-4-fluoro-5-nitrophenyl)acetic acid (20.5 g, 98.2%
yield). .sup.1HNMR (400 Hz, DMSO-d.sub.6): .delta. 12.71 (br s,
1H), 8.33 (d, J=8.0 Hz, 1H), 7.92 (d, J=11.2 Hz, 1H), 3.85 (s,
2H).
[0392] A solution of 2-(2-chloro-4-fluoro-5-nitrophenyl)acetic acid
(20.5 g, 88 mmol) in ethanol (150 mL) was treated with sulfuryl
dichloride (21 g, 0.17 mol) at 0.degree. C., then the mixture was
heated to reflux for 1 h. The reaction mixture was concentrated
under reduced pressure and the pH was adjusted to between pH 7-8 by
addition of saturated Na.sub.2CO.sub.3 solution. Then resultant
mixture was extracted with EtOAc (3.times.100 mL) and the combined
organic layers were washed with brine, dried (MgSO.sub.4) and
concentrated to give ethyl
2-(2-chloro-4-fluoro-5-nitrophenyl)acetate (22.5 g, 97.8%).
.sup.1HNMR (400 Hz, DMSO-d.sub.6): .delta. 8.32 (d, J=8.0 Hz, 1H),
7.91 (d, J=11.2 Hz, 1H), 4.09 (q, J=7.2 Hz, 2H), 3.92 (s, 2H), 1.17
(t, J=7.2 Hz, 3H).
[0393] A solution of ethyl
2-(2-chloro-4-fluoro-5-nitrophenyl)acetate (22.5 g, 86.2 mmol) in
ethanol (200 mL) was stirred with Raney Ni (20% slurry in water,
-5.0 g, 17 mmol) under a hydrogen atmosphere (30 psi) for 5 h. The
catalyst was removed by filtration and the filtrate was
concentrated to give ethyl
2-(5-amino-2-chloro-4-fluorophenyl)acetate (19 g, 95% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 7.10 (d, J=11.2 Hz,
1H), 6.71 (d, J=9.2 Hz, 1H), 5.27 (s, 2 H), 4.05 (q, J=6.8 Hz, 2H),
3.57 (s, 2H), 1.14 (t, J=6.8 Hz, 3H); MS (ESI) m/z: 232.0
[M+H].sup.+.
Examlne D4
[0394] To a stirred solution of 1-bromo-4-fluoro-2-methylbenzene
(30 g, 0.16 mol) in cone. H.sub.2SO.sub.4 (200 mL) was added
KNO.sub.3 (16.1 g, 0.16 mol) at 0.degree. C. portion wise. After
the resulting mixture was stirred at 0.degree. C. for 30 min, the
reaction was poured into ice water and extracted with EtOAc
(3.times.100 mL). The combined organic layers were washed with
saturated Na.sub.2CO.sub.3 solution and brine, dried, filtered and
concentrated to give 1-bromo-4-fluoro-2-methyl-5-nitrobenzene (20
g, 53.6% yield). .sup.1HNMR (300 Hz, DMSO-d.sub.6): .delta. 8.15
(d, J=7.2 Hz, 1H), 7.52 (d, J=12 Hz, 1H), 2.35 (s, 3H).
[0395] To a solution of 1-bromo-4-fluoro-2-methyl-5-nitrobenzene
(20 g, 85.8 mmol) in methanol (300 mL) was added Raney Ni (20%/w,
.about.2.0 g, suspension in water, washed with acetone for several
times), then the resulting mixture was hydrogenated under hydrogen
atmosphere for 2 h. The catalyst was filtered, concentrated, and
the residue was recrystallized (petroleum ether) to afford
5-bromo-2-fluoro-4-methylphenylamine (10 g, 57.5% yield).
.sup.1HNMR (400 MHz, DMSO-d.sub.6): .delta. 7.12 (d, J=10.2 Hz,
1H), 6.78 (d, J=10.9 Hz, 1H), 4.85 (s, 2H), 2.29 (s, 3H), 1.26 (s,
12H).
[0396] Nitrogen was bubbled though a solution of
5-bromo-2-fluoro-4-methylphenylamine (3.5 g, 17.2 mmol),
bis(pinacolato)diboron (3.9 g, 15.5 mmol), and KOAc (4.2 g, 51.6
mmol) in DMF (10 mL) for 20 min. To the above mixture was added
dppf (954 mg, 1.7 mmol) and PdCl.sub.2 (151 mg, 0.86 mmol), then
nitrogen was continued to bubble for 30 min., and the resulting
mixture was heated to 80.degree. C. under nitrogen for 16 h. The
excess DMF was removed under reduced pressure, and the residue was
partitioned between water and EtOAc. The organic layer was wash
with brine, dried, filtered and concentrated and purified by silica
gel column chromatography to give
2-fluoro-4-methyl-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenylam-
ine (2 g, 47% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
7.10 (d, J=10.4 hz, 1H), 6.76 (d, J=12.8 Hz, 1H), 4.85 (s, 2H),
2.27 (s, 3H), 1.24 (s, 12H); MS (ESI) m/z: 252.1 [M+H].sup.+.
Example D5
[0397] 3-Oxo-pentanedioic acid (101 g, 0.5 mmol), diethyl ester,
triethyl orthoformate (81.4 g, 0.55 mol) and acetic anhydride (102
g, 1 mol) were combined and heated to 120.degree. C. for 2 h. The
resulting mixture was cooled to RT and dissolved in DCM (1000 mL).
After further cooling to 0.degree. C., ammonia (30%, 80 mL) was
added and the reaction mixture was allowed to warm to RT overnight.
The product was extracted with water (2.times.1000 mL). Then the
aqueous layer was acidified to pH 5 with cone HCl. The precipitate
was collected by filtration to afford ethyl 4,6-dihydroxynicotinate
(60.0 g, 60% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
7.99 (s, 1 H), 5.58 (s, 1H), 4.23 (q, J=6.8, 14.0 Hz, 2H), 1.25 (t,
J=7.2 Hz, 3H). MS (ESI) m/z: 184.1 (M+H.sup.+).
[0398] Ethyl 4,6-dihydroxynicotinate (60 g, 0.328 mol) was added
slowly to a 2 L flask containing POCl.sub.3 (500 mL). After
complete addition, the reaction mixture was heated to reflux for 2
hours. The resulting mixture was distilled to remove POCl.sub.3
under reduced pressure. The residue was poured into ice-water and
stirred for 30 minutes before extracting with EtOAc (3.times.500
mL). The combined extracts were washed with brine (300 mL), dried
(MgSO.sub.4) and concentrated in vacuo to give ethyl
4,6-dichloronicotinate (65 g, 90.1%, yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 8.80 (s, 1H), 7.95 (s, 1H), 4.34 (q, J=6.9
Hz, 2H), 1.31 (t, J=6.9 Hz, 3 H). MS (ESI) m/z: 220.1
(M+H.sup.+).
Example D6
[0399] A mixture of (2-chlorophenyl)acetic acid (15 g, 88 mmol) in
cone. H.sub.2SO.sub.4 (100 mL) was cooled to -20.degree. C. and
treated (drop wise) with cone. HNO.sub.3 (9.4 g, 97 mmol). The
resulting mixture was stirred at -20.degree. C. for an additional
30 min. The reaction mixture was poured into the ice-water, and the
mixture was extracted with EtOAc (3.times.200 mL), the combined
organics were washed with brine, dried over Na.sub.2SO.sub.4 and
concentrated in vacuo to give (2-chloro-5-nitrophenyl)acetic acid
(15 g, 79% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.58 (s, 1H), 8.35 (m, 1H), 7.96 (m, 1H), 4.12 (s, 2H).
[0400] Thionyl chloride (16.7 g, 0.14 mol) was added dropwise to a
0.degree. C. solution of (2-chloro-5-nitro-phenyl)acetic acid (15
g, 0.07 mol) in EtOH (300 mL) and the resultant mixture was heated
at reflux overnight. The reaction mixture was concentrated under
reduced pressure and the residue was poured into ice water, and
extracted with EtOAc (2.times.300 mL). The combined organics were
washed with brine and saturated NaHCO.sub.3 solution, were dried
over Na.sub.2SO.sub.4, and were concentrated in vacuo to give ethyl
2-(2-chloro-5-nitrophenyl)acetate (17 g, 99% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 8.35 (d, J=2.8 Hz, 1H), 8.12 (dd,
J=8.4, 2.8 Hz, 1H), 7.72 (d, J=8.4 Hz, 1H), 4.10 (q, J=7.2 Hz, 2H),
3.96 (s, 2H), 1.15 (t, J=7.2 Hz, 3H).
[0401] Iron powder (2.5 g, 44.7 mmol) was added portion wise to a
solution of ethyl 2-(2-chloro-5-nitrophenyl)acetate (8 g, 4.68
mmol) and cone. HCl (12 M, 3.9 mL, 46.8 mmol) in EtOH (100 mL). The
resultant mixture was heated at 50.degree. C. for 2 hour. The
mixture was filtered and the filtrate cake was washed with
saturated aqueous Na.sub.2CO.sub.3 until pH 8. The filter cake was
further washed with EtOAc and the combined filtrates were
partitioned between EtOAc and water. The organics were dried over
Na.sub.2SO.sub.4 and concentrated in vacuo to provide ethyl
2-(5-amino-2-chlorophenyl)acetate (5.6 g, 56% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 7.00 (d, J=8.4 Hz, 1H), 6.50 (s,
J=2.8 Hz, 1H), 6.44 (dd, J=8.4 Hz, 2.8 Hz, 1H), 5.20 (s, 2H), 4.05
(q, J=7.2 Hz, 2H), 3.56 (s, 2H), 1.15 (t, J=7.2 Hz, 3H).
Example 1
[0402] Using general method A, Example B1 (0.16 g, 0.42 mmol) and
Example A1 (0.12 g, 0.42 mmol) were combined to afford
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uorophenyl)-3-(3-tert-butyl-1-phenyl-1H-pyrazol-5-yl)urea as the
amine hydrochloride salt (85 mg, 38% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.03 (s, 1H), 8.94 (s, 1H), 8.71 (s, 1H),
8.42 (d, J=7.6 Hz, 1H), 7.89 (s, 1H), 7.58-7.52 (m, 4H), 7.45-7.42
(m, 1H), 7.28 (d, J=8.8 Hz, 1H), 6.41 (s, 1H), 3.73 (s, 3H), 1.28
(s, 9H); MS (ES1) m/z: 527.2 (M+H.sup.+).
Example 2
[0403] Using general method A, Example B2 (0.15 g, 0.46 mmol) and
Example A1 (0.13 g, 0.46 mmol) were combined to afford
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uorophenyl)-3-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)urea as the
amine hydrochloride salt (80 mg, 37% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.99 (brs, 1H), 8.87 (s, 1H), 8.68 (s, 1H),
8.43 (d, J=8.4 Hz, 1H), 7.88 (s, 1H), 7.41-7.38 (m, 2H), 7.31-7.29
(m, 2H), 6.12 (s, 1H), 3.63 (s, 3H), 3.57 (s, 3H), 1.21 (s, 9H); MS
(ESI) m/z: 465.2 (M+H.sup.+).
Example 3
[0404] Using general method A, Example B3 (0.075 g, 0.17 mmol) and
Example A1 (0.05 g, 0.17 mmol) were combined to afford
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-tert-butyl-1H-pyrazol-5-yl)-3-(5-(2-
-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluorophen-
yl)urea as amine hydrochloride salt (41 mg, 42% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 9.03 (s, 1H), 8.95 (s, 1H), 8.72
(s, 1H), 8.44-8.42 (m, 1H), 7.90 (s, 1H), 7.54 (brs, 1H), 7.49-7.42
(m, 2H), 7.38-7.26 (m, 4H), 6.94 (brs, 1H), 6.41 (s, 1H), 3.58 (s,
3H), 3.48 (s, 2H), 1.28 (s, 9H); MS (ESI) m/z: 584.2
(M+H.sup.+).
Example 4
[0405] Using general method A, Example B4 (0.075 g, 0.14 mmol) and
Example A1 (0.04 g, 0.14 mmol) were combined and then deprotected
with HCl in dioxane solution to afford
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uorophenyl)-3-(3-tert-butyl-1-(1H-indazol-5-yl)-1H-pyrazol-5-yl)urea
as the amine hydrochloride salt. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.01 (s, 1H), 8.90 (s, 1H), 8.74 (s, 1H),
8.45-8.42 (m, 1H), 8.20 (s, 1H), 7.90 (s, 2H), 7.70 (d, J=8.8 Hz,
1H), 7.45 (dd, J=8.8 Hz, 2.0 Hz, 1H), 7.28-7.25 (m, 2H), 6.42 (s,
1H), 3.58 (s, 3H), 1.28 (s, 9H); MS (ESI) m/z: 567.3
(M+H.sup.+).
Example 5
[0406] Using general method B,
3-isopropyl-1-phenyl-1H-pyrazol-5-amine (0.071 g, 0.19 mmol) and
Example A1 (0.054 g, 0.19 mmol) were combined to afford
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-y-
l)-2-fluorophenyl)-3-(3-isopropyl-1-phenyl-1H-pyrazol-5-yl)urea as
the amine hydrochloride salt (36 mg, 38% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 9.05 (s, 1H), 8.97 (s, 1H), 8.74 (s,
1H), 8.42 (d, J=7.2 Hz, 1H), 7.91 (s, 1H), 7.57-7.44 (m, 5H), 7.28
(d, J=8.0 Hz, 1H), 6.37 (s, 1H), 3.62 (s, 3H), 2.89-2.86 (m, 1H),
1.23 (s, J=7.2 Hz, 1H); MS (ESI) m/z: 513.3 (M+H.sup.+).
Example 6
[0407] To a solution of ethyl
3-tert-butyl-1-(2-(dimethylamino)-2-oxoethyl)-1H-pyrazole-5-carboxylate
from example B17 (0.48 g, 1.7 mmol) in THF (10 mL) was added a
solution of lithium hydroxide (0.21 g, 5.1 mmol) in water (5 mL)
and the mixture was stirred for 16 h at RT. Solvents were removed
and the residue was acidified with 3M HCl and the product was
extracted with EtOAc (2.times.30 ml). The combined organic extracts
were washed with brine, dried (Na.sub.2SO.sub.4) and concentrated
to afford
3-tert-butyl-1-(2-(dimethylamino)-2-oxoethyl)-1H-pyrazole-5-carboxylic
acid (0.4, 93% yield) as a pasty mass. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 6.69 (s, 1H), 5.30 (s, 2H), 3.02 (s, 3H),
2.82 (s, 3H), 1.24 (m, 9H); MS (ESI) m/z: 254.0 (M+H.sup.+).
[0408] Using general method D,
3-tert-butyl-1-(2-(dimethylamino)-2-oxoethyl)-1H-pyrazole-5-carboxylic
acid (0.055 g, 0.22 mmol) and Example A1 (0.23 g, 0.88 mmol) were
combined to afford
1-(5-(2-amino-1-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uorophenyl)-3-(3-tert-butyl-1-(2-(dimethylamino)-2-oxoethyl)-1H-pyrazol-5--
yl)urea as the amine hydrochloride salt (81 mg, 70% yield). .sup.1H
NMR (400 MHz, DMSO-d.sub.6): .delta. 9.55 (brs, 1H), 9.16 (s, 1H),
8.78 (s, 1H), 8.47-8.42 (m, 1H), 7.32-7.30 (m, 2H), 6.28 (s, 1H),
5.10 (s, 2H), 3.58 (s, 3H), 3.07 (s, 3H), 2.88 (s, 3H), 1.24 (m,
9H); MS (ESI) m/z: 536.2 (M+H.sup.+).
Example 7
[0409] Using general method B, the carbamate of Example B21 (0.055
g, 0.18 mmol) and Example A1 (0.05 g, 0.18 mmol) were combined to
afford
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uorophenyl)-3-(1-phenyl-3-(trifluoromethyl)-1H-pyrazol-5-yl)urea as
the amine hydrochloride salt (55 mg, 58% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 9.24 (s, 1H), 9.16 (s, 1H), 8.71 (s,
1H), 8.41-8.39 (m, 1H), 7.89 (s, 1H), 7.65-7.56 (m, 5H), 7.31-7.28
(m, 2H), 6.90 (s, 1H), 3.65 (s, 3H); MS (ESI) m/z: 539.0
(M+H.sup.+).
Example 8
[0410] Using general method A, Example B2 (0.075 g, 0.23 mmol) and
Example A2 (0.07 g, 0.23 mmol) were combined to afford
1-(5-(2-amino-8-ethyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-flu-
orophenyl)-3-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)urea as the
amine hydrochloride salt (32 mg, 29% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.31 (s, 1H), 9.01 (s, 1H), 8.73 (s, 1H),
8.41 (d, J=8.4 Hz, 1H), 7.91 (s, 1H), 7.31 (d, J=8.4 Hz, 1H), 6.17
(s, 1H), 4.32 (q, J=6.8 Hz, 1H), 3.67 (s, 3H), 1.24-1.20 (m, 12H);
MS (ESI) m/z: 479.2 (M+H.sup.+).
Example 9
[0411] Using general method C, Example B5 (400 mg, 0.96 mmol) and
Example A1 (288 mg, 2.88 mmol) were combined to afford
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uorophenyl)-3-(1-phenyl-3-(thiophen-2-yl)-1H-pyrazol-5-yl)urea (208
mg, 39% yield) as the HCl salt. .sup.1H-NMR (DMSO-d.sub.6) .delta.
3.58 (s, 3H), 6.87 (s, 1H), 7.10-7.12 (m, 1H), 7.28-7.31 (m, 2H),
7.47-7.61 (m, 7H), 7.91 (s, 1H), 7.70-8.30 (br s, 2H), 8.43 (d,
1H), 8.80 (s, 1H), 9.19 (s, 2H); MS (ESI) m/z: 553.0
(M+H.sup.+).
Example 10
[0412] Using general method A, Example B6 (0.071 g, 0.2 mmol) and
Example A1 (0.057 g, 0.2 mmol) were combined to afford
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uorophenyl)-3-(1-methyl-3-(thiophen-2-yl)-1H-pyrazol-5-yl)urea as
the amine hydrochloride salt (25 mg, 25% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 9.39 (s, 1H), 9.06 (s, 1H), 8.74 (s,
1H), 8.45-8.43 (m, 1H), 7.93 (s, 1H), 7.42 (d, J=4.8 Hz, 1H),
7.34-7.31 (m, 3H), 7.06 (dd, J=4.8 Hz, 3.6 Hz, 1H), 6.60 (s, 1H),
3.58 (s, 3H); MS (ESI) m/z: 491.0 (M+H.sup.+).
Example 11
[0413] Using general method A, Example B1 (0.075 g, 0.25 mmol) and
Example A2 (0.075 g) were combined to afford
1-(5-(2-amino-8-ethyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-flu-
orophenyl)-3-(3-tert-butyl-1-phenyl-1H-pyrazol-5-yl)urea as the
amine hydrochloride salt (56 mg, 41% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.04 (s, 1H), 8.94 (s, 1H), 8.73 (s, 1H),
8.42-8.40 (m, 1H), 7.89 (s, 1H), 7.58-7.52 (m, 4H), 7.46-7.42 (m,
1H), 7.29-7.27 (m 2H), 6.41 (s, 1H), 4.32 (q, J=6.8 Hz, 1H), 1.28
(s, 9H), 1.22 (t, J=6.8 Hz, 3H); MS (ESI) m/z: 541.3
(M+H.sup.+).
Example 12
[0414] Using general method A, Example B2 (0.500 g, 3.3 mmol) and
Example A3 (0.382 g, 1.21 mmol) were combined and purified by flash
column chromatography (12-100% EtOAc/hexanes) to afford
1-(3-t-butyl-1-methyl-1H-pyrazol-5-yl)-3-(2-fluoro-5-(8-methyl-2-(methylt-
hio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.180 g, 30% yield) as a foam. MS (ESI) m/z: 496.0
(M+H.sup.+).
[0415] Using a procedure analogous to Example A1,
1-(3-t-butyl-1-methyl-1H-pyrazol-5-yl)-3-(2-fluoro-5-(8-methyl-2-(methylh-
io)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.180
g, 0.363 mmol) and MeNH.sub.2.HCl (0.0502 g, 0.743 mmol, 2.00 eq)
were combined to afford
1-(3-t-butyl-1-methyl-1H-pyrazol-5-yl)-3-(2-fluoro-5-(8-methyl-2-(methyla-
mino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.0451 g, 24% yield) as the HCl salt. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.49 (brs, 1H), 9.07 (s, 1H), 8.44-8.41 (m,
1H), 7.97 (brs, 1H), 7.92 (s, 1H), 7.33-7.27 (m, 2H), 6.23 (s, 1H),
3.71 (s, 3H), 3.63 (brs, 3H), 2.94 (s, 3H), 1.24 (s, 9H); MS (ESI)
m/z: 479.2 (M+H.sup.+).
Example 13
[0416] Using general method A, Example B7 (0.180 g, 0.444 mmol) and
Example A1 (0.138 g, 0.484 mmol) were combined to afford
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uorophenyl)-3-(3-tert-butyl-(3-fluorophenyl)-1H-pyrazol-5-yl)urea
(0.08 g, 33% yield) as a white foam. This was converted to
corresponding HCl salt by reacting with HCl. .sup.1H NMR
(DMSO-d.sub.6): .delta. 9.15 (s, 2H), 8.81 (s, 1H), 8.39 (d, J=7.8
Hz, 1H), 7.94 (s, 1H), 7.59-7.56 (m, 1H), 7.45-7.41 (m, 2H),
7.30-7.26 (m, 3H), 6.42 (s, 1H), 3.57 (s, 3H), 1.28 (s, 9H); MS
(ESI) m/z: 545 (M+H.sup.+).
Example 14
[0417] Using general method A, Example B8 (0.10 g, 0.23 mmol) and
Example A1 (65 mg, 0.23 mmol) were combined to afford
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uorophenyl)-3-(3-tert-butyl-1-(quinolin-6-yl)-1H-pyrazol-5-yl)urea
as the HCl salt (43 mg, 32% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.08 (brs, 1H), 9.02 (dd, J=1.2, 3.6 Hz,
1H), 8.97 (m, 1H), 8.69 (s, 1H), 8.60 (m, 1H), 8.40 (dd, J=1.6, 8.0
Hz, 1H), 8.21 (m, 2H), 8.02 (dd, J=2.4, 8.4 Hz, 1H), 7.86 (s, 1H),
7.69 (dd, J=4.0, 8.4 Hz, 1H), 7.39 (brm, 1H), 7.27 (m, 2H), 6.49
(s, 1H), 3.58 (s, 3H), 1.32 (s, 9H); LC-MS (EI) m/z: 578.3
(M+H.sup.+).
Example 15
[0418] Using general method B, Example B9 (0.071 g, 0.26 nmol) and
Example A1 (0.074 g, 0.26 mmol) were combined to afford
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uorophenyl)-3-(3-(2-fluorophenyl)-1-methyl-1H-pyrazol-5-yl)urea (49
mg, 38% yield). This solid was converted to the amine hydrochloride
salt by treating with 0.1 N HCl solution. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.32 (brs, 1H), 9.01 (s, 1H), 8.72 (s, 1H),
8.43 (d, J=8.0 Hz, 1H), 7.94-7.90 (m, 2H), 7.35-7.21 (m, 5H), 6.67
(d, J=4.8 Hz 1H), 3.80 (s, 3H), 3.57 (s, 3H); MS (ESI) m/z: 503.3
(M+H.sup.+).
Example 16
[0419] Using general method A, Example B10 (85 mg, 0.21 mmol) and
Example A2 (63 mg, 0.21 mmol) were combined to obtain
1-(5-(2-amino-8-ethyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-flu-
orophenyl)-3-(3-tert-butyl-1-(6-methylpyridin-3-yl)-1H-pyrazol-5-yl)urea
as the HCl salt (68 mg, 54% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.35 (brs, 1H), 9.13 (brs, 1H), 8.85 (d,
J=2.0 Hz, 1H), 8.74 (s, 1H), 8.35 (dd, J=1.6, 8.4 Hz, 1H), 8.25 (m,
1H), 7.90 (s, 1H), 7.74 (d, J=8.4 Hz, 1H), 7.71 (brs, 1H), 7.29 (m,
2H), 6.46 (s, 1H), 4.31 (q, J=7.2 Hz, 2H), 2.66 (s, 3H), 1.29 (s,
9H), 1.22 (t, J=7.2 Hz, 3H); LC-MS (EI) m/z: 556.3 (M+H.sup.+).
Example 17
[0420] Using general method A, the TROC carbamate of Example B2
(0.071 g, 0.23 mmol) and Example A4 (0.071 g, 0.23 mmol) were
combined to afford
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(5-(8-ethyl-2-(methylamino)-7-
-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluorophenyl)urea
(45 mg, 40% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
9.60 (s, 1H), 9.12 (s, 1H), 8.72 (brs, 1H), 8.40 (d, J=8.4 Hz, 1H),
7.98 (brs, 1H), 7.91 (s, 1H), 7.33-7.27 (m, 2H), 6.24 (s, 1H), 4.36
(brs, 2H), 3.79 (s, 3H), 2.93 (s, 3H), 1.24 (s, 12H); MS (ESI) m/z:
493.2 (M+H.sup.+).
Example 18
[0421] Using a procedure analogous to Example 12, Example B10
(0.051 g, 0.23 mmol), Example A3 (0.072 g, 0.23 mmol) and
methylamine were combined to afford
1-(3-tert-butyl-1-(6-methylpyridin-3-yl)-1H-pyrazol-5-yl)-3-(2--
fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-
-6-yl)phenyl)urea (57 mg, 46% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.17 (s, 1H), 9.04 (s, 1H), 8.79 (d, J=2.0
Hz, 1H), 8.69 (brs, 1H), 8.38 (dd, J=2.0, and 5.6 Hz, 1H), 8.15 (m,
1H), 7.88 (s, 1H), 7.67 (d, J=8.8 Hz, 1H), 7.29 (m, 2H), 6.46 (s,
1H), 3.60 (brm, 3H), 2.93 (brs, 3H), 2.64 (s, 3H), 1.29 (s, 9H);
LC-MS (EI) m/z: 556.3 (M+H.sup.+).
Example 19
[0422] Using general method B, the carbamate of
3-isopropyl-1-methyl-1H-pyrazol-5-amine (0.051 g, 0.23 mmol) and
Example A4 (0.072 g, 0.23 mmol) were combined to afford
1-(5-(8-ethyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-y-
l)-2-fluorophenyl)-3-(3-isopropyl-1-methyl-1H-pyrazol-5-yl)urea (78
mg, 71% yield) as a white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.10 (s, 1H), 9.06 (s, 1H), 8.71 (brs, 1H),
8.40 (d, J=8.8 Hz, 1H), 7.96-7.87 (m, 2H), 7.35-7.27 (m, 2H), 6.19
(d, J=7.6 Hz, 1H), 4.37 (brs, 2H), 3.69 (d, J=5.2 Hz, 3H), 2.92 (s,
3H), 2.85-2.81 (m, 1H), 1.25-1.17 (m, 9H); MS (ESI) m/z: 479.2
(M+H.sup.+).
Example 20
[0423] To a solution of
2-(3-tert-butyl-5-(ethoxycarbonyl)-1H-pyrazol-1-yl)acetic acid from
Example B17 (0.77 g, 3.02 mmol) in DMF (5 mL) were added EDC (0.75
g, 3.93 mmol), HOBt (0.55 g, 3.62 mmol) and morpholine (0.39 g,
4.53 mmol). After stirring the mixture for 4 h at RT, water (50 mL)
and 3M HCl (5 mL) were added and the product was extracted with
EtOAc (3.times.30 mL). The combined organic layers were washed with
aq. LiCl, dried (Na.sub.2SO.sub.4), concentrated and purified by
chromatography (EtOAc/CH.sub.2Cl.sub.2) to afford ethyl
3-tert-butyl-1-(2-morpholino-2-oxoethyl)-1H-pyrazole-5-carboxylate
(0.67 g, 69% yield) as a solid. .sup.1H NMR (400 MHz,
Acetone-d.sub.6): .delta. 6.74 (s, 1H), 5.40 (s, 2H), 4.27 (q,
J=7.2 Hz, 2H), 3.73 (brs, 2H), 3.65-3.62 (m, 4H), 3.51 (brs, 2H),
1.32 (t, J=7.2 Hz, 3H), 1.29 (s, 9H); MS (ESI) m/z: 324.2
(M+H.sup.+).
[0424] To a solution of ethyl
3-tert-butyl-1-(2-morpholino-2-oxoethyl)-1H-pyrazole-5-carboxylate
(0.34 g, 1 mmol) in THF (10 mL) was added borane in THF (4 ml of 1M
solution, 4 mmol) at 0.degree. C. under an Ar atmosphere and the
mixture was stirred at 60.degree. C. for 12 h. The mixture was
cooled to 0.degree. C. and quenched with 3M HCl solution and heated
to 60.degree. C. for 30 min. The mixture was basified with solid
NaHCO.sub.3 to pH .about.8 and the product was extracted with
CHCl.sub.3 (2.times.30 ml) and the combined organic layers were
washed with brine, dried (Na.sub.2SO.sub.4) and concentrated to
afford ethyl
3-tert-butyl-1-(2-morpholinoethyl)-1H-pyrazole-5-carboxylate amine
(0.25 g, 76% yield) as a pasty mass. .sup.1H NMR (400 MHz,
Acetone-d.sub.6): .delta. 6.69 (s, 1H), 4.60 (t, J=6.4 Hz, 2H),
4.33 (q, J=7.2 Hz, 2H), 3.59-3.53 (m, 4H), 2.69 (t, J=6.4 Hz, 2H),
2.43-2.38 (m, 4H), 1.36 (t, J=7.2 Hz, 3H), 1.29 (s, 9H); MS (ESI)
m/z: 310.3 (M+H.sup.+).
[0425] To a solution of ethyl
3-tert-butyl-1-(2-morpholinoethyl)-1H-pyrazole-5-carboxylate amine
(0.43 g, 1.4 mmol) in THF (5 mL) was added a solution of LiOH (0.17
g, 4.2 mmol) in water (2 mL) and the mixture was stirred for 16 h1
at RT. Solvents were removed, and then the thick liquid was diluted
with water (5 mL) and the pH was adjusted to 4-5 with 50% aq.acetic
acid. The product was extracted with EtOAc (3.times.25 ml) and the
combined organic layers were washed with brine, dried
(Na.sub.2SO.sub.4) and concentrated to afford
3-tert-butyl-1-(2-morpholinoethyl)-1H-pyrazole-5-carboxylic acid
(0.16 g, 41% yield) as a pasty mass. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 6.65 (s, 1H), 4.54 (t, J=6.4 Hz, 2H),
3.58-3.52 (m, 4H), 2.69 (t, J=6.4 Hz, 2H), 2.44 (brs, 4H), 1.28 (s,
9H); MS (ESI) m/z: 282.3 (M+H.sup.+).
[0426] Using general method D,
3-tert-butyl-1-(2-morpholinoethyl)-1H-pyrazole-5-carboxylic acid
(0.048 g, 0.17 mmol), Example A1 (0.097 g, 0.34 mmol),
triethylamine (0.035 g, 0.34 mmol) and diphenylphospharyl azide
(0.07 g, 0.26 mmol) were combined to afford
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin--
6-yl)-2-fluorophenyl)-3-(3-tert-butyl-1-(2-morpholinoethyl)-1H-pyrazol-5-y-
l)urea (38 mg, 40% yield) as the amine hydrochloride salt. .sup.1H
NMR (400 MHz, DMSO-d.sub.6): .delta. 9.90 (s, 1H), 9.20 (s, 1H),
8.73 (s, 1H), 8.41 (d, J=8.8 Hz, 1H), 7.92 (s, 1H), 7.30 (d, J=8.4
Hz, 2H), 6.18 (s, 1H), 4.50-4.48 (m, 2H), 3.89-3.80 (m, 4H), 3.57
(s, 3H), 3.33-3.30 (m, 4H), 1.24 (m, 9H); MS (ESI) m/z: 564.3
(M+H.sup.+).
Example 21
[0427] Using a procedure analogous to Example 20,
2-(3-tert-butyl-5-(ethoxycarbonyl)-1H-pyrazol-1-yl)acetic acid from
Example B17, benzyl piperazine-1-carboxylate and Example A1 were
combined to afford benzyl
4-(2-(5-(3-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-
-yl)-2-fluorophenyl)ureido)-3-tert-butyl-1H-pyrazol-1-yl)ethyl)piperazine--
1-carboxylate (117 mg) as a solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.88 (s, 1H), 8.82 (s, 1H), 8.67 (s, 1H),
8.42-8.40 (m, 1H), 7.86 (s, 1H), 7.38-7.28 (m, 9H), 6.11 (s, 1H),
5.05 (s, 2H), 4.04 (t, J=6.8 Hz, 2H), 3.57 (s, 3H), 3.36 (brs, 4H),
2.68 (t, J=6.8 Hz, 2H), 2.40 (brs, 2H), 1.18 (s, 9H); MS (ESI) m/z:
697.0 (M+H.sup.+).
[0428] To a solution of benzyl
4-(2-(5-(3-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-
-yl)-2-fluorophenyl)ureido)-3-tert-butyl-1H-pyrazol-1-yl)ethyl)piperazine--
1-carboxylate (0.11 g, 0.16 mmol) in EtOAc (10 mL) was added
palladium hydroxide (10% of 10 mg) and the mixture was stirred
under a H.sub.2 atmosphere for 18 h at RT. Then the mixture was
filtered through a Celite pad, the pad was washed with EtOAc
(2.times.5 ml). The filtrate was concentrated to afford a solid
which was purified by chromatography using acetonitrile and water
as eluents to afford
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uorophenyl)-3-(3-tert-butyl-(2-(piperazin-1-yl)ethyl)-1H-pyrazol-5-yl)urea
as the amine hydrochloride salt (62 mg, 70% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 9.20 (brs, 1H), 9.16 (s, 1H), 8.71
(s, 1H), 8.41-8.39 (m, 1H), 7.91 (s, 1H), 7.31-7.29 (m, 2H), 6.18
(s, 1H), 4.44 (brs, 2H), 3.57 (s, 3H), 3.52-3.39 (m, 8H), 1.23 (s,
9H); MS (ESI) m/z: 562.8 (M+H.sup.+).
Example 22
[0429] Using general method E,
1-(3-t-butyl-1-methyl-1H-pyrazol-5-yl)-3-(2-fluoro-5-(8-methyl-2-(methyls-
ulfinyl)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
from Example 12 (0.199 g, 0.389 mmol) and
N',N'-dimethylethane-1,2-diamine (0.214 ml, 1.94 mmol, 5.00 eq)
were combined to afford
1-(3-t-butyl-1-methyl-1H-pyrazol-5-yl)-3-(5-(2-(2-(dimethylamino)ethylami-
no)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluorophenyl)-
urea which was subsequently treated with HCl to afford
hydrochloride salt (20.8 mg, 10% yield) as a white solid. .sup.1H
NMR (400 MHz, DMSO-d.sub.6): .delta. 9.07 (s, 1H), 8.91 (brs, 1H),
8.80-8.75 (brs, 1H), 8.47-8.44 (m, 1H), 8.01 (brs, 1H), 7.97 (s,
1H), 7.33-7.27 (m, 2H), 6.10 (s, 1H), 3.77-3.72 (m, 2H), 3.63 (s,
3H), 3.51 (brs, 3H), 3.37-3.33 (bnn, 2H), 2.86 (m, 6H), 1.21 (s,
9H); MS (ESI) m/z: 536.2 (M+H.sup.+).
Example 23
[0430] Using general method F, Example A1 (76 mg, 0.27 mmol) and
1-isocyanato-3-(trifluoromethyl)benzene (80 mg, 0.43 mmol) were
combined to provide
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uorophenyl)-3-(3-(trifluoromethyl)phenyl)urea (67 mg, 53% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.43 (s, 1 H), 8.69
(s, 2H), 8.41 (m, 1H), 8.07 (s, 1H), 7.90 (s, 1H), 7.53 (m, 2H),
7.35-7.25 (m, 5H), 3.59 (s, 3H); MS (ESI) m/z: 473.0
(M+H.sup.+).
Example 24
[0431] Using general method D, Example B17 (0.051 g, 0.21 mmol) and
Example A1 (0.12 g, 0.43 mmol) in presence of triethylamine (0.032
g, 0.32 mmol) and diphenylphospharyl azide (0.07 g, 0.26 mmol) were
combined to afford
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin--
6-yl)-2-fluorophenyl)-3-(3-tert-butyl-1-(2-(dimethylamino)ethyl)-1H-pyrazo-
l-5-yl)urea as the amine hydrochloride salt (0.036 g, 32% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.63 (brs, 1H), 9.44
(s, 1H), 9.02 (s, 1H), 8.67 (s, 1H), 8.41-8.38 (m, 1H), 7.88 (s,
1H), 7.36-7.27 (m, 3H), 7.18-7.15 (m, 1H), 6.18 (s, 1H), 4.37 (t,
J=6.4 Hz, 2H), 3.55-3.51 (m, 2H), 2.84 (s, 3H), 2.82 (s, 3H), 1.23
(s, 9H); MS (ESI) m/z: 522.2 (M+H.sup.+).
Example 25
[0432] Using general method A, Example B2 (0.071 g, 0.22 mmol) and
Example A8 (0.067 g, 0.22 mmol) were combined to afford
1-(5-(2-amino-8-cyclopropyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-
-2-fluorophenyl)-3-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)urea as
the hydrochloride salt (0.062 g, 59% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.12 (s, 1H), 8.92 (s, 1H), 8.66 (s, 1H),
8.38-8.36 (m, 1H), 7.30-7.28 (m, 2H), 6.13 (s, 1H), 3.64 (s, 3H),
2.89-2.84 (m, 1H), 1.21 (s, 9H), 1.19-1.14 (m, 2H), 0.85-0.81 (m,
2H); MS (ESI) m/z: 491.2 (M+H.sup.+).
Example 26
[0433] Using general method F, Example A1 (75 mg, 0.26 mmol) and
1-fluoro-2-isocyanato-4-methylbenzene (0.050 mL, 0.39 mmol) were
combined to provide
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uorophenyl)-3-(2-fluoro-5-methylphenyl)urea (46 mg, 40% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.08 (d, J=1.8 Hz,
1H), 9.00 (d, J=2.2 Hz, 1H), 8.69 (s, 1H), 8.48 (m, 1H), 8.03 (dd,
J=7.9, 1.6 Hz, 1H), 7.89 (s, 1H), 7.34-7.25 (m, 4H), 7.12 (dd,
J=11.4, 8.6 Hz, 1H), 6.81 (m, 1H), 3.58 (s, 3H), 2.27 (s, 3 H); MS
(ESI) m/z: 437.3 (M+H.sup.+).
Example 27
[0434] Using general method C, Example B13 (0.081 g, 0.21 mmol) and
Example A2 (0.063 g, 0.21 mmol) were combined to afford
1-(5-(2-amino-8-ethyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-flu-
orophenyl)-3-(1-isopropyl-3-(thiophen-2-yl)-1H-pyrazol-5-yl)urea as
the hydrochloride salt (0.059 g, 52% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.13 (s, 1H), 8.94 (s, 1H), 8.70 (s, 1H),
8.42-8.40 (m, 1H), 7.89 (s, 1H), 7.41 (dd, J=5.2 Hz, 1.2 Hz, 1H),
7.34-7.30 (m, 3H), 7.06 (dd, J=5.2 Hz, 3.2 Hz, 1H), 6.57 (s, 1H),
4.54-4.49 (m, 1H), 4.32 (q, J=7.2 Hz, 2H), 1.42 (d, J=6.4 Hz, 6H),
1.22 (t, J=7.2 Hz, 3H); MS (ESI) m/z: 533.3 (M+H.sup.+).
Example 28
[0435] Using general method A, Example B13 (0.081 g, 0.21 nmol) and
Example A1 (0.060 g, 0.21 mmol) were combined to afford
1-(5-(2-amino-8-methyl-7-oxo-7,8-dilhydropyrido[2,3-d]pyrimidin-6-yl)-2-f-
luorophenyl)-3-(1-isopropyl-3-(thiophen-2-yl)-1H-pyrazol-5-yl)urea
as the hydrochloride salt (0.049 g, 45% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 9.23 (s, 1H), 8.99 (s, 1H), 8.72 (s,
1H), 8.44-8.41 (m, 1H), 7.91 (s, 1H), 7.41 (dd, J=5.2 Hz, 1.2 Hz,
1H), 7.34-7.30 (m, 3H), 7.06 (dd, J=5.2 Hz, 4.0 Hz, 1H), 6.57 (s,
1H), 4.52 (q, J=6.0 Hz, 1H), 3.58 (s, 3H), 1.42 (d, J=6.0 Hz, 6H);
MS (ESI) m/z: 519.0 (M+H.sup.+).
Example 29
[0436] Using general method B, Example B9 (0.61 g, 0.22 mmol) and
Example A2 (0.066 g, 0.22 mmol) were combined to afford
1-(5-(2-amino-8-ethyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-flu-
orophenyl)-3-(3-(2-fluorophenyl)-1-methyl-1H-pyrazol-5-yl)urea as
the hydrochloride salt (0.071 g, 62%, yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.46 (s, 1H), 9.09 (s, 1H), 8.76 (s, 1H),
8.41 (d, J=8.0 Hz, 1H), 7.94-7.88 (m, 2H), 7.35-7.21 (m, 5H), 6.66
(d, J=4.0 Hz, 1H), 4.32 (q, J=7.2 Hz, 2H), 3.81 (s, 3H), 1.23 (t,
J=7.2 Hz, 3H); MS (ESI) m/z: 517.3 (M+H.sup.+).
Example 30
[0437] Using general method F,
4-chloro-2-isocyanato-1-methylbenzene (0.112 g, 0.668 mmol) and
Example A2 (0.100 g, 0.334 mmol) were combined in ethyl acetate to
provide
1-(5-(2-amino-8-ethyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-flu-
orophenyl)-3-(5-chloro-2-methylphenyl)urea, which was converted to
the hydrochloride salt (120 mg, 77% yield) .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.38 (s, 1H), 8.78 (brs, 1H), 8.66 (s, 1H),
8.45 (d, J=8.0 Hz, 1H), 8.07 (m, 1H), 7.94 (m, 1H), 7.31 (d, J=8.0
Hz, 1H), 7.20 (d, J=8.0 Hz, 1H), 6.98 (d, J=8.0 Hz, 1H), 4.30 (q,
J=6.0 Hz, 2H), 2.26 (s, 3H), 1.22 (t, J=6.0 Hz, 3H); MS (ESI, m/z:
467.0, M+H.sup.+).
Example 31
[0438] Using general method F,
4-chloro-1-isocyanato-2-methylbenzene (0.112 g, 0.668 mmol) and
Example A2 (0.100 g, 0.334 mmol) were combined in ethyl acetate to
provide
1-(5-(2-amino-8-ethyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-flu-
orophenyl)-3-(4-chloro-2-methylphenyl)urea, which was converted to
the hydrochloride salt (125 mg, 80% yield) .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.16 (m, 1H), 8.74 (s, 1H), 8.54 (s, 1H),
8.46-8.43 (m, 2H), 7.93 (s, 1H), 7.91 (m, 1H), 7.31-7.27 (inm, 3H),
7.20 (dd, J=8.0, 2.5 Hz, 1H), 4.32 (q, J=6.0 Hz, 2H), 2.26 (s, 3H),
1.22 (t, J=6.0 Hz, 3H); MS (ESI, m/z: 467.0, M+H.sup.+).
Example 32
[0439] Using general method F, 1-isocyanatonaphthalene (0.112 g,
0.668 mmol) and Example A2 (0.100 g, 0.334 mmol) were combined in
ethyl acetate to provide
1-(5-(2-amino-8-ethyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-flu-
orophenyl)-3-(naphthalen-1-yl)urea, which was converted to the
hydrochloride salt (130 mg, 83% yield) .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.36 (s, 1H), 9.26 (s, 1H), 8.77 (m, 1H),
8.50 (d, J=8 Hz, 1H), 8.23 (d, J=8 Hz, 1H), 8.06 (d, J=8 Hz, 1H),
7.94 (m, 1H), 7.66-7.46 (m, 4H), 7.31 (m, 4H), 4.32 (q, J=6.0 Hz,
2H), 2.26 (s, 3H), 1.22 (t, J=6.0 Hz, 3H); MS (ESI, m/z: 469.0,
M+H).
Example 33
[0440] Using general method F,
1-chloro-3-isocyanato-2-methylbenzene (0.112 g, 0.668 mmol) and
Example A2 (0.100 g, 0.334 mmol) were combined in ethyl acetate to
provide
1-(5-(2-amino-8-ethyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-flu-
orophenyl)-3-(3-chloro-2-methylphenyl)urea, which was converted to
the hydrochloride salt (128 mg, 82% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.12 (s, 1H), 8.74 (m, 1H), 8.66 (s, 1H),
8.43 (d, J=8 Hz, 1H), 7.90 (m, 1H), 7.78 (m, 1H), 0.29 (m, 2H),
7.17 (m, 1H), 4.32 (q, J=6.0 Hz, 2H), 2.26 (s, 3H), 1.22 (t, J=6.0
Hz, 3H); MS (ESI, m/z: 467.0, M+H.sup.+).
Example 34
[0441] A solution of 4-(1,3,4-oxadiazol-2-yl)phenol (1.05 g, 6.48
mmol) and triethylamine (1.82 mL, 13.0 mmol) in CH.sub.2Cl.sub.2(12
mL) was cooled to 0.degree. C. and treated with triflic chloride
(0.83 mL, 7.77 mmol). The resultant orange-colored reaction was
stirred 30 min at 0.degree. C. and 30 min at RT. The reaction was
poured into EtOAc (50 mL), washed with water (20 mL), satd aq
NaHCO.sub.3 (20 mL) and brine (20 mL), dried (Na.sub.2SO.sub.4) and
concentrated in vacuo to provide 4-(1,3,4-Oxadiazol-2-yl)phenyl
trifluoromethanesulfonate (1.94 g, 102% yield) as a beige-colored
solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.43 (s, 1H),
8.22 (d, J=8.6 Hz, 2H), 7.78 (d, J=8.6 Hz, 2H).
[0442] 4-(1,3,4-Oxadiazol-2-yl)phenyl trifluoromethanesulfonate
(0.645 g, 2.19 mmoll), bis(pinacolato)diboron (0.72 g, 2.85 mol),
and potassium acetate (0.645 g, 6.58 mmol) were combined in DMF (4
mL). The resultant mixture was de-gassed under vacuum, backfilling
with argon (repeated 4.times.). Pd(dppf)Cl.sub.2 (96 mg, 0.12 mmol)
was added and the reaction warmed to 95.degree. C. overnight. The
reaction was diluted with EtOAc (50 mL), washed with water
(2.times.15 mL) and brine (2.times.10 mL), dried (MgSO.sub.4) and
concentrated in vacuo. Silica gel chromatography provided
2-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)-1,3,4--
oxadiazole (504 mg, 86% yield) as a white solid. .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 8.50 (s, 1H), 8.10 (d, J=8.0 Hz, 2H),
7.97 (d, J=8.0 Hz, 2H), 1.39 (s, 12H).
[0443] A solution of
2-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)-1,3,4-oxadiazol-
e (0.504 g, 1.85 mmol) in THF (10 mL) and water (5 mL) was treated
with sodium periodate (1.19 g, 5.56 mmol). The resultant slurry was
stirred at RT for 5 h. Glacial acetic acid (0.21 mL, 3.7 mmol) was
added and the mixture was stirred for 1 h and filtered. The
filtered solid was washed with ethyl acetate (75 mL) and
THF-methanol (1:1, 100 mL) and the filtrates were concentrated in
vacuao to a white solid. The solid was suspended in THF (75 mL) and
10 mL of 0.1 M aq HCl and was sonicated to promote dissolution. The
trace of insolubles were filtered and the organic layer was diluted
with ethyl acetate (25 mL), washed with 0.1 M
Na.sub.2S.sub.2O.sub.3 (2.times.20 mL), water (2.times.20 mL) and
brine (20 mL), dried (Na.sub.2SO.sub.4) and concentrated in vacuo
to provide 4-(1,3,4-oxadiazol-2-yl)phenylboronic acid (304 mg, 86%
yield) as a white powder. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.37 (s, 1H), 8.32 (s, 2H), 7.99 (s, 4H).
[0444] A mixture of 4-(1,3,4-oxadiazol-2-yl)phenylboronic acid (303
mg, 1.60 mmol) and powdered 4A molecular sieves (300 mg) in
CH.sub.2Cl.sub.2 (6 mL) was heated to reflux for 2 h. Ethyl
3-tert-butyl-1H-pyrazole-5-carboxylate (310 mg, 1.6 mmol), pyridine
(0.13 mL, 1.6 mmol) and copper (II) acetate (290 mg, 1.6 mmol) were
added and the reaction mixture was refluxed for 24 h. The reaction
was filtered and the solid was washed with EtOAc (40 mL) and MeOH
(40 mL).
[0445] The combined filtrate and washings were concentrated in
vacuo and partitioned between EtOAc (40 mL) and water (20 mL). The
organics were washed with water (20 mL), satd aq NaHCO.sub.3 (20
mL), water (20 mL), and brine (20 mL), dried (Na.sub.2SO.sub.4) and
concentrated in vacuo. The oily residue was chromatographed to
provide ethyl
1-(4-(1,3,4-oxadiazol-2-yl)phenyl)-3-tert-butyl-1H-pyrazole-5-carboxylate
(440 mg, >100% yield) as a visocus oil contaminated with the
starting ester. The mixture was used without further
purification.
[0446] A solution of ethyl
1-(4-(1,3,4-oxadiazol-2-yl)phenyl)-3-tert-butyl-1H-pyrazole-5-carboxylate
(440 mg, 1.29 mmol) in a mixture comprised of THF (3 mL), methanol
(1 mL) and water (1 mL) was cooled to 0.degree. C. and treated with
lithium hydroxide (62 mg, 2.59 mmol). The reaction mixture was
stirred 3 h at 0.degree. C. and was then allowed to warm to RT over
4 h. Water (15 mL) was added and the mixture was extracted with
ether (2.times.10 mL). The aqueous portion was acidified by
addition of 1 M aq HCl (2.5 mL, 2.5 mmol) and was extracted with
EtOAc (3.times.20 mL). The organics were dried (Na.sub.2SO.sub.4)
and concentrated in vacuo to provide
1-(4-(1,3,4-oxadiazol-2-yl)phenyl)-3-tert-butyl-1H-pyrazole-5-carboxylic
acid (355 mg, 88% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 13.35 (br s, 1H), 9.40 (d, J=3.4 Hz, 1H), 8.11 (m, 2H),
7.69 (m, 2H), 7.01 (d, J=3.2 Hz, 1H), 1.32 (s, 9H); MS (ESI) m/z:
313.0 (M+H.sup.+).
[0447] Using general method D,
1-(4-(1,3,4-oxadiazol-2-yl)phenyl)-3-tert-butyl-1H-pyrazole-5-carboxylic
acid (95 mg, 0.30 mmol), Example A1 (87 mg, 0.30 mmol) and pyridine
(0.015 mL, 0.19 mmol) were combined to afford crude product
product. The product was chromatographed on silica gel (100% EtOAc)
and further crystallized from EtOAc to provide
1-(1-(4-(1,3,4-oxadiazol-2-yl)phenyl)-3-tert-butyl-1H-pyrazol-5-yl)-3-(5--
(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluoroph-
enyl)urea. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.39 (s,
1H), 9.03 (br s, 1H), 8.99 (br s, 1H), 8.67 (s, 1H), 8.39 (dd,
J=8.0, 2.0 Hz, 1H), 8.19 (d, J=8.6 Hz, 2H), 7.86 (s, 1H), 7.83 (s,
1H), 7.82 (d, J=8.6 Hz, 2H), 7.33-7.24 (m, 4H), 6.47 (s, 1H), 3.57
(s, 3H), 1.30 (s, 9H); MS (ESI) m/z: 595.2 (M+H.sup.+).
Example 35
[0448] Using general method A, the troc carbamate of pyrazole amine
of Example 37 (0.2 g, 0.53 mmol) and Example A2 (0.160 g, 0.53
mmol) were combined to provide
1-(5-(2-amino-8-ethyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-flu-
orophenyl)-3-(3-isopropyl-1-phenyl-1H-pyrazol-5-yl)urea which was
converted to the hydrochloride salt (140 mg, 50% yield). .sup.1H
NMR (400 MHz, DMSO-d.sub.6): .delta. 9.10 (s, 1H), 9.05 (s, 1H),
8.79 (s, 1H), 8.40 (d, J=8 Hz, 1H), 7.90 (s, 1H), 7.54 (m, 4H),
7.43 (m, 1H), 7.27 (d, J=8 Hz, 1H), 6.36 (s, 1H), 4.32 (q, J=6.0
Hz, 2H), 2.89 (m, 1H), 1.22 (m, 9H); MS (ESI, m/z: 527.2,
M+H.sup.+).
Example 36
[0449] Using general method C, Example B14 (420 mg, 1.50 mmol) was
converted to 73% mono-Troc, 2,2,2-trichloroethyl
3-tert-butyl-1-(2-methylquinolin-6-yl)-1H-pyrazol-5-ylcarbamate and
16% bis-Troc, based on LC analysis, and which was used without
further purification in the next reaction (667 mg). MS (ESI) m/z:
456.5 (M+H.sup.+).
[0450] Example A1 (136 mg, 0.475 mmol) and the above Troc mixture
(200 mg, 0.453 mmol) were combined to afford
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uorophenyl)-3-(3-tert-butyl-1-(2-methylquinolin-6-yl)-1H-pyrazol-5-yl)urea
as the hydrochloride salt (22 mg, 8% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6), .delta. 1.32 (s, 9H), 2.96 (s, 3 H), 3.56 (s, 3H),
6.49 (s, 1H), 7.26-7.28 (m, 2H), 7.70 (br. s, 2H), 7.88 (s, 1H),
7.95 (d, J=8.7, 1H), 8.31-8.35 (m, 2H), 8.42-8.44 (m, 1H), 8.50 (m,
1H), 8.74 (s, 1H), 9.01 (m, 1H), 9.17 (s, 1H), 9.46 (s, 1H); MS
(ESI) m/z: 592.3 (M+H.sup.+).
Example 37
[0451] Using general method B, the carbamate of
3-isopropyl-1-phenyl-1H-pyrazol-5-amine (1.01 g, 5.02 mmol) and
Example A12 (0.69 g, 2.3 mmol) were combined to afford
1-(2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyr-
imidin-6-yl)phenyl)-3-(3-isopropyl-1-phenyl-1H-pyrazol-5-yl)urea as
an off-white solid (0.75 g, 62%, yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.99 (s, 1H), 8.90 (s, 1H), 8.75-8.66 (m,
1H), 8.42 (dd, J=8.0 Hz, 1.6 Hz, 1H), 7.87 (s, 1H), 7.83-7.81 (m,
1H), 7.58-7.51 (m, 4H), 7.46-7.41 (m, 1H), 7.32-7.23 (m, 2H), 6.37
(s, 1H), 3.63-3.56 (m, 3H), 2.93-2.87 (m, 4H), 1.23 (d, J=6.8 Hz,
6H); MS (ESI) m/z: 527.2 (M+H.sup.+).
Example 38
[0452] Using general method B, Example B1 (1.01 g, 4.69 mmol) and
Example A12 (1.25 g, 4.18 mmol) were combined to afford
1-(3-tert-butyl-1-phenyl-1H-pyrazol-5-yl)-3-(2-fluoro-5-(8-methyl-2-(meth-
ylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
as off-white solid (1.39 g, 62%, yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.00 (s, 1H), 8.89 (s, 1H), 8.75-8.67 (m,
1H), 8.42 (dd, J=8.0 Hz, 1.6 Hz, 1H), 7.88 (s, 1H), 7.83-7.81 (m,
1H), 7.58-7.51 (min, 4H), 7.46-7.41 (m, 1H), 7.32-7.23 (m, 2H),
6.41 (s, 1H), 3.63-3.56 (m, 3H), 2.92 (d, J=4.0 Hz, 3H), 1.28 (s,
9H); MS (ESI) m/z: 541.3 (M+H.sup.+).
Example 39
[0453] Using general method B, Example B9 (0.61 g, 0.22 mmol), and
Example A12 (0.066 g, 0.22 mmol) were combined to afford
1-(2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyr-
imidin-6-yl)phenyl)-3-(3-(2-fluorophenyl)-1-methyl-1H-pyrazol-5-yl)urea
as the hydrochloride salt (0.071 g, 62%, yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 9.33 (s, 1H), 9.01 (s, 1H), 8.70 (s,
1H), 8.44-8.41 (m, 1H), 7.94-7.90 (m, 2H), 7.35-7.21 (m, 5H), 6.67
(d, J=4.4 Hz, 1H), 3.80 (s, 3H), 3.62 (s, 3H), 2.93 (s, 3H); MS
(ESI) m/z: 517.3 (M+H.sup.+).
Example 40
[0454] Using general method F, 4-biphenylyl isocyanate (0.100 g,
0.512 mmol, 1.00 eq) and Example A3 (0.162 g, 0.512 mmol, 1.00 eq)
were combined to afford
1-(2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyri-
midin-6-yl)phenyl)-3-(4-biphenyl)urea (0.1884 g, 72% yield) as a
peach-colored solid which was used as is in the next step. .sup.1H
NMR (400 MHz, DMSO-d.sub.6): .delta. 9.22 (s, 1H), 8.98 (s, 1H),
8.68 (brs, 1H), 8.54-8.51 (m, 1H), 8.10 (s, 1H), 7.66-7.56 (m, 7H),
7.46-7.42 (m, 2H), 7.36-7.30 (m, 3H), 3.69 (s, 3H), 2.63 (s, 3H);
MS (ESI) m/z: 512.3 (M+H.sup.+), 534.0 (M+Na.sup.+).
[0455] Using a procedure analogous to Example A1,
1-(2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyri-
midin-6-yl)phenyl)-3-(4-biphenyl)urea and MeNH.sub.2--HCl were
combined to afford
1-(2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,-
3-d]pyrimidin-6-yl)phenyl)-3-(4-biphenyl)urea (59.9 mg) as a pale
yellow solid which was subsquentually converted to the HCl salt
(56.7 mg). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.30 (s,
1H), 8.71 (brs, 1H), 8.67 (brs, 1H), 8.48 (dd, 1H, J=2.0 and 8.0
Hz), 7.92 (s, 1H), 7.65-7.56 (m, 7H), 7.46-7.41 (m, 2H), 7.34-7.26
(m, 3H), 3.64 (brs, 3H), 2.94 (brs, 3H); MS (ESI) m/z: 495.0
(M+H.sup.+).
Example 41
[0456] Using general method D, Example B17 (0.061 g, 0.25 mmol) and
Example A37 (0.14 g, 0.51 mmol) in presence of triethylamine (0.077
g, 0.76 mmol) and diphenylphospharyl azide (0.077 g, 0.28 mmol)
were combined to afford
1-(3-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)pheny-
l)-3-(3-tert-butyl-1-(2-(dimethylamino)ethyl)-1H-pyrazol-5-yl)urea
as the hydrochloride salt (0.063 g, 49% yield). .sup.1H NMR (400
MHz, DMSO-ds): 9.62 (brs, 1H), 9.46 (s, 1H), 9.24 (s, 1H), 8.67 (s,
1H), 7.89 (s, 1H), 7.45 (d, J=8.0 Hz, 1H), 7.36-7.31 (m, 4H),
7.17-7.12 (m, 1H), 6.15 (s, 1H), 4.38 (t, J=6.4 Hz, 2H), 3.58 (s,
3H), 3.55-3.51 (m, 2H), 2.84 (s, 3H), 2.83 (s, 3H), 1.24 (s, 9H);
MS (ESI) m/z: 504.2 (M+H.sup.+).
Example 42
[0457] Using general method F, Example A1 (72 mg, 0.25 mmol) and
1-isocyanato-3-methylbenzene (0.049 mL, 0.38 mmol) were combined to
provide
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6--
yl)-2-fluorophenyl)-3-m-tolylurea (57 mg, 52% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 9.01 (br s, 1H), 8.69 (s, 1H),
8.57 (d, J=2.5 Hz, 1H), 8.45 (m, 1H), 7.89 (s, 1H), 7.34-7.27 (m,
4H), 7.22-7.14 (m, 3H), 6.81 (d, J=7.1 Hz, 1H), 3.58 (s, 3H), 2.29
(s, 3H); MS (ESI) m/z: 419.2 (M+H.sup.+).
Example 43
[0458] Using general method C, Example B18 (0.250 g, 1.78 mmol,
1.00 eq) as the TROC carbamate and Example A3 (0.211 g, 0.665 mmol,
1.00 eq) were combined to afford
1-(3-t-butylisoxazol-5-yl)-3-(2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7-
,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.180 g, 56%
yield) as an oil. .sup.1H NMR (400 MHz, acetone-d.sub.6): .delta.
9.64 (brs, 1H), 8.91 (s, 1N), 8.62 (m, 1H), 8.35 (brs, 1H), 8.06
(s, 1H), 7.49 (m, 1H), 7.26 (m, 1H), 6.17 (s, 1H), 3.77 (s, 3H),
2.69 (s, 3H), 1.32 (s, 9H); MS (ESI) m/z: 483.3 (M+H.sup.+).
[0459] Using a procedure analogous to Example A1,
1-(3-t-butylisoxazol-5-yl)-3-(2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7-
,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.180 g, 0.373
mmol, 1.00 eq) was oxidized with MCPBA (70.00 wt %, 0.276 g, 1.12
mmol, 3.00 eq) and then subjected to MeNH.sub.2HCl (0.019 g, 0.28
mmol, 2.00 eq) to afford
1-(3-t-butylisoxazol-5-yl)-3-(2-fluoro-5-(8-methyl-2-(methylamino)-
-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.0346
g, 53% yield) as an off-white solid. The free base thus obtained
converted to the hydrochloride (32.3 mg) as a pale yellow solid.
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.45 (s, 1H), 8.840
(s, 1H), 8.69 (brs, 1H), 8.42 (dd, J=8.0, 2.0 Hz, 1H), 7.92 (s,
1H), 7.90 (brs, 1H), 7.39-7.29 (m, 2H), 6.09 (s, 1H), 3.64 (brs,
3H), 2.93 (brs, 3H), 1.26 (s, 9H); MS (ESI) m/z: 466.2
(M+H.sup.+).
Example 44
[0460] Using general method D, Example B25 (0.1 g, 0.39 mmol) and
Example A2 (0.234 g, 0.78 mmol) were combined to provide
1-(5-(2-amino-8-ethyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-flu-
orophenyl)-3-(1-(3-cyanophenyl)-3-isopropyl-1H-pyrazol-5-yl)urea,
which was converted to the hydrochloride salt (52 mg, 24% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6) .delta.9.18 (s, 1H), 9.10 (brs,
1H), 8.79 (s, 1H), 8.34 (d, J=8.0 Hz, 1H), 8.05 (m, 1H), 7.90 (m,
3H), 7.73 (t, J=8.5 Hz, 1H), 7.30 (d, J=8.5 Hz, 1H), 6.40 (s, 1H),
4.31 (q, J=8 Hz, 2H), 2.90 (m, 1H), 1.22 (m, 9H); MS (ESI, m/z:
552.2, M+H.sup.+).
Example 45
[0461] Using general procedure D, biphenyl-3-carboxylic acid (0.100
g, 0.504 mmol, 1.00 eq) and Example A3 (0.239 g, 0.757 mmol, 1.50
eq) were combined to afford
1-(2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyri-
midin-6-yl)phenyl)-3-(3-biphenyl)urea (0.110 g, 43% yield) as a
foam. .sup.1H NMR (400 MHz, acetone-da): .delta. 9.23 (s, 1H), 8.97
(s, 1H), 8.69 (dd, J=8.0, 2.4 Hz), 8.64 (brs, 1H), 8.09 (s, 1H),
7.93 (m, 1H), 7.68-7.65 (m, 2H), 7.50-7.46 (m, 3H), 7.43-7.36 (m,
3H), 7.30-7.24 (m, 2H), 3.76 (s, 3H), 2.67 (s, 3H); MS (ESI) m/z:
512.0 (M+H.sup.+).
[0462] Using a procedure analogous to example A1,
1-(2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyri-
midin-6-yl)phenyl)-3-(3-biphenyl)urea (0.110 g, 0.215 mmol, 1.00
eq) was oxidized with MCPBA (70.00 wt %, 0.159 g, 0.645 mmol, 3.00
eq) and then subjected to MeNH.sub.2.HCl (0.00870 g, 0.129 mmol,
2.00 eq) to afford
1-(2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyr-
imidin-6-yl)phenyl)-3-(3-biphenyl)urea (0.0227 g, 71% yield). This
was converted to the HCl salt (0.021 g) as an off-white solid.
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.29 (brs, 1H), 8.71
(brs, 1H), 8.69 (brs, 1H), 8.44 (min, 1H), 7.92 (s, 1H), 7.84 (s,
1H), 7.64-7.61 (m, 2H), 7.50-7.46 (m, 2H), 7.40-7.36 (m, 3H),
7.31-7.26 (m, 3H), 3.64 (brs, 3H), 2.93 (brs, 3H); MS (ESI) m/z:
495.2 (M+H.sup.+).
Example 46
[0463] Using general method F, Example A1 (80 ing, 0.28 mmol) and
4-chloro-3-(trifluoromethyl)phenyl isocyanate (93 mg, 0.42 mmol)
were combined to provide
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uorophenyl)-3-(4-chloro-3-(trifluoromethyl)phenyl)urea (62 mg, 44%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.52 (s, 1H),
8.71 (d, J=2.3 Hz, 1H), 8.68 (s, 1H), 8.37 (dd, J=8.2, 1.9 Hz, 1H),
8.14 (d, J=2.2 Hz, 1H), 7.90 (s, 1H), 7.65-7.58 (m, 2H), 7.36-7.26
(m, 4H), 3.58 (s, 3H); MS (ESI) m/z: 507.0 (M+H.sup.+).
Example 47
[0464] 6-t-Butyl-1H-thieno[3,2-d][1,3]oxazine-2,4-dione (0.075 g,
0.33 mmol, 1.0 eq; prepared according to the method disclosed in WO
99/32111) and Example A12 (0.100 g, 0.33 mmol, 1.0 eq) were
combined in DMSO (3.3 ml) and stirred with heating at 70.degree. C.
for 16 h and at 110.degree. C. for 24 h. The completed reaction was
cooled to RT, diluted with brine and extracted with EtOAc
(3.times.). The combined organics were washed with brine
(2.times.), dried (Na.sub.2SO.sub.4), filtered, concentrated in
vacuo and purified by flash column chromatography (10%
EtOAc/hexanes-100% EtOAc) to afford
1-(5-t-butylthiophen-3-yl)-3-(2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo--
7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.060 g, 38%
yield) as a creamy yellow solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.18 (s, 1H), 8.67 (brs, 1H), 8.49 (m, 1H),
8.42 (m, 1H), 7.89 (s, 1H), 7.82 (brs, 1H), 7.28-7.25 (m, 2H), 7.02
(d, J=1.6 Hz, 1H), 6.82 (d, J=1.6 Hz, 1H), 3.639 (brs, 3H), 2.93
(d, J=4.1 Hz, 3H); MS (ESI) m/z: 481.2 (M+H.sup.+).
Example 48
[0465] Using general method B, the carbamate of
1-phenyl-3-(trifluoromethyl)-1H-pyrazol-5-amine (1.01 g, 3.24 mmol)
and Example A12 (0.97 g, 3.24 mmol) were combined to afford
1-(2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyr-
imidin-6-yl)phenyl)-3-(1-phenyl-3-(trifluoromethyl)-1H-pyrazol-5-yl)urea
as an off-white solid (1.41 g, 79%, yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.16 (s, 1H), 9.08 (s, 1H), 8.72 (s, 1H),
8.37 (dd, J=8.0 Hz, 1.6 Hz, 1H), 7.92 (s, 1H), 7.85 (brs, 1H),
7.64-7.54 (m, 5H), 7.32-7.20 (m, 2H), 6.87 (s, 1H), 3.60-3.57 (m,
3H), 2.89 (d, J=4.8 Hz, 3H); MS (ESI) m/z: 556.3 (M+H.sup.+).
Example 49
[0466] Using general method D,
3-tert-butyl-1-methyl-1H-pyrazole-5-carboxylic acid (0.041 g, 0.24
mmol) and Example A52 (0.085 g, 0.27 mmol) were combined in
presence of triethylamine (0.046 g, 0.45 mmol) and
diphenylphospharyl azide (0.093 g, 0.34 mmol) to afford
1-(5-(2-amino-8-isopropyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-
-fluorophenyl)-3-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)urea as a
white solid (0.068 g, 61% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.92 (s, 1H), 8.82 (s, 1H), 8.64 (s, 1H),
8.37-8.35 (m, 1H), 7.80 (s, 1H), 7.29-7.26 (m, 4H), 6.01 (s, 1H),
5.80-5.76 (m, 1H), 3.62 (s, 3H), 1.54 (d, J=6.8 Hz, 6H), 1.21 (s,
9H); MS (ESI) m/z: 493.2 (M+H.sup.+).
Example 50
[0467] Using general method D, Example B24 (0.150 g, 0.403 mmol)
and Example A2 (0.271 g, 0.906 mmol) were combined to provide
1-(5-(2-amino-8-ethyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-flu-
orophenyl)-3-(1-(4-fluorophenyl)-3-isopropyl-1H-pyrazol-5-yl)urea,
which was converted to the mesylate salt (184 mg, 63% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.06 (brs, 1H), 8.96
(s, 1H), 8.78 (s, 1H), 8.39 (d, J=9 Hz, 1H), 7.92 (s, 1H), 7.59 (m,
1H), 7.42 (m, 2H), 7.29 (m, 2H), 6.39 (s, 1H), 4.31 (q, J=7 Hz,
2H), 2.90 (m, 1H), 2.37 (s, 6H), 1.24 (m, 9H); MS (ESI, m/z: 545.3,
M+H.sup.+).
Example 51
[0468] Using general method D, example B25 (0.150 g, 0.588 mmol)
and Example A1 (0.2 g, 0.705 mmol) were combined to provide
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uorophenyl)-3-(1-(3-cyanophenyl)-3-isopropyl-1H-pyrazol-5-yl)urea
which was converted to the mesylate salt (78 mg, 51% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6) .delta.9.00 (brs, 1H), 8.96 (s,
1H), 8.75 (s, 1H), 8.39 (d, J=8 Hz, 1H), 8.05 (s, 1H), 7.93-7.85
(m, 3H), 7.75 (m, 1H), 7.29 (d, J=8 Hz, 2H), 6.41 (s, 1H), 3.50 (s,
3H), 2.90 (m, 1H), 2.37 (s, 6H), 1.24 (d, J=7 Hz, 6H); MS (ESI,
m/z: 538.3, M+H.sup.+).
Example 52
[0469] Using general method D,
1-(3-fluorophenyl)-3-isopropyl-1H-pyrazole-5-carboxylic acid (0.10
g, 0.403 mmol) and Example A2 (0.241 g, 0.806 mmol) were combined
to provide
1-(5-(2-amino-8-ethyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-flu-
orophenyl)-3-(1-(3-fluorophenyl)-3-isopropyl-1H-pyrazol-5-yl)urea,
which was converted to the mesylate salt (70 mg, 63% yield),
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.06 (brs, 1H), 8.96
(s, 1H), 8.78 (s, 1H), 8.39 (d, J=9 Hz, 1H), 7.92 (s, 1H), 7.59 (m,
1H), 7.42 (m, 2H), 7.29 (m, 2H), 6.39 (s, 1H), 4.31 (q, J=7 Hz,
2H), 2.90 (m, 1H), 2.37 (s, 6H), 1.24 (m, 9H); MS (ESI, m/z: 545.3,
M+H.sup.+).
Example 53
[0470] To a stirring solution of Example A45 (0.460 g, 1.5 mmol,
1.0 eq) and (Boc).sub.2O (0.70 g, 3.2 mmol, 2.200 eq) in THF (15
ml) at 22.degree. C. was added DMAP (0.040 g, 0.30 mmol, 0.20 eq).
The mixture was heated at reflux for 1 h. The completed reaction
was cooled to RT, concentrated to a residue and purified by flash
column chromatography (0-35% EtOAc in hexanes) to afford
bis-tert-butyl
3-(8-ethyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)ph-
enylcarbamate (0.54 g, 70% yield) as an oil that solidified under
high vacuum. .sup.1H NMR (400 MHz, acetone-d.sub.6): .delta. 8.89
(s, 1H), 8.11 (s, 1H), 7.74 (ddd, J=1.2, 1.6, and 8.0 Hz, 1H), 7.68
(t, J=2.4 Hz, 1H), 7.48 (t, J=7.6 Hz, 1H), 7.26 (ddd, J=1.2, 2.0
and 8.0 Hz, 1H), 4.54 (q, J=6.8 Hz, 2H), 2.67 (s, 3H), 1.48 (s,
18H), 1.35 (t, J=6.8 Hz, 3H); MS (ESI) m/z: 513.3 (M+H.sup.+),
535.2 (M+Na.sup.+).
[0471] Using a procedure analogous to Example A1, bis-tert-butyl
3-(8-ethyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)ph-
enylcarbamate (0.540 g, 1.1 mmol) in CH.sub.2Cl.sub.2 (11 ml),
MCPBA (70.00 wt %, 0.31 g, 1.3 mmol) and 0.5M NH.sub.3 in
1,4-dioxane (11 ml, 5.3 mmol) were combined to afford desired
product (0.50 g, 99% yield) as a brittle foam which was used as is
in the next reaction. .sup.1H NMR (400 MHz, acetone-d.sub.6):
.delta. 8.66 (s, 1H), 7.94 (s, 1H), 7.70 (m, 1H), 7.65 (m, 1H),
7.44 (m, 1H), 7.19 (m, 1H), 6.65 (brs, 2H), 4.42 (q, J=6.8 Hz),
1.47 (s, 18H), 1.27 (t, J=6.8 Hz, 3H); MS (ESI) m/z: 482.2
(M+H.sup.+).
[0472] To a stirring solution of bis-t-butyl
3-(2-amino-8-ethyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenylcar-
bamate (0.500 g, 1.04 mmol, 1.00 eq) in MeOH (5.00 ml) at
22.degree. C. was added 3M HCl (5.00 ml, 15.0 mmol, 14.4 eq). After
3 d, the completed reaction was concentrated to remove the MeOH and
excess HCl. The aqueous residue was diluted with MeCN/H.sub.2O,
frozen and lyophilized to afford
2-amino-6-(3-aminophenyl)-8-ethylpyrido[2,3-d]pyrimidin-7(8H)-one
hydrochloride (0.330 g, 100% yield) which was used as is in the
next reaction. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.79
(s, 1H), 8.02 (s, 1H), 7.52 (t, J=2.0 Hz, 1H), 7.64 (dt, J=1.2 and
8.0 Hz, 1H), 7.56 (t, J=7.6 Hz, 1H), 7.39 (ddd, J=1.2, 2.0, and 8.0
Hz, 1H), 4.33 (q, J=7.2 Hz, 2H), 1.23 (t, J=7.2 Hz, 3H); MS (ESI)
m/z: 282.3 (M+H.sup.+).
[0473] Using general method C, the TROC carbamate of Example B26
(0.304 g, 0.711 mmol) and
2-amino-6-(3-aminophenyl)-8-ethylpyrido[2,3-d]pyrimidin-7(8H)-one
hydrochloride (0.226 g, 0.711 mmol) were combined to afford impure
product (0.300 g) as a yellowish solid. This was triturated with
CH.sub.2Cl.sub.2 at 0.degree. C. The solids were collected by
filtration, rinsed with ice-cold CH.sub.2Cl.sub.2 and dried on the
filter to afford desired product (0.1584, 40% yield) as an
off-white solid. The solid was treated with MsOH to afford
1-(3-(2-amino-8-ethyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl-
)-3-(3-isopropyl-1-(quinolin-6-yl)-1H-pyrazol-5-yl)urea (0.1793 g)
as the bis-mesylate salt. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.19 (s, 1H), 9.15 (dd, J=1.2 and 4.40 Hz, 1H), 8.87 (d,
J=8.8 Hz, 1H), 8.73-8.71 (m, 2H), 8.38 (d, J=2.0 Hz, 1H), 8.27 (d,
J=8.8 Hz, 1H), 8.19 (dd, J=2.0 and 8.8 Hz, 1H), 7.91 (s, 1H), 7.88
(dd, J=4.4 and 8.4 Hz, 1H), 7.74 (dd, J=2.0 and 4.0 Hz, 1H), 7.41
(m, 1H), 7.31 (t, J=8.0 Hz, 1H), 7.22 (m, 1H), 6.44 (s, 1H), 4.31
(q, J=6.8 Hz, 2H), 2.96 (septet, J=6.8 Hz, 1H), 2.36 (s, 6H), 1.28
(d, J=6.8 Hz, 6H), 1.21 (t, J=6.8 Hz, 3H); MS (ESI) m/z: 560.2
(M+H.sup.+).
Example 54
[0474] Using General Method A, Example A22 (197 mg, 0.697 mmol) and
the 2,2,2-trichloroethyl carbamate of Example B18 (200 mg, 0.634
mmol) were combined to afford
1-(3-tert-butylisoxazol-5-yl)-3-(5-(1-ethyl-2-oxo-1,2-dihydro-1,6-naphthy-
ridin-3-yl)-2-fluorophenyl)urea (98 mg, 34% yield) as the
hydrochloride salt. .sup.1H NMR (300 MHz, DMSO-d.sub.6) .delta.
1.25 (s, 9H), 1.26-1.30 (d, 3H), 4.39 (q, 2H), 6.06 (s, 1H),
7.40-7.43 (m, 2H), 7.98-8.00 (m, 1H), 8.34 (s, 1H), 8.49-8.51 (m,
1H), 8.78-8.80 (m, 1H), 9.07 (s, 1H), 9.28 (s, 1H), 10.6 (s, 1 H);
MS (ESI) m/z: 450.2 (M+H.sup.+).
Example 55
[0475] Using general method A, the TROC carbamate of Example B18
(0.083 g, 0.26 mmol) and Example A52 (0.082 g, 0.26 mmol) were
combined to afford
1-(5-(2-amino-8-isopropyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimhnidin-6-yl)-
-2-fluorophenyl)-3-(3-tert-butylisoxazol-5-yl)urea as an off-white
solid (0.051 mg, 40% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 10.37 (s, 1H), 8.75 (s, 1H), 8.64 (s, 1H), 8.34 (dd, J=7.6
Hz, 1.6 Hz, 1H), 7.82 (s, 1H), 7.35-7.27 (m, 4H), 6.09 (s, 1H),
5.82-5.76 (m, 1H), 1.55 (d, J=7.2 Hz, 6H), 1.25 (s, 9H); MS (ESI)
m/z: 480.2 (M+H.sup.+).
Example 56
[0476] Using general method B, prop-1-en-2-yl
3-tert-butylphenylcarbamate (0.18 g, 0.75 mmol) and Example A12
(0.090 g, 0.30 mmol) were combined to afford
1-(3-tert-butylphenyl)-3-(2-fluoro-5-(8-methyl-2-(methylamino)-7-o-
xo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.057 g, 40%
yield) as a yellow solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.07 (s, 1H), 8.68 (s, 1H), 8.52 (s, 1H), 8.42 (dd, J=7.6,
2.4 Hz, 1H), 7.90 (s, 1H), 7.83 (s, 1H), 7.45 (s, 1H), 7.32-7.19
(m, 4H), 7.03 (d, J=4.4 Hz, 1H), 3.67 (m, 3H), 3.32 (s, 3H), 1.28
(s, 9H); MS (ESI) m/z: 475.2 (M+H.sup.+).
Example 57
[0477] To a stirring solution of
1-(3-t-butylisoxazol-5-yl)-3-(2-fluoro-5-(8-methyl-2-(methylsulfinyl)-7-o-
xo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea from Example
43 (0.125 g, 0.251 mmol, 1.00 eq) in DMF (2.50 ml) at 0.degree. C.
was added unsym-dimethylethylenediarmine (0.138 ml, 1.25 mmol, 5.00
eq). After 1 h, the completed reaction was diluted with brine (5
ml) and left to stir overnight. The solids were collected by
filtration, rinsed well with H.sub.2O and dried on the filter to
afford crude desired product (76 mg) as a pale pink solid. The
crude product was purified by reverse phase chromatography (5-40%
MeCN (w/0.1% TFA)/H.sub.2O (w/0.1% TFA)) to afford
1-(3-t-butylisoxazol-5-yl)-3-(5-(2-(2-(dimethylamino)ethylamino)-8-methyl-
-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluorophenyl)urea
(37.3 mg, 0.059 mmol) as the TFA salt following lyophilization. The
TFA salt thus obtained was treated with MP-Carbonate resin and
certified 0.1N HCl (1.0 eq), frozen and lyophilized to afford the
HCl salt. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.44 (s,
1H), 9.56 (brs, 1H), 8.85 (brs, 1H), 8.76 (brs, 1H), 8.41 (dd,
J=2.0 and 7.6 Hz, 1H), 8.01 (brs, 1H), 7.95 (s, 1H), 7.37-7.28 (m,
2H), 6.05 (s, 1H), 3.73 (m, 2H), 3.58 (brs, 3H), 3.41 (brs, 2H),
2.85 (brs, 6H), 1.24 (s, 9H); MS (ESI) m/z: 523.2 (M+H.sup.+).
Example 58
[0478] Using General Method A, Example A24 (400 mg, 1.28 mmol) and
the TROC carbamate of Example B18 (421 mg, 1.28 mmol) were combined
to afford
1-(3-tert-butylisoxazol-5-yl)-3-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dih-
ydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)urea (242 mg) as a foam.
The foam was treated with methanesulfonic acid (47 mg, 0.492 mmol)
and isolated as the methanesulfonic acid salt (248 mg, 87% yield).
.sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 1.20-1.28 (an, 3H),
1.22 (s, 9H), 2.28 (s, 3H), 2.94 (s, 3H), 4.15-4.18 (q, 2H), 6.04
(s, 1H), 6.51 (s, 1H), 7.31-7.33 (m, 2H), 7.98 (s, 1H), 8.37-8.39
(m, 1H), 8.55 (s, 1H), 8.77 (s, 1H), 10.3 (s, 1H), acid proton
missing; MS (ESI) m/z: 479.2 (M+H.sup.+).
Example 59
[0479] Using general method A, Example A14 (54 mg, 0.18 mmol) and
the TROC carbamate of Example B18 (57 mg, 0.18 mmol) were combined
to provide
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uoro-4-methylphenyl)-3-(3-tert-butylisoxazol-5-yl)urea (45 mg, 54%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.30 (s, 1H),
8.68 (s, 1H), 8.63 (s, 1H), 7.90 (d, J=8.6 Hz, 1H), 7.69 (s, 1H),
7.32 (s, 2H), 7.19 (d, J=12.2 Hz, 1H), 6.03 (s, 1H), 3.56 (s, 3H),
2.10 (s, 3H), 1.24 (s, 9H); MS (ESI) m/z: 466.2 (M+H.sup.+).
Example 60
[0480] Using general method A, Example A1 (54 mg, 0.18 mmol) and
the TROC carbamate of Example 118 (57 mg, 0.18 nanol) were combined
to provide
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uorophenyl)-3-(3-tert-butylisoxazol-5-yl)urea. .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 10.37 (s, 1H), 8.77 (d, J=2.0 Hz, 1H),
8.68 (s, 1 H), 8.42 (dd, J=8.0, 2.0 Hz, 1H), 7.90 (s, 1H),
7.38-7.28 (m, 4H), 6.09 (s, 1H), 3.58 (s, 3H), 1.27 (s, 9H); MS
(ESI) m/z: 452.2 (M+H.sup.+).
Example 61
[0481] Using a procedure analogous to Example A1, Example A3 (1.00
g, 3.16 mmol) and unsym-dimethylethylenediamine (1.74 ml, 15.8
mmol) were combined to afford
6-(3-amino-4-fluorophenyl)-2-(2-(dimethylamino)ethylamino)-8-methylpyrido-
[2,3-d]pyrimidin-7(8H)-one (0.8640 g, 77% yield) as a tan solid
which was used as is in the next reaction. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.62 (s, 1H), 7.80 (s, 1H), 7.71 (brt, 1H),
7.10 (dd, J=2.0 and 9.2 Hz, 1H), 7.00 (dd, J=8.4 and 11.2 Hz, 1H),
6.76 (ddd, J=2.0, 4.40, and 8.40 Hz, 1H), 5.14 (brs, 2H), 3.58
(brs, 3H), 3.47 (q, J=6.4 Hz, 2H), 2.47 (bnn, 2H), 2.20 (s, 6H); MS
(ESI) m/z: 357.2 (M+H.sup.+).
[0482] Using general method F,
6-(3-amino-4-fluorophenyl)-2-(2-(dimethylamino)ethylamino)-8-methylpyrido-
[2,3-d]pyrimidin-7(8H)-one (0.1000 g, 0.281 mmol, 1.00 eq) and
.alpha.,.alpha.,.alpha.-trifluoro-m-tolyl isocyanate (0.0589 ml,
0.421 mmol, 1.50 eq) were combined to afford crude product.
[0483] The crude residue was purified by reverse phase
chromatography and isolated as the HCl salt of
1-(5-(2-(2-(dimethylamino)ethylamino)-8-methyl-7-oxo-7,8-dihydropyrido-[2-
,3-d]pyrimidin-6-yl)-2-fluorophenyl)-3-(3-(trifluoromethyl)phenyl)urea
(63 mg). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.62 (brs,
1H), 9.59 (s, 1H), 8.78 (brs, 1H), 8.75 (s, 1H), 8.40 (m, 1H), 8.05
(s, 1H), 7.99 (brs, 1H), 7.95 (s, 1H), 7.51-7.49 (m, 2H), 7.33-7.25
(m, 3H), 3.75-3.70 (m, 2H), 3.62 (brs, 3H), 3.32 (brs, 2H), 2.83
(brs, 6H), MS (ESI) m/z: 544.2 (M+H.sup.+).
Example 62
[0484] Using general procedure A, Example B3 (0.3000 g, 1.1 mmol,
1.0 eq) and
6-(3-amino-4-fluorophenyl)-2-(2-(dimethylamin)ethylamino)-8-methylpyr-
id[2,3-d]pyrimidin-7(8H)-one from Example 61 (0.0796 g, 0.223 mmol,
1.00 eq) were combined to to give the target crude product. The
crude product was purified by reverse phase chromatography to
afford the TFA salt (34.2 mg) following lyophilization. The TFA
salt thus obtained was converted to the HCl of desired product,
1-(1-(3-(2-mnino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(5-(2-(2-
-(dimethylamino)ethylamino)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimid-
in-6-yl)-2-fluorophenyl)urea (30 mg). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.87 (brs, 1H), 9.05 (s, 1H), 8.97 (s, 1H),
8.77 (brs, 1H), 8.45 (m, 1H), 8.05 (brs, 1H), 7.95 (s, 1H), 7.55
(brs, 1H), 7.50-7.44 (m, 2H), 7.39-7.25 (m, 4H), 6.94 (brs, 1H),
6.40 (s, 1H), 3.76 (brnn, 2H), 3.66 (brs, 3H), 3.48 (s, 2H), 3.34
(brm, 2H), 2.85 (brs, 6H), 1.28 (s, 9H); MS (ESI) m/z: 655.2
(M+H.sup.+).
Example 63
[0485] Using general method C, Example B27 (400 mg, 1.7 mmol) was
converted to the his (2,2,2-trichloroethyl)carbamate of
1-(6-methylpyridin-3-yl)-3-(trifluoromethyl)-1H-pyrazol-5-amine
(435 mg, 43% yield). MS (ESI) m/z: 592.7/594.8 (M+H.sup.+).
[0486] A solution of the bis(2,2,2-trichloroethyl) carbamate of
1-(6-methylpyridin-3-yl)-3-(trifluoromethyl)-1H-pyrazol-5-amine
(433 mg, 0.7 mmol) and trichloroethanol (1 mL, 10 mmol) in
acetonitrile (5 mL) was treated with K.sub.2CO.sub.3(9 mg, 0.07
mmol). The resultant reaction mixture was stirred at RT for 7 h.
The reaction mixture was diluted with ethyl acetate (30 mL), washed
with water and brine, dried (MgSO.sub.4) and concentrated in vacuo.
Chromatography provided 2,2,2-trichloroethyl
1-(6-methylpyridin-3-yl)-3-(trifluoromethyl)-1H-pyrazol-5-ylcarbamate
(270 mg, 89% yield) as a white foam. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 10.56 (br s, 1H), 8.61 (d, J=2.5 Hz, 1H),
7.87 (dd, J=8.3, 2.8 Hz, 1H), 7.47 (d, J=8.3 Hz, 1H), 6.95 (s, 1H),
4.89 (s, 2H), 2.56 (s, 3H); MS (ESI) m/z: 417.0/419.0
(M+H.sup.+).
[0487] Using general method A, Example A1 (69 mg, 0.24 mmol) and
2,2,2-trichloroethyl
1-(6-methylpyridin-3-yl)-3-(trifluoromethyl)-1H-pyrazol-5-ylcarbamate
(98 mg, 0.23 mmol) were combined to provide impure desired product.
The residue was chromatographed and triturated with boiling
CH.sub.2Cl.sub.2 to provide
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uorophenyl)-3-(1-(6-methylpyridin-3-yl)-3-(trifluoromethyl)-1H-pyrazol-5-y-
l)urea (35 mg, 27% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.21 (br s, 1H), 9.02 (m, 1 H), 8.70 (d, J=2.4 Hz, 1H),
8.65 (s, 1H), 8.37 (dd, J=8.0, 1.2 Hz, 1H), 7.96 (dd, J=8.0, 2.6
Hz, 1H), 7.84 (s, 1H), 7.51 (d, J=8.0 Hz, 1H), 7.31-7.22 (m, 4H),
6.89 (s, 1H), 3.55 (s, 3H), 2.58 (s, 3H); MS (ESI) m/z: 554.0
(M+H.sup.+).
Example 64
[0488] Using general method A,
1-(5-(2-(2-(dimethylamino)ethylamino)-8-methyl-7-oxo-7,8-dihydropyrido[2,-
3-d]pyrimidin-6-yl)-2-fluorophenyl)-3-(3-isopropylisoxazol-5-yl)urea
hydrochloride (210 mg, 45% yield) was prepared from the Troc
carbamate of Example B20 (0.300 g, 0.995 mmol, 1.00 eq) and
6-(3-amino-4-fluorophenyl)-2-(2-(dimethylamino)ethylamino)-8-methylpyrido-
[2,3-d]pyrimidin-7(8H)-one from Example 61 (0.355 g, 0.995 mmol,
1.00 eq). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.40 (s,
1H), 9.43 (brs, 1H), 8.82 (d, J=2.4 Hz, 1H), 8.75 (brs, 1H), 8.39
(dd, J=2.0 and 7.6 Hz, 1H), 7.99 (brs, 1H), 7.95 (s, 1H), 7.37-7.28
(m, 2H), 6.01 (s, 1H), 3.73 (brm, 2H), 3.63 (brs, 3H), 3.32 (bnn,
2H), 2.89 (septet, J=6.8 Hz, 1H), 2.85 (brs, 6H), 1.18 (d, J=6.8
Hz, 6H); MS (ESI) m/z: 509.2 (M+H.sup.+).
Example 65
[0489] Using a modified general method B, the carbamate of Example
B19 (0.3 g, 1.36 mmnoI) and Example A3 (0.43 g, 1.36 mmol) in
presence of 1-methylpyrrolidine (catalytic amount) were heated at
120.degree. C. for 1.5 h under microwave irradiation to afford
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-5-(8-methyl-2-(methylthio)-7-
-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.3 g, 47%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.95 (s, 1H),
8.72 (brs, 1H), 8.54 (d, J=2.0 Hz, 1H), 8.48-8.46 (m, 1H), 8.05 (s,
1H), 7.81 (s, 1H), 7.39 (s, 1H), 7.29-7.26 (m, 2H), 3.66 (s, 3H),
2.60 (s, 3H), 1.47 (s, 9H); (ESI) m/z: 482.2 (M+H.sup.+).
[0490] Using a procedure analogous to Example A1,
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-5-(8-methyl-2-(methylthio)-7-
-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.3 g,
0.63 mmol) and methyl amine (1.3 ml of 1M solution, 1.3 mmol) were
combined to afford
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-5-(8-methyl-2-(methyl-
amino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea as
a white solid (0.135 g, 66% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.73-8.70 (m, 1H), 8.65 (s, 1H), 8.48 (d,
J=2.0 Hz, 1H), 8.41-8.39 (m, 1H), 7.85 (s, 1H), 7.81 (brs, 2H),
7.38 (s, 1H), 7.24-7.22 (m, 2H), 3.61-3.57 (m, 3H), 2.90 (d, J=4.0
Hz, 1H), 2.60 (s, 3H), 1.46 (s, 9H); (ESI) m/z: 465.2
(M+H.sup.+).
Example 66
[0491] Using general method B, the carbamate of B2 (0.045 g, 0.19
mol) and Example A14 (0.057 g, 0.19 mmol) were combined to afford
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uoro-4-methylphenyl)-3-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)urea
(0.076 g, 84% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.85 (s, 1H), 8.71 (m, 1H), 8.60 (s, 1H), 7.92 (d, J=8.8 Hz, 1H),
7.65 (s, 1H), 7.28 (s, 2H), 7.14 (d, J=12.4 Hz, 1H), 6.04 (s, 1H),
3.58 (s, 3H), 3.54 (s, 3H), 2.05 (s, 3H), 1.16 (s, 9H); MS (ESI)
m/z: 479.2 (M+H.sup.+).
Example 67
[0492] Using general method F, Example A3 (500 mg, 1.58 mmol) and
1-isocyanato-3-(trifluoromethyl)benzene (311 mg, 1.66 mmol) were
combined in the presence of pyridine (500 mg, 6.32 mmol) to afford
1-(2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyri-
midin-6-yl)phenyl)-3-(3-(trifluoromethyl)phenyl)urea (440 mg, 55%
yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 2.60 (s, 3H),
3.65 (s, 3H), 7.29-7.34 (m, 3H), 7.50-7.51 (m, 2H), 8.04-8.08 (m,
2H), 8.43-8.46 (m, 1H), 8.69 (s, 1H), 8.95 (s, 1H), 9.42 (s, 1H);
MS (ESI) m/z: 504.0 (M+H.sup.+).
[0493] Using a procedure analogous to Example A1,
1-(2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyri-
midin-6-yl)phenyl)-3-(3-(trifluoromethyl)phenyl)urea (436 mg, 0.866
mmol) and 2.00N methylamine in THF (1.93 mL, 3.85 mmol) were
combined to provide
1-(2-fluoro-5-(S-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2-
,3-d]pyrimidin-6-yl)phenyl)-3-(3-(trifluoromethyl)phenyl)urea (141
mg, 75% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 2.89
(s, 3H), 3.53-3.61 (m, 3H), 7.24-7.31 (m, 3H), 7.49-7.51 (m, 2H),
7.65-7.75 (br. m, 1H), 7.79 (m, 1H), 8.03 (s, 1H), 8.37-8.39 (m,
1H), 8.65-8.73 (m, 2H), 9.40 (s, 1H); MS (ESI) m/z: 487.0
(M+H.sup.+).
Example 68
[0494] Using general method C,
2,2,2-trichloroethyl-(2-phenyl)phenylcarbamate (0.10 g, 0.29 mmol)
and Example A38 (87 mg, 0.29 mmol) were combined to afford
1-(2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridi-
n-3-yl)phenyl)-3-(2-phenyl)phenylurea. The product was treated with
MsOH to obtain
1-(2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-n-
aphthyridin-3-yl)phenyl)-3-(2-phenyl)phenylurea mesylate salt (33
mg, 19% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): U 8.90 (m,
1H), 8.48 (s, 1H), 8.41 (m, 1H), 8.18 (s, 1H), 7.89 (s, 1H), 7.84
(m, 1H), 7.1-7.5 (m, 1H), 6.29 (brs, 1H), 2.89 (brs, 3H), 2.27 (s,
3H), 2.05 (s, 3H); MS (ESI) m/z: 494.3 (M+H.sup.+).
Example 69
[0495] Using general method B, the carbamate of Example B1 (0.081
g, 0.27 mmol) and Example A38 (0.081 g, 0.27 mmol) were combined to
afford
1-(3-tert-butyl-1-phenyl-1H-pyrazol-5-yl)-3-(2-fluoro-5-(1-methyl-7-(meth-
ylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea as the
methane sulfonic acid salt (0.105 g, 72% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 9.00 (s, 1H), 8.87 (s, 1H), 8.52 (s,
1H), 8.40 (d, J=8.8 Hz, 1H), 7.93 (s, 1H), 7.55-7.48 (m, 4H),
7.43-7.39 (m, 1H), 7.27-7.25 (m, 2H), 6.40 (brs, 1H), 6.38 (s, 1H),
3.53 (s, 3H), 2.98 (s, 3H), 2.27 (s, 3H), 1.25 (s, 9H); MS (ESI)
m/z: 540.3 (M+H.sup.+).
Example 70
[0496] Using general method B, the carbamate of
3-isopropyl-1-phenyl-1H-pyrazol-5-amine (0.081 g, 0.28 mmol), and
Example A38 (0.085 g, 0.28 mmol) were combined to afford
1-(2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridi-
n-3-yl)phenyl)-3-(3-isopropyl-1-phenyl-1H-pyrazol-5-yl)urea as
methane sulfonic acid salt (0.095 g, 64% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 9.00 (s, 1H), 8.89 (s, 1H), 8.53 (s,
1H), 8.40 (d, J=8.8 Hz, 1H), 7.93 (s, 1H), 7.55-7.49 (m, 4H),
7.43-7.40 (m, 1H), 7.27-7.25 (m, 2H), 6.40 (brs, 1H), 6.34 (s, 1H),
3.54 (s, 3H), 2.93 (s, 3H), 2.90-2.83 (m, 1H), 2.28 (s, 3H), 1.20
(d, J=6.8 Hz, 6H); MS (ESI) m/z: 526.2 (M+H.sup.+).
Example 71
[0497] Using general method B, prop-1-en-2-yl
3-tert-butylphenylcarbamnate (0.18 g, 0.75 mmol) and Example A38
(0.090 g, 0.30 mmol) were combined to afford
1-(3-tert-butylphenyl)-3-(2-fluoro-5-(1-methyl-7-(methylamino)-2-o-
xo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea (0.103 g, 72%
yield) as a light yellow solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.05 (s, 1H), 8.50 (d, J=2.0 Hz, 1H), 8.45
(s, 1H), 8.40 (dd, J=6.8, 2.0 Hz, 1H), 7.86 (s, 1H), 7.44 (t, J=2.0
Hz, 1H), 7.28-7.24 (m, 3H), 7.20 (t, J=8.0 Hz, 1H), 7.03-7.00 (m,
2H), 6.16 (s, 1H), 3.53 (s, 3H), 2.86 (d, J=5.2 Hz, 3H), 1.26 (s,
9H); MS (ESI) m/z: 474.2 (M+H.sup.+).
Example 72
[0498] Using general method A, the TROC carbamate of Example B20
(0.250 g, 0.83 mmol) and Example A12 (0.248 g, 0.83 mmol) were
combined to provide
1-(2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyr-
imidin-6-yl)phenyl)-3-(3-isopropylisoxazol-5-yl)urea (180 mg, 48%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.10.33 (s, 1H),
8.75 (brs, 1H), 8.64 (brs, 1H), 8.38 (brd, J=8 Hz, 1H), 7.90 (s,
1H), 7.80 (brs, 1H), 7.36-7.25 (m, 2H), 6.04 (s, 1H), 3.61 (brs,
3H), 2.89 (brs, 3H), 1.23 (s, 6H); MS (ESI, m/z: 452.2,
M+H.sup.+).
Example 73
[0499] Using general method A, the TROC carbamate of Example B18
(0.170 g, 0.54 mmol) and Example A38 (0.160 g, 0.54 mmol) were
combined to provide
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(1-methyl-7-(methylmnino)-2-o-
xo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea (81 mg, 32%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.10.32 (s, 1H),
8.72 (brs, 1H), 8.43 (s, 1H), 8.38 (dd, J=8.0, 2.0 Hz, 1H), 7.85
(s, 1H), 7.35-7.23 (m, 2H), 7.03 (m, 1H), 6.15 (brs, 1H), 6.06 (s,
1H), 3.51 (s, 3H), 2.85 (d, J=5 Hz, 3H), 1.22 (s, 9H); MS (ESI,
m/z: 465.2, M+H.sup.+).
Example 74
[0500] Using general method B, the carbamate of
3-isopropyl-1-phenyl-1H-pyrazol-5-amine (0.100 g, 0.35 mmol) and
Example A4 (0.110 g, 0.35 mmol) were combined to provide
1-(5-(8-ethyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-y-
l)-2-fluorophenyl)-3-(3-isopropyl-1-phenyl-1H-pyrazol-5-yl)urea
(130 mg, 68% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.95 (s, 1H), 8.86 (s, 1H), 8.66 (brs, 1H), 8.38 (brd, J=8.0 Hz,
1H), 7.83 (brs, 1H), 7.78 (brs, 1H), 7.50 (m, 4H), 7.40 (m, 1H),
7.30-7.20 (m, 2H), 6.34 (brs, 1H), 4.40 (brs, 2H), 2.85 (m, 4H),
1.22 (m, 9H); MS (ESI, m/z: 541.3, M+H.sup.+).
Example 75
[0501] Using general method F,
1-isocyanato-3-(trifluoromethyl)benzene (0.125 g, 0.668 mmol) and
Example A2 (0.2 g, 0.668 mmol) were combined in ethyl acetate to
provide
1-(5-(2-amino-8-ethyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-flu-
orophenyl)-3-(3-(trifluoromethyl)phenyl)urea (188 mg, 58% yield)
.sup.1H NMR (400 MHz, DMSO-d.sub.6: .delta. 9.46 (s, 1H), 8.72 (s,
1H), 8.70 (brd, J=8 Hz, 1H), 8.42 (dd, J=8.0, 2.0 Hz, 1H), 8.08 (s,
1H), 7.57 (m, 2H), 7.35 (m, 5H), 4.37 (q, J=6 Hz, 2H), 1.25 (t, J=6
Hz, 3H); MS (ESI, m/z: 487.2, M+H.sup.+).
Example 76
[0502] Using general method B, prop-1-en-2-yl
3-tert-butylphenylcarbamate (0.100 g, 0.43 mmol) and Example A4
(0.134 g, 0.43 nmol) were combined to provide
1-(3-tert-butylphenyl)-3-(5-(8-ethyl-2-(methylamino)-7-oxo-7,8-di-
hydropyrido[2,3-d]pyrimidin-6-yl)-2-fluorophenyl)urea (50 mg, 24%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.04 (s, 1H),
8.65 (brs, 1H), 8.50 (d, J=2.4 Hz, 1H), 8.35 (brd, J=8.0 Hz, 1H),
7.86 (s, 1H), 7.78 (brs, 1H), 7.41 (m, 1H), 7.30-7.20 (m, 3H), 7.07
(brd, J=8 Hz, 1H), 4.37 (brs, 2H), 2.89 (d, J=5 Hz, 3H), 1.25 (s,
12H); MS (ESI, m/z: 489.2, M+H.sup.+).
Example 77
[0503] Using general method A, the TROC carbamate of Example B21
(0.100 g, 0.25 mmol) and Example A4 (0.078 g, 0.25 mmol) were
combined to provide
1-(5-(8-ethyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-y-
l)-2-fluorophenyl)-3-(1-phenyl-3-(trifluoromethyl)-1H-pyrazol-5-yl)urea
(98 mg, 70% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): 9.16 (s,
1H), 9.08 (s, 1H), 8.68 (brs, 1H), 8.35 (brd, J=8.0 Hz, 1H), 7.83
(s, 1H), 7.78 (brs, 1H), 7.63-7.50 (m, 5H), 7.30-7.20 (m, 2H), 6.87
(brs, 1H), 4.33 (brs, 2H), 3.54 (s, 3H), 2.88 (d, J=5 Hz, 3H); MS
(ESI, m/z: 567.3, M+H.sup.+).
Example 78
[0504] Using general method D, Example B16 (0.050 g, 0.25 mmol) and
Example A12 (0.099 g, 0.33 mmol) were combined to afford
1-(3-tert-butyl-1-ethyl-1H-pyrazol-5-yl)-3-(2-fluoro-5-(8-methyl-2-(methy-
lamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(33 mg, 26% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major
rotomer): .delta. 8.83 (s, 1H), 8.79 (d, J=2.0 Hz, 1H), 8.64 (s,
1H), 8.41 (dd, J=2.0, and 8.4 Hz, 1H), 7.86 (s, 1H), 7.79 (m, 1H),
7.27 (m, 2H), 6.08 (s, 1H), 3.93 (q, J=7.2 Hz, 2H), 3.61 (s, 3H),
2.89 (brd, J=4.0 Hz, 3H), 1.26 (t, J=7.2 Hz, 3H), 1.18 (s, 9H); MS
(ESI) m/z: 493.2 (M+H.sup.+).
Example 79
[0505] Using General Method F, Example A3 (150 mg, 0.474 mmol) and
1-chloro-4-isocyanato-2-(trifluoromethyl)benzene (110 mg, 0.498
mmol) were combined in the presence of pyridine (150 mg, 1.90 mmol)
to provide
1-(4-chloro-3-(trifluoromethyl)phenyl)-3-(2-fluoro-5-(8-methyl-2-(methylt-
hio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.055 g, 22% yield). MS (ESI) m/z: 538.0 (M+H.sup.+).
[0506] Using a procedure analogous to Example
A1,1-(4-chloro-3-(trifluoromethyl)phenyl)-3-(2-fluoro-5-(8-methyl-2-(meth-
ylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(55 mg, 0.100 mmol) and 2.00N methylamine in THF (4.00 mL, 8.0
mmol) were combined to provide
1-(4-chloro-3-(trifluoromethyl)phenyl)-3-(2-fluoro-5-(8-methyl-2-(methyla-
mino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (36
mg, 67% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 2.90
(s, 3H), 3.53-3.61 (m, 3H), 7.26-7.31 (m, 2H), 7.58-7.59 (m, 2H),
7.60-7.75 (br. m, 1H), 7.88 (s, 1H), 8.10 (s, 1H), 8.33-8.35 (m,
1H), 8.64-8.77 (m, 2H), 9.49 (s, 1 H); MS (ESI) m/z: 521.0
(M+H.sup.+).
Example 80
[0507] Using the procedure in Example 57,
1-(3-t-butylisoxazol-5-yl)-3-(2-fluoro-5-(8-methyl-2-(methylsulfinyl)-7-o-
xo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea from Example
43 (0.150 g, 0.311 mmol, 1.00 eq) and L-alaninol (48.4 .mu.L, 0.622
mmol, 2.00 eq) were combined to afford
(S)-1-(3-t-butylisoxazol-5-yl)-3-(2-fluoro-5-(2-(1-hydroxypropan-2-ylamin-
o)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(72 mg, 46% yield) as an off-white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 10.34 (s, 1H), 8.73 (brs, 1H), 8.65 (brs,
1H), 8.39 (dd, J=2.4 and 8.0 Hz, 1H), 7.87 (s, 1H), 7.60-7.57 (m,
1H), 7.35-7.25 (m, 2H), 6.06 (s, 1H), 4.70 (t, J=6.0 Hz, 1H), 4.09
(brs, 1H), 3.58-3.49 (m, 4H), 3.35 (brs, 1H), 1.23 (s, 9H),
1.17-1.15 (m, 3H); MS (ESI) m/z: 510.2 (M+H.sup.+).
Example 81
[0508] Using general method B, the carbamate of Example B21 (0.071
g, 0.23 mmol) and Example A38 (0.068 g, 0.23 mmol) were combined to
afford
1-(2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthynidi-
n-3-yl)phenyl)-3-(1-phenyl-3-(trifluoromethyl)-1H-pyrazol-5-yl)urea
as the methane sulfonic acid salt (0.076 g, 60% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 9.18 (s, 1H), 9.11 (s, 1H), 8.50
(s, 1H), 8.38-8.36 (m, 1H), 7.92 (s, 1H), 7.64-7.56 (m, 6H),
7.29-7.26 (m, 2H), 6.88 (s, 1H), 6.35 (brs, 1H), 3.53 (s, 3H), 2.91
(s, 3H), 2.27 (s, 3H); (ESI) m/nz: 552.2 (M+H.sup.+).
Example 82
[0509] Using general method D,
3-tert-butyl-1-methyl-1H-pyrazole-5-carboxylic acid (0.051 g, 0.28
mmol) and Example A38 (0.1 g, 0.34 mmol) were combined to afford
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(2-fluoro-5-(1-methyl-7-(meth-
ylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea as the
methane sulfonic acid salt (0.089 g, 67% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): 8.94 (s, 1H), 8.85 (d, J=2.4 Hz, 1H), 8.53 (s,
1H), 8.41 (dd, J=8.0 Hz, 2.0 Hz, 1H), 7.95 (s, 1H), 7.30-7.27 (m,
2H), 6.42 (brs, 1H), 6.08 (s, 1H), 3.60 (s, 3H), 3.54 (s, 3H), 2.93
(s, 3H), 2.28 (s, 3H), 1.18 (s, 9H); (ESI) m/z: 478.3
(M+H.sup.+).
Example 83
[0510] Using general method C, the carbamate of Example B20 (2.70
g, 21.4 mmol, 1.00 eq) and Example A3 (0.525 g, 1.66 mmol, 1.00 eq)
were combined to afford
1-(2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-(3-isopropylisoxazol-5-yl)urea
(0.344 g, 44% yield) as a pale yellow foam. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 10.35 (s, 1H), 8.93 (s, 1H), 8.79 (d, J=2.0
Hz, 1H), 8.44 (dd, J=2.00 and 8.0 Hz, 1H), 8.07 (s, 1H), 7.40-7.31
(m, 2H), 6.02 (s, 1H), 3.66 (s, 3H), 2.89 (septet, J=6.8 Hz, 1H),
2.60 (s, 3H), 1.18 (d, J=6.8 Hz, 6H); MS (ESI) m/z: 469.0
(M+H.sup.+).
[0511] Using a procedure analogous to Example A1,
1-(2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyri-
midin-6-yl)phenyl)-3-(3-isopropylisoxazol-5-yl)urea (0.150 g, 0.322
mmol, 1.00 eq) was oxidized and reacted with L-alaminol (41.4
.mu.L, 0.533 mmol, 2.00 eq) to afford
(S)-1-(2-fluoro-5-(2-(1-hydroxypropan-2-ylamino)-8-methyl-7-oxo-7,8-dihyd-
ropyrido[2,3-d]pyrimidin-6-yl)phenyl)-3-(3-isopropylisoxazol-5-yl)urea
(67 mg, 51% yield) as an off-white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 10.34 (s, 1H), 8.73 (brs, 1H), 8.65 (brs,
1H), 8.39 (dd, J=2.4 and 8.0 Hz, 1H), 7.87 (s, 1H), 7.60-7.57 (m,
1H), 7.35-7.25 (m, 2H), 6.06 (s, 1H), 4.70 (t, J=6.0 Hz, 1H), 4.09
(brs, 1H), 3.58-3.49 (m, 4H), 3.35 (brs, 1H), 2.89 (m, 1H), 1.23
(s, 9H), 1.17-1.15 (m, 9H); MS (ESI) m/z: 496.3 (M+H.sup.+).
Example 84
[0512] Pivalonitrile (2.75 g, 33.1 mmol), water (20 mL), dioxane
(20 mL), sodium hydrogensulfide hydrate (14.7 g, 198 mmol) and
diethyl amine hydrochloride (21.8 g, 198 mmol) were combined and
mixture was stirred at 55.degree. C. for 48 h. Water (150 mL) and
EtOAc (60 mL) were added, the organic layer was separated and the
aqueous layer was extracted with EtOAC (1.times.60 mL). The
combined organics were washed with brine, dried (Na.sub.2SO.sub.4)
and concentrated in vacuo to afford 2,2-dimethylpropanethioamide as
off-white solid (3.00 g, 89% yield).
[0513] Ethyl 3-bromo-2-oxopropanoate (1.95 g, 10 mmol) and
2,2-dimethylpropanethioamide (1.17 g, 10 mmol) were combined in
ethanol (20 mL) and solution was stirred at RT for 48 h. Solvent
was removed and to the residue Sat. NaHCO.sub.3 solution was added
and product was extracted with EtOAc (2.times.30 mL). The combined
organics were washed with brine, dried (Na.sub.2SO.sub.4),
concentrated in vacuo and purification by silica gel chromatography
afforded ethyl 2-tert-butylthiazole-5-carboxylate (1.16 g, 55%) as
a colorless liquid (1.16 g, 55% yield). MS (ESI) m/z: 214.0
(M+H.sup.+).
[0514] To a solution of ethyl 2-tert-butylthiazole-5-carboxylate
(1.16 g, 5.44 mmol) in THF (10 mL) was added lithium hydroxide
(0.45 g, 10.9 mmol) in water (5 mL) and the mixture was stirred for
16 h at RT. Solvents were removed under vacuum, and the thick
liquid was diluted with water (5 mL) and acidified with 2M HCl
solution to pH 4 to 5. The product precipitated, was filtered,
washed with water (2.times.5 mL) and dried to provide
2-tert-butylthiazole-5-carboxylic acid as white solid (0.55 g, 55%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.32 (s, 1H),
1.39 (s, 9H); MS (ESI) m/z: 186.0 (M+H.sup.+).
[0515] To a solution of 2-tert-butylthiazole-5-carboxylic acid
(0.46 g, 2.52 mmol) in dioxane (10 mL) was added with triethylamine
(0.76 g, 7.55 mmol), Diphenylphosphorylazide (1.04 g, 3.77 mmol)
and trichloroethanol (1.13 g, 7.55 mmol) and mixture was heated to
90.degree. C. for 3 h. Sat. NaHCO.sub.3 solution (30 mL) was added
and the product was extracted with EtOAc (2.times.30 mL). The
combined organics were washed with brine, dried (Na.sub.2SO.sub.4),
concentrated in vacuo and purificatied by silica gel chromatography
provided 2,2,2-trichloroethyl 2-tert-butylthiazol-5-ylcarbamate as
a pasty mass (0.55 g, 66% yield). .sup.1H NMR (400 MHz, Acetone-d):
.delta. 8.44 (s, 1H), 4.94 (s, 2H), 1.38 (s, 9H); MS (ESI) m/z:
333.0 (M+H.sup.+).
[0516] Using general method C, 2,2,2-trichloroethyl
2-tert-butylthiazol-5-ylcarbamate (0.081 g, 0.24 mmol) and Example
A12 (0.73 g, 0.24 mmol) were combined to afford
1-(2-tert-butylthiazol-5-yl)-3-(2-fluoro-5-(8-methyl-2-(methylamino)-7-ox-
o-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea as an
off-white solid (0.025 g, 21% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.88 (s, 1H), 8.64 (s, 1H), 8.44 (d, J=8.4
Hz, 1H), 7.87 (s, 1H), 7.88 (brs, 1H), 7.26-7.22 (m, 2H), 7.04 (s,
1H), 3.60 (s, 3H), 2.89 (d, J=4.4 Hz, 3H), 1.35 (s, 9H); MS (ESI)
m/z: 482.2 (M+H.sup.+).
Example 85
[0517] Using general method B, the carbamate of Example B22 (0.10
g, 0.40 mmol) and Example A4 (0.10 g, 0.32 mmol) were combined to
afford
1-(5-(8-ethyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-y-
l)-2-fluorophenyl)-3-(1-methyl-3-(trifluoromethyl)-1H-pyrazol-5-yl)urea
(0.12 g, 61% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major
rotomer): .delta. 9.27 (s, 1H), 8.94 (brs, 1H), 8.64 (s, 1H), 8.36
(dd, J=2.0, 8.0 Hz, 1H), 7.85 (s, 1H), 7.79 (m, 1H), 7.2-7.4 (m,
2H), 6.61 (s, 1H), 4.35 (q, J=5.6 Hz, 2H), 3.77 (s, 3H), 2.88 (d,
J=4.4 Hz, 3H), 1.23 (t, J=6.8 Hz, 3H); MS (ESI) m/z: 505.2
(M+H.sup.+).
Example 86
[0518] Using general method B, the carbamate of B15 (0.05 g, 0.21
mmol) and Example A12 (0.063 g, 0.21 mmol) were combined to afford
1-(5-(8-ethyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-y-
l)-2-fluorophenyl)-3-(1-methyl-3-(trifluoromethyl)-1H-pyrazol-5-yl)urea
(55 mg, 55% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major
rotomer): .delta. 11.0 (s, 1H), 8.91 (brs, 1H), 8.64 (s, 1H), 8.33
(dd, J=1.6, and 6.4 Hz, 1H), 7.90 (s, 1H), 7.83 (m, 1H), 7.2-7.4
(m, 2H), 6.52 (s, 1H), 3.61 (brs, 3H), 2.90 (brd, J=4.8 Hz, 3H); MS
(ESI) m/z: 478.0 (M+H.sup.+).
Example 87
[0519] Using general method B, prop-1-en-2-yl
3-tert-butyl-1-methyl-1H-pyrazol-5-ylcarbamate (0.12 g, 0.51 mmol)
and Example A24 (0.16 g, 0.51 mmol) were combined to afford
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(5-(1-ethyl-7-(methylamino)-2-
-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)urea as the
mesylate salt (130 mg, 47% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.98 (s, 1H), 8.87 (brs, 1H), 8.57 (dd,
J=2.0, and 8.0 Hz, 1H), 7.88 (s, 1H), 7.2-7.4 (m, 2H), 6.55 (brs,
1H), 6.09 (s, 1H), 4.18 (m, 2H), 3.61 (s, 3H), 2.96 (brs, 3H), 2.30
(s, 3H), 1.22 (t, J=6.4 Hz, 3H), 1.18 (s, 9H); MS (ESI) m/z: 492.3
(M+H.sup.+).
Example 88
[0520] Using general method B, prop-1-en-2-yl
3-tert-butylphenylcarbamate (0.545 g, 2.34 mmol) and Example A3
(0.592 g, 01.87 mmol) were combined to afford
1-(3-tert-butylphenyl)-3-(2-fluoro-5-(8-methyl-2-(methylthio)-7-
-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.574 g,
62% yield) as a light yellow solid. MS (ESI) m/z: 475.2
(M+H.sup.+).
[0521] Using a procedure analogous to Example A1,
1-(3-tert-butylphenyl)-3-(2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-d-
ihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.200 g, 0.407 mmol)
and N,N-dimethylethylenediamine (0.181 mL, 1.65 mmol) were combined
to afford
1-(3-tert-butylphenyl)-3-(5-(2-(2-(dimethylamino)ethylamino)-8-methyl-7-o-
xo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluorophenyl)urea
(0.150 g, 86% yield) as a light yellow solid. It was converted to
corresponding HCl salt by reacting with HCl (4.0 M HCl in dioxane,
1.0 eq.). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.28 (s,
1H), 8.73 (s, 1H), 8.64 (d, J=1.6 Hz, 1H), 8.39 (d, J=7.6 Hz, 1H),
8.04 (s, 1H), 7.93 (s, 1H), 7.43 (s, 1H), 7.28-7.24 (m, 3H), 7.18
(t, J=8.0 Hz, 1H), 6.99 (tt, J=7.6, 0.8 Hz, 1H), 3.74 (broad, 2H),
3.63 (s, 3H), 3.30 (broad, 2H), 2.81 (d, J=4.8 Hz, 6H), 1.25 (s,
9H); MS (ESI) m/z: 532.3 (M+H.sup.+).
Example 89
[0522] Using a procedure analogous to Example A1,
1-(4-chloro-3-(trifluoromethyl)phenyl)-3-(2-fluoro-5-(8-methyl-2-(methylt-
hio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea from
Example 67 (55 mg, 0.100 mmol) and 2-amino-1-propanol (249 mg, 3.31
mmol) were combined to provide
1-(2-fluoro-5-(2-(1-hydroxypropan-2-ylamino)-8-methyl-7-oxo-7,8-dihydropy-
rido[2,3-d]pyrimidin-6-yl)phenyl)-3-(3-(trifluoromethyl)phenyl)urea
(489 mg, 22% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6), .delta.
1.15 (s, 3 H), 3.37-3.56 (m, 4H), 3.90-4.15 (m, 1H), 4.69 (s, 1H),
7.22-7.55 (m, 6H), 7.84 (s, 1H), 8.02 (s, 1H), 8.36-8.38 (m, 1H),
8.63 (br. s, 2H), 9.38 (s, 1H), OH missing; MS (ESI) m/z: 531.2
(M+H.sup.+).
Example 90
[0523] Using general method C, the TROC carbamate of Example B23
(150 mg, 0.421 mmol) and Example A12 (132 mg, 0.442 mmol) were
combined to afford
1-(3-tert-butyl-1-isopropyl-1H-pyrazol-5-yl)-3-(2-fluoro-5-(8-methyl-2-(m-
ethlylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(13 mg, 6% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
1.18 (s, 9H), 1.31 (d, J=6.5, 6 H), 2.89 (s, 3H), 3.50-3.61 (m,
3H), 4.33 (hep, J=6.3, 1H), 6.03 (s, 1H), 7.24-7.26 (m, 2H),
7.65-7.84 (m, 2H), 8.37-8.39 (m, 1H), 8.62-8.76 (m, 3H); MS (ESI)
m/z: 507.2 (M+H.sup.+).
Example 91
[0524] Using general method D, Example B16 (0.060 g, 0.31 mmol) and
Example A4 (0.096 g, 0.31 mmol) were combined to afford
1-(3-tert-butyl-1-ethyl-1H-pyrazol-5-yl)-3-(5-(8-ethyl-2-(methylamino)-7--
oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluorophenyl)urea (57
mg, 37% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major rotomer):
.delta. 8.82 (s, 1H), 8.78 (m, 1H), 8.64 (s, 1H), 8.39 (dd, J=2.0,
and 8.4 Hz, 1H), 7.85 (s, 1H), 7.78 (m, 1H), 7.27 (m, 2H), 6.08 (s,
1H), 4.30 (m, 2H), 3.93 (q, J=7.2 Hz, 2H), 2.89 (brd, J=4.0 Hz,
3H), 1.25 (m, 6H), 1.19 (s, 9H); MS (ESI) m/z: 507.2
(M+H.sup.+).
Example 92
[0525] Using general method F, Example A38 (88 mg, 0.29 mmol) and
1-isocyanato-3-(trifluoromethyl)benzene (63 mg, 0.34 mmol) were
combined to provide
1-(2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridi-
n-3-yl)phenyl)-3-(3-(trifluoromethyl)phenyl)urea (123 mg, 87%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.40 (s, 1 H),
8.63 (s, 1H), 8.44 (s, 1H), 8.37 (dd, J=8.2, 2.2 Hz, 1H), 8.03 (s,
1H), 7.87 (s, 1H), 7.51 (m, 2H), 7.32-7.22 (m, 3H), 7.03 (q, J=4.8
Hz, 1H), 6.15 (s, 1H), 3.52 (s, 3H), 2.85 (d, J=5.0 Hz, 3H); MS
(ESI) m/z: 486.2 (M+H.sup.+).
Example 93
[0526] Using general procedure B, Example B11 (0.125 g, 0.362 mmol)
and Example A12 (0.104 g, 0.347 mmol) were combined to form crude
1-(3-(1-(tert-butyldimethylsilyloxy)-2-methylpropan-2-yl)-1-phenyl-1H-pyr-
azol-5-yl)-3-(2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido-
[2,3-d]pyrimidin-6-yl)phenyl)urea. TBAF (1.0 M in THF, 1.0 mL, 1.0
mmol) was added to the above filtrate, and the mixture was stirred
at 30.degree. C. for 2 d. Solvent was removed under reduced
pressure. The residue was quenched with H.sub.2O (15 mL) and
extracted with EtOAc (2.times.25 mL). The combined organic layers
were washed with brine (15 mL), dried (MgSO.sub.4), concentrated in
vacuo and purified by chromatography to afford
1-(2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyr-
imidin-6-yl)phenyl)-3-(3-(1-hydroxy-2-methylpropan-2-yl)-1-phenyl-1H-pyraz-
ol-5-yl)urea (0.096 g, 52% yield) as a white solid. .sup.1H NMR
(400 MHz, DMSO-d.sub.6), .delta. 8.98 (d, J=1.2 Hz, 1H), 8.88 (s,
1H), 8.655 (s, 1H), 8.40 (dd, J=8.0, 1.2 Hz, 1H), 7.86 (s, 1H),
7.82 (d, J=4.4 Hz, 1H), 7.56-7.49 (m, 4H), 7.44-7.39 (m, 1H),
7.28-7.21 (m, 2H), 6.39 (s, 1H), 4.59 (t, J=5.2 Hz, 1H), 3.61 (s,
2H), 3.54 (s, 1H), 3.41 (d, J=5.2 Hz, 2H), 2.90 (d, J=4.4 Hz, 3H),
1.19 (s, 6H); MS (ESI) m/z: 557.3 (M+H.sup.+).
Example 94
[0527] Using general method D,
3-tert-butyl-1-methyl-1H-pyrazole-5-carboxylic acid (0.041 g, 0.23
mmol) and Example A49 (0.081 g, 0.25 mmol) in presence of
triethylamine (0.07 g, 0.68 mmol) and diphenylphospharyl azide
(0.12 g, 0.45 mmol) were combined to afford
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(2-fluoro-5-(8-isopropyl-2-(m-
ethylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
as white solid (0.86 g, 75% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.91 (s, 1H), 8.81 (d, J=2.4 Hz, 1H), 8.62
(s, 1H), 8.36-8.34 (m, 1H), 7.79-7.76 (m, 2H), 7.26-7.23 (m, 2H),
6.08 (s, 1H), 5.77-5.74 (m, 1H), 3.60 (s, 3H), 2.88 (d, J=4.4 Hz,
3H), 1.58-1.51 (m, 6H), 1.18 (s, 9H); MS (ESI) m/z: 507.2
(M+H.sup.+).
Example 95
[0528] Using general method D, 4-methylpyrimidine-5-carboxylic acid
(300 mg, 2.17 mmol) and Example A3 (687 mg, 2.17 mmol) were
combined to afford
1-(2-fluoro-5-(8-methyl-2-(methylhio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrim-
idin-6-yl)phenyl)-3-(4-methylpyrimidin-5-yl)urea (305 mg, 31%
yield). MS (ESI) m/z: 452.0 (M+H.sup.+).
[0529] Using a procedure analogous to Example A1,
1-(2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyri-
midin-6-yl)phenyl)-3-(4-methylpyrimidin-5-yl)urea (300 mg, 0.664
mmol) and 2.0 N methylamine in THF (2.3 mL, 4.53 mmol) were
combined to afford
1-(2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyr-
imnidin-6-yl)phenyl)-3-(4-methylpyrimidin-5-yl)urea (75 mg, 38%
yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6), .delta. 2.45 (s, 3 H),
2.88 (s, 3H), 3.50-3.57 (m, 3H), 7.23-7.29 (m, 2H), 7.67-7.79 (m,
1H), 7.82 (s, 1H), 8.39-8.42 (m, 1H), 8.60 (s, 3H), 8.68 (s, 2H),
9.13 (m, 1H); MS (ESI) m/z: 435.2 (M+H.sup.+).
Example 96
[0530] Using general method A, the TROC carbamate of Example B18
(0.5 g, 1.58 mmol) and Example A10 (0.523 g, 1.58 mmol) were
combined to provide
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(methylt-
hio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (440
mg, 56% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.3
(brs, 1H), 8.9 (s, 1H)), 8.70 (brs, 1H), 7.94 (d, J=9 Hz, 1H), 7.88
(s, 1H), 7.20 (d, J=12 Hz, 1H), 6.00 (s, 1H), 3.64 (s, 3H), 2.61
(s, 3H), 2.07 (s, 3H), 1.21 (s, 9H); MS (ESI) m/z: 497.2
(M+H.sup.+).
[0531] Using a procedure analogous to Example A1,
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(methylt-
hio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (1.70
g, 3.426 mmol) and methylamine (2 ml, 4 mmol, 2.0M in THF) were
combined to provide
[0532]
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(m-
ethylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(92 mg, 42% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
10.28 (brs, 1H), 8.67 (brs, 1H), 8.61 (s, 1H), 7.89 (d, J=9 Hz,
1H), 7.82 (brs, 1H), 7.68 (s, 1H), 7.17 (d, J=12 Hz, 1H), 6.00 (s,
1H), 3.58 (s, 3H), 2.90 (d, J=5 Hz, 3H), 2.08 (s, 3H), 1.21 (s,
9H); MS (ESI) m/z: 480.2 (M+H.sup.+).
Example 97
[0533] Using general method A, the TROC carbamate of Example B21
(0.2 g, 0.5 mmol) and Example A39 (0.156 g, 0.5 mmol) were combined
to provide
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-(1-phenyl-3-(trifluoromethyl)-1H-pyrazol-5--
yl)urea (210 mg, 75% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
9.12 (s, 1H), 9.02 (s, 1H), 8.60 (s, 1H), 7.90 (d, J=9.5 Hz, 1H),
7.6 (m, 6H), 7.13 (d, J=12 Hz, 1H), 6.83 (s, 1H), 3.54 (s, 3H),
2.90 (d, J=5 Hz, 3H), 2.07 (s, 3H); MS (ESI, m/z: 567.3,
M+H.sup.+).
Example 98
[0534] Using a modified general method B, the carbamate of Example
B21 (0.071 g, 0.23 mmol), and Example A38 (0.068 g, 0.23) were
heated at 130.degree. C. for 1 h under microwave irradiation to
afford
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-5-(1-methyl-7-(methylamino)--
2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea as the methane
sulfonic acid salt (0.048 g, 45% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.72 (s, 1H), 8.54 (brs, 2H), 8.41 (dd,
J=8.4 Hz, 2.4 Hz, 1H), 7.95 (s, 1H), 7.80 (s, 1H), 7.40 (s, 1H),
7.29-7.19 (m, 2H), 6.42 (brs, 1H), 3.54 (s, 3H), 2.94 (s, 3H), 2.27
(s, 3H), 1.47 (s, 9H); (ESI) m/z: 464.2 (M+H.sup.+).
Example 99
[0535] Using general method A, the carbamate of Example B1 (0.45 g,
1.5 mmol) and Example A10 (0.4 g, 1.21 mmol) were combined to
provide
1-(3-tert-butyl-1-phenyl-1H-pyrazol-5-yl)-3-(2-fluoro-4-methyl-5-(8-methy-
l-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
as white solid (0.25 g, 36% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.94 (d, J=2.0 Hz, 1H), 8.90 (s, 1H), 8.83
(s, 1H), 7.98 (d, J=8.4 Hz, 1H), 7.87 (s, 1H), 7.54-7.47 (m, 4H),
7.43-7.39 (m, 1H), 7.15 (d, J=12.0 Hz, 1H), 6.34 (s, 1H), 3.64 (s,
3H), 2.61 (s, 3H), 2.06 (s, 3H), 1.22 (s, 9H); MS (ESI) m/z: 482.2
(M+H.sup.+).
[0536] Using a procedure analogous to Example A1,
1-(3-tert-butyl-1-phenyl-1H-pyrazol-5-yl)-3-(2-fluoro-4-methyl-5-(8-methy-
l-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.25, 0.43 mmol), MCPBA (0.081 g, 0.47 mmol) and 2 M methylamine
in THF (1 mL) were combined to provide
1-(3-tert-butyl-1-phenyl-1H-pyrazol-5-yl)-3-(2-fluoro-4-methyl-5-(8-methy-
l-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
as white solid (0.17 g, 72% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.90 (d, J=2.0 Hz, 1H), 8.81 (s, 1H), 8.60
(s, 1H), 7.93 (d, J=8.4 Hz, 1H), 7.83-7.78 (m, 1H), 7.65 (s, 1H),
7.54-7.47 (m, 4H), 7.43-7.38 (m, 1H), 7.11 (d, J=12.0 Hz, 1H), 6.34
(s, 1H), 3.59 (s, 3H), 2.90 (d, J=4.4 Hz, 1H), 2.05 (s, 3H), 1.23
(s, 9H); MS (ESI) m/z: 555.2 (M+H.sup.+).
Example 100
[0537] Using general method B, Example B15 (0.15 g, 0.64 mmol) and
Example A39 (0.20 g, 0.64 mmol) were combined to afford
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-(3-(trifluoromethyl)isoxazol-5-yl)urea
(0.19 g, 60% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major
rotomer): .delta. 11.0 (s, 1H), 8.82 (s, 1H), 8.60 (s, 1H), 7.81
(d, J=8.0 Hz, 1H), 7.68 (s, 1H), 7.20 (s, 1H), 6.46 (s, 1H), 3.59
(brs, 3H), 2.90 (brd, J=4.4 Hz, 3H), 2.09 (s, 3H); MS (ESI) m/z:
492.3 (M+H.sup.+).
Example 101
[0538] Using general method F,
1-chloro-4-isocyanato-2-(trifluoromethyl)benzene (0.16 g, 0.55
mmol) and Example A39 (0.113 g, 0.51 mol) were combined in ethyl
acetate to provide
1-(4-chloro-3-(trifluoromethyl)phenyl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-
-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(150 mg, 55% yield) .sup.1H NMR (400 MHz, DMSO-d.sub.6) .delta.
9.44 (s, 1H), 8.6 (s, 1H), 8.1 (d, J=2.5 Hz), 7.87 (d, J=9 Hz, 1H),
7.67 (s, 1H), 7.59 (d, J=9.0 Hz, 1H), 7.53 (dd, J=9.0, 2.5 Hz, 1H),
7.15 (d, J=12 Hz, 1H), 3.54 (s, 3H), 2.90 (d, J=5 Hz, 3H), 2.07 (s,
3H); MS (ESI, m/z: 535.0, M+H.sup.+).
Example 102
[0539] Using general procedure C, the TROC carbamate of Example B18
(0.212 g, 0.672 mmol, 1.00 eq) and Example A26 (0.2100 g, 0.672
mmol, 1.00 eq) were combined to provide crude desired product. The
product was purified by reverse phase chromatography 5-42% MeCN
(w/0.1% TFA)/H.sub.2O (w/0.1% TFA) to obtain the TFA salt. The TFA
salt thus obtained was treated with MP-Carbonate resin to obtain
the free base and then 2 wt % MsOHITHF to afford
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-4-methyl-5-(1-methyl-7-(-
methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea
(60 mg, 16% yield) as the MsOH salt. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 10.32 (s, 1H), 8.71 (d, J=2.00 Hz, 1H), 8.50
(s, 1H), J=8.8 Hz, 1H), 7.81 (s, 1H), 7.20 (d, J=12.4 Hz, 1H), 6.51
(s, 1H), 6.00 (s, 1H), 3.54 (s, 3H), 2.96 (brs, 3H), 2.31 (s, 3H),
2.09 (s, 3H), 1.21 (s, 9H); MS (ESI) m/z: 479.2 (M+H.sup.+).
Example 103
[0540] Using general procedure D,
3-(t-butyl)1-methyl-1H-pyrazole-5-carboxylic acid (0.111 g, 0.611
mmol, 1.00 eq) and Example A26 (0.210 g, 0.672 mmol, 1.10 eq) were
combined to give desired product. The free base was slurried in THF
and treated with 2% MsOH/THF solution (1.44 g, 1.00 eq) and the
thick suspension was stirred overnight at RT. The solids were
collected by filtration, rinsed with THF and EtOAc and dried under
high vacuum to afford
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(2-fluoro-4-methyl-5-(1-methy-
l-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea
(150 mg, 42% yield) as the MsOH salt. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.93 (s, 1H), 8.79 (brs, 1H), 8.50 (s, 1H),
7.97 (d, J=8.4 Hz), 7.80 (s, 1H), 7.18 (d, J=12.0 Hz, 1H), 6.50 (s,
1H), 6.05 (s, 1H), 3.59 (s, 3H), 3.53 (s, 3H), 2.96 (s, 3H), 2.30
(s, 3H), 2.07 (s, 3H), 1.17 (s, 9H); MS (ESI) m/z: 492.3
(M+H.sup.+).
Example 104
[0541] Using general method B, the carbamate of Example B2 (0.171
g, 0.720 mmol) and Example A39 (0.150 g, 0.48 mmol) were combined
to afford
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(2-fluoro-4-methyl-5-(8-methy-
l-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.105 g, 44% yield) as a white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.87 (s, 1H), 8.73 (d, J=2.0 Hz, 1H), 8.60
(s, 1H), 7.93 (d, J=8.4 Hz, 1H), 7.80 (m, 1H), 7.66 (s, 1H), 7.14
(d, J=12.4, 1H), 6.04 (s, 1H), 3.59-3.57 (m, 6H), 2.90 (d, J=4.4
Hz, 3H), 2.06 (s, 3H), 1.16 (s, 9H); MS (ESI) m/z: 493.2
(M+H.sup.+).
Example 105
[0542] Using a modified method B, the carbamnate of Example B19
(0.061 g, 0.27 mmol) and
6-(3-amino-4-fluorophenyl)-8-isopropyl-2-(methylthio)pyrido[2,3-d]pyrimid-
in-7(SH)-one from Example A59 (0.094 g, 0.27 mmol) in THF were
stirred at 130.degree. C. for 1 h under microwave irradiation.
Solvents were removed and the crude residue was purified by silica
gel chromatography to afford
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-5-(8-isopropyl-2-(methylthio-
)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea as
off-white solid (68 mg, 49% yield). .sup.1H NMR (400 MHz,
Acetone-d.sub.6): .delta. 8.89 (s, 1H), 8.58 (dd, J=8.0 Hz, 2.4 Hz,
1H), 8.21 (brs, 1H), 7.99 (brs, 1H), 7.96 (s, 1H), 7.89 (s, 1H),
7.39-7.35 (m, 2H), 7.17 (dd, J=11.2 Hz, 8.4 Hz, 1H), 5.94-5.89 (m,
1H), 2.65 (s, 3H), 1.66 (d, J=6.8 Hz, 6H), 1.54 (m, 9H); MS (ESI)
m/z: 507.2 (M+H.sup.+).
[0543] Using a procedure analogous to Example A1,
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-5-(8-isopropyl-2-(methylthio-
)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.065
g, 0.13 mmol) and 2 M methylamine in THF (1 mL) were combined to
afford
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-5-(8-isopropyl-2-(methylamin-
o)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea as
white solid (39 mg, 62%). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 8.68 (s, 1H), 8.62 (s, 1H), 8.48 (d, J=2.0 Hz, 1H), 8.34
(d, J=7.6 Hz, 1H), 7.80 (s, 1H), 7.79 (s, 1H), 7.78-7.74 (m, 1H),
7.38 (s, 1H), 7.22-7.20 (m, 2H), 5.77-5.74 (m, 1H), 2.89 (d, J=4.4
Hz, 3H), 1.59-1.55 (m, 6H), 1.46 (m, 9H); MS (ESI) m/z: 493.2
(M+H.sup.+).
Example 106
[0544] Using general method D, 6-phenylpyrimidine-4-carboxylic acid
(250 mg, 1.25 mmol) and Example A3 were combined to afford
1-(2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyri-
midin-6-yl)phenyl)-3-(6-phenylpyrimidin-4-yl)urea (265 mg, 41%
yield) which was used without purification. .sup.1H NMR (300 MHz,
DMSO-d.sub.6) .delta. 2.59 (s, 3H), 3.66 (s, 3H), 7.36-7.38 (m,
2H), 7.53-7.55 (m, 3H), 8.03-8.12 (m, 4H), 8.50-8.52 (m, 1H), 8.88
(s, 1 H), 8.95 (s, 1H), 10.2 (br. s, 2H); MS (ESI) m/z: 514.0
(M+H.sup.+).
[0545] Using a procedure analogous to Example A1,
1-(2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyri-
midin-6-yl)phenyl)-3-(6-phenylpyrimidin-4-yl)urea (265 mg, 0.516
mmol) and 2.00 N methylamine in THF (3.87 mL, 7.73 mmol) were
combined to afford
1-(2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyr-
imidin-6-yl)phenyl)-3-(6-phenylpyrimidin-4-yl)urea (139 mg, 54%
yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6) .delta. 2.89 (m, 3H),
3.54-3.62 (m, 3H), 7.29-7.35 (m, 2H), 7.53-7.55 (m, 3H), 7.70-7.82
(m, 1H), 7.91 (s, 1H), 8.03-8.06 (m, 2H), 8.13 (s, 1H), 8.44-8.46
(s, 1H), 8.60-8.75 (m, 1H), 8.98 (s, 1H), 10.1 (br. s, 1H), 10.2
(s, 1H); MS (ESI) m/z: 497.2 (M+H.sup.+).
Example 107
[0546] To a solution of
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-5-(8-methyl-2-(methylsulfiny-
l)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea from
Example 65 (0.1 g, 0.2 mmol) in DMF (1 mL) was added
N1,N1-dimethylethane-1,2-diamine (0.054 g, 0.61 mmol) and the
solution was stirred for 2 h at RT. The reaction mixture was
purified by reverse phase chromatography to furnish product as the
TFA salt. The TFA salt (0.2 g) thus obtained was suspended in THF
(5 ml), MP-carbonate resin (0.2 g) was added and the slurry was
orbitally shaken for a few hours. The solution was separated and
concentrated to provide
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(5-(2-(2-(dimethylamino)ethylamino)-8--
methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluorophenyl)urea
as the hydrochloride salt (45 mg, 42% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.70-8.69 (m, 2H), 8.49 (d, J=2.0 Hz, 1H),
8.38-8.36 (m, 1H), 7.95-7.93 (brs, 1H), 7.87 (s, 1H), 7.75 (s, 1H),
7.35 (s, 1H), 7.21-7.18 (m, 2H), 3.67-3.52 (m, 7H), 2.79 (s, 3H),
2.78 (s, 3H), 1.42 (s, 9H); (ESI) m/z: 522.2 (M+H.sup.+).
Example 108
[0547] Using general method B, Example B15 (0.060 g, 0.25 mmol) and
Example A30 (0.083 g, 0.25 mmol) were combined to afford
1-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2--
fluoro-4-methylphenyl)-3-(3-(trifluoromethyl)isoxazol-5-yl)urea
(0.060 g, 47% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
11.0 (s, 1H), 8.80 (s, 1H), 8.39 (s, 1H), 7.80 (d, J=8.4 Hz, 1H),
7.66 (s, 1H), 7.18 (d, J=12.0 Hz, 1H), 6.99 (q, J=5.2 Hz, 2H), 6.45
(s, 1H), 6.23 (s, 1H), 4.14 (q, J=6.8 Hz, 1H), 2.85 (d, J=4.8 Hz,
1H), 2.08 (s, 3H), 1.20 (t, J=7.2 Hz, 3H); MS (ESI) m/z: 505.2
(M+H.sup.+).
Example 109
[0548] Using a modified general method B, the carbainate of Example
B19 (0.17 g, 0.76 mmol), Example A10 (0.25 g, 0.76 mmol) and
N-methylpyrrolidine (catalytic amount) were stirred at 120.degree.
C. in THF for 1 h under microwave irradiation. Solvents were
removed and crude residue was purified by silica gel chromatography
to afford
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(meth-
ylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea as
an off-white solid (0.192 g, 51% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.90 (s, 1H), 8.65 (s, 1H), 8.44 (d, J=1.6
Hz, 1H), 8.00 (d, J=8.4 Hz, 1H), 7.87 (s, 1H), 7.77 (s, 1H), 7.36
(s, 1H), 7.14 (d, J=8.4 Hz, 1H), 3.64 (s, 3H), 2.61 (s, 3H), 2.06
(s, 3H), 1.45 (s, 9H); (ESI) m/z: 496.3 (M+H.sup.+).
[0549] Using a procedure analogous to Example A1,
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(meth-
ylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.192 g, 0.39 mmol) and 2M methylamine in THF (1 mL; 5 eq) were
combined to afford
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(meth-
ylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
as an off-white solid (0.174 g, 94% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.63 (s, 1H), 8.60 (s, 1H), 8.40 (d, J=1.6
Hz, 1H), 7.94 (d, J=8.8 Hz, 1H), 7.80-7.77 (m, 2H), 7.66 (s, 1H),
7.36 (s, 1H), 7.10 (d, J=8.4 Hz, 1H), 3.59-3.51 (m, 3H), 2.90 (d,
J=4.4 Hz, 1H), 2.05 (s, 3H), 1.45 (s, 9H); (ESI) m/z: 479.2
(M+H.sup.+).
Example 110
[0550] Using general method B, Example B15 and Example A30 (0.083
g, 0.25 mmol) were combined to afford
1-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2--
fluoro-4-methylphenyl)-3-(3-(trifluoromethyl)isoxazol-5-yl)urea (60
mg, 47% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 11.0
(s, 1H), 8.80 (s, 1H), 8.39 (s, 1H), 7.80 (d, J=8.4 Hz, 1H), 7.66
(s, 1H), 7.18 (d, J=12.0 Hz, 1H), 6.99 (q, J=5.2 Hz, 1H), 6.45 (s,
1H), 6.23 (s, 1H), 4.13 (q, J=7.2 Hz, 2H), 2.85 (d, J=4.8 Hz, 3H),
2.08 (s, 3H), 1.20 (t, J=7.2 Hz, 3H); MS (ESI) m/z: 505.2
(M+H.sup.+).
Example 1111
[0551] Using a procedure analogous to Example 102, Example A34
(1.61 g, 4.85 mmol) was converted to
3-(5-amino-4-fluoro-2-methylphenyl)-1-ethyl-7-(methylamino)-1,6-naphthyri-
din-2(1H)-one (1.16 g, 73% yield for two steps). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 8.36 (s, 1H), 7.58 (s, 1H), 6.94-6.92
(brm, 1H), 6.83 (d, J=12.0 Hz, 1H), 6.57 (d, J=9.6 Hz, 1H), 4.87
(brs, 2H), 4.12 (q, J=6.8 Hz, 2H), 2.84 (d, J=4.8 Hz, 3H), 1.94 (s,
3H), 1.185 (t, J=7.2 Hz, 3H); MS (ESI) m/z: 327.2 (M+H.sup.+).
[0552] Using general procedure C, the TROC carbamate of B18 (0.212
g, 0.672 mmol, 1.00 eq) and
3-(5-amino-4-fluoro-2-methylphenyl)-1-ethyl-7-(methylamino)-1,6-naphthyri-
din-2(1H)-one (0.210 g, 0.672 mmol, 1.00 eq) were combined to form
desired product which was subsequently treated with MsOH to afford
1-(3-tert-butylisoxazol-5-yl)-3-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dih-
ydro-1,6-naphthyridin-3-yl)-2-fluoro-4-methylphenyl)urea (96 mg,
24% yield) as the mesylate salt. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 10.31 (s, 1H), 8.70 (brs, 1H), 8.50 (s, 1H),
7.92 (d, J=8.4 Hz, 1H), 7.79 (s, 1H), 7.20 (d, J=11.6 Hz, 1H),
6.526 (s, 1H), 5.99 (s, 1H), 4.16 (q, J=7.6 Hz, 2H), 2.95 (s, 3H),
2.29 (s, 3H), 2.08 (s, 3H), 1.23-1.19 (m, 12H); MS (ESI) m/z: 493.2
(M+H.sup.+).
Example 112
[0553] Using general method D, Example B17 (0.061 g, 0.25 mmol) and
Example A39 (0.088 g, 0.28 mmol) were combined in presence of
triethylamine (0.077 g, 0.76 mmol) and diphenylphospharyl azide
(0.11 g, 0.38 mmol) to afford
1-(3-tert-butyl-1-(2-(dimethylamino)ethyl)-1H-pyrazol-5-yl)-3-(2-fluoro-4-
-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidi-
n-6-yl)phenyl)urea as the hydrochloride salt (70 mg, 50% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.50 (s, 1H), 9.26 (s,
1H), 8.87 (s, 1H), 8.59 (s, 1H), 7.88 (d, J=8.4 Hz, 1H), 7.82-7.80
(m, 1H), 7.65 (s, 1H), 7.15 (d, J=12.0 Hz, 1H), 6.11 (s, 1H), 4.31
(t, J=6.4 Hz, 2H), 3.59 (s, 3H), 3.51-3.46 (m, 2H), 2.89 (s, 3H),
2.79 (s, 3H), 2.78 (s, 3H), 2.06 (s, 3H), 1.19 (s, 9H); MS (ESI)
m/z: 550.2 (M+H.sup.+).
Example 113
[0554] Using a modified general method G, the carbamate of
5-t-butylisoxazol-3-amine (60 mg, 0.27 mmol), Example A39 (84 mg,
0.27 mmol) and N-methylpyrrolidine (2.3 mg, 0.027 mmol) were
combined in THF (1 mL) and were heated to 60.degree. C. overnight.
The reaction mixture was diluted with acetonitrile and filtered.
The filtered solid was washed with acetonitrile and dried in vacuo
to provide
1-(5-tert-butylisoxazol-3-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(methyla-
mino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (53
mg, 41% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.78
(s, 1H), 8.74 (br s, 1H), 8.60 (br s, 1H), 7.92 (d, J=8.4 Hz, 1H),
7.81 (m, 1H), 7.68 (s, 1H), 7.16 (d, J=12.3 Hz, 1H), 6.43 (s, 1H),
3.59-3.52 (m, 3 H), 2.90 (d, J=4.5 Hz, 3H), 2.07 (s, 3H), 1.25 (s,
9H); MS (ESI) m/z: 480.2 (M+H.sup.+).
Example 114
[0555] Using general method B, Example B15 (0.065 g, 0.28 mmol) and
Example A10 (0.091 g, 0.28 mmol) were combined to afford
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2-
,3-d]pyrimidin-6-yl)phenyl)-3-(3-(trifluoromethyl)isoxazol-5-yl)urea
(0.090 g, 64% yield). MS (ESI) m/z: 509.0 (M+H.sup.+).
[0556] Using a procedure analogous to Example A1,
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2-
,3-d]pyrimidin-6-yl)phenyl)-3-(3-(trifluoromethyl)isoxazol-5-yl)urea
(0.090 g, 0.18 mmol) was treated with mCPBA (70% wt, 0.052 g, 0.21
mmol) and then N,N-dimethylethylenediamine (0.039 g, 0.44 mmol) to
afford
1-(5-(2-(2-(dimethylamino)ethylamino)-8-methyl-7-oxo-7,8-dihydropyrido[2,-
3-d]pyrimidin-6-yl)-2-fluoro-4-methylphenyl)-3-(3-(trifluoromethyl)isoxazo-
l-5-yl)urea (0.071 g, 73% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6, major rotomer): .delta. 8.69 (brs, 1H), 8.60 (brs,
1H), 7.83 (d, J=8.4 Hz, 1H), 7.76 (m, 1H), 7.67 (s, 1H), 7.17 (d,
J=12.4 Hz, 1H), 6.41 (s, 1H), 5.74 (s, 1H), 3.58 (brs, 3H), 3.48
(q, J=6.4 Hz, 2H), 2.53 (m, 2H), 2.24 (s, 6H), 2.08 (s, 3H); MS
(ESI) m/z: 523.2 (M+H.sup.+).
Example 115
[0557] Using a procedure analogous to Example A1,
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(meth-
ylsulfinyl)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
from Example 109 (0.081 g, 0.16 mmol) and (R)-1-phenylethanamine
(0.058 g, 0.48 mmol) were combined in THF (1 mL) to provide
(R)-1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-7-o-
xo-2-(1-phenylethylamino)-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)ur-
ea as a white solid (0.048 g, 53% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.62 (s, 1H), 8.60 (s, 1H), 8.48 (d, J=7.2
Hz, 1H), 8.39 (brs, 1H), 7.90 (d, J=8.0 Hz, 1H), 7.76 (s, 1H), 7.62
(s, 1H), 7.43-7.35 (m, 3H), 7.31-7.27 (m, 2H), 7.18 (t, J=7.2 Hz,
1H), 7.08 (d, J=12.8 Hz, 1H), 5.12 (t, J=7.2 Hz, 1H), 3.54-3.46 (m,
3H), 2.01 (s, 3H), 1.44 (s, 9H); (ESI) m/z: 569.3 (M+Wf).
Example 116
[0558] To a solution of
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(meth-
ylsulfinyl)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
from Example 109 (0.075 g, 0.15 mmol) in THF (1 mL) was added,
N'-dimethylethane-1,2-diamine (0.04 g, 0.44 mmol) and stirring
continued for 4 h at RT. Solvent was removed under vacuum and crude
product was purified by silica gel chromatography to provide
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(5-(2-(2-(dimethylamino)ethylamino)-8--
methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-methylphen-
yl)urea as the hydrochloride salt (0.058, 74% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 9.61 (brs, 1H), 8.67-8.64 (m, 2H),
8.42 (s, 1H), 7.95-7.88 (m, 2H), 7.71 (s, 1H), 7.68 (s, 1H), 7.32
(s, 1H), 7.07 (d, J=12.4 Hz, 1H), 3.68-3.65 (m, 2H), 3.57 (s, 3H),
3.28-3.26 (m, 2H), 2.79 (s, 3H), 2.78 (s, 3H), 2.00 (s, 3H), 1.40
(s, 9H); MS (ESI) m/z: 536.2 (M+H.sup.+).
Example 117
[0559] Using general method B, the carbamate of
5-t-butylisoxazol-3-amine (0.10 g, 0.45 mmol) and Example A12 (0.13
g, 0.45 mmol) were combined to afford
1-(5-tert-butylisoxazol-3-yl)-3-(2-fluoro-5-(8-methyl-2-(methylami-
no)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (36
mg, 17% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major rotomer):
.delta. 9.84 (s, 1H), 8.81 (brs, 1H), 8.65 (s, 1H), 8.40 (d, J=8.0
Hz, 1H), 7.88 (s, 1H), 7.2-7.4 (m, 2H), 6.49 (s, 1H), 3.61 (brs,
3H), 2.90 (brd, J=4.8 Hz, 3H); MS (ESI) m/z: 466.2 (M+H.sup.+).
Example 118
[0560] Using a procedure analogous to Example A1,
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(meth-
ylsulfinyl)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
from Example 109 (0.075 g, 0.15 mmol) and (S)-1-phenylethanamine
(0.053 g, 0.44 mmol) were combined in THF (1 mL) to afford
(S)-1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-7-o-
xo-2-(1-phenylethylamino)-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)ur-
ea as a white solid (0.048 g, 58% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.62 (s, 1H), 8.60 (s, 1H), 8.48 (d, J=8.0
Hz, 1H), 8.39 (brs, 1H), 7.90 (d, J=8.4 Hz, 1H), 7.76 (s, 1H), 7.62
(s, 1H), 7.44-7.35 (m, 3H), 7.31-7.27 (m, 2H), 7.18 (t, J=7.2 Hz,
1H), 7.09 (d, J=12.4 Hz, 1H), 5.12 (t, J=6.8 Hz, 1H), 3.55-3.46 (m,
3H), 2.01 (s, 3H), 1.44 (s, 9H); (ESI) m/z: 569.3 (M+H.sup.+).
Example 119
[0561] Using general method C, 5-(trifluoromethyl)pyridin-3-amine
(250 mg, 1.54 mmol) and Example A12 (295 mg, 0.984 mmol) were
combined to afford
1-(2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyr-
imidin-6-yl)phenyl)-3-(5-(trifluoromethyl)pyridin-3-yl)urea (15 mg,
2.3% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6) .delta. 2.89 (s,
3H), 3.54-3.61 (m, 3H), 7.26-7.32 (m, 2H), 7.70-7.85 (m, 1H), 7.89
(s, 1H), 8.33-8.35 (m, 1H), 8.46 (s, 1H), 8.56 (s, 1H), 8.65 (s,
1H), 8.71 (s, 1H), 8.91 (s, 1H), 9.71 (s, 1H); MS (ESI) m/z: 488.3
(M+H.sup.+).
Example 120
[0562] Using a procedure analogous to Example 57,
1-(3-t-butylisoxazol-5-yl)-3-(2-fluoro-5-(8-methyl-2-(methylsulfinyl)-7-o-
xo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea from Example
43 (0.150 g, 0.311 mmol, 1.00 eq) and L-(-)-alpha-methylbenzylamine
(0.0846 ml, 0.656 mmol, 3.00 eq) were combined to afford
(S)-1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(8-methyl-7-oxo-2-(1-phen-
ylethylamino)-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(36 nmg, 30% yield) as a white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 10.34 (s, 1H), 8.73 (brs, 1H), 8.65 (brs,
1H), 8.51 (d, J=7.6 Hz, 1H), 8.37 (d, J=7.6 Hz, 1H), 7.85 (s, 1H),
7.44-7.38 (m, 2H), 7.31-7.25 (m, 4H), 7.20-7.16 (m, 1H), 6.06 (s,
1H), 5.16-5.09 (m, 1H), 3.48 (s, 3H), 1.48 (d, J=7.2 Hz, 3H), 1.23
(s, 9H); MS (ESI) m/z: 556.3 (M+H.sup.+).
Example 121
[0563] Using a procedure analogous to Example 57,
1-(3-t-butylisoxazol-5-yl)-3-(2-fluoro-5-(8-methyl-2-(methylsulfinyl)-7-o-
xo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea from Example
43 (0.150 g, 0.311 mmol, 1.00 eq) and
(R)-(+)-alpha-methylbenzylamine (0.0846 ml, 0.656 mmol, 3.00 eq)
were combined to afford
(R)-1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(8-methyl-7-oxo-2-(1-phen-
ylethylamino)-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(51 mg, 42% yield) as a white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 10.34 (s, 1H), 8.73 (brs, 1H), 8.65 (brs,
1H), 8.51 (d, J=7.6 Hz, 1H), 8.37 (d, J=7.6 Hz, 1H), 7.85 (s, 1H),
7.44-7.38 (m, 2H), 7.31-7.25 (m, 4H), 7.20-7.16 (m, 1H), 6.06 (s,
1H), 5.16-5.09 (m, 1H), 3.48 (s, 3H), 1.48 (d, J=7.2 Hz, 3H), 1.23
(s, 9H); MS (ESI) m/z: 556.3 (M+H.sup.+).
Example 122
[0564] Using general procedure G, the carbamate of B31 (212 mg,
0.81 mmol) and Example A10 (260 mg, 0.79 mmol) were combined to
provide
1-(3-cyclopentyl-1-methyl-1H-pyrazol-5-yl)-3-(2-fluoro-4-methyl-5-(8-meth-
yl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(285 mg, 68% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.90 (s, 1 H), 8.89 (s, 1H), 8.76 (d, J=2.2 Hz, 1H), 7.97 (d, J=8.4
Hz, 1H), 7.88 (s, 1H), 7.18 (d, J=12.4 Hz, 1H), 5.98 (s, 1H), 3.64
(s, 3H), 3.57 (s, 3H), 2.83 (m, 1H), 2.61 (s, 3H), 2.07 (s, 3 H),
1.90-1.80 (m, 2H), 1.66-1.46 (m, 6H); MS (ESI) m/z: 522.2
(M+H.sup.+).
[0565] Using a procedure analogous to Example A1,
1-(3-cyclopentyl-1-methyl-1H-pyrazol-5-yl)-3-(2-fluoro-4-methyl-5-(8-meth-
yl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(283 mg, 0.54 mmol) and methylamine in THF (2.0 M, 1.0 mL, 2.0
mmol) were combined to provide
1-(3-cyclopentyl-1-methyl-1H-pyrazol-5-yl)-3-(2-fluoro-4-methyl-5-(8-meth-
yl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)ure-
a (34 mg, 46%). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.87
(s, 1H), 8.71 (d, J=2.0 Hz, 1H), 8.60 (br s, 1H), 7.92 (d, J=8.4
Hz, 1H), 7.81 (m, 1H), 7.66 (s, 1H), 7.14 (d, J=12.8 Hz, 1H), 5.98
(s, 1H), 3.59 (br s, 3H), 3.57 (s, 3H), 2.91-2.85 (m, 4H), 2.06 (s,
3H), 1.86 (m, 2H), 1.64-1.50 (m, 6H); MS (ESI) m/z: 505.2
(M+H.sup.+).
Example 123
[0566] Using general method B, the carbamate of
5-t-butylisoxazol-3-amine (0.15 g, 0.67 mmol) and Example A3 (0.21
g, 0.67 mmol) were combined to afford
1-(5-tert-butylisoxazol-3-yl)-3-(2-fluoro-5-(8-methyl-2-(methylthi-
o)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.15
g, 46% yield). MS (ESI) m/z: 483.2 (M+H.sup.+).
[0567] Using a procedure analogous to Example A1,
1-(5-tert-butylisoxazol-3-yl)-3-(2-fluoro-5-(8-methyl-2-(methylthio)-7-ox-
o-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.15 g, 0.31
mmol) was treated with mCPBA (70% wt, 0.092 g, 0.37 mmol) and then
N,N-dimethylethylenediamine (0.070 g, 0.78 mmol) to afford
1-(5-tert-butylisoxazol-3-yl)-3-(5-(2-(2-(dimethylamino)ethylamino)-8-met-
hyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluorophenyl)urea
(0.15 g, 92% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major
rotomer): .delta. 9.88 (brs, 1H), 8.85 (brs, 1H), 8.65 (s, 1H),
8.40 (dd, J=2.4, 8.0 Hz, 1H), 7.88 (s, 1H), 7.76 (m, 1H), 7.2-7.4
(m, 2H), 6.49 (s, 1H), 3.59 (brs, 3H), 3.46 (m, 4H), 2.19 (s, 6H),
1.27 (s, 9H); MS (ESI) m/z: 523.2 (M+H*).
Example 124
[0568] Using a procedure analogous to Example 136,
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(meth-
yl
sulfinyl)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
from Example 109 (0.071 g, 0.14 mmol) and
(2,2-dimethyl-1,3-dioxolan-4-yl)methanamine (0.055 g, 0.42 mmol)
were combined in THF (1 mL) to provide
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(5-(2-(2,3-dihydroxypropylamino)-8-met-
hly-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-methylphenyl)urea
as a white solid (0.047 g, 63% yield; 2 steps). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 8.76 (s, 1H), 8.63 (s, 1H), 8.48 (s,
1H), 7.96 (d, J=8.4 Hz, 1H), 7.79 (s, 1H), 7.68 (s, 1H), 7.54 (brs,
1H), 7.33 (s, 1H), 7.12 (d, J=12.4 Hz, 1H), 4.82 (brs, 1H), 4.60
(t, J=6.8 Hz, 1H), 3.78-3.74 (m, 1H), 3.59-3.52 (m, 5H), 2.01 (s,
3H), 1.44 (s, 9H); (ESI) m/z: 539.2 (M+H.sup.+).
Example 125
[0569] Using general method B, Example B15 (0.070 g, 0.30 mmol) and
Example A26 (0.093 g, 0.30 mmol) were combined to afford
1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(3-(trifluoromethyl)isoxazol-5-yl)urea
(80 mg, 55% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
11.0 (s, 1H), 8.83 (s, 1H), 8.41 (s, 1H), 7.83 (d, J=8.4 Hz, 1H),
7.69 (s, 1H), 7.21 (d, J=12.0 Hz, 1H), 7.06 (q, J=4.8 Hz, 1H), 6.48
(s, 1H), 6.19 (s, 1H), 3.52 (s, 3H), 2.87 (d, J=4.4 Hz, 3H), 2.11
(s, 3H); MS (ESI) m/z: 491.2 (M+H.sup.+).
Example 126
[0570] Using general method B, Example B15 0.0378 g, 0.160 mmol)
and Example A7 (0.0455 g, 0.123 mmol) were combined to afford
1-(5-(7-(2-(dimethylamino)ethylamino)-1-methyl-2-oxo-1,2-dihydro-1,6-naph-
thyridin-3-yl)-2-fluoro-4-methylphenyl)-3-(3-(trifluoromethyl)isoxazol-5-y-
l)urea (0.018 g, 27% yield) as a white solid. It was converted to
corresponding mesylate salt by reacting with MsOH (1.0 eq.).
.sup.1H NMR (400 MHz, DMSO-d.sub.6), .delta. 10.9 (s, 1H), 9.31 (m,
1H), 8.81 (s, 1H), 8.41 (s, 1H), 7.77 (d, J=8.4 Hz, 1H), 7.70 (s,
1H), 7.29 (m, 1H), 7.16 (d, J=12.0 Hz, 1H), 6.39 (s, 1H), 6.31 (s,
1H), 3.65 (q, J=5.2 Hz, 2H), 3.47 (s, 3H), 3.23 (m, 2H), 2.79 (d,
J=2.0 Hz, 6H), 2.24 (s, 3H), 2.04 (s, 3H); MS (ESI) m/z: 548.3
(M+H.sup.+).
Example 127
[0571] Using general method B, the carbamate of B2 (0.0463 g, 0.195
mmol) and Example A6 (0.0482 g, 0.130 mmol) were combined to afford
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(5-(2-(2-(dimethylamino)ethyl-
amino)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-m-
ethylphenyl)urea (0.046 g, 64% yield) as a white solid. It was
converted to the corresponding HCl salt by reacting with HCl (4.0 M
HCl in dioxane, 1.0 eq.). .sup.1H NMR (400 MHz, DMSO-d.sub.6),
.delta. 9.78 (s, 1H), 9.61 (s, 1H), 9.16 (s, 1H), 8.89 (s, 1H),
8.68 (s, 1H), 8.02 (s, 1H), 7.94 (d, J=8.0 Hz, 1H), 7.73 (s, 1H),
7.16 (d, J=12.4 Hz, 1H), 6.06 (m, 1H), 3.97 (m, 3H), 3.54 (m, 3H),
3.32 (m, 2H), 2.82 (d, J=4.4 Hz, 6H), 2.06 (s, 3H), 1.17 (s, 9H);
MS (ESI) m/z: 550.2 (M+H.sup.+).
Example 128
[0572] Using general method A, the TROC carbamate of Example B18
(208 mg, 0.658 mmol) and Example A40 (120 mg, 0.470 mmol) were
combined to afford
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(2-oxo-1,2-dihydro-1,6-naphth-
yridin-3-yl)phenyl)urea (35 mg, 18% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 1.22 (s, 9H), 6.07 (s, 1H), 7.20-7.22 (m,
1H), 7.31-7.35 (m, 1H), 7.42-7.45 (m, 1H), 8.15 (s, 1H), 8.43-8.46
(m, 2H), 8.80 (br. s, 1H), 8.91 (br. s, 1H), 10.3 (br. s, 1H), 12.2
(br. s, 1H); MS (ESI) m/z: 422.2 (M+H.sup.+).
Example 129
[0573] Using general method A, the TROC carbamate of Example B18
(0.256 g, 0.81 mmol) and Example A6 (0.300 g, 0.81 mmol) were
combined to provide
1-(3-tert-butylisoxazol-5-yl)-3-(5-(2-(2-(dimethylamino)ethylamino)-8-met-
hyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-methylphenyl)-
urea, which was converted to the mesylate salt (27 mg, 6% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.36 (s, 1H), 9.62
(brs, 1H), 8.74 (s, 1H), 8.64 (s, 1H), 7.97 (brs, 1H), 7.85 (d, J=9
Hz), 7.70 (s, 1H), 7.34 (d, J=12 Hz, 1H), 5.94 (s, 1H), 3.68 (brs,
2H), 3.28 (brs, 2H), 2.90 (brs, 6H), 2.23 (s, 3H), 2.03 (s, 3H),
1.16 (s, 9H); MS (ESI, m/z: 537.3, M+H.sup.+).
Example 130
[0574] Using general method B, the carbamate of
5-t-butylisoxazol-3-amine (0.029 g, 0.130 mmol) and Example A6
(0.032 g, 0.086 mmol) were combined to afford
1-(5-tert-butylisoxazol-3-yl)-3-(5-(2-(2-(dimethylamino)ethylam-
ino)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-met-
hylphenyl)urea (0.011 g, 24% yield) as a white solid. It was
converted to the corresponding mesylate salt by reacting with MsOH
(1.0 eq.). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.80 (s,
1H), 9.34 (m, 1H), 8.77 (s, 1H), 8.69 (s, 1H), 7.99 (m, 1H), 7.92
(d, J=8.0 Hz, 1H), 7.74 (s, 1H), 7.18 (d, J=12.0 Hz, 1H), 6.42 (s,
1H), 3.70 (q, J=6.0 Hz, 2H), 3.61 (m, 2H), 2.84 (s, 6H), 2.31 (s,
3H), 2.07 (s, 3H), 1.33 (s, 3H), 1.25 (s, 9H); MS (ESI) m/z: 537.3
(M+H.sup.+).
Example 131
[0575] A solution
1-(3-cyclopentyl-1-methyl-1H-pyrazol-5-yl)-3-(2-fluoro-4-methyl-5-(8-meth-
yl-2-(methylsulfinyl)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)-
urea from Example 122 (80 mg, 0.15 mmol) in THF (1 mL) was treated
with N,N-dimethylethylenediamine (0.080 mL, 0.74 mmol). The
reaction was stirred 1 h at RT, diluted with EtOAc (15 mL) and
washed with 2 M aq Na.sub.2CO.sub.3 (2.times.10 mL), water (10 mL)
and brine (10 mL). The organics were dried (Na.sub.2SO.sub.4),
concentrated in vacuo and chromatographed on reverse phase silica
gel to provide
1-(3-cyclopentyl-1-methyl-1H-pyrazol-5-yl)-3-(5-(2-(2-(dimethylamino)ethy-
lamino)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4--
methylphenyl)urea (33 mg, 39% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.87 (s, 1H), 8.72 (d, J=2.0 Hz, 1H), 8.65
and 8.60 (br s, 1H), 7.91 (d, J=8.6 Hz, 1H), 7.75 and 7.59 (m, 1
H), 7.66 (s, 1H), 7.14 (d, J=8.4 Hz, 1H), 5.98 (s, 1H), 3.59-3.43
(m, 8H), 2.86 (m, 1H), 2.21 (br s, 6H), 2.49 (m, 2H obscured by
solvent), 2.06 (s, 3H), 1.87 (m, 2H), 1.66-1.48 (m, 6H); MS (ESI)
m/z: 562.3 (M+H.sup.+).
Example 132
[0576] Using general method F,
1-isocyanato-3-(trifluoromethyl)benzene (0.120 g, 0.648 mmol) and
Example A6 (0.240 g, 0.648 mmol) were combined in ethyl acetate to
provide
1-(5-(2-(2-(dimethylamino)ethylamino)-8-methyl-7-oxo-7,8-dihydropyrido[2,-
3-d]pyrimidin-6-yl)-2-fluoro-4-methylphenyl)-3-(3-(trifluoromethyl)phenyl)-
urea (106 mg, 28% yield) .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.34 (s, 1H), 8.65 (m, 1H), 8.65 (m, 1H), 8.59 (m, 1H)),
8.02 (s, 1H), 7.91 (d, J=9 Hz, 1H), 7.74 (m, 1H), 7.67 (s, 1H),
7.49 (m, 4H), 7.29 (d, J=6.5 Hz, 1H), 7.15 (d, J=12 Hz, 1H);
3.45-3.6 (m, 4H), 2.18 (s, 6H), 2.07 (s, 3H), 1.97 (s, 3H); MS
(ESI, m/z: 558.3, M+H.sup.+).
Example 133
[0577] Using the general method E,
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(meth-
ylsulfinyl)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
from Example 109 (0.081 g, 0.16 mmol) and propan-2-amine (0.029 g,
0.49 mmol) were combined in THF (1 mL) to provide
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-5-(2-(isopropylamino)-8-meth-
yl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-4-methylphenyl)urea
as a white solid (0.042 g, 50% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.63 (s, 1H), 8.60 (s, 1H), 8.40 (d, J=2.0
Hz, 1H), 7.93 (d, J=8.4 Hz, 1H), 7.77 (s, 1H), 7.64 (s, 1H), 7.36
(s, 1H), 7.10 (d, J=12.4 Hz, 1H), 4.16-4.13 (m, 1H), 3.56-3.54 (m,
3H), 2.05 (s, 3H), 1.45 (s, 9H), 1.20 (d, J=6.0 Hz, 6H); (ESI) m/z:
507.2 (M+H.sup.+).
Example 134
[0578] Using general method B, the carbamate of
5-t-butylisoxazol-3-amine (0.050 g, 0.22 mmol) and Example A26
(0.070 g, 0.22 mmol) were combined to afford
1-(5-tert-butylisoxazol-3-yl)-3-(2-fluoro-4-methyl-5-(1-methyl--
7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea
(66 mg, 62% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
9.78 (s, 1H), 8.73 (s, 1H), 8.38 (s, 1H), 7.91 (d, J=8.4 Hz, 1H),
7.66 (s, 1H), 7.14 (d, J=12.0 Hz, 1H), 7.03 (q, J=4.8 Hz, 1H), 6.43
(s, 1H), 6.17 (s, 1H), 3.50 (s, 3H), 2.85 (d, J=4.4 Hz, 3H), 2.07
(s, 3H), 1.28 (s, 9H); MS (ESI) m/z: 479.2 (M+H.sup.+).
Example 135
[0579] Using a procedure analogous to Example 93, Example B12
(0.119 g) and Example A12 (0.086 g, 0.289 mmol) were combined to
afford
1-(2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyr-
imidin-6-yl)phenyl)-3-(3-(1-hydroxy-2-methylpropan-2-yl)-1-methyl-H-pyrazo-
l-5-yl)urea (0.043 g, 32% yield) as a light yellow solid. .sup.1H
NMR (400 MHz, DMSO-d.sub.6), .delta. 8.57 (s, 1H), 8.29 (dd, J=7.6,
2.0 Hz, 1H), 7.85 (s, 1H), 7.40-7.35 (m, 1H), 7.18 (dd, J=10.4, 8.4
Hz, 1H), 6.17 (s, 1H), 3.75-3.68 (m, 6H), 3.53 (s, 2H), 3.03 (s,
3H), 1.25 (s, 6H); MS (ESI) m/z: 495.2 (M+H.sup.+).
Example 136
[0580] To a solution of
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-5-(8-methyl-2-(methylsulfiny-
l)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea from
Example 65 (0.082 g, 0.16 mmol) in THF (1 mL) was added
2,2-dimethyl-1,3-dioxolan-4-yl)methanamine (0.065 g, 0.48 mmol).
After stirring for 20 h at RT, the solvent was removed and crude
residue was purified by silica gel chromatography to afford
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(5-(2-((2,2-dimethyl-1,3-dioxolan-4-yl-
)methylamino)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-flu-
orophenyl)urea (64 mg) as a white solid.
[0581] This intermediate was stirred in THF and 2M HCl (5 mL, 4:1)
for 2 h at RT. The reaction mixture was concentrated to 1 mL, and
2N NaOH was added until the pH of the solution was around 8. The
resultant solid was filtered, washed with water and dried to
provide
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(5-(2-(2,3-dihydroxypropylamino)-8-met-
hyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluorophenyl)urea
as a white solid (53 mg, 61% yield, 2 steps). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.70 (brs, 2H), 8.65 (s, 1H), 8.49 (d, J=2.0
Hz, 1H), 8.40 (d, J=8.0 Hz, 1H), 7.85 (s, 1H), 7.81 (s, 1H),
7.70-7.67 (m, 1H), 7.38 (s, 1H), 7.24 (s, 1H), 7.22 (s, 1H), 4.79
(d, J=4.8 Hz, 1H), 4.58 (t, J=5.6 Hz, 1H), 3.73-3.48 (m, 5H),
3.38-3.33 (m, 3H), 1.47 (s, 9H); (ESI) m/z: 525.3 (M+H.sup.+).
Example 137
[0582] Using general method G, 2-amino-5-t-butyl-1,3,4-thiadiazole
(0.5000 g, 3.2 mmol) and Example A10 (0.342 g, 1.04 mmol) were
combined to afford
1-(5-t-butyl-1,3,4-thiadiazol-2-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(m-
ethylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.345 g, 65% yield) as a white solid which was used as is in the
next reaction. .sup.1H NMR (400 MHz, CDCl.sub.3): .delta. 8.67 (s,
1H), 7.94 (d, J=7.6 Hz), 7.67 (s, 1H), 6.96 (d, J=11.2 Hz), 3.91
(s, 3H), 2.69 (s, 3H), 2.15 (s, 3H), 1.45 (s, 9H); MS (ESI) m/z:
514.2 (M+H.sup.+).
[0583] Using a procedure analogous to Example A1,
1-(5-t-butyl-1,3,4-thiadiazol-2-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(m-
ethylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.345 g, 0.672 mmol) and 2.00M MeNH.sub.2/THF (3.36 ml, 6.72 mmol)
were combined to afford
1-(5-tert-butyl-1,3,4-thiadiazol-2-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-
-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.311 g, 93% yield) as a white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 7.822-7.75 (m, 3H), 7.69 (s, 1H), 7.39-7.37
(m, 1H), 7.34-7.30 (m, 1H), 7.16 (d, J=12.0 Hz, 1H), 2.90 (brd,
J=4.8 Hz, 3H), 2.35 (s, 3H), 2.09 (s, 3H), 1.34 (s, 9H); MS (ESI)
m/z: 497.0 (M+H.sup.+).
Example 138
[0584] Using general method B, the carbamate of Example B19 (0.080
g, 0.36 mmol) and Example A7 (0.088 g, 0.24 mmol) were combined to
afford
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(5-(7-(2-(dimethylamino)ethylamino)-1--
methyl-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoro-4-methylphenyl)ur-
ea (0.0469 g, 37% yield) as a white solid. It was converted to
corresponding mesyalte salt by reacting with MsOH (1.0 eq.).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.38 (s, 1H), 8.66 (s,
1H), 8.44-8.43 (m, 2H), 7.94 (d, J=8.4 Hz, 1H), 7.76 (s, 1H), 7.71
(s, 1H), 7.37 (s, 1H), 7.27 (t, J=5.6 Hz, 1H), 7.11 (d, J=12.0 Hz,
1H), 6.34 (s, 1H), 3.68 (q, J=5.6 Hz, 2H), 3.50 (s, 3H), 3.27 (t,
J=5.6 Hz, 2H), 2.83 (s, 6H), 2.30 (s, 3H), 2.05 (s, 3H), 1.45 (s,
9H); MS (ESI) m/z: 535.2 (M+H.sup.+).
Example 139
[0585] Using General Method B, Example B15 (100 mg, 0.381 mmol)
Example A16 (116 mg, 0.346 mmol) were combined to afford
1-(2,4-difluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]-
pyrimidin-6-yl)phenyl)-3-(3-(trifluoromethyl)isoxazol-5-yl)urea (65
mg, 37% yield) as an oil, which was used without purification in
the next reaction.
[0586] Using a procedure analogous to Example A1,
1-(2,4-difluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]-
pyrimidin-6-yl)phenyl)-3-(3-(trifluoromethyl)isoxazol-5-yl)urea (65
mg, 0.130 mmol) and 2.0N methylamine in THF (0.63 mL, 1.3 mmol)
were combined to afford
1-(2,4-difluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropy-
rido[2,3-d]pyrimidin-6-yl)phenyl)-3-(3-(trifluoromethyl)isoxazol-5-yl)urea
(8 mg, 13% yield). MS (ESI) m/z: 496.0 (M+H.sup.+).
Example 140
[0587] Using General Method B, Example B15 (120 mg, 0.457 mmol) and
Example A17 (100 mg, 0.286 mmol) were combined to afford
1-(4-chloro-2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2-
,3-d]pyrimidin-6-yl)phenyl)-3-(3-(trifluoromethyl)isoxazol-5-yl)urea
(75 mg, 50% yield) which was used without further purification. MS
(ESI) m/z: 529.0 (M+H.sup.+).
[0588] Using a procedure analogous to Example A1,
1-(4-chloro-2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2-
,3-d]pyrimidin-6-yl)phenyl)-3-(3-(trifluoromethyl)isoxazol-5-yl)urea
(75 mg, 0.140 mmol) and 2.0 N methylamine in THF (0.71 mL) were
combined to afford
1-(4-chloro-2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydro-
pyrido[2,3-d]pyrimidin-6-yl)phenyl)-3-(3-(trifluoromethyl)isoxazol-5-yl)ur-
ea (15 mg, 21% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6) .delta.
2.89 (s, 3H), 3.51-3.58 (m, 3H), 6.48 (s, 1H), 7.61 (d, J=111 Hz,
1H), 7.77 (s, 1H), 7.88-7.90 (m, 1H), 8.04 (d, J=9.5 Hz, 1H),
8.61-8.69 (m, 1H), 9.01 (s, 1H), 11.0 (s, 1H); MS (ESI) m/z: 512.0
(M+H.sup.+).
Example 141
[0589] In a solution of ethanol:water:dioxane (1:1:1, 9 mL) was
placed ethyl
1-tert-butyl-5-(trifluoromethyl)-1H-pyrazole-4-carboxylate (750 mg,
2.84 mmol) and lithium hydroxide hydrate (357 mg, 8.51 mmol). The
mixture was stirred at 40.degree. C. for 3 hrs and then at RT
overnight. The mixture was diluted with water (25 mL) and 1N HCl
(10 mL) and extracted with ethyl acetate (2.times.25 mL). The
combined organic phases were washed with brine (20 mL), dried
(Na.sub.2SO.sub.4) and evaporated at reduced pressure to afford
1-tert-butyl-5-(trifluoromethyl)-1H-pyrazole-4-carboxylic acid (646
mg, 94% yield) as a solid. .sup.1H NMR (300 MHz, DMSO-d.sub.6)
.delta. 1.63 (s, 9H), 7.92 (s, 1H); MS (ESI) m/z: 259.0
(M+Na.sup.+).
[0590] Using General Method D,
1-tert-butyl-5-(trifluoromethyl)-1H-pyrazole-4-carboxylic acid (200
mg, 0.847 mmol) and Example A3 (268 mg, 0.847 mmol) were combined
to afford
1-(1-tert-butyl-5-(trifluoromethyl)-1H-pyrazol-4-yl)-3-(2-fluoro-5-(8-met-
hyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)ure-
a (247 mg, 53% yield).
[0591] Using a procedure analogous to Example A1,
1-(1-tert-butyl-5-(trifluoromethyl)-1H-pyrazol-4-yl)-3-(2-fluoro-5-(8-met-
hyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)ure-
a (247 mg, 0.449 mmol) and 2.0N methylamine in THF (2.25 mL, 4.49
mmol) were combined to afford
1-(1-tert-butyl-5-(trifluoromethyl)-1H-pyrazol-4-yl)-3-(2-fluoro-5-(8-met-
hyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)ur-
ea (152 mg, 63% yield). .sup.1H NMR (300 MHz, acetone-d.sub.6)
.delta. 1.64 (s, 9H), 2.82 (s, 3H), 3.06 (m, 3H), 6.80-6.95 (m,
1H), 7.14-7.19 (m, 1H), 7.38-7.42 (m, 1H), 7.85 (s, 1H), 8.06 (s,
1H), 8.11 (br. s, 1 H), 8.50 (br. s, 1H), 8.57-8.59 (m, 1H),
8.60-8.63 (m, 1H); MS (ESI) m/z: 533.3 (M+H.sup.+).
Example 142
[0592] To a stirring solution of 4-chloro-3-(trifluoromethyl)phenyl
isocyanate (0.0750 g, 0.401 mmol, 1.00 eq) in THF (5 ml) at
22.degree. C. was added Example A25 (0.125 g, 0.401 mmol, 1.00 eq).
The reaction became homogeneous and then solids precipitated. The
suspension was stirred overnight at RT. The reaction was chilled
thoroughly at 0-5.degree. C. The solids were collected by
filtration, rinsed well with ice-cold THF and dried on the filter.
The free base thus obtained was treated with MsOH in THF (2 wt %,
1.64 g, 0.342 mmol, 1.0 eq) to afford
1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(3-(trifluoromethyl)phenyl)urea (182 mg,
76% yield) as the mesylate salt as a nearly white solid. .sup.1H
NMR (400 MHz, DMSO-d.sub.6): .delta. 9.34 (s, 1H), 8.65 (brs, 1H),
8.51 (s, 1H), 8.05 (s, 1H), 7.96 (d, J=8.4 Hz, 1H), 7.82 (s, 1H),
7.51-7.44 (m, 2H), 7.30 (d, J=7.6 Hz, 1H), 7.18 (d, J=12.4 Hz, 1H),
6.51 (s, 1H), 3.54 (s, 3H), 2.96 (s, 3H), 2.30 (s, 3H), 2.08 (s,
3H); MS (ESI) m/z: 500.3 (M+H.sup.+).
Example 143
[0593] Using a procedure analogous to Example 142,
4-chloro-3-(trifluoromethyl)phenyl isocyanate (0.1000 g, 0.451
mmol, 1.00 eq) and Example A26 (0.141 g, 0.451 mmol, 1.00 eq) were
combined to afford
1-(4-chloro-3-(trifluoromethyl)phenyl)-3-(2-fluoro-4-methyl-5-(1-m-
ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea
mesylate (168 mg, 59% yield) as a nearly white solid. .sup.1H NMR
(400 MHz, DMSO-d.sub.6) .delta. 9.47 (s, 1H), 8.65 (brs, 1H), 8.48
(s, 1H), 8.12 (d, J=2.4 Hz, 1H), 7.91 (d, J=8.8 Hz, 1H), 7.78 (s,
1H), 7.59 (d, J=8.8 Hz, 1H), 7.51 (dd, J=2.4 and 8.8 Hz, 1H), 7.18
(d, J=12.4 Hz, 1H), 6.43 (s, 1H), 3.53 (s, 3H), 2.94 (s, 3H), 2.28
(s, 3H), 2.08 (s, 3H); MS (ESI) m/z: 534.2 (M+H.sup.+).
Example 144
[0594] 3-(Trifluoromethyl)phenyl isocyanate (0.075 g, 0.40 mmol,
1.0 eq) and Example A10 (0.13 g, 0.40 mmol, 1.0 eq) were combined
in THF (5 ml) and stirred at RT overnight. The resulting suspension
was chilled at 0-5.degree. C. and the solids collected by
filtration. The solids were washed sparingly with ice-cold THF and
dried on the filter to afford
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2-
,3-d]pyrimidin-6-yl)phenyl)-3-(3-(trifluoromethyl)phenyl)urea (92
mg, 44% yield) as a white solid which was used as is in the next
reaction. .sup.1H NMR (400 MHz, acetone-d.sub.6) .delta. 8.89 (s,
1H), 8.78 (brs, 1H), 8.16-8.08 (m, 2H), 7.88 (s, 1H), 7.63 (brd,
J=8.0 Hz, 1H), 7.51 (dd, J=8.0 and 16.4 Hz, 1H), 7.33-7.31 (m, 1H),
7.09 (d, J=12.4 Hz, 1H), 3.76 (s, 3H), 2.67 (s, 3H), 2.17 (s, 3H);
MS (ESI) m/z: 518.0 (M+H.sup.+).
[0595] Using a procedure analogous to Example A1,
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2-
,3-d]pyrimidin-6-yl)phenyl)-3-(3-(trifluoromethyl)phenyl)urea
(0.092 g, 0.18 mmol) and 2.00M MeNH.sub.2/THF (0.89 ml, 1.8 mmol)
were combined to afford
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydro-
pyrido[2,3-d]pyrimidin-6-yl)phenyl)-3-(3-(trifluoromethyl)phenyl)urea
(28 mg, 31% yield) as a white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6) .delta. 8.78 (s, 1H), 8.61 (s, 1H), 8.12-8.09 (m,
2H), 8.04 (s, 1H), 7.68 s, 1H), 7.64 (brd, J=10.0 Hz, 1H), 7.50
(dd, J=7.6 and 16.0 Hz, 1H), 7.31 (brd, J=7.6 Hz, 1H), 7.06 (d,
J=12.4 Hz, 1H), 6.82 (brs, 1H), 3.59 (s, 3H), 3.08 (brd, J=4.4 Hz,
3H), 2.16 (s, 3H); MS (ESI) m/z: 501.0 (M+H.sup.+).
Example 145
[0596] Using general method E,
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(meth-
ylsulfinyl)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
from Example 109 (0.081 g, 0.16 mmol) and cyclopropanamine (0.027
g, 0.48 mmol) were combined in THF (1 mL) to provide
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(5-(2-(cyclopropylamino)-8-methyl-7-ox-
o-7,8-dihydropyrido[2,3-d]pyrimnidin-6-yl)-2-fluoro-4-methylphenyl)urea
as a white solid (0.051 g, 64% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.64 (s, 1H), 8.60 (brs, 1H), 8.40 (d, J=1.6
Hz, 1H), 8.06-8.04 (m, 1H), 7.94 (d, J=8.8 Hz, 1H), 7.77 (s, 1H),
7.66 (s, 1H), 7.36 (s, 1H), 7.10 (d, J=12.4 Hz, 1H), 3.61-3.54 (m,
3H), 2.78-2.83 (m, 1H), 2.05 (s, 3H), 1.45 (s, 9H), 0.725 (brs,
2H), 0.55-0.53 (m, 2H); (ESI) m/z: 505.2 (M+H.sup.+).
Example 146
[0597] Using general method E,
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(meth-
ylsulfinyl)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
from Example 109 (0.081 g, 0.16 mmol) and (S)-2-aminopropan-1-ol
(0.036 g, 0.48 mmol) were combined in THF (1 mL) to provide
(S)-1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-5-(2-(1-hydroxypropan-2--
ylamino)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-4-methylph-
enyl)urea as a white solid (0.062 g, 75% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 8.64 (s, 1H), 8.60 (s, 1H), 8.40 (d,
J=1.6 Hz, 1H), 7.94 (d, J=8.4 Hz, 1H), 7.77 (s, 1H), 7.64 (s, 1H),
7.59 (d, J=8.0 Hz, 1H) 7.36 (s, 1H), 7.10 (d, J=12.4 Hz, 1H), 4.72
(t, J=5.6 Hz, 1H), 4.10-4.06 (min, 1H), 3.65-3.53 (m, 3H), 2.05 (s,
3H), 1.45 (s, 9H), 1.17 (d, J=6.4 Hz, 3H); (ESI) m/z: 523.2
(M+H.sup.+).
Example 147
[0598] Using general method E,
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(meth-
ylsulfinyl)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
from Example 109 (0.085 g, 0.17 mmol) and (R)-2-aminopropan-1-ol
(0.037 g, 0.50 mmol) were combined in THF (1 mL) to provide
(R)-1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-5-(2-(1-hydroxypropan-2--
ylamino)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-4-methylph-
enyl)urea as a white solid (0.055 g, 63% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 8.64 (s, 1H), 8.60 (s, 1H), 8.40 (d,
J=2.0 Hz, 1H), 7.94 (d, J=8.8 Hz, 1H), 7.77 (s, 1H), 7.64 (s, 1H),
7.59 (d, J=8.0 Hz, 1H) 7.36 (s, 1H), 7.10 (d, J=12.4 Hz, 1H), 4.72
(t, J=5.6 Hz, 1H), 4.10-4.06 (m, 1H), 3.56-3.53 (m, 3H), 2.05 (s,
3H), 1.45 (s, 9H), 1.17 (d, J=6.4 Hz, 3H); (ESI) m/z: 523.2
(M+H.sup.+).
Example 148
[0599] Using general method B, the carbamate of
5-t-butylisoxazol-3-amine (0.07 g, 0.31 mmol) and Example A17 (0.11
g, 0.31 mmol) were combined to afford
1-(5-tert-butylisoxazol-3-yl)-3-(4-chloro-2-fluoro-5-(8-methyl-2-(-
methylthio)-7-oxo-7,8-dihydrpyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(48 mg, 30% yield). MS (ESI) m/z: 517.0 (M+H.sup.+).
[0600] Using a procedure analogous to Example A1,
1-(5-tert-butylisoxazol-3-yl)-3-(4-chloro-2-fluoro-5-(8-methyl-2-(methylt-
hio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.048 g, 0.093 mmol) was treated with mCPBA (70% wt, 0.027 g, 0.11
mmol) and then N-methylamine (2.0M in THF, 0.19 mL, 0.37 nmol) to
afford
1-(5-tert-butylisoxazol-3-yl)-3-(4-chloro-2-fluoro-5-(8-methyl-2-(methyla-
mino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (30
mg, 65% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major rotomer):
.delta. 9.86 (brs, 1H), 8.92 (brs, 1H), 8.62 (s, 1H), 8.15 (d,
J=8.8 Hz, 1H), 7.89 (m, 1H), 7.76 (s, 1H), 7.58 (d, J=10.8 Hz, 1H),
6.44 (s, 1H), 3.59 (brs, 3H), 2.90 (brd, J=4.8 Hz, 3H), 1.25 (s,
9H); MS (ESI) m/z: 500.0 (M+H.sup.+).
Example 149
[0601] Using general method B, the carbamate of
5-t-butylisoxazol-3-amine (0.07 g, 0.31 mmol) and Example A41 0.11
g, 0.31 mmol) were combined to afford
1-(5-tert-butylisoxazol-3-yl)-3-(5-(8-ethyl-2-(methylthio)-7-oxo-7-
,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-methylphenyl)urea
(97 mg, 61% yield). MS (ESI) m/z: 511.2 (M+H.sup.+).
[0602] Using a procedure analogous to Example A1,
1-(5-tert-butylisoxazol-3-yl)-3-(5-(8-ethyl-2-(methylthio)-7-oxo-7,8-dihy-
dropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-methylphenyl)urea (0.097
g, 0.19 mmol) was treated with mCPBA (70% wt, 0.056 g, 0.23 mmol)
and then N-methylamine (2.0M in THF, 0.38 mL, 0.76 mmol) to afford
1-(5-tert-butylisoxazol-3-yl)-3-(5-(8-ethyl-2-(methylamino)-7-oxo-7,8-dih-
ydropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-methylphenyl)urea (59
mg, 63% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major rotomer):
.delta. 9.79 (s, 1H), 8.74 (brs, 1H), 8.60 (s, 1H), 7.91 (d, J=8.4
Hz, 1H), 7.80 (m, 1H), 7.67 (s, 1H), 7.16 (d, J=12.0 Hz, 1H), 6.44
(s, 1H), 4.35 (m, 2H), 2.89 (brd, J=4.4 Hz, 3H), 2.06 (s, 3H), 1.25
(s, 9H), 1.19 (m, 3H); MS (ESI) m/z: 494.2 (M+H.sup.+).
Example 150
[0603] Using general method B, the carbamate of
3-isopropyl-1-phenyl-1H-pyrazol-5-amine (0.061 g, 0.21 mmol), and
Example A50 (0.07 g, 0.21 mmol) were combined to afford
1-(5-(8-ethyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-y-
l)-2-fluoro-4-methylphenyl)-3-(3-isopropyl-1-phenyl-1H-pyrazol-5-yl)urea
as an off-white solid (53 mg, 45%, yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.90 (s, 1H), 8.82 (s, 1H), 8.67-8.60 (m,
1H), 7.91 (d, J=8.4 Hz, 1H), 7.81-7.79 (m, 1H), 7.64 (s, 1H),
7.54-7.47 (m, 4H), 7.43-7.38 (m, 1H), 7.11 (d, J=12.4 Hz, 1H), 6.30
(s, 1H), 4.36-4.32 (m, 2H), 2.89-2.80 (m, 4H), 2.04 (s, 3H),
1.23-1.17 (m, 9H); MS (ESI) m/z: 555.2 (M+H.sup.+).
Example 151
[0604] Using general method D, Example B30 (0.051 g, 0.3 mmol) and
Example A50 (0.1 g, 0.3 mmol) were combined in presence of
triethylamine (0.092 g, 0.91 mmol) and diphenylphospharyl azide
(0.13 g, 0.45 mmol) to afford
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(5-(8-ethyl-2-(methylamino)-7-oxo-7,8--
dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-methylphenyl)urea
(65 mg, 44% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.63 (s, 1H), 8.60 (s, 1H), 8.40 (d, J=2.0 Hz, 1H), 7.94 (d, J=8.8
Hz, 1H), 7.80-7.77 (m, 2H), 7.65 (s, 1H), 7.36 (s, 1H), 7.10 (d,
J=12.0 Hz, 1H), 4.36-4.32 (m, 2H), 2.89 (d, J=4.4 Hz, 1H), 2.04 (s,
3H), 1.45 (s, 9H), 1.24-1.20 (m, 3H); MS (ESI) m/z: 493.2
(M+H.sup.+).
Example 152
[0605] Using general method A, the TROC carbamate of Example B18
(0.3 g, 0.95 mmol) and Example A17 (0.3 g, 0.86 mmol) were combined
to provide
1-(3-tert-butylisoxazol-5-yl)-3-(4-chloro-2-fluoro-5-(8-methyl-2-(methylt-
hio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (175
mg, 40% yield) .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.10.38
(brs, 1H), 8.92 (s, 1H)), 8.90 (m, 1H), 8.17 (d, J=8.5 Hz, 1H),
8.00 (s, 1H), 7.63 (d, J=12 Hz, 1H), 6.03 (s, 1H), 3.54 (s, 3H),
2.50 (s, 3H), 2.61 (s, 3H), 1.21 (s, 9H); MS (ESI) m/z: 517.0
(M+H.sup.+).
[0606] Using a procedure analogous to Example A1,
1-(3-tert-butylisoxazol-5-yl)-3-(4-chloro-2-fluoro-5-(8-methyl-2-(methylt-
hio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea and
methylamine were combined to provide
1-(3-tert-butylisoxazol-5-yl)-3-(4-chloro-2-fluoro-5-(8-methyl-2-(methyla-
mino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (88
mg, 50% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.10.5
(brs, 1H), 9.00 (brs, 1H), 8.61 (s, 1H), 8.11 (d, J=9 Hz, 1H), 7.88
(brs, 1H), 7.76 (s, 1H), 7.57 (d, J=12 Hz, 1H), 6.00 (s, 1H), 3.58
(s, 3H), 2.89 (d, J=5 Hz, 3H), 1.21 (s, 9H); MS (ESI) m/z: 500.3
(M+H.sup.+).
Example 153
[0607] Using general method A, the TROC carbamate of Example B18
(0.3 g, 0.95 mmaol) and Example A41 (0.3 g, 0.67 mmol) were
combined in presence of N-methylpyrrolidine (0.080 g, 0.95 mmol),
to provide
1-(3-tert-butylisoxazol-5-yl)-3-(5-(8-ethyl-2-(methylthio)-7-oxo-7,8-dihy-
dropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-methylphenyl)urea (320
mg, 72% yield) .sup.1H NMR (400 MHz, DMSO-d.sub.6) .delta.10.3
(brs, 1H), 8.91 (s, 1H)), 8.71 (brs, 1H), 7.94 (d, J=9 Hz, 1H),
7.89 (s, 1H), 7.20 (d, J=12 Hz, 1H), 6.00 (s, 1H), 3.64 (s, 3H),
4.38 (q, J=6 Hz, 2H), 2.61 (s, 3H), 2.07 (s, 3H), 1.24 (t, J=6 Hz,
3H), 1.21 (s, 9H); MS (ESI) m/z: 511.2 (M+H.sup.+).
[0608] Using a procedure analogous to Example A1,
1-(3-tert-butylisoxazol-5-yl)-3-(5-(8-ethyl-2-(methylthio)-7-oxo-7,8-dihy-
dropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-methylphenyl)urea (0.16
g, 0.315 mmol) and methylamine were combined to provide
1-(3-tert-butylisoxazol-5-yl)-3-(5-(8-ethyl-2-(methylamino)-7-oxo-7,8-dih-
ydropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-methylphenyl)urea (62
mg, 20% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.3
(brs, 1H), 8.67 (brs, 1H), 8.61 (brs, 1H), 7.88 (d, J=9 Hz, 1H),
7.80 (brs, 1H), 7.66 (s, 1H), 7.16 (d, J=12 Hz, 1H), 6.00 (s, 1H),
5.73 (s, 1H), 4.34 (br, 2H), 2.89 (d, J=6 Hz, 3H), 2.07 (s, 3H),
1.21 (br, 12H); MS (ESI) m/z: 494.2 (M+H.sup.+).
Example 154
[0609] Using general procedure C, the TROC carbamate of Example B20
(0.150 g, 0.497 mmol, 1.00 eq) and Example A10 (0.164 g, 0.497
mmol, 1.00 eq) were combined to afford
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2-
,3-d]pyrimidin-6-yl)phenyl)-3-(3-isopropylisoxazol-5-yl)urea (0.203
g, 85% yield) as a pale yellow solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 10.30 (s, 1H), 8.90 (s, 1H), 8.72 (brs, 1H),
7.93 (d, J=8.4 Hz, 1H), 7.89 (s, 1H), 7.21 (d, J=12.4 Hz, 1H), 5.96
(s, 1H), 3.64 (s, 3H), 2.87 (septet, J=7.2 Hz, 1H), 2.61 (s, 3H),
2.09 (s, 3H), 1.16 (d, J=6.8 Hz, 6H); MS (ESI) m/z: 483.0
(M+H.sup.+).
[0610] Using a procedure analogous to Example A1,
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2-
,3-d]pyrimidin-6-yl)phenyl)-3-(3-isopropylisoxazol-5-yl)urea (0.203
g, 0.421 mmol, 1.00 eq) and 2.00M MeNH.sub.2/THF (2.10 ml, 4.21
mmol, 10.00 eq,) were combined to afford
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-(3-isopropylisoxazol-5-yl)uea (41
mg, 21% yield) as a pale yellow powder. .sup.1H NMR (400 MHz,
DMSO-d.sub.6) .delta. 10.28 (s, 1H), 8.67 (brs, 1H), 8.60 (s, 1H),
7.88 (d, J=8.0 Hz, 1H), 7.81 (brq, J=4.0 Hz, 1H), 7.67 9s, 1H),
7.17 (d, J=12.8 Hz, 1H), 5.96 (s, 1H), 3.59 (s, 3H), 2.90 (d, J=4.8
Hz, 3H), 2.89 (septet, J=7.2 Hz, 1H), 2.08 (s, 3H), 1.16 (d, J=7.2
Hz, 6H); MS (ESI) m/z: 466.0 (M+H.sup.+).
Example 155
[0611] Using general method B, the carbamate of
5-t-butylisoxazol-3-amine (0.07 g, 0.31 mmol) and Example A16 (0.10
g, 0.31 mmol were combined to afford
1-(5-tert-butylisoxazol-3-yl)-3-(2,4-difluoro-5-(8-methyl-2-(methy-
lthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (80
mg, 50% yield). MS (ESI) m/z: 501.0 (M+H.sup.+).
[0612] Using a procedure analogous to Example A1,
1-(5-tert-butylisoxazol-3-yl)-3-(2,4-difluoro-5-(8-methyl-2-(methylthio)--
7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.080 g,
0.16 mmol) was treated with mCPBA (70% wt, 0.047 g, 0.19 mmol) and
then N-methylamine (2.0M in THF, 0.32 mL, 0.64 mmol) to afford
1-(5-tert-butylisoxazol-3-yl)-3-(2,4-difluoro-5-(8-methyl-2-(methylamino)-
-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (58 mg,
75% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major rotomer):
.delta. 9.81 (s, 1H), 8.78 (brs, 1H), 8.63 (s, 1H), 8.13 (t, J=8.4
Hz, 1H), 7.89 (m, 1H), 7.84 (s, 1H), 7.40 (dd, J=10.0, and 11.2 Hz,
1H), 6.45 (s, 1H), 3.59 (s, 3H), 2.99 (brd, J=4.8 Hz, 3H), 1.28 (s,
9H); MS (ESI) m/z: 484.2 (M+H.sup.+).
Example 156
[0613] Using general method D,
3-tert-butyl-1-methyl-1H-pyrazole-5-carboxylic acid (0.061 g, 0.33
mmol) and Example A50 (0.1 g, 0.33 mmol) were combined in presence
of triethylamine (0.1 g, 1 mmol) and diphenylphospharyl azide (0.14
g, 0.5 mmol) to afford
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(5-(8-ethyl-2-(methylamino)-7-
-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-methylphenyl)urea
as a white solid (140 mg, 83% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.86 (s, 1H), 8.73 (s, 1H), 8.59 (s, 1H),
7.93 (d, J=8.4 Hz, 1H), 7.81-7.79 (m, 1H), 7.65 (s, 1H), 7.14 (d,
J=12.4 Hz, 1H), 6.04 (s, 1H), 4.35-4.32 (m, 2H), 3.58 (s, 3H), 2.89
(d, J=4.4 Hz, 1H), 2.05 (s, 3H), 1.23-1.16 (m, 12H); MS (ESI) m/z:
507.2 (M+H.sup.+).
Example 157
[0614] Using general method D,
3-tert-butyl-1-methyl-1H-pyrazole-5-carboxylic acid (0.21 g, 1.2
mmol), Example A17 (0.4 g, 1.2 mmol) were combined in presence of
triethylamine (0.35 g, 3.5 mmol) and diphenylphospharyl azide (0.48
g, 1.7 mmol) to afford
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(4-chloro-2-fluoro-5-(-
8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)pheny-
l)urea as a white solid (0.49 g, 80% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.97 (brs, 2H), 8.92 (s, 1H), 8.22 (d, J=8.4
Hz, 1H), 7.98 (s, 1H), 7.60 (d, J=11.2 Hz, 1H), 6.04 (s, 1H), 3.64
(s, 3H), 3.58 (s, 3H), 2.61 (s, 3H), 1.16 (s, 9H); MS (ESI) m/z:
530.2 (M+H.sup.+).
[0615] Using a procedure analogous to example A1,
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(4-chloro-2-fluoro-5-(8-methy-
l-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.2, 0.38 mmol) and 2 M methylamine in THF (3 eq) were combined
and purified via C-18 chromatography to provide
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(4-chloro-2-fluoro-5-(8-methy-
l-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
as a white solid (0.045 g, 23% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.95 (brs, 2H), 8.61 (s, 1H), 8.17 (d, J=8.8
Hz, 1H), 7.87 (brs, 1H), 7.75 (s, 1H), 7.55 (d, J=10.8 Hz, 1H),
6.04 (s, 1H), 3.58-3.51 (m, 6H), 2.90 (s, 3H), 1.16 (s, 9H); MS
(ESI) m/z: 513.3 (M+H.sup.+).
Example 158
[0616] Using general procedure B, the carbamate of
3-isopropyl-1-phenyl-1H-pyrazol-5-amine (0.075 g, 0.26 mmol, 1.0
eq) and Example A26 (0.082 g, 0.26 mmol, 1.0 eq) were combined to
afford slightly impure desired product. This was slurried in
MeCN/H.sub.2O, cooled thoroughly at 0-5.degree. C. and the solids
collected by filtration, rising with cold H.sub.2O. The solids were
dried under high vacuum. The free base thus obtained was dissolved
in a minimum volume of hot THF (70.degree. C.) and treated with 2%
MsOH/THF (0.82 g, 0.17 mmol, 1.00 eq) to afford
1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihy-
dro-1,6-naphthyridin-3-yl)phenyl)-3-(3-isopropyl-1-phenyl-1H-pyrazol-5-yl)-
urea mesylate (92 mg; 56% yield) as an off-white solid. .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 8.95 (brs, 1H), 8.85 (s, 1H), 8.49
(s, 1H), 7.96 (d, J=8.4 Hz, 1H), 7.78 (s, 1H), 7.56-7.48 (m, 4H),
7.44-7.40 (m, 1H), 7.15 (d, J=12.4 Hz, 1H), 6.45 (brs, 1H), 6.31
(s, 1H), 3.54 (s, 3H), 2.95 (s, 3H), 2.85 (septet, J=6.8 Hz, 1H),
2.29 (s, 3H), 2.07 (s, 3H), 1.19 (d, J=7.6 Hz, 6H); MS (ESI) m/z:
540.3 (M+H.sup.+).
Example 159
[0617] Using general procedure D,
3-(t-butyl)1-methyl-1H-pyrazole-5-carboxylic acid (0.125 g, 0.686
mmol, 1.00 eq) and Example A30 (0.210 g, 0.672 mmol, 1.10 eq) were
combined to afford desired product which was subsequently treated
with 2% MsOH/THF (0.67 g, 0.14 mmol, 1.00 eq) to afford
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(5-(1-ethyl-7-(methylamino)-2-
-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoro-4-methylphenyl)urea
mesylate (70 mg, 17% yield) as a white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.92 (s, 1H), 8.79 (brs, 1H), 8.50 (s, 1H),
7.97 (d, J=8.4 Hz, 1H), 7.78 (s, 1H), 7.18 (d, J=12.0 Hz, 1H), 6.53
(brs, 1H), 6.05 (s, 1H), 4.17 (q, J=7.2 Hz, 2H), 3.59 (s, 3H), 2.95
(s, 3H), 2.29 (s, 3H), 2.07 (s, 3H), 1.21 (t, J=7.2 Hz, 3H), 1.16
(s, 9H); MS (ESI) m/z: 506.2 (M+H.sup.+).
Example 160
[0618] Using general method A, the TROC carbamate of Example B18
(0.66 g, 1.9 mmol) and Example A42 (0.68 g, 2.09 mmol) were
combined to provide
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(8-isopropyl-2-(methylthio)-7-
-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-4-methylphenyl)urea
(440 mg, 44%) .sup.1H NMR (400 MHz, DMSO-d.sub.6) .delta. 10.3 (s,
1H), 8.88 (s, 1H)), 8.70 (brs, 1H), 7.94 (d, J=9 Hz, 1H), 7.85 (s,
1H), 7.20 (d, J=12 Hz, 1H), 6.00 (s, 1H), 5.75 (m, 1H), 2.61 (s,
3H), 2.07 (s, 3H), 1.55 (d, J=6 Hz, 6H), 1.21 (s, 9H); MS (ESI)
m/z: 525.3 (M+H.sup.+).
[0619] In a procedure analogous to Example A1,
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(8-isopropyl-2-(methylthio)-7-
-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-4-methylphenyl)urea
(0.1 g, 0.2 mmol) and methylamine were combined to provide
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(8-isopropyl-2-(methylamino)--
7-oxo-7,8-dihydrop yrido[2,3-d]pyrimidin-6-yl)-4-methylphenyl)urea
(45 mg, 50% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.78 (brs, 1H), 8.57 (brs, 1H), 7.85 (d, J=9 Hz, 1H), 7.75 (brs,
1H), 7.62 (s, 1H), 7.15 (d, J=12 Hz, 1H), 6.00 (s, 1H), 5.74 (m,
1H), 2.89 (d, J=5 Hz, 3H), 2.07 (s, 3H), 1.56 (d, J=6 Hz, 6H), 1.21
(s, 9H); MS (ESI) m/z: 508.3 (M+H.sup.+).
Example 161
[0620] Using general method D,
1-tert-butyl-1H-pyrazole-4-carboxylic acid (150 mg, 0.892 mmol) and
Example A16 (298 mg, 0.892 mmol) were combined to afford
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2,4-difluoro-5-(8-methyl-2--
(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(80 mg, 95% yield).
[0621] Using a procedure analogous to Example A1,
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2,4-difluoro-5-(8-methyl-2-(methylthi-
o)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (80 mg,
0.160 mmol) and 2.00N methylamine in THF (0.9 mL, 1.80 mmol) were
combined to afford
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2,4-difluoro-5-(8-methyl-2-(me-
thylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(31 mg, 36% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6) .delta.
1.53 (s, 9H), 2.90 (s, 3H), 3.52-3.59 (m, 3H), 7.31-7.38 (m, 2H),
7.78-7.90 (m, 3H), 8.12-8.16 (m, 1H), 8.48 (s, 1H), 8.63-8.70 (m,
1H), 8.65 (s, 1H); MS (ESI) m/z: 483.3 (M+H.sup.+).
Example 162
[0622] Using a procedure analogous to Example 141, ethyl
1-tert-butyl-5-methyl-1H-pyrazole-4-carboxylate (500 mg, 2.38
mmol), Example A3 (260 mg, 0.823 mmol) and 2.0N methylamine in THF
(2.0 mL, 3.96 mmol) were combined to afford
1-(1-tert-butyl-5-methyl-1H-pyrazol-4-yl)-3-(2-fluoro-5-(8-methyl-2-(meth-
ylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(106 mg). .sup.1H NMR (300 MHz, DMSO-d.sub.6) .delta. 1.50 (s, 9H),
2.30 (s, 3H), 2.90 (s, 3H), 3.53-3.60 (m, 3H), 7.20-7.24 (m, 2H),
7.44 (s, 1H), 7.60-7.81 (m, 1H), 7.84 (s, 1H), 8.16 (s, 1H),
8.39-8.41 (m, 1H), 8.54-8.72 (m, 1H), 8.63 (s, 1H); MS (ESI) m/z:
479.2 (M+1H).
Example 163
[0623] Using general method A, the TROC carbamate of
3-isopropyl-1-phenyl-1H-pyrazol-5-amine (0.25 g, 0.66 mmol) and
Example A10 (0.22 g, 0.66 mmol) were combined to afford
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2-
,3-d]pyrimidin-6-yl)phenyl)-3-(3-isopropyl-1-phenyl-1H-pyrazol-5-yl)urea
as an off-white solid (0.24 g, 65% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.96 (s, 1H), 8.90 (s, 1H), 8.87 (s, 1H),
7.97 (d, J=8.4 Hz, 1H), 7.87 (s, 1H), 7.55-7.48 (m, 4H), 7.43-7.39
(m, 1H), 7.16 (d, J=12.4 Hz, 1H), 6.30 (s, 1H), 3.65 (s, 3H),
2.87-2.80 (m, 1H), 2.61 (s, 3H), 2.06 (s, 3H), 1.18 (d, J=7.2 Hz,
6H); MS (ESI) m/z: 558.3 (M+H.sup.+).
[0624] Using a procedure analogous to Example A1,
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2-
,3-d]pyrimidin-6-yl)phenyl)-3-(3-isopropyl-1-phenyl-1H-pyrazol-5-yl)urea
(0.24, 0.43 mmol) and 2 M methylamine in THF (3 eq) were combined
to provide
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydr-
opyrido[2,3-d]pyrimidin-6-yl)phenyl)-3-(3-isopropyl-1-phenyl-1H-pyrazol-5--
yl)urea as a white solid (0.12 g, 52% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.90 (s, 1H), 8.82 (s, 1H), 8.68-8.60 (m,
1H), 7.92 (d, J=8.8 Hz, 1H), 7.82-7.79 (m, 1H), 7.66 (s, 1H),
7.55-7.47 (m, 4H), 7.43-7.39 (m, 1H), 7.12 (d, J=12.4 Hz, 1H), 6.30
(s, 1H), 3.59-3.52 (m, 3H), 2.91-2.80 (m, 4H), 2.05 (s, 3H), 1.18
(d, J=7.2 Hz, 6H); MS (ESI) m/z: 541.3 (M+H.sup.+).
Example 164
[0625] Using general procedure D, 5-isopropylisoxazole-3-carboxylic
acid (0.0750 g, 0.483 mmol, 1.00 eq) and Example A10 (0.192 g,
0.580 mmol, 1.20 eq) were combined to afford
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2-
,3-d]pyrimidin-6-yl)phenyl)-3-(5-isopropylisoxazol-3-yl)urea (63.5
mg, 27% yield) as an off-white solid which was used as is in the
next reaction. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.79
(s, 1H), 8.91 (s, 1H), 8.79 (brs, 1H), 7.97 (d, J=8.4 Hz, 1N), 7.90
(s, 1H), 7.20 (d, J=12.4 Hz, 1H), 6.44 (s, 1H), 3.65 (s, 3H), 2.99
(septet, J=7.2 Hz, 1H), 2.62 (s, 3H), 2.08 (s, 3H), 1.20 (d, J=6.8
Hz, 6H); MS (ESI) m/z: 483.3 (M+H.sup.+).
[0626] Following a procedure analogous to Example A1,
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2-
,3-d]pyrimnidin-6-yl)phenyl)-3-(5-isopropylisoxazol-3-yl)urea
(0.0635 g, 0.13 mmol) and 2.0M MeNH/JTHF (0.66 ml, 1.3 mmol) were
combined to afford
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-(5-isopropylisoxazol-3-yl)urea (38
mg, 62% yield) as a pale yellow solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.77 (s, 1H), 8.75 (brs, 1N), 8.60 (s, 1H),
7.92 (d, J=8.4 Hz, 1H), 7.80 (brq, J=4.4 Hz, 1H), 7.68 (s, 1H),
7.16 (d, J=12.4 Hz, 1H), 6.45 (s, 1H), 3.60 (s, 3H), 2.99 (septet,
J=6.8 Hz, 1H), 2.90 (brd, J=4.4 Hz, 3H), 2.07 (s, 3H), 1.20 (d,
J=6.8 Hz, 6H); MS (ESI) m/z: 466.2 (M+H.sup.+).
Example 165
[0627] Using general procedure D, 5-isopropylisoxazole-3-carboxylic
acid (0.0750 g, 0.483 mmol, 1.00 eq) and Example A17 (0.203 g,
0.580 mmol, 1.20 eq) were combined to afford
1-(4-chloro-2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2-
,3-d]pyrimidin-6-yl)phenyl)-3-(5-isopropylisoxazol-3-yl)urea (0.113
g, 47% yield) as an off-white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): f 9.87 (s, 1H), 8.97 (brs, 1H), 8.93 (s, 1H), 8.20
(d, J=8.8 Hz, 1H), 8.00 (s, 1H), 7.63 (d, J=10.8 Hz, 1H), 6.54 (s,
1H), 3.65 (s, 3H), 3.00 (septet, J=6.8 Hz, 1H), 2.62 (s, 3H), 1.20
(d, J=7.2 Hz, 6H); MS (ESI) m/z: 503.0 (M+H.sup.+), 505.0
(M+2+H.sup.+).
[0628] Using a procedure analogous to Example A1,
1-(4-chloro-2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2-
,3-d]pyrimidin-6-yl)phenyl)-3-(5-isopropylisoxazol-3-yl)urea (0.113
g, 0.225 mmol) and 2.0M MeNH.sub.2/THF (1.12 ml, 2.25 mmol) were
combined to afford
1-(4-chloro-2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydro-
pyrido[2,3-d]pyrimidin-6-yl)phenyl)-3-(5-isopropylisoxazol-3-yl)urea
(52 mg, 48% yield) as a faintly yellow solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.85 (s, 1H), 8.94 (brs, 1H), 8.62 (s, 1H),
8.15 (d, J=8.8 Hz, 1H), 7.88 (brq, J=4.8 Hz, 1H), 7.77 (s, 1H),
7.58 (d, J=10.8 Hz, 1H), 6.46 (s, 1H), 3.59 (s, 3H), 3.00 (septet,
J=6.8 Hz, 1H), 2.91 (d, J=4.8 Hz, 3H), 1.20 (d, J=6.8 Hz, 6H); MS
(ESI) m/z: 486.2 (M+H), 488.3 (M+2+H.sup.+).
Example 166
[0629] Using general method A, the TROC carbamate of Example B18
(0.066 g, 0.21 mmol) and Example A43 (0.076 g, 0.20 mmol) were
combined to afford
1-(3-tert-butylisoxazol-5-yl)-3-(5-(2-(3-(dimethylamino)propylamino)-8-me-
thyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-methylphenyl-
)urea (0.022 g, 20% yield) as an off white solid. .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 10.3 (s, 1H), 9.21 (m, 1H), 8.68-8.64
(min, 2H), 7.98 (m, 1H), 7.90 (d, J=8.4 Hz, 1H), 7.70 (s, 1H), 7.18
(d, J=12.4 Hz, 1H), 6.00 (s, 1H), 3.63-3.51 (m, 3H), 3.44 (q, J=6.8
Hz, 2H), 3.14-2.98 (m, 2H), 2.77 (s, 6H), 2.28 (s, 3H), 2.08 (s,
3H), 1.99-1.86 (m, 2H), 1.21 (s, 9H); MS (ESI) m/z: 551.2
(M+H.sup.+).
Example 167
[0630] Example A11 (0.125 g, 0.394 mmol, 1.00 eq) and aniline
(0.108 ml, 1.18 mmol, 3.00 eq) were combined in NMP (4 ml) and
heated in a microwave for 7 h at 220.degree. C. The roughly
half-complete reaction was diluted with HzO (40 ml) and extracted
with EtOAc (3.times.20 ml). The combined organics were washed with
H.sub.2O (2.times.), brine (1.times.), dried (MgSO.sub.4),
concentrated in vacuo and purified by flash column chromatography
(50:50 EtOAc/hexanes-100% EtOAc) to afford
3-(5-amino-4-fluoro-2-methylphenyl)-1-methyl-7-(phenylamino)-1,6-naphthyr-
idin-2(1H)-one (51 mg, 17% yield) as an off-white solid. .sup.1H
NMR (400 MHz, DMSO-d.sub.6): .delta. 9.40 (s, 1H), 8.52, s, 1H),
7.70-7.64 (m, 3H), 7.31-7.27 (an, 2H), 6.95-6.93 (m, 1H), 6.86 (d,
J=12.0 Hz, 1H), 6.68 (s, 1H), 6.59 (d, J=9.2 Hz, 1H), 4.91 (brs,
2H), 3.52 (s, 3H), 1.96 (s, 3H); MS (ESI) m/z: 375.2
(M+H.sup.+).
[0631] Using general procedure A, the TROC carbamate of Example B18
(0.0431 g, 0.136 mmol) and
3-(5-amino-4-fluoro-2-methylphenyl)-1-methyl-7-(phenylamino)-1,6-naphthyr-
idin-2(1H)-one (0.0511 g, 0.136 mmol) were combined to afford
desired product. The free base thus obtained was converted to the
meslyate salt,
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-4-methyl-5-(1-methyl-2-oxo-7-(p-
henylamino)-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea mesylate
(19 mg, 21% yield) as an off-white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 10.30 (s, 1H), 9.55 (s, 1H), 8.69 (brs, 1H),
8.56 (s, 1H), 7.92 (d, J=8.4 Hz, 1H), 7.79 (s, 1H), 7.63 (dd, J=1.2
and 8.4 Hz, 2H), 7.34-7.29 (m, 2H), 7.19 (d, J=12.4 Hz, 1H), 6.98
9dd, J=7.2 and 13.6 Hz, 1H), 6.71 (s, 1H), 6.01 (s, 1H), 3.54 (s,
3H), 2.30 (s, 3H), 2.10 (s, 3H), 1.21 (s, 9H); MS (ESI) m/z: 541.3
(M+H.sup.+).
Example 168
[0632] Example A11 (0.250 g, 0.787 mmol, 1.00 eq), phenylboronic
acid (0.115 g, 0.944 mmol, 1.20 eq) and 2M K.sub.2CO.sub.3 (1.06
ml, 2.12 mmol, 2.70 eq) were combined in DME (0.90 ml) and degassed
with Ar. Pd(PPh.sub.3).sub.4 (0.0455 g, 0.0393 mmol, 0.05 eq) was
then added and the mixture was stirred with heating at 90.degree.
C. After 16 h, the completed reaction cooled to RT, diluted
generously with EtOAc and filtered on Celite, rinsing forward with
more EtOAc. The combined filtrates were washed with brine
(2.times.), dried (MgSO.sub.4), filtered and evaporated to a dark
orange solid. This was triturated with cold EtOAc. The solid
product was collected by filtration, rinsed sparingly with ice-cold
EtOAc and dried on the filter to afford desired product (0.112 g,
40% yield) as a gold-colored solid which was used as is in the next
reaction. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.96 (s,
1H), 8.26-8.23 (m, 2H), 7.93-7.91 (m, 2H), 7.55-7.45 (m, 3H), 6.89
(d, J=12.4 Hz, 1H), 6.63 (d, J=9.6 Hz, 1H), 4.96 (brs, 2H), 3.75
(s, 3H), 1.98 (s, 3H); MS (ESI) m/z: 360.0 (M+H.sup.+).
[0633] Using general procedure A, the TROC carbamate of Example B
18 (0.100 g, 0.317 mmol, 1.00 eq) and
3-(5-amino-4-fluoro-2-methylphenyl)-1-methyl-7-phenyl-1,6-naphthyridin-2(-
1H)-one (0.114 g, 0.317 mmol, 1.00 eq) were combined to afford
desired product. The free base thus obtained was converted to the
mesylate salt,
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-4-methyl-5-(1-methyl-2-oxo-7-ph-
enyl-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea mesylate (53 mg,
27% yield) as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 10.32 (s, 1H), 9.04 (s, 1H), 8.72 (brs, 1H), 8.26-8.23 (m,
2H), 8.03-7.96 (m, 3H), 7.58-7.49 (m, 3H), 7.23 (d, J=12.0 Hz, 1H),
6.01 (s, 1H), 3.78 (s, 3H), 2.29 (s, 3H), 2.12 (s, 3H), 1.21 (s,
9H); MS (ESI) m/z: 526.2 (M+H.sup.+).
Example 169
[0634] Using general method D,
3-tert-butyl-1-methyl-1H-pyrazole-5-carboxylic acid (0.051 g, 0.28
mmol) and Example A51 (0.096 g, 0.28 mmol) were combined in
presence of triethylamine (0.085 g, 0.84 mmol) and
diphenylphospharyl azide (0.12 g, 0.42 mmol) to afford
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(2-fluoro-5-(8-isopropyl-2-(m-
ethylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-4-methylphenyl)u-
rea as white solid (0.095 g, 65% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.87 (s, 1H), 8.73 (s, 1H), 8.57 (s, 1H),
7.92 (d, J=8.4 Hz, 1H), 7.76-7.73 (m, 1H), 7.60 (s, 1H), 7.14 (d,
J=12.4 Hz, 1H), 6.04 (s, 1H), 5.74 (brs, 1H), 3.58 (s, 3H), 2.88
(d, J=4.4 Hz, 3H), 2.05 (s, 3H), 1.57-1.49 (m, 6H), 1.16 (s, 9H);
MS (ESI) m/z: 521.3 (M+H.sup.+).
Example 170
[0635] Using general method D, Example B30 (0.041 g, 0.24 mmol) and
Example A51 (0.083 g, 0.24 mmol) were combined in presence of
triethylamine (0.074 g, 0.73 mmol) and diphenylphospharyl azide
(0.1 g, 0.37 mmol) to afford
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-5-(8-isopropyl-2-(methylamin-
o)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-4-methylphenyl)urea
as a white solid (0.055 g, 45% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.59 (s, 1H), 8.52 (s, 1H), 8.36 (s, 1H),
7.88 (d, J=8.0 Hz, 1H), 7.73 (s, 1H), 7.71-7.68 (m, 1H), 7.55 (s,
1H), 7.34 (s, 1H), 7.05 (d, J=12.4 Hz, 1H), 5.69-5.66 (m, 1H), 2.84
(d, J=4.4 Hz, 3H), 1.99 (s, 3H), 1.52-1.51 (m, 6H), 1.40 (s, 9H);
MS (ESI) m/z: 507.2 (M+H.sup.+).
Example 171
[0636] Using general procedure B, the carbamate of Example B21
(0.100 g, 0.321 mmol, 1.00 eq) and Example A44 (0.100 g, 0.321
mmol, 1.00 eq) were combined to afford
1-(4-methyl-3-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyri-
midin-6-yl)phenyl)-3-(1-phenyl-3-(trifluoromethyl)-1H-pyrazol-5-yl)urea
(0.1231 g, 68% yield) as a pale yellow solid which was used as is
in the next reaction. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
9.12 (s, 1H), 8.91 (s, 1H), 8.72 (s, 1H), 7.89 (s, 1H), 7.65-7.55
(m, 5H), 7.38 (brs, 1H), 7.25 (brd, J=8.8 Hz, 1H), 7.18 (d, J=8.4
Hz, 1H), 6.86 (s, 1H), 3.67 (s, 3H), 2.63 (s, 3H), 2.08 (s, 3H); MS
(ESI) m/z: 566.2 (M+H.sup.+).
[0637] Using a procedure analogous to example A1,
1-(4-methyl-3-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyri-
midin-6-yl)phenyl)-3-(1-phenyl-3-(trifluoromethyl)-1H-pyrazol-5-yl)urea
(0.1231 g, 0.218 mmol) and 2.0M MeNH.sub.2/THF (1.088 ml, 2.177
mmol) were combined to afford
1-(4-methyl-3-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyr-
imidin-6-yl)phenyl)-3-(1-phenyl-3-(trifluoromethyl)-1H-pyrazol-5-yl)urea
(93 mg, 78% yield) as a white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.08 (s, 1H), 8.69 (s, 1H), 8.59 (s, 1H),
7.81 (brq, J=4.4 Hz, 1H), 7.66 (s, 1H), 7.63-7.52 (m, 5H), 7.30 (d,
J=2.0 Hz, 1H) 7.21 (dd, J=2.0 and 8.4 Hz, 1H), 7.13 (d, J=8.4 Hz,
1H), 6.85 (s, 1H), 3.59 (s, 3H), 2.90 (brd, J=4.8 Hz, 3H), 2.05 (s,
3H); MS (ESI) m/z: 549.3 (M+H.sup.+).
Example 172
[0638] Using general method C, the TROC carbamate of Example B18
(150 mg, 0.475 mmol) and Example A27 (142 mg, 0.475 mmol) were
combined to provide
1-(5-(7-amino-1-methyl-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoro--
4-methylphenyl)-3-(3-tert-butylisoxazol-5-yl)urea (105 mg, 48%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.31 (s, 1H),
8.67 (s, 1H), 8.33 (s, 1H), 7.88 (d, J=8.5 Hz, 1H), 7.66 (s, 1H),
7.16 (d, J=12.3 Hz, 1H), 6.54 (s, 2H), 6.26 (s, 1H), 6.01 (s, 1H),
3.47 (s, 3H), 2.08 (s, 3H), 1.21 (s, 9H); MS (ESI) m/z: 465.2
(M+H.sup.+).
Example 173
[0639] Using general method D, Example B30 (150 mg, 0.892 mmol),
triethylamine (104 mg, 1.03 mmol) and Example A17 (313 mg, 0.892
mmol) were combined to afford
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(4-chloro-2-fluoro-5-(8-methyl-2-(meth-
ylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(143 mg, 31% yield). Using a procedure analogous to Example A1,
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(4-chloro-2-fluoro-5-(8-methyl-2-(meth-
ylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(143 mg, 0.277 mmol) and 2.0N were combined and purified by reverse
phase chromatography (Biotage C18-25 column, 0-100%
acetonitrile/water--750 mL), treated with 10% potassium carbonate
solution (2 mL) and set aside to precipitate. The solid was
collected by filtration, washed with water (2.times.5 mL) and dried
on high vacuum line to give
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(4-chloro-2-fluoro-5-(8-methyl-2-(meth-
ylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(59 mg, 42% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
1.45 (s, 9H), 2.90 (s, 3H), 3.51-3.59 (m, 3H), 7.38 (s, 1H), 7.52
(d, J=10.9 Hz, 1H), 7.75 (s, 1H), 7.78 (s, 1H), 7.86 (br s, 1H),
8.20 (d, J=8.9 Hz, 1H), 8.62-8.69 (m, 2H), 8.70-8.72 (m, 1H); MS
(ESI) m/z: 499.2 (M+H.sup.+).
Example 174
[0640] Using general method D, Example B30 (0.041 g, 0.24 mmol) and
Example A26 (0.076 g, 0.24 mmol) in presence of triethylamine
(0.074 g, 0.75 mmol) and diphenylphospharyl azide (0.1 g, 0.37
mmol) were combined to afford
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-5-(1-meth-
yl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea
as a white solid (0.055 g, 47% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.63 (s, 1H), 8.38 (s, 2H), 7.94 (d, J=8.8
Hz, 1H), 7.78 (s, 1H), 7.65 (s, 1H), 7.36 (s, 1H), 7.10 (d, J=12.4
Hz, 1H), 7.04-7.00 (m, 1H), 6.17 (s, 1H), 3.50 (s, 3H), 2.85 (d,
J=4.8 Hz, 3H), 2.05 (s, 3H), 1.45 (s, 9H); MS (ESI) m/z: 478.3
(M+H.sup.+).
Example 175
[0641] Using general method D, Example B30 (0.027 g, 0.161 mmol)
and Example A53 (0.0925 g, 0.24 mmol) were combined to afford
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(5-(7-(3-(dimethylamino)propylamino)-1-
-methyl-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoro-4-methylphenyl)u-
rea (0.029 g, 33% yield). It was converted to corresponding
bis-mesylate salt by reacting with MsOH (2.0 eq.). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 8.49 (s, 1H), 8.00 (d, J=8.4 Hz, 1H),
7.76 (s, 2H), 7.38 (s, 1H), 7.33 (t, J=8.4 Hz, 1H), 7.17-7.10 (m,
1H), 6.46 (s, 1H), 3.53 (s, 3H), 3.43 (m, 2H), 3.18-3.09 (m, 2H),
2.79 (s, 6H), 2.35 (s, 6H), 2.06 (s, 3H), 1.96-1.89 (m, 2H), 1.45
(s, 9H); MS (ESI) m/z: 549.3 (M+H.sup.+).
Example 176
[0642] Using general method C, the TROC carbamate of Example B18
(0.66 g, 1.9 mmol) and Example A42 (0.68 g, 2.09 mmol) were
combined to provide
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(8-isopropyl-2-(methylthio)-7-
-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-4-methylphenyl)urea
(0.44 g, 44% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta.10.3 (s, 1H), 8.88 (s, 1H), 8.70 (brs, 1H), 7.94 (d, J=9 Hz,
1H), 7.85 (s, 1H), 7.20 (d, J=12 Hz, 1H), 6.00 (s, 1H), 5.75 (m,
1H), 2.61 (s, 3H), 2.07 (s, 3H), 1.55 (d, J=6 Hz, 6H), 1.21 (s,
9H); MS (ESI) m/z: 525.3 (M+H.sup.+).
[0643] Using a procedure analogous to Example A1, oxidation of the
intermediate sulfide with MCPBA, followed by reaction with excess
(S)-alaminolprovided
(S)-1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(2-(1-hydroxypropan-2-yla-
mino)-8-isopmpyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-4-methylphe-
nyl)urea (33% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): 8.75 (s,
1H), 8.58 (s, 1H), 7.86 (d, J=9 Hz, 1H), 7.61 (s, 1H), 7.55 (m,
1H), 7.15 (d, J=12 Hz, 1H), 6.00 (s, 1H), 5.71 (brs, 1H), 4.75
(brs, 1H), 4.03 (m, 1H), 3.50 (m, 1H), 3.35 (m, 1H), 2.07 (s, 3H),
1.55 (d, J=6 Hz, 6H), 1.21 (s, 9H), 1.16 (d, J=6 Hz, 3H); MS (ESI)
m/z: 525.3 (M+H.sup.+).
Example 177
[0644] Using general method B, the carbamate of Example B2 (120 mg,
0.506 mmol) and Example A28 (168 mg, 0.506 mmol) were combined to
afford
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(4-chloro-2-fluoro-5-(1-methy-
l-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea
(128 mg, 49% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
1.16 (s, 9H), 2.85 (s, 3H), 3.49 (s, 3H), 3.56 (s, 3H), 6.05 (s,
1H), 6.16 (s, 1H), 7.09-7.11 (m, 1H), 7.53-7.56 (m, 1H), 7.72 (s,
1H), 8.15-8.17 (m, 1H), 8.39 (s, 1H), 8.93-8.94 (m, 2H); MS (ESI)
m/z: 512.3 (M+H.sup.+).
Example 178
[0645] Using general method C, the TROC carbamate of Example B18
(0.080 g, 0.25 mmol) and Example A28 (85 mg, 0.25 mmol) were
combined to afford
1-(3-tert-butylisoxazol-5-yl)-3-(4-chloro-2-fluoro-5-(1-methyl-7-(methyla-
mino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea (0.050 g,
40% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.4 (s,
1H), 8.86 (brs, 1H), 8.40 (s, 1H), 8.12 (d, J=8.4 Hz, 1H), 7.75 (s,
1H), 7.58 (d, J=10.4 Hz, 1H), 7.11 (q, J=4.8 Hz, 1H), 6.17 (s, 1H),
6.03 (s, 1H), 3.50 (s, 3H), 2.86 (d, J=4.8 Hz, 3H), 1.21 (s, 3H);
MS (ESI) m/z: 499.2 (M+H.sup.+).
Example 179
[0646] Using general method B, the carbamate of
5-t-butylisoxazol-3-amine (70 mg, 0.31 mmol) and Example A29 (99
mg, 0.31 mmol) were combined to afford
1-(5-tert-butylisoxazol-3-yl)-3-(4-chloro-5-(1-ethyl-7-(methylamin-
o)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)urea
(0.15 g, 100% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
9.91 (brs, 1H), 8.89 (brs, 1H), 8.42 (s, 1H), 8.11 (m, 1H), 7.83
(s, 1H), 7.38 (dd, J=9.6, and 10.8 Hz, 1H), 7.13 (q, J=4.8 Hz, 1H),
6.46 (s, 1H), 6.17 (brs, 1H), 3.50 (s, 3H), 2.85 (d, J=4.8 Hz, 3H),
1.26 (s, 9H); MS (ESI) m/z: 483.3 (M+H.sup.+).
Example 180
[0647] Using general method D, 1-methyl-1H-pyrazole-5-carboxylic
acid (150 mg, 1.19 mmol) and Example A3 (376 mg, 1.19 mmol) were
converted to the intermediate
1-(2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyri-
midin-6-yl)phenyl)-3-(1-methyl-1H-pyrazol-5-yl)urea (487 mg, 93%
yield). This was then further converted using a procedure analogous
to Example A1 with 2.0N methylamine in THF (5.5 mL, 11.1 mmol) to
afford
1-(2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyr-
imidin-6-yl)phenyl)-3-(1-methyl-1H-pyrazol-5-yl)urea (48 mg, 9%
yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 2.93 (s, 3 H),
3.59 (m, 3H), 3.74 (s, 3H), 6.27 (s, 1H), 7.27-7.30 (m, 2H), 7.41
(s, 1H), 7.92 (s, 1H), 8.20 (br s, 1H), 8.36-8.38 (m, 1H), 8.75 (s,
1H), 9.20 (s, 1H), 9.73 (s, 1H); MS (ESI) m/z: 423.3
(M+H.sup.+).
Example 181
[0648] Using general method D, Example B32 (150 mg, 0.585 mmol) and
Example A57 (165 mg, 0.585 mmol) were combined and purified by
chromatography (Biotage Si-25 column, 50-100% ethyl acetate) to
give
1-(2-tert-butyl-4-phenylpyrimidin-5-yl)-3-(3-(8-methyl-2-(methylamino)-7--
oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea as an off
white foam (81 mg, 25% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 1.37 (s, 9H), 2.90 (s, 3H), 3.52-3.59 (m, 3H), 7.21-7.31
(m, 2H), 7.43-7.57 (m, 4H), 7.70-7.88 (m, 5H), 8.11 (s, 1H),
8.62-8.70 (m, 1H), 9.07 (s, 1H), 9.19 (s, 1H); MS (ESI) m/z: 535.2
(M+H.sup.+).
Example 182
[0649] Using general method G, Example B32 (150 mg, 0.585 mmol) and
Example A10 (193 mg, 0.585 mmol) were combined to give the
intermediate sulfide (224 mg, 65% yield). Using a procedure
analogous to Example A1, The sulfide and 2.0N methylamine in THF
(1.917 ml, 3.83 mmol) were combined to afford
1-(2-tert-butyl-4-phenylpyrimidin-5-yl)-3-(2-fluoro-4-methyl-5-(8-methyl--
2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(150 mg, 69% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
1.35 (s, 9H), 2.05 (s, 3H), 2.90 (s, 3 H), 3.52-3.59 (m, 3H), 7.11
(d, J=12.4 Hz, 1H), 7.51-7.91 (m, 8H), 8.54 (s, 1H), 8.59-8.64 (m,
1H), 8.93 (s, 1H), 9.02 (s, 1H); MS (ESI) m/z: 567.3
(M+H.sup.+).
Example 183
[0650] Using general method D, Example B32 (61 mg, 0.237 mmol) and
Example A26 (74 mg, 0.237 mmol) were combined to afford
1-(2-tert-butyl-4-phenylpyrimidin-5-yl)-3-(2-fluoro-4-methyl-5-(1-methyl--
7-(methylamino)-2-oxo-,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea
(69 mg, 51% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
1.35 (s, 9H), 2.05 (s, 3 H), 2.84 (s, 3H), 3.49 (s, 3H), 6.16 (s,
1H), 7.03-7.04 (m, 1H), 7.09-7.12 (m, 1H), 7.51-7.57 (inm, 3H),
7.64 (s, 1H), 7.71-7.74 (m, 2H), 7.89 (d, J=8.5 Hz, 1H), 8.38 (s,
1H), 8.53 (s, 1H), 8.92 (s, 1H), 9.02 (s, 1H); MS (ESI) m/z: 566.2
(M+Na).
Example 184
[0651] Using general method F, Example A39 (0.100 g, 0.319 mmol)
was reacted with 1-isocyanatonaphthalene (0.054 g, 0.319 mmol) in
ethyl acetate at room temperature for 14 hours to provide
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-(naphthalen-1-yl)urea (0.052 g, 33%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .quadrature. 9.12 (s,
1H), 9.00 (brs, 1H), 8.60 (s, 1H), 8.15 (d, J=8 Hz, 1H), 8.03 (d,
J=9 Hz, 1H), 8.00 (d, J=8 Hz, 1H), 7.91 (d, J=9 Hz, 1H), 7.80 (m,
1H), 7.69 (s, 1H), 7.63-7.4 (m, 4H), 7.16 (d, J=12 Hz, 1H), 5.75
(s, 1H), 3.60 (brs, 3H), 2.90 (d, J=5 Hz, 3H), 2.08 (s, 3H); MS
(ESI) m/z: 483.3 (M+1H).
Example 185
[0652] Using a procedure analogous to Example 186,
(R)-1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(2-(1-hydroxy-3-methylbut-
an-2-ylamino)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-4-met-
hylphenyl)urea was prepared from the carbamate of B18, Example A10
and R(-)-2-amino-3-methyl-1-butanol. .sup.1H NMR (400 Miz,
DMSO-d.sub.6): .delta. 8.67 (s, 1H), 8.61 (m, 1H), 7.88 (d, J=9 Hz,
1H), 7.64 (m, 1H), 7.57 (d, J=9 Hz, 1H), 7.16 (d, J=12 Hz, 1H),
6.10 (s, 1H), 4.59 (m, 1H), 3.97 (m, 1H), 3.56 (s, 3H), 3.52 (m,
2H), 2.08 (s, 3H), 1.98 (m, 1H), 1.22 (s, 9H), 0.91 (m. 6H); MS
(ESI) m/z: 552.2 (M+H.sup.+).
Example 186
[0653] Using general method C, the TROC carbamate of Example B18
(0.5 g, 1.58 mmol) and Example A10 (0.52 g, 1.58 mmol) were
combined to provide
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(methylt-
hio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.44
g, 56% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.10.3
(brs, 1H), 8.9 (s, 1H), 8.70 (brs, 1H), 7.94 (d, J=9 Hz, 1H), 7.88
(s, 1H), 7.20 (d, J=12 Hz, 1H), 6.00 (s, 1H), 3.64 (s, 3H), 2.61
(s, 3H), 2.07 (s, 3H), 1.21 (s, 9H); LC-MS (ES, m/z, M+H)
497.2.
[0654] Using a procedure analogius to Example A1, the sulfide was
oxidatized with MCPBA and subjected to excess
S(+)-2-amino-3-methyl-1-butanol to provide
(S)-1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(2-(1-hydroxy-3-methylbut-
an-2-ylamino)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-4-met-
hylphenyl)urea (47% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 8.67 (s, 1H), 8.61 (m, 1H), 7.88 (d, J=9 Hz, 1H), 7.64 (m,
1H), 7.57 (d, J=9 Hz, 1H), 7.16 (d, J=12 Hz, 1H), 6.10 (s, 1H),
4.59 (m, 1H), 3.97 (m, 1H), 3.56 (s, 3H), 3.52 (m, 2H), 2.08 (s,
3H), 1.98 (m, 1H), 1.22 (s, 9H), 0.91 (m. 6H); MS (ESI) m/z: 552.2
(M+H.sup.+).
Example 187
[0655] Using general method C, the TROC carbamate of Example B18
(0.091 g, 0.29 mmol) and Example A33 (0.1 g, 0.29 mmol) were
combined to afford
1-(3-tert-butylisoxazol-5-yl)-3-(4-chloro-5-(1-ethyl-7-(methylamino)-2-ox-
o-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)urea as a white
solid (0.051 g, 35% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 8.56 (s, 1H), 8.41 (s, 1H), 8.11 (d, J=8.8 Hz, 1H), 7.74
(s, 1H), 7.57 (d, J=10.8 Hz, 1H), 7.07-7.04 (m, 1H), 6.23 (s, 1H),
6.02 (s, 1H), 4.13 (q, J=7.2 Hz, 1H), 2.86 (d, J=4.8 Hz, 3H),
1.21-1.17 (m, 12H); MS (ESI) m/z: 513.3 (M+H.sup.+).
Example 188
[0656] Using general method C, the TROC carbamate of Example B18
(0.091 g, 0.29 mmol) and Example A31 (0.09 g, 0.28 mmol) were
combined to afford
1-(5-(7-amino-1-ethyl-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoro-4-
-methylphenyl)-3-(3-tert-butylisoxazol-5-yl)urea as a white solid
(0.12 g, 87% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
10.3 (s, 1H), 8.66 (s, 1H), 8.34 (s, 1H), 7.87 (d, J=8.4 Hz, 1H),
7.65 (s, 1H), 7.16 (d, J=12.0 Hz, 1H), 6.49 (s, 1H), 6.33 (s, 1H),
6.01 (s, 1H), 4.09 (q, J=7.2 Hz, 1H), 2.07 (s, 3H), 1.21-1.18 (m,
12H); MS (ESI) m/z: 479.2 (M+H.sup.+).
Example 189
[0657] Using general method B, the carbamate of
5-t-butylisoxazol-3-amine (70 mg, 0.31 mmol) and Example A47 (108
mg, 0.31 mmol) were combined to afford
1-(5-tert-butylisoxazol-3-yl)-3-(4-ethyl-2-fluoro-5-(8-methyl-2-(m-
ethylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.085 g, 53% yield). MS (ESI) m/z: 511.2 (M+H.sup.+).
[0658] Using a procedure analogous to Example A1,
1-(5-tert-butylisoxazol-3-yl)-3-(4-ethyl-2-fluoro-5-(8-methyl-2-(methylth-
io)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.085
g, 0.17 mmol) was treated with mCPBA (70% wt, 0.049 g, 0.20 mmol)
and then N-methylamine (2.0M in THF, 0.34 mL, 0.67 mmol) to afford
1-(5-tert-butylisoxazol-3-yl)-3-(4-ethyl-2-fluoro-5-(8-methyl-2-(methylam-
ino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (72
mg, 88% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major rotomer):
.delta. 9.79 (s, 1H), 8.76 (brs, 1H), 8.60 (s, 1H), 7.88 (d, J=8.4
Hz, 1H), 7.81 (q, J=4.4 Hz, 1H), 7.67 (s, 1H), 7.18 (d, J=12.4 Hz,
1H), 6.43 (s, 1H), 3.59 (s, 3H), 2.91 (d, J=4.4 Hz, 3H), 2.38 (q,
J=7.6 Hz, 2H), 1.25 (s, 9H), 1.02 (t, J=7.6 Hz, 3H); MS (ESI) m/z:
494.0 (M+H.sup.+).
Example 190
[0659] Using general method C, the TROC carbamate of Example B18
(212 mg, 0.672 mmol) and Example A44 (150 mg, 0.480 mmol) were
combined and purified by reverse phase chromatography (Biotage
Si-25 column, 25-85% ethyl acetate/Hex) to give the intermediate
sulfide
1-(3-tert-butylisoxazol-5-yl)-3-(4-methyl-3-(8-methyl-2-(methylthio)-7-ox-
o-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (68 mg, 29%
yield).
[0660] Using a procedure analogous to Example A1,
1-(3-tert-butylisoxazol-5-yl)-3-(4-methyl-3-(8-methyl-2-(methylthio)-7-ox-
o-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (56 mg, 0.117
emnol) and 2.0N methylamine in THF (0.71 mL, 1.421 mmol) were
combined to afford
1-(3-tert-butylisoxazol-5-yl)-3-(4-methyl-3-(8-methyl-2-(methylamino)-7-o-
xo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (29 mg, 44%
yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6), .delta. 1.46 (s, 9H),
2.04 (s, 3H), 2.89 (s, 3H), 3.52-3.60 (m, 3H), 5.74 (s, 1H),
7.08-7.10 (m, 1H), 7.22-7.25 (m, 1H), 7.33-7.36 (m, 2H), 7.65 (s,
1H), 7.78 (s, 1H), 7.68-7.82 (m, 1H), 8.25 (s, 1H), 8.53 (s, 1H),
8.60-8.65 (m, 1H); MS (ESI) m/z: 462.3 (M+H.sup.+).
Example 191
[0661] Using general method D, Example B30 (150 mg, 0.585 mmol) and
Example A44 (165 nmg, 0.585 mmol) were combined to give the
intermediate sulfide,
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(4-methyl-3-(8-methyl-2-(meth-
ylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(56 mg, 24% yield). Using a procedure analogous to Example A1, the
sulfide (56 mg, 0.117 mmol) was combined with 2.0N methylamine in
THF (0.59 mL, 1.173 rmnunol) to afford the desired product,
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(4-methyl-3-(8-methyl-2-(methylamino)--
7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (43 mg,
80% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6), .delta. 1.22 (s,
9H), 2.06 (s, 3H), 2.90 (s, 3H), 3.53-3.60 (m, 3H), 6.01 (s, 1H),
7.14-7.16 (d, 1H), 7.27-7.29 (d, 1H), 7.34 (s, 1H), 7.67 (s, 1H),
7.68-7.81 (m, 1 H), 8.60-8.65 (m, 1H), 8.74 (s, 1H), 10.06 (s, 1H);
MS (ESI) m/z: 461.2 (M+H.sup.+).
Example 192
[0662] Using general method F, 1-isocyanato-3-methylbenzene (42 mg,
0.32 mmol) and Example A39 (100 mg, 0.32 mmol) in presence of
pyridine (52 .mu.L, 0.64 mmol) were combined to afford
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-m-tolylurea (91 mg, 64% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6, major rotomer): .delta. 8.94
(s, 1H), 8.61 (s, 1H), 8.47 (d, J=2.0 Hz, 1H), 7.96 (d, J=8.8 Hz,
1H), 7.81 (q, J=4.8 Hz, 1H), 7.68 (s, 1H), 7.28 (brs, 1H), 7.14 (m,
2H), 6.77 (d, J=7.2 Hz, 1H), 3.60 (s, 3H), 2.91 (d, J=4.8 Hz, 3H),
2.24 (s, 3H), 2.06 (s, 3H); MS (ESI) m/z: 447.0 (M+H.sup.+).
Example 193
[0663] Using general method F, 1-chloro-3-isocyanatobenzene (49 mg,
0.32 mmol) and Example A39 (100 mg, 0.32 mmol) in presence of
pyridine (52 .mu.L, 0.64 mmol) were combined to afford
1-(3-chlorophenyl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-
-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (123 mg, 83%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major rotomer): .delta.
9.20 (s, 1H), 8.61 (s, 1H), 8.55 (d, J=1.6 Hz, 1H), 7.91 (d, J=8.4
Hz, 1H), 7.81 (q, J=4.4 Hz, 1H), 7.71 (t, J=2.0 Hz, 1H), 7.68 (s,
1H), 7.28 (t, J=8.0 Hz, 1H), 7.17 (m, 2H), 7.00 (m, 1H), 3.60 (s,
3H), 2.91 (d, J=4.4 Hz, 3H), 2.07 (s, 3H); MS (ESI) m/z: 467.0
(M+H.sup.+).
Example 194
[0664] Using general method F, 1-bromo-3-isocyanatobenzene (63 mg,
0.32 mmol) and Example A39 (100 mg, 0.32 mmol) in presence of
pyridine (52 .mu.L, 0.64 mmol) were combined to afford
1-(3-bromophenyl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo--
7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (115 mg, 71%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major rotomer): F 9.19
(s, 1H), 8.61 (s, 1H), 8.55 (d, J=2.0 Hz, 1H), 7.91 (d, J=8.8 Hz,
1H), 7.86 (m, 1H), 7.81 (q, J=4.4 Hz, 1H), 7.68 (s, 1H), 7.1-7.3
(m, 4H), 3.60 (s, 3H), 2.91 (d, J=4.4 Hz, 3H), 2.07 (s, 3H); MS
(ESI) m/z: 511.0 (M+H.sup.+).
Example 195
[0665] Using general method F, 1-fluoro-3-isocyanatobenzene (44 mg,
0.32 mmol) and Example A39 (100 mg, 0.32 mmol) in the presence of
pyridine (52 .mu.L, 0.64 mmol) were combined to afford
1-(3-fluorophenyl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-
-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (92 mg, 64%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major rotomer): .delta.
9.23 (s, 1H), 8.61 (s, 1H), 8.55 (d, J=2.0 Hz, 1H), 7.91 (d, J=8.4
Hz, 1H), 7.81 (q, J=4.4 Hz, 1H), 7.68 (s, 1H), 7.46 (dt, J=2.0, and
11.6 Hz, 1H), 7.28 (m, 1H), 7.15 (d, J=12.4 Hz, 1H), 7.04 (m, 1H),
6.77 (dt, J=2.4, and 8.4 Hz, 1H), 3.60 (s, 3H), 2.91 (d, J=4.4 Hz,
3H), 2.07 (s, 3H); MS (ESI) m/z: 451.0 (M+H.sup.+).
Example 196
[0666] Using general method F,
1-chloro-3-isocyanato-2-methylbenzene (43 mg, 0.26 mmol) and
Example A39 (80 mg, 0.32 mmol) in the presence of pyridine (41
.mu.L, 0.51 mmol) were combined to afford
1-(3-chloro-2-methylplenyl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(methylami-
no)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (98
mg, 80% yield). .sup.1H NMR (400 MHz, DMSO-d, major rotomer):
.delta. 8.95 (d, J=1.6 Hz, 1H), 8.60 (s, 1H), 8.48 (s, 1H), 7.96
(d, J=8.8 Hz, 1H), 7.81 (q, J=4.4 Hz, 1H), 7.74 (m, 1H), 7.67 (s,
1H), 7.12 (m, 3H), 3.59 (s, 3H), 2.90 (d, J=4.4 Hz, 3H), 2.28 (s,
3H), 2.07 (s, 3H); MS (ESI) m/z: 481.0 (M+H.sup.+).
Example 197
[0667] Using general method F, 1,2-dichloro-3-isocyanatobenzene (48
mg, 0.26 mmol) and Example A39 (80 mg, 0.32 mmol) in the presence
of pyridine (41 .mu.L, 0.51 mmol) were combined to afford
1-(2,3-dichlorophenyl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-
-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (100 mg,
78% yield). .sup.1H NMR (400 MHz, DMSO-d, major rotomer): .delta.
9.39 (brs, 1H), 8.89 (s, 1H), 8.60 (s, 1H), 8.10 (dd, J=3.2, and
6.8 Hz, 1H), 7.94 (d, J=8.4 Hz, 1H), 7.81 (q, J=4.4 Hz, 1H), 7.68
(s, 1H), 7.27 (m, 2H), 7.16 (d, J=12.0 Hz, 1H), 3.60 (s, 3H), 2.90
(d, J=4.4 Hz, 3H), 2.07 (s, 3H); MS (ESI) m/z: 501.0
(M+H.sup.+).
Example 198
[0668] Using general method F,
1-chloro-2-isocyanato-4-(trifluoromethyl)benzene (49 mg, 0.22 nmol)
and Example A39 (70 mg, 0.22 mmol) in the presence of pyridine (36
.mu.L, 0.48 mmol) were combined to afford
1-(2-chloro-5-(trifluoromethyl)phenyl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-
-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(100 mg, 84% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major
rotomer): .delta. 9.49 (brs, 1H), 9.04 (s, 1H), 8.61 (brs, 1H),
8.57 (d, J=2.0 Hz, 1H), 7.96 (d, J=8.4 Hz, 1H), 7.81 (q, J=4.8 Hz,
1H), 7.70 (m, 2H), 7.35 (dd, J=1.6, and 8.4 Hz, 1H), 7.17 (d,
J=12.4 Hz, 1H), 3.60 (s, 3H), 2.90 (d, J=4.8 Hz, 3H), 2.08 (s, 3H);
MS (ESI) m/z: 535.0 (M+H.sup.+).
Example 199
[0669] Using general method B, the carbamate of
5-t-butylisoxazol-3-amine (0.075 g, 0.334 mmol) and Example A28
(0.111 g, 0.334 mmol) were combined to afford
1-(5-tert-butylisoxazol-3-yl)-3-(4-chloro-2-fluoro-5-(1-methyl--
7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea
(0.042 g, 25%) as a white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.86 (s, 1H), 8.91 (s, 1H), 8.40 (s, 1H),
8.15 (d, J=8.4 Hz, 1H), 7.75 (s, 1H), 7.57 (d, J=10.8 Hz, 1H), 7.11
(m, 1H), 6.45 (s, 1H), 3.50 (s, 3H), 2.86 (d, J=5.2 Hz, 3H), 1.25
(s, 9H); MS (ESI) m/z: 499.0 (M+Ht).
Example 200
[0670] Using general method D, 2-methyl-5-(trifluoromentyl)benzoic
acid (50 mg, 0.25 mmol) and Example A39 (92 mg, 0.29 mmol) in
presence of DPPA (58 mL, 0.27 mmol) and Et.sub.3N (38 .mu.L, 0.27
mmol) were combined to afford
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamnio)-7-oxo-7,8-dihydro-
pyrido[2,3-d]pyrimidin-6-yl)phenyl)-3-(2-methyl-5-(trifluoromethyl)phenyl)-
urea (83 mg, 66% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major
rotomer): .delta. 9.15 (d, J=1.6 Hz, 1H), 8.61 (brs, 1H), 8.54 (s,
1H), 8.35 (d, J=1.6 Hz, 1H), 7.99 (d, J=8.4 Hz, 1H), 7.81 (q, J=4.4
Hz, 1H), 7.68 (s, 1H), 7.38 (d, J=8.4 Hz, 1H), 7.24 (m, 1H), 7.16
(d, J=12.4 Hz, 1H), 3.60 (s, 3H), 2.90 (d, J=4.4 Hz, 3H), 2.32 (s,
3H), 2.07 (s, 3H); MS (ESI) m/z: 515.0 (M+H.sup.+).
Example 201
[0671] Using general method F, 3-(trifluoromethyl)phenylisocyanate.
(45 mg, 0.24 mmol) and Example A28 (80 mg, 0.24 mmol)in the
presence of pyridine (39 .mu.L, 0.48 mmol) were combined to afford
1-(4-chloro-2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(3-(trifluoromethyl)phenyl)urea (55 mg,
44% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.53 (brs,
1H), 8.85 (s, 1H), 8.41 (s, 1H), 8.14 (d, J=8.8 Hz, 1H), 8.02 (brs,
1H), 7.75 (s, 1H), 7.55 (d, J=10.8 Hz, 1H), 7.50 (m, 2H), 7.31 (m,
1H), 7.11 (q, J=4.4 Hz, 1H), 6.17 (s, 1H), 3.50 (s, 3H), 2.86 (d,
J=4.4 Hz, 3H); MS (ESI) m/z: 520.0 (M+H.sup.+).
Example 202
[0672] Using general method D, 3-bromo-2-methylbenzoic acid (50 mg,
0.23 mmol) and Example A39 (87 mg, 0.28 mmol) in presence of DPPA
(55 .mu.L, 0.25 mmol) and Et.sub.3N (36 .mu.L, 0.25 mmol) were
combined to afford
1-(3-bromo-2-methylphenyl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamin-
o)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (105
mg, 86% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major rotomer):
.delta. 8.94 (d, J=2.0 Hz, 1H), 8.60 (brs, 1H), 8.49 (s, 1H), 7.95
(d, J=8.8 Hz, 1H), 7.81 (q, J=4.4 Hz, 1H), 7.76 (brd, J=7.2 Hz,
1H), 7.67 (s, 1H), 7.29 (m, 1H), 7.15 (d, J=12.4 Hz, 1H), 7.06 (t,
J=8.4 Hz, 1H), 3.59 (s, 3H), 2.90 (d, J=4.4 Hz, 3H), 2.32 (s, 3H),
2.07 (s, 3H); MS (ESI) r.sup.1/z: 525.0 (M+H.sup.+).
Example 203
[0673] Using general method F, 3-chloro-2-methylphenylisocyanate
(39 mg, 0.23 mmol) and Example A12 (70 mg, 0.23 mmol) in the
presence of pyridine (38 .mu.L, 0.47 mmol) were combined to afford
1-(2-chloro-5-(trifluoromethyl)phenyl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-
-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)pheyl)urea
(75 mg, 69% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major
rotomer): .delta. 9.03 (d, J=2.0 Hz, 1H), 8.65 (brs, 1H), 8.55 (s,
1H), 8.43 (m, 1H), 7.86 (s, 1H), 7.82 (m, 1H), 7.78 (dd, J=2.8, and
6.8 Hz, 1H), 7.27 (m, 2H), 7.15 (m, 2H), 3.61 (s, 3H), 2.90 (d,
J=4.4 Hz, 3H), 2.30 (s, 3H); MS (ESI) m/z: 467.0 (M+H.sup.+).
Example 204
[0674] Using general method B, the carbamate of
4-bromonaphthalen-1-amine (0.061 g, 0.2 mmol) and Example A14 (0.06
g, 0.2 mmol) were combined to afford
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-y-
l)-2-fluoro-4-methylphenyl)-3-(4-bromonaphthalen-1-yl)urea as
off-white solid (35 mg, 32%, yield). .sup.1H NMR (400 MHz,
DMSO-ds): .delta. 9.24 (s, 1H), 9.06 (s, 1H), 8.61 (s, 1H),
8.24-8.21 (m, 1H), 8.15-8.13 (m, 1H), 8.01 (d, J=8.4 Hz, 1H), 7.98
(d, J=8.4 Hz, 1H), 7.81 (d, J=8.4 Hz, 1H), 7.74-7.68 (m, 3H), 7.31
(brs, 2H), 7.18 (d, J=12.4 Hz, 1H), 3.54 (s, 3H), 2.08 (s, 3H); MS
(ESI) m/z: 547.0 (M+H.sup.+).
Example 205
[0675] To a degassed solution of 2-bromo-4-methylbenzenamine (0.301
g, 1.618 mmol), phenyl boronic acid (0.296 g, 2.427 mmol), and
tetrakistriphenylphosphine palladium(0) (0.187 g, 0.162 mmol) in
DME (8 mL) was added 2M sodium carbonate solution (3 ml, 6 mmol)
and the mixture was stirred for 16 h at 80.degree. C. Water (30 ml)
was added and the product was extracted with EtOAc (2.times.30 mL).
The combined organics were washed with brine, dried
(Na.sub.2SO.sub.4), concentrated and purified by silica gel
chromatography to provide 2-phenyl-4-methylbenzenamine as a thick
syrup (0.22 g, 75% yield). .sup.1H NMR (400 MHz, CDCl.sub.3):
.delta. 7.47-7.41 (m, 4H), 7.36-7.32 (m, 1H), 6.99-6.96 (m, 2H),
6.71 (d, J=8.0 Hz, 1H), 2.28 (s, 3H); MS (ESI) m/z: 184.2
(M+H.sup.+).
[0676] To a biphasic solution of 2-phenyl-4-methylbenzenanine (0.29
g, 1.583 mmol) in EtOAc (10 mL) and NaHCO.sub.3 (10 ml) was added
prop-1-en-2-yl carbonochloridate (0.259 ml, 2.374 mmol) and mixture
was stirred for 16 h at RT. The layers were separated and the
aqueous layer was extracted with EtOAc (1.times.30 mL). The
combined organics were washed with brine, dried (Na.sub.2SO.sub.4)
and concentrated to provide prop-1-en-2-yl
2-phenyl-4-methylphenylcarbamate as an off-white solid (0.33 g, 78%
yield). .sup.1H NMR (400 MHz, CDCl.sub.3): .delta. 8.00 (brs, 1H),
7.50-7.46 (m, 2H), 7.42-7.35 (m, 3H), 7.18 (dd, J=8.4 Hz, 1.6 Hz,
1H), 7.05 (s, 1H), 6.67 (brs, 1H), 4.72 (s, 1H), 4.68 (s, 1H), 2.34
(s, 3H), 1.94 (s, 3H); MS (ESI) m/z: 290.0 (M+Na.sup.+).
[0677] Using general method C, prop-1-en-2-yl
2-Phenyl-4-methylphenylcarbamate (0.061 g, 0.23 mmol) and Example
A26 (0.071 g, 0.23 mmol) were combined to afford
1-(2-phenyl-4-methylphenyl)-3-(2-fluoro-4-methyl-5-(1-methyl-7-(methylami-
no)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea as a white
solid (0.034 g, 28% yield). .sup.1H NMR (400 MHz, MeOH-d.sub.4):
.delta. 8.35 (s, 1H), 7.79 (d, J=8.0 Hz, 1H), 7.68 (s, 1H), 7.57
(d, J=8.0 Hz, 1H), 7.45-7.41 (m, 2H), 7.37-7.33 (m, 3H), 7.14 (dd,
J=8.0 Hz, 2.0 Hz, 1H), 7.06 (d, J=2.0 Hz, 1H), 6.99 (d, J=11.6 Hz,
1H), 6.29 (s, 1H), 3.63 (s, 3H), 2.97 (s, 3H), 2.33 (s, 3H), 2.12
(s, 3H); MS (ESI) m/z: 522.2 (M+H.sup.+).
Example 206
[0678] Using general method D, [1,1'-biphenyl]-2-carboxylic acid,
2'-methyl (0.051 g, 0.24 mmol) and Example A26 (0.075 g, 0.24 mmol)
in presence of triethylamine (0.073 g, 0.72 mmol) and
diphenylphospharyl azide (0.13 g, 0.48 mmol) were combined to
afford
1-[2-(2'-methylphenyl)]-3-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)--
2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea as a white
solid (83 mg, 66%). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.87 (s, 1H), 8.38 (s, 1H), 7.91 (d, J=8.4 Hz, 1H), 7.89 (d, J=8.4
Hz, 1H), 7.76 (s, 1H), 7.65 (s, 1H), 7.34-7.26 (m, 4H), 7.14-7.02
(m, 5H), 6.16 (s, 1H), 3.50 (s, 3H), 2.84 (d, J=4.8 Hz, 3H), 2.04
(s, 3H), 2.01 (s, 3H); MS (ESI) m/z: 522.2 (M+H.sup.+).
Example 207
[0679] Using general method B, the carbamate of 2-aminobiphenyl
(0.071 g, 0.28 mmol) and Example A26 (0.088 g, 0.28 mmol) were
combined to afford
1-(2-phenylphenyl)-3-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-
-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea as a white solid
(0.107 g, 75% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.82 (s, 1H), 8.39 (s, 1H), 8.11 (s, 1H), 7.34 (d, J=8.4 Hz, 1H),
7.81 (d, J=8.0 Hz, 1H), 7.65 (s, 1H), 7.51-7.47 (m, 2H), 7.42-7.37
(m, 3H), 7.30-7.26 (m, 1H), 7.19 (dd, J=8.0 Hz, 1.6 Hz, 1H),
7.13-7.02 (m, 3H), 6.16 (s, 1H), 3.50 (s, 3H), 2.84 (d, J=4.8 Hz,
3H), 2.05 (s, 3H); MS (ESI) m/z: 508.0 (M+H.sup.+).
Example 208
[0680] A degassed mixture of ethyl 5-chloro-2-iodobenzoate (0.621
g, 2.00 mmol), Pd(PPh3)4 (0.116 mg, 0.1 mmol), dimethoxyethane (20
mL), phenylboronic acid (0.268 g, 2.2 mmol), K2CO3 (0.829 g, 6.0
mmol), and water (5 mL) was heated under reflux for 6 h. Solvent
was removed under reduced pressure. The residue was diluted with
sat. NH4Cl (15 mL) and extracted with EtOAc (2.times.30 mL). The
combined organic layers were dried (MgSO4) and concentrated. The
crude product was purified by chromatography to afford ethyl
5-chloro-2-phenylbenzoate (0.473 g, 91%) as colorless oil. MS (ESI)
m/z: 261.0 (M+H.sup.+).
[0681] Ethyl 5-chloro-2-phenylbenzoate (0.473 g, 1.81 mmol) was
hydrolyzed with lithium hydroxide monohydrate to provide
5-chloro-2-phenylbenzoic acid (0.336 g, 80% yield). MS (ESI) m/z:
233.0 (M+H.sup.+)
[0682] Using general method D, 3-chloro-6-phenyl benzoic acid
(0.084 g, 0.36 mmol) and Example A27 were combined to afford
1-(3-chloro-6-phenylphenyl)-3-(2-fluoro-4-methyl-5-(1-methyl-7-(methylami-
no)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea (0.117 g,
60%) as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
9.00 (s, 1H), 8.40 (s, 1H), 8.24 (s, 1H), 8.03 (s, 1H), 7.94 (d,
J=8.4 Hz, 1H), 7.66 (s, 1H), 7.53-7.50 (m, 2H), 7.45-7.37 (m, 3H),
7.20-7.03 (m, 4H), 6.17 (s, 1H), 3.51 (s, 3H), 2.86 (d, J=4.8 Hz,
3H), 2.06 (s, 3H); MS (ESI) m/z: 542.0 (M+H.sup.+).
Example 209
[0683] Using general method B, the carbamate of
4-chloronaphthalen-1-amine (0.061 g, 0.23 mmol) and Example A14
(0.07 g, 0.23 mmol) were combined to afford
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-y-
l)-2-fluoro-4-methylphenyl)-3-(4-chloronaphthalen-1-yl)urea as
off-white solid (25 mg, 21%, yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.25 (s, 1H), 9.17 (s, 1H), 8.56 (s, 1H),
8.27-8.24 (m, 1H), 8.18-8.16 (m, 1H), 8.01 (d, J=8.4 Hz, 1H), 7.97
(d, J=8.4 Hz, 1H), 7.72-7.63 (m, 3H), 7.58 (d, J=8.4 Hz, 1H), 7.26
(brs, 2H), 7.13 (d, J=12.4 Hz, 1H), 3.49 (s, 3H), 2.03 (s, 3H); MS
(ESI) m/z: 503.0 (M+H.sup.+).
Example 210
[0684] Using general method B, the carbamate of
5-t-butylisoxazol-3-amine (60 mg, 0.27 mmol) and Example A33 (93
mg, 0.27 mmol) were combined to afford
1-(5-tert-butylisoxazol-3-yl)-3-(4-chloro-5-(1-ethyl-7-(methylamin-
o)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)urea
(0.045 g, 33% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
9.86 (s, 1H), 8.91 (brs, 1H), 8.41 (s, 1H), 8.15 (d, J=8.8 Hz, 1H),
7.74 (s, 1H), 7.56 (d, J=11.2 Hz, 1H), 7.06 (q, J=4.8 Hz, 1H), 6.45
(s, 1H), 6.24 (brs, 1H), 4.14 (q, J=6.8 Hz, 2H), 2.86 (d, J=4.8 Hz,
3H), 1.26 (s, 9H), 1.20 (t, J=6.8 Hz, 3H); MS (ESI) m/z: 513.3
(M+H.sup.+).
Example 211
[0685] Using general method D, Example B33 (200 mg, 0.806 mmol) and
Example A3 (255 mg, 0.806 mmol) were combined to give the
intermediate sulfide (132 mg, 29% yield).
[0686] Using a procedure analogous to Example A1, The sulfide and
2.0N methylamine in THF (1.2 mL, 2.35 mmol) were combined to give
1-(2-tert-butyl-4-(trifluoromethyl)pyrimidin-5-yl)-3-(2-fluoro-5-(8-methy-
l-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(79 mg, 61% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
1.35 (s, 9H), 2.90 (s, 3H), 3.53-3.60 (m, 3H), 7.29-7.33 (m, 2H),
7.70-7.80 (br m, 1H), 7.87 (s, 1H), 8.37-8.39 (m, 1H), 8.63-8.70
(m, 1H), 8.89 (s, 1H), 9.33 (s, 1H), 9.38 (s, 1H); MS (ESI) m/z:
545.3 (M+H.sup.+).
Example 212
[0687] Using general method F, Example A3 (0.173 g, 0.547 mmol) and
1-naphthyl isocyate (0.086 ml, 0.602 mmol) were combined to provide
1-(2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyri-
midin-6-yl)phenyl)-3-(naphthalene-1-yl)urea (246 mg, 94% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.20 (s, 1H), 9.16 (s,
1H), 8.96 (s, 1 H), 8.57 (m, 1H), 8.17 (d, J=8.3 Hz, 1H), 8.09 (s,
1H), 8.05 (d, J=6.8 Hz, 1H), 7.93 (d, J=7.8 Hz, 1H), 7.65-7.52 (m,
3H), 7.46 (t, J=7.8 Hz, 1H), 7.38-7.32 (m, 2H), 3.67 (s, 3H), 2.61
(s, 3H).
[0688] Using a procedure analogous to Example A1,
1-(2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyri-
midin-6-yl)phenyl)-3-(Oaphthalene-1-yl)urea (244 mg, 0.503 mmol),
mCPBA (136 mg, 0.553 mmol) and N,N-dimethylethylenediamine (0.11
mL, 1.01 mmol) were combined to provide
1-(5-(2-(2-(dimethylamino)ethlylamino)-8-methyl-7-oxo-7,8-dihydropyrido[2-
,3-d]pyrimidin-6-yl)-2-fluorophenyl)-3-(.quadrature.aphthalene-1-yl)urea
(110 mg, 100% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
9.13 (s, 1H), 9.05 (d, J=1.9 Hz, 1H), 8.67 and 8.61 (s, 1H), 8.45
(d, J=8.5 Hz, 1H), 8.12 (d, J=8.0 Hz, 1H), 8.00 (d, J=8.2 Hz, 1H),
7.88 (d, J=7.7 Hz, 1H), 7.83 (s, 1H), 7.71 (t, J=5.6 Hz, 1H),
7.60-7.47 (m, 3H), 7.41 (t, J=7.9 Hz, 1H), 7.25 (d, J=8.2 Hz, 2H),
3.55 and 3.50 (s, 3H), 3.41 (q, J=6.5 Hz, 2H), 2.41 (m, 2H), 2.14
and 2.11 (s, 6H); MS (ESI) m/z: 526.2 (M+H.sup.+).
Example 213
[0689] Using general method G, the carbamate of
5-t-butylisoxazol-3-amine (1.340 g, 5.97 mmol), and Example A30
(1.50 g, 4.60 mmol) were combined to furnish
1-(5-tert-butylisoxazol-3-yl)-3-(5-(1-ethyl-7-(methlylamino)-2-oxo-1,2-di-
hydro-1,6-naphthyridin-3-yl)-2-fluoro-4-methylphenyl)urea (1.99 g,
88% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.79 (s,
1H), 8.74 (s, 1H)), 8.40 (s, 1H), 7.91 (d, J=8 Hz, 1H), 7.66 (s,
1H), 7.15 (d, J=13 Hz, 1H), 7.00 (m, 1H), 6.44 (s, 1H), 6.23 (s,
1H), 4.15 (m, 2H), 2.86 (d, J=5 Hz, 3H), 2.07 (s, 3H), 1.26 (s,
9H), 1.20 (t, J=6 Hz, 3H): MS (ESI) m/z: 493.2 (M+H.sup.+).
Example 214
[0690] Using general method B, the carbamate of 2-phenylaniline
(0.089 g, 0.353 mmol) and Example A54 (0.100 g, 0.353 mmol) were
combined to afford
1-(2-phenylphenyl)-3-(2-fluoro-4-methyl-5-(1-methyl-2-oxo-1,2-dihydro-1,6-
-naphthyridin-3-yl)phenyl)urea (0.128 g, 76% yield) as a white
solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.92 (s, 1H),
8.87 (s, 1H), 8.60 (d, J=5.6 Hz, 1H), 8.14 (s, 1H), 8.03-7.97 (m,
2H), 7.81 (d, J=8.4 Hz, 1H), 7.53-7.48 (m, 3H), 7.43-7.37 (m, 3H),
7.29 (t, J=8.8 Hz, 1H), 7.21-7.12 (m, 3H), 3.65 (s, 3H), 2.07 (s,
3H); MS (ESI) m/z: 479.2 (M+H.sup.+).
Example 215
[0691] Using general method B, the carbamate of
5-t-butylisoxazol-3-amine (80 mg, 0.36 mmol) and Example A48 (122
mg, 0.36 mmol) were combined to afford
1-(5-tert-butylisoxazol-3-yl)-3-(4-cyano-2-fluoro-5-(8-methyl-2-(m-
ethylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.046 g, 25% yield). MS (ESI) m/z: 508.2 (M+H.sup.+).
[0692] Using a procedure analogous to Example A1,
1-(5-tert-butylisoxazol-3-yl)-3-(4-cyano-2-fluoro-5-(8-methyl-2-(methylth-
io)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.046
g, 0.091 mmol) was treated with mCPBA (70% wt, 0.027 g, 0.11 mmol)
and then N-methylamine (2.0M in THF, 0.18 mL, 0.36 mmol) to afford
1-(5-tert-butylisoxazol-3-yl)-3-(4-cyano-2-fluoro-5-(8-methyl-2-(methylam-
ino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (15
mg, 34% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.0
(s, 1H), 9.24 (brs, 1H), 8.67 (s, 1H), 8.41 (d, J=7.6 Hz, 1H), 7.98
(d, J=11.2 Hz, 1H), 7.94 (s, 1H), 7.88 (m, 1H), 6.49 (s, 1H), 3.61
(s, 3H), 2.92 (d, J=4.8 Hz, 3H), 1.26 (s, 9H); MS (ESI) m/z: 491.2
(M+H.sup.+).
Example 216
[0693] Using general method D, Example B34 (200 mg, 0.646 mmol) and
Example A3 (205 mg, 0.646 mmol) were combined to give the
intermediate sulfide (215 mg, 53% yield). Using a procedure
analogous to Example A1, the sulfide and 2.00N methylamine in THF
(1.35 mL, 2.70 mmol) were combined to afford
1-(2-tert-butyl-4-(1-methyl-1H-indol-5-yl)pyrimidin-5-yl)-3-(2-fluoro-5-(-
8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phen-
yl)urea (22 mg, 13% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 1.38 (s, 9H), 2.90 (s, 3 H), 3.53-3.60 (m, 3H), 3.83 (s,
3H), 6.55 (s, 1H), 7.23-7.29 (m, 3H), 7.41 (m, 1H), 7.56-7.61 (m,
2H), 7.85 (s, 1H), 7.98 (s, 1H), 8.38-8.40 (m, 1H), 8.63-8.70 (m,
2H), 9.01-9.05 (br. s, 2 H); MS (ESI) m/z: 606.2 (M+H.sup.+).
Example 217
[0694] Using general method F, Example A30 (70 mg, 0.21 mmol) and
1-isocyanato-3-(trifluoromethyl)benzene (0.035 mL, 0.25 mmol) were
combined to provide
1-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2--
fluoro-4-methylphenyl)-3-(3-(trifluoromethyl)phenyl)urea (43 mg,
39% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.37 (s, 1
H), 8.58 (d, J=1.5 Hz, 1H), 8.41 (s, 1H), 8.02 (s, 1H), 7.90 (d,
J=8.4 Hz, 1H), 7.67 (s, 1H), 7.52-7.45 (m, 2H), 7.30 (br d, J=6.2
Hz, 1H), 7.14 (d, J=12.2 Hz, 1H), 7.00 (q, J=4.8 Hz, 1H), 6.24 (s,
1H), 4.15 (q, J=7.0 Hz, 2H), 2.86 (d, J=4.8 Hz, 3H), 2.07 (s, 3H),
1.21 (t, J=7.0 Hz, 3H); MS (ESI) m/z: 514.2 (M+H.sup.+).
Example 218
[0695] Using general method B, the carbamate of 2-phenylaniline
(0.107 g, 0.422 mmol) and Example A56 (0.100 g, 0.281 mmol) were
combined to afford
1-(5-(7-(2-(dimethylamino)ethylamino)-1-methyl-2-oxo-1,2-dihydro-1,6-naph-
thyridin-3-yl)-2-fluorophenyl)-3-(2-phenylphenyl)urea (0.276 g,
18%) as a white solid. It was converted to the corresponding
bis-methylate salt by reacting with MsOH (2.0 eq.). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 8.54 (s, 1H), 8.36 (dd, J=7.6, 2.0
Hz, 1H), 7.94 (s, 1H), 7.82 (dd, J=8.4, 0.8 Hz, 1H), 7.50-7.46 (m,
2H), 7.41-7.32 (m, 5H), 7.27 (dd, J=7.6, 1.6 Hz, 1H), 7.22-7.13 (m,
2H), 6.72 (s, 1H), 3.90 (t, J=6.0 Hz, 2H), 3.70 (s, 3H), 3.50 (t,
J=6.0 Hz, 2H), 3.01 (s, 6H), 2.72 (s, 6H); MS (ESI) m/z: 551.2
(M+H.sup.+).
Example 219
[0696] Using general method B, the carbamate of
3-isopropyl-1-phenyl-1H-pyrazol-5-amine (0.100 g, 0.350 mmol) and
Example A28 (0.111 g, 0.334 mmol) were combined to afford
1-(4-chloro-2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(3-isopropyl-1-phenyl-1H-pyrazol-5-yl)urea
(0.075 g, 40% yield) as a white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.36 (s, 1H), 8.13 (d, J=8.4 Hz, 1H), 7.74
(s, 1H), 7.57-7.52 (m, 2H), 7.49-7.45 (m, 3H), 7.29 (d, J=10.8 Hz,
1H), 6.39 (s, 1H), 6.29 (s, 1H), 3.62 (s, 3H), 2.97-2.91 (m, 4H),
1.27 (d, J=6.8 Hz, 6H); MS (ESI) m/z: 560.2 (M+H.sup.+).
Example 220
[0697] Using general method D, 2-fluoro-5-(trifluoromethyl)benzoic
acid (50 mg, 0.24 mmol) and Example A39 (75 mg, 0.24 mmol) in
presence of DPPA (57 .mu.L, 0.26 mmol) and Et.sub.3N (37 .mu.L,
0.26 mmol) were combined to afford
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihy-
dropyrido[2,3-d]pyrimidin-6-yl)phenyl)-3-(2-fluoro-5-(trifluoromethyl)phen-
yl)urea (90 mg, 76% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6,
major rotomer): .delta. 9.33 (d, J=2.4 Hz, 1H), 9.12 (brs, 1H),
8.61 (s, 1H), 8.59 (dd, J=2.4, and 7.6 Hz, 1H), 7.97 (d, J=8.4 Hz,
1H), 7.81 (q, J=4.4 Hz, 1H), 7.69 (s, 1H), 7.48 (m, 1H), 7.37 (m,
1H), 7.16 (d, J=12.4 Hz, 1H), 3.60 (s, 3H), 3.54 (s, 3H), 2.91 (d,
J=4.4 Hz, 3H), 2.08 (s, 3H); MS (ESI) m/z: 519.0 (M+H.sup.+).
Example 221
[0698] In a manner analogous to that described for the preparation
of Example 137, prop-1-en-2-yl
5-t-butyl-1,3,4-thiadiazol-2-ylcarbamate (100 mg, 0.414 mmol, 1.00
eq) and Example A17 (145 mg, 0.414 mmol, 1.00 eq) were reacted in
the presence of N-methylpyrrolidine (0.043 ml, 0.041 mmol, 0.10 eq)
in THF (4 ml). Subsequent oxidation with mCPBA (44.3 mg, 0.180
mmol, 1.20 eq) and displacement with 2.0M methylamine in THF (0.749
ml, 1.498 mmol, 10.00 eq) afforded
1-(5-tert-butyl-1,3,4-thiadiazol-2-yl)-3-(4-chloro-2-fluoro-5-(8-methyl-2-
-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(14 mg, 6.5% overall yield) as a white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.98 (brs, 1H), 8.66 (brs, 1H), 8.58 (brs,
1H), 8.05 (d, 1H, J=8.0 Hz), 7.85 (brq, 1H), 7.73 (s, 1H), 7.56 (d,
1H, J=10.8 Hz), 3.55 (brs, 3H), 2.86 (brd, 3H), 1.30 (s, 9H); MS
(ESI) m/z: 517.0 (M+H.sup.+).
Example 222
[0699] Using general method B, the carbamate of Example B19 (3.00
g, 13.44 mmol) and Example A28 (3.00 g, 9.02 mmol) were combined to
provide
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(4-chloro-2-fluoro-5-(1-methyl-7-(meth-
ylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea (1.85
g, 41% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): 8.72 (s, 1H),
8.63 (brs, 1H), 8.40 (s, 1H), 8.18 (d, J=9 Hz, 1H), 7.79 (s, 1H),
7.73 (s, 1H), 7.50 (d, J=11 Hz, 1H), 7.39 (s, 1H), 7.10 (m, 1H),
6.17 (s, 1H), 3.50 (s, 3H), 2.85 (d, J=5 Hz, 3H), 1.46 (s, 9H); MS
(ESI) m/z: 498.0 (M+H.sup.+).
Example 223
[0700] Using general method B, the carbamate of
5-t-butylisoxazol-3-amine (50 mg, 0.223 mmol) and Example A46 (72
mg, 0.223 mmol) were combined to afford
1-(5-tert-butylisoxazol-3-yl)-3-(4-ethynyl-2-fluoro-5-(8-methyl-2--
(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.058 g, 53% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major
isomers): .delta. 9.90 (s, 1H), 8.99 (s, 1H), 8.62 (s, 1H), 8.22
(d, J=8.4 Hz, 1H), 7.87 (q, J=4.8 Hz, 1H), 7.80 (s, 1H), 7.48 (d,
J=11.6 Hz, 1H), 6.47 (s, 1H), 4.08 (s, 1H), 3.60 (s, 3H), 2.91 (d,
J=4.8 Hz, 3H), 1.26 (s, 9H); MS (ESI) m/z: 490.2 (M+Ht).
Example 224
[0701] To a stirring suspension of
3-t-butyl-1-(3-nitrophenyl)-1H-pyrazol-5-amine hydrochloride (0.500
g, 1.685 mmol, 1.00 eq) and pyridine (0.412 ml, 5.05 mmol, 3.00 eq)
in CH.sub.2Cl.sub.2 (17 ml) at 22.degree. C. was added Troc-Cl
(0.244 ml, 1.769 mmol, 1.05 eq). The reaction was stirred overnight
at RT. The completed reaction was diluted with CH.sub.2Cl.sub.2 and
washed with 3M HCl (2.times.). The combined aqueous were extracted
with CH.sub.2Cl.sub.2 (1.times.). The combined organics were washed
with H.sub.2O (2.times.), brine (1.times.), dried
(Na.sub.2SO.sub.4), filtered ad evaporated. The crude product was
purified by flash column chromatography (100% hexanes to 30%
EtOAc/hexanes) to afford 2,2,2-trichloroethyl
3-t-butyl-1-(3-nitrophenyl)-1H-pyrazol-5-ylcarbamate (0.67 g, 91%
yield) as an oil.
[0702] 2,2,2-Trichloroethyl
3-t-butyl-1-(3-nitrophenyl)-1H-pyrazol-5-ylcarbamate (0.67 g, 1.538
mmol, 1.00 eq) in EtOAc (30 ml) was shaken under Hz.sub.2 (3.5 atm)
at 22.degree. C. over 10% Pd/C (0.327 g, 0.154 mmol, 0.10 eq, 50%
H.sub.2O) overnight. The completed hydrogenation was treated with
Ac.sub.2O (3 ml) and stirred at RT. After 45 min, the mixture was
filtered through Celite, rinsing forward with EtOAc. The filtrate
was treated with a roughly equal volume of satd. NaHCO.sub.3 and
stirred briskly at RT for 3 h. The layers were separated and the
organic layer washed with satd. NaHCO.sub.3 (2.times.). The
combined aqueous layers were extracted with EtOAc (1.times.). The
combined organics were washed with brine (1.times.), dried
(MgSO.sub.4), filtered and evaporated to afford
2,2,2-trichloroethyl
1-(3-acetamidophenyl)-3-t-butyl-1H-pyrazol-5-ylcarbamate (0.50 g,
73% yield) as a white solid which was used as is in the next
reaction. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.10 (s,
1H), 9.95 (brs, 1H), 7.74 (brs, 1H), 7.54-7.51 (m, 1H), 7.37-7.31
(m, 1H), 7.08 (d, J=7.6 Hz, 1H), 6.26 (s, 1H), 4.84 (s, 2H), 2.03
(s, 3H), 1.26 (s, 9H); MS (ESI) m/z: 447.0 (M+H), 449.0
((M+2+H).
[0703] Using general method C, 2,2,2-trichloroethyl
1-(3-acetamidophenyl)-3-t-butyl-1H-pyrazol-5-ylcarbamate (0.100 g,
0.223 mmol, 1.00 eq) and Example A39 (0.070 g, 0.223 mmol, 1.00 eq)
were combined to afford
1-(1-(3-acetamidophenyl)-3-tert-butyl-1H-pyrazol-5-yl)-3-(2-fluoro-4-meth-
yl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-y-
l)phenyl)urea (20 mg, 15% yield) as an off-white solid. .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 10.17 (s, 2H), 8.92 (s, 1H), 8.85
(s, 1H), 8.61 (brs, 1H), 7.95 (d, J=8.4 Hz, 1H), 7.82 (brq, 1H),
7.68 (d, J=8.0 Hz, 2H), 7.44 (dd, J=7.6 and 16.4 Hz, 1H), 7.16-7.11
(m, 2H), 6.35 (s, 1H), 3.60 (s, 3H), 2.90 (brd, 3H), 2.05 (brs,
3H), 1.23 (s, 9H); MS (ESI) m/z: 612.3 (M+H.sup.+).
Example 225
[0704] Using general method D, Example B30 (0.051 g, 0.3 mmol) and
Example A30 (0.1 g, 0.3 mmol) in presence of triethylamine (0.12 g,
1.2 mmol) and diphenylphospharyl azide (0.25 g, 0.91 mmol) were
combined to afford
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2--
dihydro-1,6-naphthyridin-3-yl)-2-fluoro-4-methylphenyl)urea as a
white solid (41 mg. 27% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.64 (s, 1H), 8.41 (s, 1H), 8.40 (s, 1H),
7.94 (d, J=8.8 Hz, 1H), 7.78 (s, 1H), 7.64 (s, 1H), 7.36 (s, 1H),
7.10 (d, J=12.0 Hz, 1H), 7.01-6.97 (m, 1H), 6.23 (s, 1H), 4.14 (q,
J=6.8 Hz, 2H), 2.85 (d, J=4.8 Hz, 3H), 2.05 (s, 3H), 1.45 (s, 9H),
1.20 (t, J=6.8 Hz, 3H); MS (ESI) m/z: 492.3 (M+H.sup.+).
Example 226
[0705] Using general method F, Example A22 (0.060 g, 0.21 mmol) and
1-naphthyl isocyate (0.033 mL, 0.23 mmol) were combined to provide
1-(5-(1-ethyl-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)-3--
(naphthalen-1-yl)urea (72 mg, 75% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.14 (s, 1H), 9.08 (d, J=2.0 Hz, 1H), 8.92
(s, 1H), 8.54-8.51 (m, 2H), 8.13-8.11 (m, 2H), 7.99 (d, J=7.8 Hz,
1H), 7.88 (d, J=7.4 Hz, 1H), 7.60-7.47 (min, 4H), 7.42 (t, J=7.8
Hz, 1H), 7.31 (d, J=9.0 Hz, 2H), 4.26 (q, J=7.0 Hz, 2H), 1.19 (t,
J=7.0 Hz, 3H); MS (ESI) m/z: 453.3 (M+H.sup.+).
Example 227
[0706] Using general method D, 2,3-difluorobenzoic acid (40 mg,
0.25 mmol) and Example A39 (80 mg, 0.25 mmol) in presence of DPPA
(60 .mu.L, 0.28 mmol) and Et.sub.3N (40 .mu.L, 0.28 mmol) were
combined to afford
1-(2,3-difluorophenyl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-
-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (90 mg, 76%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major rotomer): .delta.
9.16 (brs, 1H), 9.02 (brs, 1H), 8.61 (brs, 1H), 7.9-8.0 (m, 2H),
7.80 (m, 1H), 7.69 (s, 1H), 7.16 (d, J=12.4 Hz, 1H), 7.10 (m, 1H),
7.00 (m, 1H), 3.60 (s, 3H), 2.91 (d, J=4.4 Hz, 3H), 2.07 (s, 3H);
MS (ESI) m/z: 469.0 (M+H.sup.+).
Example 228
[0707] Using general method C, the TROC carbamate of
4-bromo-3-(trifluoromethyl)aniline (0.10 g, 0.24 mmol), and Example
A12 (72 mg, 0.24 mmol) (0.10 mL, 0.54 mmol) were combined to afford
1-(4-bromo-3-(trifluoromethyl)phenyl)-3-(2-fluoro-5-(8-methyl-2-(methylam-
ino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.027 g, 20% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major
rotomer): .delta. 9.52 (s, 1H), 8.70 (d, J=2.0 Hz, 1H), 8.66 (s,
1H), 8.35 (dd, J=1.6, and 7.6 Hz, 1H), 8.11 (d, J=2.4 Hz, 1H), 7.90
(s, 1H), 7.73, m, 1H), 7.76 (d, J=9.2 Hz, 1H), 7.51 (dd, J=2.8, and
8.8 Hz, 1H), 7.30 (m, 2H), 3.62 (s, 3H), 2.91 (d, J=4.8 Hz, 3H); MS
(ESI) m/z: 566.0 (M+H.sup.+).
Example 229
[0708] Using general method C, Example A1 (127 mg, 0.444 mmol), and
2,2,2-trichloroethyl quinolin-8-ylcarbamate (142 mg, 0.444 mmol),
at 120.degree. C., were combined to afford
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uorophenyl)-3-(quinolin-8-yl)urea (18 mg, 8% yield). .sup.1H NMR
(300 MHz, DMSO-d.sub.6): .delta. 3.55 (s, 3H), 7.29-7.31 (m, 2H),
7.51-7.64 (m, 3H), 7.50-8.00 (br. s, 2H), 7.94 (s, 1H), 8.37-8.40
(m, 1H), 8.45-8.48 (m, 1H), 8.54-8.56 (m, 1H), 8.75 (s, 1H),
8.92-8.93 (m, 1H), 9.82 (s, 1H), 10.20 (s, 1H); MS (ESI) m/z: 456.0
(M+H.sup.+).
Example 230
[0709] Using general method C, the TROC carbamate of Example B20
(0.10 g, 0.33 mmol) and Example A 17 (116 mg, 0.33 mmol) were
combined to afford
1-(4-chloro-2-fluoro-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2-
,3-d]pyrimidin-6-yl)phenyl)-3-(3-isopropylisoxazol-5-yl)urea (0.087
g, 52% yield). MS (ESI) m/z: 503.0 (M+H.sup.+).
[0710] Using a procedure analogous to Example A1,
1-(4-chloro-2-fluoro-5-(8-methyl-2-(methyltlhio)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-(3-isopropylisoxazol-5-yl)urea
(0.087 g, 0.17 mmol) was treated with mCPBA (70% wt, 0.051 g, 0.21
mmol) and then N-methylamine (2.0M in THF, 0.35 mL, 0.69 mmol) to
afford
1-(4-chloro-2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-(3-isopropylisoxazol-5-yl)urea (65
mg, 77% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major rotomer):
.delta. 10.4 (brs, 1H), 8.93 (brs, 1H), 8.62 (s, 1H), 8.11 (d,
J=8.8 Hz, 1H), 7.88 (m, 1H), 7.77 (s, 1H), 7.59 (d, J=10.8 Hz, 1H),
5.99 (s, 1H), 3.59 (s, 3H), 2.90 (m, 4H), 1.16 (d, J=7.2 Hz, 6H);
MS (ESI) m/z: 486.0 (M+H.sup.+).
Example 231
[0711] Using general method F, Example A1 (0.150 g, 0.526 mmol) and
1-isocyanatonaphthalene (0.100 g, 0.591 mmol) were combined to
provide
1-(5-(2-amino-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fl-
uorophenyl)-3-(naphthalen-1-yl)urea (0.11, 40% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 9.16 (s, 1H), 9.10 (brs, 1H), 8.66
(s, 1H), 8.51 (m, 1H), 8.18 (d, J=9 Hz, 1H), 8.05 (brd, J=8 Hz,
1H), 7.93 (brd, J=8 Hz, 1H), 7.89 (s, 1H), 7.65-7.45 (m, 4H), 7.31
(m, 4H), 3.56 (s, 3H); MS (ESI) m/z: 455.0 (M+H.sup.+).
Example 232
[0712] Using general method B, the carbamate of
3-isopropyl-1-phenyl-1H-pyrazol-5-amine (0.100 g, 0.350 mmol), and
Example A30 (0.100 g, 0.306 nmol) were combined to provide
1-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2--
fluoro-4-methylphenyl)-3-(3-isopropyl-1-phenyl-1H-pyrazol-5-yl)urea
(0.14 g, 72% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.89 (s, 1H), 8.82 (s, 1H), 8.40 (s, 1H), 7.91 (d, J=9 Hz, 1H),
7.64 (s, 1H), 7.50 (m, 4H), 7.41 (m, 1H), 7.10 (d, J=12 Hz, 1H),
7.00 (m, 1H), 6.31 (s, 1H), 6.24 (s, 1H), 4.14 (q, J=6 Hz, 2H),
2.85 (m, 4H), 2.06 (s, 3H), 1.20 (t, J=6 Hz, 3H), 1.18 (d, J=6 Hz,
6H); MS (ESI) m/z: 554.2 (M+H.sup.+).
Example 233
[0713] To a stirring solution of Example B28 (0.200 g, 1.314 mmol,
1.00 eq) and pyridine (0.213 ml, 2.63 mmol, 2.00 eq) in
CH.sub.2Cl.sub.2 (13 ml) at 0.degree. C. was added isopropenyl
chloroformate (0.158 ml, 1.446 mmol, 1.10 eq). After 45 min at
0.degree. C., the completed reaction was diluted with
CH.sub.2Cl.sub.2 and washed with 3M HCl (2.times.). The combined
aqueous layers were extracted with CH.sub.2Cl.sub.2 (1.times.). The
combined organics were washed with H.sub.2O (1.times.), and brine
(1.times.), dried (Na.sub.2SO.sub.4), filtered and evaporated to
afford crude prop-1-en-2-yl 3-cyclopentylisoxazol-5-ylcarbamate
(0.41 g, 132% yield) as an oil which was used as is in the next
reaction. MS (ESI) m/z: 237.0 (M+H.sup.+).
[0714] Prop-1-en-2-yl 3-cyclopentylisoxazol-5-ylcarbamate (0.310 g,
1.312 mmol), Example A39 (0.411 g, 1.312 mmol) and
1-methylpyrrolidine (0.027 ml, 0.262 mmol) were combined in THF (13
ml) and stirred with heating at 60.degree. C. overnight. The
completed reaction was cooled to RT, applied to a samnplet and
allowed to dry. The crude product was purified by flash column
chromatography (10-75% EtOAc/hexanes) and then by reverse phase
chromatography (10-60% MeCN (w/0.1% TFA)/H.sub.2O (w/0.1% TFA)) to
afford
1-(3-cyclopentylisoxazol-5-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(methyl-
amino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (75
mg, 12% yield) as an off-white solid following lyophilization.
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.30 (s, 1H), 8.68
(brs, 1H), 8.61 (brs, 1H), 7.88 (d, J=8.4 Hz, 1H), 7.83 (brq, 1H),
7.68 (s, 1H), 7.17 (d, J=12.0 Hz, 1H), 5.93 (s, 1H), 3.60 (brs,
3H), 3.03-2.95 (m, 1H), 2.90 (brs, 3H), 2.08 (s, 3H), 1.96-1.90 (m,
2H), 1.69-1.54 (m, 6H); MS (ESI) m/z: 492.3 (M+H.sup.+).
Example 234
[0715] In a manner analogous to that described for the preparation
of Example 233, Example B29 (0.200 g, 1.203 mmol, 1.00 eq) and
Example A39 (0.377 g, 1.203 mmol) were reacted to afford
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-(3-(1-methylcyclopentyl)isoxazol-5-yl)urea
(107 mg, 18% yield) as an off-white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 10.30 (s, 1H), 8.68 (brs, 1H), 8.61 (s, 1H),
7.89 (d, J=8.4 Hz, 1H), 7.85 (brq, 1H), 7.68 (s, 1H), 7.17 (d,
J=12.4 Hz, 1H), 5.97 (s, 1H), 3.60 (brs, 3H), 2.95 (brs, 3H) 2.08
(s, 3H), 1.95-1.91 (m, 2H), 1.70-1.52 (m, 6H), 1.23 (s, 3H); MS
(ESI) m/z: 506.2 (M+H.sup.+).
Example 235
[0716] The carbamate of 5-t-butylisoxazol-3-amine (100 mg, 0.446
mmol), Example A31 (139 mg, 0.446 mmol) and 1-methylpyrrolidine
(9.27 .mu.l, 0.089 mmol) were combined in THF (5 ml) and stirred
with heating at 60.degree. C. in a sealed screw-cap vial for 24 h.
The completed reaction was cooled to RT and concentrated to
dryness. The crude product was purified by reverse phase
chromatography (5-45% MeCN (w/0.1% TFA)/H.sub.2O (w/0.1% TFA)).
Fractions containing pure product were pooled and neutralized with
satd. NaHCO.sub.3. This was extracted with EtOAc (2.times.). The
combined organics were washed with brine (2.times.), dried
(MgSO.sub.4), filtered and evaporated to a solid residue. This was
dissolved/suspended in MeCN/H.sub.2O, frozen and lyophilized to
afford
1-(5-(7-amino-1-ethyl-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoro-4-
-methylphenyl)-3-(5-tert-butylisoxazol-3-yl)urea (108 mg, 50.6%
yield) as a beige solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.79 (s, 1H), 8.74 (s, 1H), 8.35 (s, 1H), 7.91 (d, J=8.4
Hz, 1H), 7.65 (s, 1H), 7.15 (d, J=12.0 Hz, 1H), 6.49 (brs, 2H),
6.44 (s, 1H), 6.34 (s, 1H), 4.09 (q, J=6.8 Hz, 2H), 2.07 (s, 3H),
1.25 (s, 9H), 1.20 (t, J=6.8 Hz, 3H); MS (ESI) m/z: 479.2
(M+H.sup.+).
Example 236
[0717] Using general method B, the carbamate of
5-t-butylisoxazol-3-amine (108 mg, 0.480 mmol) and Example A44 (150
mg, 0.480 mmol) were combined to give the intermediate sulfide,
1-(5-tert-butylisoxazol-3-yl)-3-(4-methyl-3-(8-methyl-2-(methylthio)-7-ox-
o-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (35 mg, 15%
yield). Using a procedure analogous to Example A1,
1-(5-tert-butylisoxazoI-3-yl)-3-(4-methyl-3-(8-methyl-2-(methylthio)-7-ox-
o-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (158 mg, 0.330
mmol) and 2.0N solution of methylamine in THF (1.7 mL) were
combined and purified by chromatography (Biotage Si-25 column,
60-100% ethyl acetate/Hex) to afford
1-(5-tert-butylisoxazol-3-yl)-3-(4-methyl-3-(8-methyl-2-(methylamino)-7-o-
xo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (49 mg, 32%
yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 1.26 (s, 9H),
2.06 (s, 3 H), 2.90 (s, 3H), 3.53-3.60 (m, 3H), 6.46 (s, 1H),
7.14-7.16 (m, 1H), 7.26-7.28 (m, 1H), 7.32 (s, 1H), 7.67 (s, 1H),
7.65-7.80 (br m, 1H), 8.60-8.65 (m, 1H), 8.72 (s, 1H), 9.47 (s,
1H); MS (ESI) m/z: 462.0 (M+H.sup.+).
Example 237
[0718] Using general method D, Example B40 (50 mg, 0.19 mmol) and
Example A12 (56 mg, 0.19 mmol) in presence of DPPA (46 .mu.L, 0.21
mmol) and Et3N (30 .mu.L, 0.21 mmol) were combined to afford
1-(2-tert-butyl-4-morpholinopyrimidin-5-yl)-3-(2-fluoro-5-(8-methyl-2-(me-
thylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea.
This was treated with aqueous HCl (0.100 M) to afford
1-(2-tert-butyl-4-morpholinopyrimidin-5-yl)-3-(2-fluoro-5-(8-methyl-2-(me-
thylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
HCl salt (14 mg, 13% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6,
major isomers): .delta. 9.17 (s, 1H), 8.90 (brs, 1H), 8.65 (brs,
1H), 8.32 (s, 1H), 8.30 (dd, J=2.0, and 8.0 Hz, 1H), 7.88 (brs 1H),
7.86 (s, 1H), 7.27 (m, 2H), 4.00 (m, 4H), 3.73 (m, 4H), 3.60 (s,
3H), 2.90 (s, 3H), 1.36 (s, 9H); MS (ESI) m/z: 562.3
(M+H.sup.+).
Example 238
[0719] Using general method D,
3-tert-butyl-1-methyl-1H-pyrazole-5-carboxylic acid (0.061 g, 0.33
mmol) and Example A63 (0.116 g, 0.33 mmol) in presence of
triethylamine (0.1 g, 0.97 mmol) and diphenylphospharyl azide (0.14
g, 0.5 mmol) were combined to afford
1-(3-tert-buty-1-methyl-1H-pyrazol-5-yl)-3-(4-chloro-5-(8-ethyl-
-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluorophe-
nyl)urea as a white solid (0.045 g, 25% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 8.96-8.95 (m, 2H), 8.61 (s, 1H), 8.17
(d, J=8.8 Hz, 1H), 7.88-7.86 (m, 1H), 7.74 (s, 1H), 7.56 (d, J=7.2
Hz, 1H), 6.05 (s, 1H), 4.36-4.31 (m, 2H), 3.59 (s, 3H), 2.89 (d,
J=4.4 Hz, 3H), 1.24-1.17 (m, 12H); MS (ESI) m/z: 527.2
(M+H.sup.+).
Example 239
[0720] Using general method D,
3-isopropyl-1-methyl-1H-pyrazole-5-carboxylic acid (0.055 g, 0.33
mmol) and Example A63 (0.114 g, 0.33 mmol) in presence of
triethylamine (0.1 g, 0.97 mmol) and diphenylphospharyl azide (0.14
g, 0.5 mmol) were combined to afford
1-(4-chloro-5-(8-ethyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)-2-fluorophenyl)-3-(3-isopropyl-1-methyl-1H-pyrazol-5-
-yl)urea as a white solid (0.037 g, 22% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 8.98 (s, 1H), 8.96 (s, 1H), 8.61 (s,
1H), 8.16 (d, J=8.4 Hz, 1H), 7.88-7.86 (m, 1H), 7.74 (s, 1H), 7.57
(d, J=10.8 Hz, 1H), 6.01 (s, 1H), 4.36-4.31 (m, 2H), 3.58 (s, 3H),
2.90 (d, J=4.4 Hz, 3H), 2.77-2.70 (m, 1H), 1.22 (t, J=6.8 Hz, 3H),
1.12 (d, J=6.0 Hz, 6H); MS (ESI) m/z: 513.0 (M+H.sup.+).
Example 240
[0721] Using general method D, Example B45 (100 mg, 0.549 mmol),
triethylamine (64 mg, 0.631 mmol), Example A38 (164 mg, 0.549 mmol)
and diphenylphosphorylazide (174 mg, 0.631 mmol) were combined to
afford
1-(1-tert-butyl-5-methyl-1H-pyrazol-4-yl)-3-(2-fluoro-5-(1-methyl-7-(meth-
ylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea (81
mg, 30% yield). This was converted to the mono mesylate salt (91
mg). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 1.53 (s, 9H),
2.31 (s, 3H), 2.33 (s, 3H), 2.97 (s, 3H), 3.54 (s, 3H), 6.53 (s,
1H), 7.20-7.29 (m, 2H), 7.45 (s, 1H), 7.98 (s, 1H), 8.18-8.35 (br.
s, 1H), 8.21 (s, 1H), 8.42 (d, 1H), 8.58 (s, 1 H), 8.63 (br. s,
1H); MS (ESI) m/z: 478.3 (M+H.sup.+).
Example 241
[0722] Using general method D, Example B46 (124 mg, 0.525 mmol),
triethylamine (61 mg, 0.604 mmol), Example A38 (157 mg, 0.525 mmol)
and diphenylphosphorylazide (166 mg, 0.604 mmol) were combined to
afford
1-(1-tert-butyl-5-(trifluoromethyl)-1H-pyrazol-4-yl)-3-(2-fluoro-5-(1-met-
hyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea
(62 mg, 22% yield). This was converted to the mono mesylate salt
(55 mg). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 1.57 (m, 9H),
2.29 (s, 3H), 2.95 (s, 3H), 3.54 (s, 3H), 6.46 (s, 1H), 7.24-7.30
(m, 2H), 7.94 (s, 1H), 7.97 (s, 1H), 8.05 (br. s, 1H), 8.39-8.41
(m, 1H), 8.56 (d, 2H), 9.15 (s, 1H); MS (ESI) m/z: 532.0
(M+H.sup.+).
Example 242
[0723] Using general method F, Example A39 (75 mg, 0.239 mmol) and
cyclopentyl isocyanate (0.270 ml, 2.396 mmol) were combined to
afford
1-cyclopentyl-3-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8--
dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (81 mg, 80% yield)
as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.59
(brs, 1H), 8.05 (d, J=2.4 Hz, 1H), 7.94 (d, J=8.81 Hz, 1H), 7.80
(brq, 1H), 7.64 (s, 1H), 7.05 (d, J=12.8 Hz, 1H), 6.60 (d, J=7.21
Hz, 1H), 3.87 (m, J=6.8 Hz, 1H), 3.59 (brs, 3H), 2.90 (brs, 3H),
2.03 (s, 3H), 1.84-1.75 (m, 2H), 1.64-1.46 (m, 4H), 1.36-1.28 (m,
2H); MS (ESI) m/z: 425.2 (M+H.sup.+).
Example 243
[0724] Using general method B, the carbamate of Example B2 (114 mg,
0.480 mmol) and Example A44 (150 mg, 0.480 mmol) were combined to
afford
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(4-methyl-3-(8-methyl-2-(meth-
ylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea as
a light yellow solid (217 mg, 92% yield). MS (ESI) m/z: 492.3
(M+H.sup.+).
[0725] Using a procedure analogous to Example A1,
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(4-methyl-3-(8-methyl-2-(meth-
ylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(217 mg, 0.441 mmol) and 2.0N methylamine in THF (2.2 mL, 4.41
mmol) were combined and purified by reverse phase chromatography
(Biotage C18-25 column, 10-100% acetonitrile/water)and neutralized
with 10% sodium carbonate to give
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(4-methyl-3-(8-methyl-2--
(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(60 mg, 28% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
1.15 (s, 9 H), 2.06 (s, 3H), 2.90 (s, 3H), 3.53-3.63 (m, 6H), 6.02
(s, 1H), 7.12-7.14 (m, 1H), 7.23-7.26 (m, 1H), 7.34 (s, 1H),
7.66-7.80 (m, 2H), 8.42 (s, 1H), 8.58-8.68 (m, 1H), 8.79 (s, 1H);
MS (ESI) m/z: 475.2 (M+H.sup.+).
Example 244
[0726] Using general method C, the TROC carbamate of Example B18
(0.150 g, 0.475 mmol) and Example A64 (0.100 g, 0.317 mmol) were
combined to afford
1-(3-tert-butylisoxazol-5-yl)-3-(4-chloro-3-(8-methyl-2-(methylamino)-7-o-
xo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.055 g,
36%) as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
10.20 (s, 1H), 8.99 (s, 1H), 8.62 (s, 1H), 7.88 (m, 1H), 7.77 (s,
1H), 7.56 (t, J=1.4 Hz, 1H), 7.44-7.42 (m, 2H), 6.04 (s, 1H), 3.60
(s, 3H), 2.91 (m, 3H), 1.23 (s, 9H); MS (ESI) m/z: 482.0
(M+H.sup.+).
Example 245
[0727] Using general method D, Example B41 (60 mg, 0.22 mmol) and
Example A12 (65 mg, 0.22 mmol) in presence of DPPA (52 .mu.L, 0.26
mmol) and Et.sub.3N (34 .mu.L, 0.26 mmol) were combined to afford
1-(2-tert-butyl-4-(3-fluorophenyl)pyrimidin-5-yl)-3-(2-fluoro-5-(8-methyl-
-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(68 mg, 55% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major
isomer): .delta. 9.08 (s, 1H), 9.01 (brs, 1H), 8.64 (brs, 1H), 8.62
(brs, 1H), 8.34 (dd, J=2.0, and 8.0 Hz, 1H), 7.85 (s, 1H), 7.81 (m,
1H), 7.59 (m, 3H), 7.38 (m, 1H), 7.28 (m, 2H), 3.61 (s, 3H), 2.90
(d, J=4.8 Hz, 3H), 1.37 (s, 9H); MS (ESI) m/z: 571.3
(M+H.sup.+).
Example 246
[0728] Using general method F, Example A12 (50 mg, 0.167 mmol) and
3,5-dimethylphenyl isocyanate (0.025 ml, 0.175 mmol) were combined
and purified by reverse phase chromatography (MeCN (w/0.1%
TFA)/H.sub.2O (w/0.1% TFA)) to afford
1-(3,5-dimethylphenyl)-3-(2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8--
dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (34 mg, 46% yield)
as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.95
(brs, 1H), 8.69 (brs, 1H), 8.57 (brs, 1H), 8.48-8.45 (m, 1H), 7.90
(s, 1H), 7.83 (brq, 1H), 7.29-7.27 (m, 2H), 7.09-7.05 (m, 2H),
6.64-6.61 (m, 1H), 3.60 (brs, 3H), 2.93 (brs, 3H), 2.24 (s, 3H),
2.22 (s, 3H); MS (ESI) m/z: 447.0
Example 247
[0729] Using general method F, Example A12 (50 mg, 0.167 mmol) and
3,5-dichlorophenyl isocyanate (0.024 ml, 0.175 mmol) were combined
to afford
1-(3,5-dichllorophenyl)-3-(2-fluoro-5-(8-methyl-2-(methylamino)-7--
oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (70 mg, 86%
yield) as a solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
9.42 (brs, 1H), 8.75-8.68 (m, 2H), 8.39-8.37 (m, 1H), 7.92 (s, 1H),
7.84 (brq, 1H), 7.54-7.53 (m, 2H), 7.35-7.27 (m, 2H), 7.21-7.19 (m,
1H), 3.64 (brs, 3H), 2.93 (brs, 3H); MS (ESI) m/z: 487.0
(M+H.sup.+), 489.0 (M+2+H.sup.+).
Example 248
[0730] Using general method D, Example B45 (69 mg, 0.378 mmol),
triethylamine (44 mg, 0.435 mmol), Example A10 (125 mg, 0.378 mmol)
and diphenylphosphorylazide (120 mg, 0.435 mmol) were combined and
purified by chromatography (Biotage Si-25 column, 50-100% ethyl
acetate/hexane--1200 mL) to give
1-(1-tert-butyl-5-methyl-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-5-(8-methy-
l-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
as a tan solid (31 mg, 16% yield). MS (ESI) m/z: 510.0
(M+H.sup.+).
[0731] Using a procedure analogous to Example A1,
1-(1-tert-butyl-5-methyl-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-5-(8-methy-
l-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(31 mg, 0.061 mmol), MCPBA (19 mg, 0.079 mmol) and 2.0N methylamine
in THF (0.4 mL) were converted to
1-(1-tert-butyl-5-methyl-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-5-(8-methy-
l-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(15 mg, 50% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6), .delta.
1.60 (s, 9H), 2.20 (s, 3 H), 2.35 (s, 3H), 2.95 (s, 3H), 3.60-3.70
(m, 3H), 7.20-7.25 (m, 1H), 7.50 (s, 1H), 7.70 (s, 1 H), 7.70-7.90
(m, 1H), 8.05 (m, 1H), 8.20 (s, 1H), 8.55 (m, 1H), 8.70-8.80 (m,
1H); MS (ESI) m/z: 493.0 (M+H.sup.+).
Example 249
[0732] Using general method D, quinoline-5-carboxylic acid (92 mg,
0.529 mmol), triethylamine (64 mg, 0.635 mmol), Example A22 (150
mg, 0.529 mmol) and diphenylphosphorylazide (175 mg, 0.635 mmol)
were combined to afford
1-(5-(1-ethyl-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophe-
nyl)-3-(quinolin-5-yl)urea. This was converted to the dichloride
salt using 4N HCl/dioxane,
1-(5-(1-ethyl-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)-3--
(quinolin-5-yl)urea dihydrochloride (139 mg, 49% yield). .sup.1H
NMR (300 MHz, DMSO-d.sub.6): .delta. 1.29 (t, 3H), 4.37 (q, 2H),
7.40-7.43 (m, 2H), 7.86-8.00 (m, 4H), 8.29-8.35 (m, 2H), 8.57 (d,
1H), 8.75-8.80 (m, 1H), 9.14-9.19 (m, 2H), 9.29 (s, 1H), 9.53 (s,
1H), 10.01 (s, 1H); MS (ESI) m/z: 454.0 (M+H.sup.+).
Example 250
[0733] Using general method D, Example B46 (101 mg, 0.428 mmol),
triethylamine (52 mg, 0.513 mmol), Example A17 (150 mg, 0.428 mmol)
and diphenylphosphorylazide (141 mg, 0.513 mmol) were combined to
afford
1-(1-tert-butyl-5-(trifluoromethyl)-1H-pyrazol-4-yl)-3-(4-chloro-2-fluoro-
-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)p-
henyl)urea (230 mg, 92% yield). MS (ESI) m/z: 584.0
(M+Na.sup.+).
[0734] Using a procedure analogous to Example A1,
1-(1-tert-butyl-5-(trifluoromethyl)-1H-pyrazol-4-yl)-3-(4-chloro-2-fluoro-
-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)p-
henyl)urea (230 mg, 0.394 mmol), MCPBA (126 mg, 0.512 mmol) and
2.0N methylamine in THF (1.97 mL, 3.94 mmol) were combined to
afford
1-(1-tert-butyl-5-(trifluoromethyl)-1H-pyrazol-4-yl)-3-(4-chloro-2-fluoro-
-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-
phenyl)urea (127 mg, 56% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6), .delta. 1.59 (s, 9H), 2.92 (s, 3H), 3.53-3.62 (m,
3H), 7.55-7.65 (m, 1H), 7.78 (s, 1H), 7.80-7.90 (m, 1H), 7.93 (s,
1H), 8.15-8.25 (m, 1H), 8.45-8.70 (m, 2H), 9.25 (s, 1H); MS (ESI)
m/z: 567.0 (M+H.sup.+).
Example 251
[0735] Using general method D, Example B42 (60 mg, 0.23 mmol) and
Example A12 (70 mg, 0.23 mmol) in presence of DPPA (55 .mu.L, 0.26
mmol) and Et.sub.3N (36 .mu.L, 0.26 mmol) were combined to afford
1-(2-tert-butyl-4-(pyridin-3-yl)pyrimidin-5-yl)-3-(2-fluoro-5-(8-methyl-2-
-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(78 mg, 60% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major
isomer): .delta. 9.10 (s, 1H), 9.02 (brs, 1H), 8.96 (m, 1H), 8.75
(brs, 1H), 8.72 (dd, J=2.0, and 5.2 Hz, 1H), 8.65 (brs, 1H), 8.35
(dd, J=2.0, and 7.6 Hz, 1H), 8.19 (dt, J=1.6, and 7.6 Hz, 1H), 7.86
(s, 1H), 7.83 (m, 1H), 7.61 (m, 1H), 7.29 (m, 2H), 3.62 (s, 3H),
2.92 (d, J=4.0 Hz, 3H), 1.40 (s, 9H); MS (ESI) m/z: 554.2
(M+H.sup.+).
Example 252
[0736] Using general method D, B46 (89 mg, 0.378 noI),
triethylamine (44 mg, 0.435 mmol), Example A10 (125 mg, 0.378 mmol)
and diphenylphosphorylazide (120 mg, 0.435 mmol) were combined to
afford
1-(1-tert-butyl-5-(trifluoromethyl)-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-
-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)p-
henyl)urea (124 mg, 58% yield). MS (ESI) m/z: 564.0
(M+H.sup.+).
[0737] Using a procedure analogous to Example A1,
1-(1-tert-butyl-5-(trifluoromethyl)-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-
-5-(8-methyl-2-(methylthio)-7-oxo-7,8-dihydropyridol[2,3-d]pyrimidin-6-yl)-
phenyl)urea (148 mg, 0.263 mmol), MCPBA (81 mg, 0.328 mmol) and
2.0N methylamine in THF (1.3 mL) were combined to afford
1-(1-tert-butyl-5-(trifluoromethyl)-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-
-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-
phenyl)urea (103 mg, 71% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 1.59 (s, 9 H), 2.08 (s, 3H), 2.92 (s, 3H),
3.55-3.62 (m, 3H), 7.25-7.30 (m, 1H), 7.69 (s, 1H), 7.70-7.80 (m,
1H), 7.93 (s, 1H), 7.95-8.05 (m, 1H), 8.51 (s, 1H), 8.20-8.25 (m,
1H), 9.04 (s, 1H); MS (ESI) m/z: 547.2 (M+H.sup.+).
Example 253
[0738] Using general method D, Example B43 (50 mg, 0.18 mmol) and
Example A12 (54 mg, 0.18 mmol) in presence of DPPA (43 .mu.L, 0.20
mmol) and Et.sub.3N (28 .mu.L, 0.20 mmol) were combined to afford
1-(2-tert-butyl-4-(4-methylpiperazin-1-yl)pyrimidin-5-yl)-3-(2-fluoro-5-(-
8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phen-
yl)urea (78 mg, 60% yield). This was then treated with aqueous HCl
(0.100 M) to afford
1-(2-tert-butyl-4-(4-methylpiperazin-1-yl)pyrimidin-5-yl)-3-(2-fluoro-5-(-
8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phen-
yl)urea HCl salt (27 mg, 37% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6, major isomer): .delta. 9.92 (s, 1H), 8.64 (brs, 1H),
8.36 (dd, J=1.2, and 8.0 Hz, 1H), 8.33 (s, 1H), 7.20 (s, 1H), 7.85
(s, 1H), 7.81 (m, 1H), 7.28 (m, 2H),
Example 254
[0739] Using general method F, Example A39 (50 mg, 0.160 mmol) and
1-isocyanato-1,2,3,4-tetrahydronaphthalene (0.0275 mL, 0.175 mmol)
were combined to afford
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-(1,2,3,4-tetrahydronaphthalen-1-yl)urea
(73 mg, 94% yield) as a white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.69-8.61 (m, 1H), 8.15 (brs, 1H), 8.01 (d,
J=8.8 Hz, 1H), 7.82 (brq, 1H), 7.68 (s, 1H), 7.27-7.24 (m, 1H),
7.17-7.14 (m, 2H), 7.13-7.06 (m, 2H), 6.95 (d, J=8.41 Hz, 1H), 4.81
(m, 1H), 3.59 (brs, 3H), 2.92 (brs, 3H), 2.80-2.65 (m, 2H), 2.05
(s, 3H), 1.91-1.87 (m, 1H), 1.81-1.71 (m, 3H); MS (ESI) m/z: 487.3
(M+H.sup.+).
Example 255
[0740] Using general method D, Example B45 (78 mg, 0.428 mmol),
triethylamine (52 mg, 0.513 mmol), Example A17 (150 mg, 0.428 mmol)
and diphenylphosphorylazide (141 mg, 0.513 mmol) were combined to
afford
1-(1-tert-butyl-5-methyl-1H-pyrazol-4-yl)-3-(4-chloro-2-fluoro-5-(8-methy-
l-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(80 mg, 35% yield). MS (ESI) m/z: 530.02 (M.sup.+).
[0741] Using a procedure analogous to Example A1,
1-(1-tert-butyl-5-methyl-1H-pyrazol-4-yl)-3-(4-chloro-2-fluoro-5-(8-methy-
l-2-(methylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(80 mg, 0.151 mmol), MCPBA (47 mg, 0.189 mmol) and 2.0N methylamine
in THF (0.8 mL) were combined to afford
1-(1-tert-butyl-5-methyl-1H-pyrazol-4-yl)-3-(4-chloro-2-fluoro-5-(8-methy-
l-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(48 mg, 62% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
1.49 (s, 9H), 2.27 (s, 3H), 2.89 (s, 3H), 3.49-3.56 (m, 3H), 7.39
(s, 1H), 7.49 (d, 1H), 7.74 (s, 1H), 7.94 (br. s, 1H), 8.17 (d,
1H), 8.29 (s, 1H), 8.62-8.74 (m, 2H); MS (ESI) m/z: 513.0
(M+H.sup.+).
Example 256
[0742] Using general method D, Example B45 (84 mg, 0.460 mmol),
triethylamine (56 mg, 0.552 mmol), Example A30 (150 mg, 0.460 mmol)
and DPPA (152 mg, 0.552 mmol) were combined to afford
1-(1-tert-butyl-5-methyl-1H-pyrazol-4-yl)-3-(5-(1-ethyl-7-(methylamino)-2-
-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoro-4-methylphenyl)urea
(52 mg, 22% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
1.17 (t, 3H), 1.49 (s, 9H), 2.03 (s, 3H), 2.26 (s, 3H), 2.83 (s, 3
H), 4.11 (q, 2H), 6.23 (s, 1H), 7.05 (br. s, 1H), 7.08 (d, 1H),
7.38 (s, 1H), 7.63 (s, 1H), 7.92 (d, 1H), 8.08 (s, 1H), 8.38 (s,
1H), 8.40 (br. s, 1H); MS (ESI) m/z: 506.2 (M+H.sup.+).
Example 257
[0743] ((R)-Aminoindan hydrochloride (81 mg, 0.475 mmol) and
triphosgene (56.4 mg, 0.19 mmol) were combined in toluene (5 ml)
and stirred with heating at 110.degree. C. After 3 h, Example A39
(100 mg, 0.319 mmol) was added and the reaction was heated
overnight at 110.degree. C. The reaction was cooled to RT, diluted
with H.sub.2O and extracted with EtOAc (2.times.). The combined
organics were washed with satd. NaHCO.sub.3 (2.times.), H.sub.2O
(1.times.), and brine (1.times.), dried (MgSO.sub.4), filtered and
evaporated. The crude residue was triturated with
CH.sub.2Cl.sub.2/hexanes. The solids were collected by filtration,
rinsed well with hexanes and dried on the filter to afford
(R)-1-(2,3-dihydro-1H-inden-1-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(met-
hylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(92 mg, 62% yield) as a pale tan solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.61 (s, 1H), 8.19 (brs, 1H), 7.99 (d, J=8.4
Hz, 1H), 7.80 (brq, 1H), 7.67 (s, 1H), 7.29-7.16 (m, 4H), 7.07 (d,
J=12.4 Hz, 1H), 6.93 (d, J=8 Hz, 1H), 5.17-5.07 (m, 1H), 3.58 (brs,
3H), 2.90 (brs, 3H), 2.87-2.74 (m, 1H), 2.48-2.39 (m, 1H), 2.04 (s,
3H), 1.77-1.67 (m, 2H); MS (ESI) m/z: 473.0 (M+H.sup.+).
Example 258
[0744] Using a procedure analogous to Example 257, (S)-aminoindan
HCl (81 mg, 0.477 nmol), triphosgene (71.0 mg, 0.239 mmol) and
Example A39 (100 mg, 0.319 mmol) were combined and purified by
flash column chromatography (EtOAc/hexanes) to afford
(S)-1-(2,3-dihydro-1H-inden-1-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(met-
hylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(41 mg, 27% yield) as an off-white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.61 (s, 1H), 8.19 (brs, 1H), 7.99 (d, J=8.4
Hz, 1H), 7.80 (brq, 1H), 7.67 (s, 1H), 7.29-7.16 (m, 4H), 7.07 (d,
J=12.4 Hz, 1H), 6.93 (d, J=8 Hz, 1H), 5.17-5.07 (m, 1H), 3.58 (brs,
3H), 2.90 (brs, 3H), 2.87-2.74 (m, 1H), 2.48-2.39 (m, 1H), 2.04 (s,
3H), 1.77-1.67 (m, 2H); MS (ESI) m/z: 473.0 (M+H.sup.+).
Example 259
[0745] Using general method C, the TROC carbamate of Example B18
(80 mg, 0.25 mmol) and Example A36 (91 mg, 0.25 mmol) were combined
to afford
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(7-(methylamino)-2-oxo-1-phen-
yl-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea (31 mg, 25%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.4 (s, 1H),
8.75 (brs, 1H), 8.52 (s, 1H), 8.45 (dd, J=2.0, and 8.0 Hz, 1H),
8.04 (s, 1H), 7.2-7.7 (m, 7H), 7.01 (q, J=4.4 Hz, 1H), 6.08 (s,
1H), 5.32 (s, 1H), 2.69 (d, J=4.4 Hz, 2H), 1.25 (s, 9H); MS (ESI)
m/z: 527.0 (M+H.sup.+).
Example 260
[0746] Using general method C, the TROC carbamate of Example B18
(100 mg, 0.32 mmol) and Example A21 (122 mg, 0.32 mmol) were
combined to afford
1-(3-tert-butylisoxazol-5-yl)-3-(5-(8-cyclopentyl-2-(methylthio)-7-oxo-7,-
8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-methylphenyl)urea
(115 mg, 66% yield). MS (ESI) m/z: 551.0 (M+H.sup.+).
[0747] Using a procedure analogous to Example A1,
1-(3-tert-butylisoxazol-5-yl)-3-(5-(8-cyclopentyl-2-(methylthio)-7-oxo-7,-
8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-methylphenyl)urea
(115 mg, 0.21 nmol) was treated with mCPBA (70% wt, 62 mg, 0.25
mmol) and then 2 M methylamine (0.42 mL, 0.84 mmol) to afford
1-(3-tert-butylisoxazol-5-yl)-3-(5-(8-cyclopentyl-2-(methylamino)-7-oxo-7-
,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-methylphenyl)urea
(91 mg, 82% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major
isomer): .delta. 10.3 (s, 1H), 8.69 (d, J=2.0 Hz, 1H), 8.61 (brs,
1H), 7.89 (d, J=8.4 Hz, 1H), 7.79 (brs, 1H), 7.65 (s, 1H), 7.18 (d,
J=12.4 Hz, 1H), 6.03 (s, 1H), 5.94 (m, 1H), 2.91 (d, J=4.8 Hz, 3H),
2.33 (m, 2H), 2.09 (s, 3H), 1.98 (m, 2H), 1.81 (m, 2H), 1.63 (m,
2H), 1.24 (s, 9H); MS (ESI) m/z: 534.2 (M+H.sup.+).
Example 261
[0748] Using general method C, the TROC carbamate of Example B18
(100 mg, 0.32 mmol), and Example A19 (120 mg, 0.32 mmol) were
combined to afford
1-(3-tert-butylisoxazol-5-yl)-3-(5-(8-cyclopentyl-2-(methylthio)-7-oxo-7,-
8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluorophenyl)urea (105 mg,
62% yield); MS (ESI) m/z: 537. (M+H.sup.+).
[0749] Using a procedure analogous to Example A1,
1-(3-tert-butylisoxazol-5-yl)-3-(5-(8-cyclopentyl-2-(methylthio)-7-oxo-7,-
8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluorophenyl)urea (105 mg,
0.20 mmol) was treated with mCPBA (70% wt, 58 mg, 0.24 mmol) and
then 2 M methylamine (0.39 mL, 0.78 mmol) to afford
1-(3-tert-butylisoxazol-5-yl)-3-(5-(8-cyclopentyl-2-(methylamino)-7-oxo-7-
,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluorophenyl)urea (61 mg,
60% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major isomer):
.delta. 10.4 (s, 1H), 8.80 (d, J=2.0 Hz, 1H), 8.68 (s, 1H), 8.36
(m, 1H), 7.88 (s, 1H), 7.85 (m, 1H), 7.35 (m, 2H), 6.11 (s, 1H),
5.97 (m, 1H), 2.93 (d, J=4.8 Hz, 3H), 2.42 (m, 2H), 2.03 (s, 3H),
1.98 (m, 2H), 1.81 (m, 2H), 1.65 (m, 2H), 1.28 (s, 9H); MS (ESI)
m/z: 520.2 (M+H.sup.+).
Example 262
[0750] Using general method D, Example B50 (0.061 g, 0.34 mmol) and
Example A38 (0.1 g, 0.34 mmol) in presence of triethylamine (0.1 g,
1 mmol) and DPPA (0.18 g, 0.67 mmol) were combined to afford
1-(1-cyclopentyl-1H-pyrazol-4-yl)-3-(2-fluoro-5-(1-methyl-7-(methylamino)-
-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea as a white
solid (0.061 g, 38% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 8.66 (s, 1H), 8.42 (s, 1H), 8.39 (s, 1H), 8.35-8.33 (m,
1H), 7.79 (s, 1H), 7.73 (s, 1H), 7.32 (s, 1H), 7.18-7.16 (m, 2H),
7.03-7.00 (m, 1H), 6.11 (s, 1H), 4.58-4.51 (m, 1H), 3.47 (s, 3H),
2.80 (d, J=4.8 Hz, 3H), 2.00-1.93 (m, 2H), 1.85-1.64 (m, 4H),
1.59-1.50 (m, 2H); MS (ESI) m/z: 476.2 (M+H.sup.+).
Example 263
[0751] Using general method F, 1-isocyanatonaphthalene (0.051 g,
0.3 mmol) and Example A30 (0.1 g, 0.3 mmol) were combined to afford
1-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2--
fluoro-4-methylphenyl)-3-(naphthalen-1-yl)urea as a white solid
(0.115 g, 77% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
9.16 (s, 1H), 9.05 (s, 1H), 8.45 (s, 1H), 8.19 (d, J=8.4 Hz, 1H),
8.08-8.04 (m, 2H), 7.96 (d, J=7.6 Hz, 1H), 7.72 (s, 1H), 7.67-7.58
(m, 3H), 7.47 (t, J=8.0 Hz, 1H), 7.21 (d, J=12.4 Hz, 1H), 7.05-7.02
(m, 1H), 6.28 (s, 1H), 4.21-4.16 (m, 2H), 2.89 (d, J=4.8 Hz, 3H),
2.12 (s, 3H), 1.25 (t, J=6.8 Hz, 3H); MS (ESI) m/z: 496.3
(M+H.sup.+).
Example 264
[0752] Using general method C, the TROC carbamate of Example B18
(100 mg, 0.32 mmol) and Example A59 (110 mg, 0.32 mmol) were
combined to afford
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(8-isopropyl-2-(methylthio)-7-
-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (90 mg, 56%
yield). MS (ESI) m/z: 511.0 (M+H.sup.+).
[0753] Using a procedure analogous to Example A1,
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(8-isopropyl-2-(methylthio)-7-
-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (87 mg,
0.17 mmol) was treated with mCPBA (70% wt, 50 mg, 0.20 mmol) and
then 2 M methylamine (0.34 mL, 0.68 mmol) to afford
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(8-isopropyl-2-(methylamino)--
7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (48 mg,
57% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major isomer):
.delta. 10.4 (s, 1H), 8.82 (d, J=2.0 Hz, 1H), 8.69 (s, 1H), 8.42
(brd, J=8.0 Hz, 1H), 7.89 (s, 1H), 7.85 (q, J=4.4 Hz, 1H), 7.36 (m,
2H), 6.14 (s, 1H), 5.83 (brs, 1H), 2.97 (d, J=4.4 Hz, 3H), 1.66 (d,
J=6.4 Hz, 6H), 1.30 (s, 9H); MS (ESI) m/z: 494.2 (M+H.sup.+).
Example 265
[0754] To a stirring solution of Example A39 (0.100 g, 0.319 mmol)
in CH.sub.2Cl.sub.2 (5 ml) at 0.degree. C. was rapidly added 20 wt
% COCl.sub.2 in PhMe (0.185 ml, 0.351 mmol). After 10 min at
0.degree. C., Et.sub.3N (0.200 ml, 1.436 mmol) was then added. The
reaction was stirred at 0.degree. C. for another 10 min and then
treated with 8-methyl-8-azabicyclo[3.2.1]octan-3-amine
dihydrochloride (0.068 g, 0.319 mmol). The reaction was stirred at
RT overnight. The reaction was diluted generously with
CH.sub.2Cl.sub.2 and washed with brine (2.times.). The combined
aqueous were back-extracted with CH.sub.2Cl.sub.2 (2.times.). The
combined organics were washed with brine (1.times.), dried
(Na.sub.2SO.sub.4), filtered, evaporated and purified by reverse
phase chromatography (MeCN (w/0.1% TFA)/H.sub.2O (w/0.1% TFA)). The
TFA salt thus obtained was converted to the free base in the
presence of MP-Carbonate resin to afford
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-(8-methyl-8-aza-bicyclo[3.2.1]octan-3-yl)ur-
ea (43 mg, 28% yield) as a white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.37 (brs, 1H), 8.60 (brs, 1H), 8.40 (brs,
1H), 7.94 (d, J=8.8 Hz, 1H), 7.78 (brq, 1H), 7.64 (s, 1H), 7.09 (d,
J=12.4 Hz, 1H), 6.86-6.84 (m, 1H), 3.85-3.78 (m, 1H), 3.63-3.51
(brs, 3H), 2.91 (brs, 3H), 2.69 (brs, 3H), 2.32-2.30 (m, 6H), 2.05
(s, 3H), 1.95-1.91 (m, 2H); MS (ESI) m/z: 480.2 (M+H.sup.+).
Example 266
[0755] Using general method F,
1-isocyanato-3-(trifluoromethyl)benzene (0.055 ml, 0.401 mmol) and
Example A58 (0.131 g, 0.401 mmol) were combined and purified by
flash column chromatography (EtOAc/hexanes) and then by reverse
phase chromatography (MeCN (w/0.1% TFA)/H.sub.2O (w/0.1% TFA)). The
TFA salt thus obtained was converted to the free base with
MP-Carbonate resin to afford
1-(2-fluoro-5-(1-isopropyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyr-
idin-3-yl)phenyl)-3-(3-(trifluoromethyl)phenyl)urea (70 mg, 34%
yield) as a pale yellow solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.46 (s, 1H), 8.71 (s, 1H), 8.49 (s, 1H), 8.32 (d, J=8.4
Hz, 1H), 8.05 (s, 1H), 7.88 (s, 1H), 7.53-7.49 (m, 3H), 7.33-7.27
(m, 3H), 6.80 (s, 1H), 6.58 (brs, 1H), 2.91 (brs, 3H), 1.53 (d,
J=6.8 Hz, 6H); MS (ESI) m/z: 514.0 (M+H.sup.+).
Example 267
[0756] Using general method F, cyclohexyl isocyanate (0.051 ml,
0.399 mmol) and Example A58 (0.130 g, 0.399 mmol) were combined and
purified directly by reverse phase chromatography (MeCN (w/0.1%
TFA)/H.sub.2O (w/0.1% TFA)) to give impure product after
basification (2M Na2CO3) and extraction into EtOAc. The impure
product was re-purified by flash column chromatography
(EtOAc/hexanes) to afford
1-cyclohexyl-3-(2-fluoro-5-(1-isopropyl-7-(methylamino)-2-oxo-1,2-dihydro-
-1,6-naphthyridin-3-yl)phenyl)urea (40 mg, 22% yield) as a fluffy
white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.41 (s,
1H), 8.34 (d, J=8.4 Hz, 1H), 8.18 (brs, 1H), 7.74 (s, 1H),
7.17-7.15 (m, 2H), 6.95 (m, 1H), 6.86 (s, 1H), 6.59 (d, J=7.6 Hz,
1H), 6.43 (brs, 1H), 3.47-3.45 (m, 1H), 2.85 (d, J=4.80 Hz, 3H),
1.80-1.77 (m, 2H), 1.66-1.63 (m, 2H)<1.52 (d, J=6.8 Hz, 6H),
1.34-1.14 (m, 6H); MS (ESI) m/z: 452.2 (M+H.sup.+).
Example 268
[0757] Using a procedure analogous to Example 265, Example A39
(0.100 g, 0.319 mmol), 20 wt % COCl.sub.2 in PhMe (0.185 ml, 0.351
mmol) and 1-methylpiperidin-4-amine (0.036 g, 0.319 mmol) were
combined to afford
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-(1-methylpiperidin-4-yl)urea (63 mg,
44% yield) as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.37 (brs, 1H), 8.60 (brs, 1H), 8.40 (brs, 1H), 7.94 (d,
J=8.8 Hz, 1H), 7.78 (brq, 1H), 7.64 (s, 1H), 7.09 (d, J=12.4 Hz,
1H), 6.86-6.84 (m, 1H), 3.69 (brs, 3H), 3.52-3.42 (m, 1H),
3.22-3.08 (min, 4H), 2.91 (brs, 3H), 2.81 (brs, 3H), 2.040 (s, 3H),
2.02-1.79 (m, 4H); MS (ESI) m/z: 454.2 (M+H.sup.+).
Example 269
[0758] Using general method F, 1-isocyanatonaphthalene (0.045 g,
0.26 nmol) and Example A24 (0.1 g, 0.3 mmol) were combined to
afford
1-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2--
fluorophenyl)-3-(naphthalen-1-yl)urea as a white solid (0.062 g,
48% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.23 (s,
1H), 9.14 (s, 1H), 8.56-8.54 (m, 1H), 8.52 (s, 1H), 8.23 (d, J=8.4
Hz, 1H), 8.11 (d, J=7.6 Hz, 1H), 8.09 (d, J=7.6 Hz, 1H), 7.93 (s,
1H), 7.71-7.59 (m, 3H), 7.53 (t, J=8.0 Hz, 1H), 7.36-7.34 (m, 2H),
7.10-7.07 (m 1H), 6.29 (s, 1H), 4.23 (q, J=6.8 Hz, 2H), 2.92 (d,
J=4.8 Hz, 3H), 1.28 (t, J=7.2 Hz, 3H); MS (ESI) m/z: 482.0
(M+H.sup.+).
Example 270
[0759] Using general method D, Example B47 (0.071 g, 0.3 mmol) and
Example A12 (0.1 g, 0.33 mmol; DP-2201) in presence of
triethylamine (0.09 g, 0.89 mmol) and DPPA (0.16 g, 0.59 mmol) were
combined to afford
1-(1-(2-(dimethylamino)-2-oxoethyl)-5-isopropyl-1H-pyrazol-3-yl)-3-(2-flu-
oro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6--
yl)phenyl)urea as a white solid (0.075 g, 47% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 9.29 (s, 1H), 8.73 (s, 1H), 8.53
(d, J=8.4 Hz, 1H), 7.95 (s, 1H), 7.90-7.87 (m, 1H), 7.34-7.29 (m,
2H), 6.15-6.10 (m, 1H), 4.98 (s, 2H), 3.69 (s, 3H), 3.10 (s, 3H),
2.97 (d, J=4.8 Hz, 3H), 2.90-2.85 (m, 4H), 1.20 (d, J=6.4 Hz, 6H);
MS (ESI) m/z: 536.2 (M+H.sup.+).
Example 271
[0760] Using general method D, Example B44 (70 mg, 0.19 mmol) and
Example A4 (60 mg, 0.19 mmol) in presence of DPPA (55 .mu.L, 0.21
mmol) and Et.sub.3N (30 .mu.L, 0.21 mmol) were combined to afford
tert-butyl
4-(2-tert-butyl-5-(3-(5-(8-ethyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)-2-fluorophenyl)ureido)pyrimidin-4-yl)piperazine-1-ca-
rboxylate (50 mg, 39% yield). This was then treated with HCl (4.0
M, in dioxane) to afford
1-(2-tert-butyl-4-(piperazin-1-yl)pyrimidin-5-yl)-3-(5-(8-ethyl-2-(methyl-
amino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluorophenyl)urea
HCl salt (40 mg, 94% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6,
major isomer): .delta. 9.72 (brs, 1H), 9.66 (brs, 1H), 8.82 (brs,
1H), 8.58 (s, 1H), 8.38 (dd, J=1.6, and 7.6 Hz, 1H), 8.11 (brs,
1H), 7.98 (s, 1H), 7.38 (m, 2H), 4.44 (brs, 2H), 4.29 (brm, 4H),
3.35 (brm, 4H), 1.47 (s, 9H), 1.31 (brm, 3H); MS (ESI) m/z: 575.2
(M+H.sup.+).
Example 272
[0761] Using general method B, the carbamate of Example B31 (0.123
g, 0.493 mmol) and Example A3 (0.130 g, 0.411 mmol) were combined
to afford
1-(3-cyclopentyl-1-methyl-1H-pyrazol-5-yl)-3-(2-fluoro-5-(8-methyl-2-(met-
hylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.068 g, 33%) as a white solid. MS (ESI) m/z: 508.0
(M+H.sup.+).
[0762] Using a procedure analogous to Example A1,
1-(3-cyclopentyl-1-methyl-1H-pyrazol-5-yl)-3-(2-fluoro-5-(8-methyl-2-(met-
hylthio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.068 g, 0.134 mmol) and MeNH.sub.2 (2.0 M in THF, 1.4 mL) were
combined to afford
1-(3-cyclopentyl-1-methyl-1H-pyrazol-5-yl)-3-(2-fluoro-5-(8-methyl-
-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.013 g, 20%) as white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.02 (s, 1H), 8.89 (d, J=2.0 Hz, 1H), 8.73 (s, 1H), 8.49
(d, J=7.6 Hz, 1H), 7.95 (m, 1H), 7.92 (m, 1H), 7.38-7.34 (m, 2H),
6.11 (s, 1H), 3.70-3.68 (m, 6H), 2.99-2.94 (m, 4H), 1.99-1.94 (m,
2H), 1.73-1.68 (m, 2H), 1.67-1.60 (m, 4H); MS (ESI) m/z: 491.2
(M+H.sup.+).
Example 273
[0763] Using general method D, 2-fluoro-5-(trifluoromethyl)benzoic
acid (75 mg, 0.360 mmol), DPPA (0.116 ml, 0.541 mmol) and Example
A58 (129 mg, 0.396 mmol) were combined and purified by flash column
chromatography (10% EtOAc/hexanes to 100% EtOAc) to afford
1-(2-fluoro-5-(1-isopropyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyr-
idin-3-yl)phenyl)-3-(2-fluoro-5-(trifluoromethyl)phenyl)urea (111
mg, 58% yield) as a white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.37 (s, 1H), 9.17 (s, 1H), 8.63-8.61 (m,
1H), 8.44 (s, 1H), 8.37-8.35 (m, 1H), 7.82 (s, 1H), 7.53-7.48 (m,
1H), 7.41-7.38 (1H), 7.29-7.24 (m, 2H), 6.96 (brm, 1H), 6.44 (brs,
1H), 2.86 (d, J=4.4 Hz, 3H), 1.53 (d, J=6.8 Hz, 6H); MS (ESI) m/z:
532.0 (M+H.sup.+).
Example 274
[0764] Using general method F,
1-isocyanato-3-(trifluoromethyl)benzene (0.1 mg, 0.534 mmol) and
Example A33 (0.093 mg, 0.267 mmol) were combined to provide
1-(4-chloro-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-
-3-yl)-2-fluorophenyl)-3-(3-(trifluoromethyl)phenyl)urea (0.115 mg,
81% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.45 (s,
1H), 8.17 (d, J=9 Hz, 1H), 8.05 (s, 1H), 7.78 (s, 1H), 7.58 (d,
J=10.5 Hz, 1H), 7.52 (m, 2H), 7.35 (m, 1H), 7.08 (brs, 1H), 6.27
(s, 1H), 4.18 (q, J=6 Hz, 2H), 2.89 (brs, 3H), 1.24 (t, J=6 Hz,
3H); MS (ESI) m/z: 534.0 (M+H.sup.+).
Example 275
[0765] Using general method F,
1-chloro-4-isocyanato-2-(trifluoromethyl)benzene (0.100 g, 0.451
mmol) and Example A24 (0.141 g, 0.451 mmol) were combined to
provide
1-(4-chloro-3-(trifluoromethyl)phenyl)-3-(5-(1-ethyl-7-(methylamino)-2-ox-
o-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)urea (0.172 g,
7% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6); .delta. 9.54 (s,
1H), 8.72 (brs, 1H), 8.49 (s, 1H), 8.36 (m, 1H), 8.14 (brs, 1H),
7.91 (s, 1H), 7.64 (m, 2H), 7.38-7.26 (m, 2H), 7.05 (m, 1H), 6.27
(s, 1H), 4.18 (q, J=6 Hz, 2H), 2.89 (d, J=5.5 Hz, 3H), 1.25 (t, J=6
Hz, 3H; MS (ESI) m/z: 534.0 (M+H.sup.+).
Example 276
[0766] Using general method F, 1-isocyanatobenzene (0.05 g, 0.420
mmol) and Example A33 (0.146 g, 0.420 mmol) were combined to
provide
1-(4-chloro-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-
-3-yl)-2-fluorophenyl)-3-phenylurea (0.180 g, 92% yield). .sup.1H
NMR (400 MHz, DMSO-d.sub.6): .delta. 9.16 (s, 1H), 8.75 (s, 1H),
8.45 (s, 1H), 8.22 (d, J=9 Hz, 1H), 7.78 (s, 1H), 7.58 (d, J=10.5
Hz, 1H), 7.46 (s, 1H), 7.44 (s, 1H), 7.30 (m, 2H), 7.08 (m, 1H),
7.00 (s, 1H), 6.27 (s, 1H), 4.18 (q, J=5 Hz, 2H), 2.89 (d, J=5 Hz,
3H), 1.24 (t, J=6 Hz, 3H); MS (ESI) m/z: 466.0 (M+H.sup.+).
Example 277
[0767] Using general method D, 2,3-difluorobenzoic acid (0.100 g,
0.633 mmol) and Example A33 (0.219 g, 0.633 mmol) were combined to
provide
1-(4-chloro-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-
-3-yl)-2-fluorophenyl)-3-(2,3-difluorophenyl)urea (0.172 g, 54%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.27 (s, 1H),
9.24 (s, 1H), 8.45 (s, 1H)), 8.22 (d, J=10 Hz, 1H), 7.96 (m, 1H),
7.77 (s, 1H), 7.58 (d, J=12 Hz, 1H), 7.18-7.00 (m, 3H), 6.27 (s,
1H), 4.17 (q, J=6 Hz, 2H), 2.90 (d, J=5.5 Hz, 3H), 1.24 (t, J=6 Hz,
3H; MS (ESI) m/z: 502.0 (M+H.sup.+).
Example 278
[0768] Using a procedure analogous to Example 265, Example A39 (100
mg, 0.319 mmol), 20% COCl.sub.2 in PhMe (0.185 ml, 0.351 mmol) and
4-aminotetrahydropyran (32.3 mg, 0.319 mmol) were combined and
purified directly by reverse phase chromatography (MeCN (w/0.1%
TFA)/H.sub.2O (w/0.1% TFA)) to afford
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-(tetrahydro-2H-pyran-4-yl)urea (46
mg, 33% yield) as a nearly white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.60 (brs, 1H), 8.13 (brs, 1H), 7.92 (d,
J=8.4 Hz, 1H), 7.83 (brq, 1H), 7.65 (s, 1H), 7.06 (d, J=12.4 Hz,
1H), 6.64 (d, J=7.2 Hz, 1H), 3.81-3.76 (m, 2H), 3.68-3.57 (m, 1H),
3.59 (brs, 3H), 3.39-3.33 (m, 2H), 2.90 (brs, 3H), 2.04 (s, 3H),
1.79-1.76 (m, 2H), 1.38-1.30 (m, 2H); MS (ESI) m/z: 441.2
(M+H.sup.+).
Example 279
[0769] Using a procedure analogous to Example 265, Example A39
(0.100 g, 0.319 mmol), 20 wt % COCl.sub.2 in PhMe (0.185 ml, 0.351
mmol) and 1-Cbz-4-aminopiperidine (0.075 g, 0.319 mmol) were
combined and purified by flash column chromatography
(EtOAc/hexanes) to afford benzyl
4-(3-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyri-
do[2,3-d]pyrimidin-6-yl)phenyl)ureido) piperidine-1-carboxylate (80
mg, 44% yield) as a white solid. MS (ESI) m/z: 574.2
(M+H.sup.+).
[0770] Benzyl
4-(3-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyri-
do [2,3-d]pyrimidin-6-yl)phenyl)ureido)piperidine-1-carboxylate (80
mg, 0.139 mmol) was hydrogenated (1 atm) in MeOH (5 ml) over 10%
Pd/C (50% H.sub.2O) (98 mg, 0.046 mmol) After 3 h, the reaction
mixture was filtered through Celite, rinsing forward generously
with MeOH. The combined filtrates were concentrated to dryness. The
crude product was purified by reverse phase chromatography (MeCN
(w/0.1% TFA)/H.sub.2O (w/0.1% TFA)) to afford
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-(piperidin-4-yl)urea trifluoroacetic
acid salt (12 mg 15% yield) as a white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.54 (brs, 1H), 8.38 (brm, 1H), 8.14 (brm,
1H), 8.03 (brs, 1H), 7.84-7.74 (m, 2H), 7.58 (s, 1H), 7.02 (d,
J=12.4 Hz, 1H), 6.70 (d, J=7.2 Hz, 1H), 3.63 (m, 1H), 3.59 (brs,
3H), 3.15-3.13 (m, 2H), 2.97-2.92 (m, 2H), 2.90 (brs, 3H), 1.99 (s,
3H), 1.93-1.89 (m, 2H), 1.50-1.40 (m, 2H); MS (ESI) m/z: 440.2
(M+H.sup.+).
Example 280
[0771] Using general method C, the TROC carbamate of B18 (80 mg,
0.25 mmol) and Example A58 (83 mg, 0.254 mmol) were combined to
afford
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(1-isopropyl-7-(methylamino)--
2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea (43 mg, 34%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.4 (s, 1H),
8.82 (d, J=1.6 Hz, 1H), 8.51 (brs, 1H), 8.42 (dd, J=1.6, and 7.6
Hz, 1H), 7.90 (s, 1H), 7.38 (m, 1H), 7.06 (q, J=4.8 Hz, 1H), 6.52
(brs, 1H), 6.16 (s, 1H), 2.94 (d, J=4.8 Hz, 3H), 1.62 (d, J=7.2 Hz,
6H), 1.32 (s, 9H); MS (ESI) m/z: 493.2 (M+H.sup.+).
Example 281
[0772] Using general method F, Example A24 (100 mg, 0.320 mmol) and
alpha,alpha,alpha-trifluoro-m-tolyl isocyanate (0.066 ml, 0.480
nmol) were combined and purified by flash column chromatography (5%
EtOAc/hexanes to 100% EtOAc) to afford
1-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2--
fluorophenyl)-3-(3-(trifluoromethyl)phenyl)urea (8 mg, 5% yield) as
a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.47
(s, 1H), 8.68 (brs, 1H), 8.46 (s, 1H), 8.40-8.37 (m, 1H), 7.88 (s,
1H), 7.67-7.62 (m, 3H), 7.34-7.24 (m, 2H), 7.01 (brq, 1H), 6.23 (s,
1H), 4.16 (q, J=6.4 Hz, 2H), 2.86 (d, J=4.4 Hz, 3H), 1.23 (t, J=6.4
Hz, 3H); MS (ESI) m/z: 500.3 (M+H.sup.+).
Example 282
[0773] Using general method F, 1-isocyanatobenzene (0.036 g, 0.302
mmol) and Example A58 (0.1 g, 0.302 mmol) were combined to provide
1-(2-fluoro-5-(1-isopropyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyr-
idin-3-yl)phenyl)-3-phenylurea (0.94 g, 70% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 9.03 (s, 1H), 8.62 (s, 1H)), 8.49
(s, 1H), 8.42 (d, J=8 Hz, 1H), 7.86 (s, 1H), 7.52 (s, 1H), 7.50 (s,
1H), 7.32 (m, 4H), 7.03 (m, 2H), 6.50 (brs, 1H), 3.40 (s, 1H), 2.91
(d, J=6 Hz, 3H), 1.60 (d, J=6 Hz, 6H); MS (ESI) m/z: 446.3
(M+H.sup.+).
Example 283
[0774] Using general method B, the carbamate of Example B48 (0.084
g, 0.401 mmol) and Example A12 (0.060 g, 0.20 mmol) were combined
to afford
1-(2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyr-
imidin-6-yl)phenyl)-3-(1-isopropyl-1H-pyrazol-4-yl)urea (0.074 g,
82%) as white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.82 (s, 1H), 8.74 (s, 1H), 8.58 (d, J=1.6 Hz, 1H), 8.50 (d, J=8.0
Hz, 1H), 7.96-7.79 (m, 3H), 7.46 (s, 1H), 7.34-7.31 (m, 2H), 4.50
(m, 1H), 3.71 (s, 3H), 2.99 (m, 3H), 1.45 (d, J=6.8 Hz, 1H); MS
(ESI) m/z: 451.2 (M+H.sup.+).
Example 284
[0775] Using general method F, 1-isocyanatonaphthalene (0.05 g,
0.29 mmol) and Example A33 (0.1 g, 0.29 mmol) were combined to
afford
1-(4-chloro-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-
-3-yl)-2-fluorophenyl)-3-(naphthalen-1-yl)urea as a white solid
(0.121 g, 79% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
9.26 (brs, 2H), 8.48 (s, 1H), 8.32 (d, J=8.8 Hz, 1H), 8.21 (d,
J=8.8 Hz, 1H), 8.05 (dd, J=7.6 Hz, 0.8 Hz, 1H), 7.98 (d, J=8.4 Hz,
1H), 7.81 (s, 1H), 7.71-7.58 (m, 4H), 7.51 (t, J=8.0 Hz, 1H), 7.11
(q, J=4.8 Hz, 1H), 6.30 (s, 1H), 4.20 (q, J=6.8 Hz, 2H), 2.92 (d,
J=4.8 Hz, 3H), 1.27 (t, J=6.8 Hz, 3H); MS (ESI) m/z: 516.0
(M+H.sup.+).
Example 285
[0776] Using general method D, 2-fluoro-5-(trifluoromethyl)benzoic
acid (75 mg, 0.360 mmol), DPPA (0.116 ml, 0.541 mmol) and Example
A24 (124 mg, 0.396 mmol) were combined and purified by flash column
chromatography (5% EtOAc/hexanes to 100% EtOAc) to afford
1-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2--
fluorophenyl)-3-(2-fluoro-5-(trifluoromethyl)phenyl)urea (66 mg,
35% yield) as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.38 (brs, 1H), 9.18 (brs, 1H), 8.64-8.62 (m, 1H), 8.47 (s,
1H), 8.44-8.41 (m, 1H), 7.89 (s, 1H), 7.53-7.48 (m, 1H), 7.41-7.38
(m, 1H), 7.33-7.26 (m, 2H), 7.01 (brq, 1H), 6.23 (s, 1H), 4.17 (q,
J=7.6 Hz, 2H), 2.86 (d, J=4.4 Hz, 3H), 1.23 (t, J=7.6 Hz, 3H); MS
(ESI) m/z: 518.2 (M+H.sup.+).
Example 286
[0777] Using general method B, prop-1-en-2-yl
5-tert-butyl-1,3,4-thiadiazol-2-ylcarbamate (0.06 g, 0.25 mmol) and
Example A24 (0.08 g, 0.25 mmol) were combined to afford
1-(5-tert-butyl-1,3,4-thiadiazol-2-yl)-3-(5-(1-ethyl-7-(methylamino)-2-ox-
o-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)urea as a white
solid (0.08 g, 64% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 11.16 (s, 1H), 9.00 (s, 1H), 8.54 (s, 1H), 8.45 (d, J=6.4
Hz, 1H), 7.98 (s, 1H), 7.47-7.36 (m, 2H), 7.13-7.10 (m, 1H), 6.31
(s, 1H), 4.28-4.22 (m, 2H), 2.94 (d, J=4.8 Hz, 3H), 1.46 (s, 9H),
1.31 (t, J=6.8 Hz, 3H); MS (ESI) m/z: 496.3 (M+H.sup.+).
Example 287
[0778] Using general method B, prop-1-en-2-yl
5-tert-butyl-1,3,4-thiadiazol-2-ylcarbamate (0.07 g, 0.3 mmol), and
Example A30 (0.096 g, 0.29 mmol) were combined to afford
1-(5-tert-butyl-1,3,4-thiadiazol-2-yl)-3-(5-(1-ethyl-7-(methylamino)-2-ox-
o-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoro-4-methylphenyl)urea
as a white solid (0.09 g, 60% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 11.12 (s, 1H), 8.95 (s, 1H), 8.51 (s, 1H),
7.96 (d, J=8.8 Hz, 1H), 7.78 (s, 1H), 7.28 (d, J=7.6 Hz, 1H), 7.10
(d, J=4.8 Hz, 1H), 6.34 (s, 1H), 4.25 (q, J=6.8 Hz, 2H), 2.96 (d,
J=4.8 Hz, 3H), 2.18 (s, 3H), 1.45 (s, 9H), 1.31 (t, J=6.8 Hz, 3H);
MS (ESI) m/z: 510.2 (M+H.sup.+).
Example 288
[0779] Using general method D
3-tert-butyl-1-methyl-1H-pyrazole-5-carboxylic acid (0.051 g, 0.28
mmol) and Example A58 (0.09 g, 0.28 mmol) in presence of
triethylamine (0.06 g, 0.56 mmol) and DPPA (0.15 g, 0.56 mmol) were
combined to afford
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(2-fluoro-5-(1-isopropyl-7-(m-
ethylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea as
a white solid (0.085 g, 60% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.00 (s, 1H), 8.89 (s, 1H), 8.51 (s, 1H),
8.44-8.42 (m, 1H), 7.87 (s, 1H), 7.35-7.33 (m, 2H), 7.07-7.04 (m
1H), 6.52 (brs, 1H), 6.17 (s, 1H), 3.69 (s, 3H), 2.94 (d, J=4.8 Hz,
3H), 1.61 (d, J=7.2 Hz, 3H), 1.28 (s, 9H); MS (ESI) m/z: 506.2
(M+H.sup.+).
Example 289
[0780] Using general method D, Example B50 (0.041 g, 0.23 mmol) and
Example A12 (0.069 g, 0.23 mmol) were combined to afford
1-(1-cyclopentyl-1H-pyrazol-4-yl)-3-(2-fluoro-5-(8-methyl-2-(methylamino)-
-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.033 g,
30%) as a brown solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.82 (s, 1H), 8.75 (s, 1H), 8.58 (d, J=1.6 Hz, 1H), 8.50 (d, J=8.0
Hz, 1H), 7.96-7.79 (m, 3H), 7.47 (s, 1H), 7.35-7.32 (m, 2H), 4.70
(m, 1H), 3.71 (s, 3H), 2.99 (m, 3H), 2.14-2.09 (m, 2H), 1.98-1.92
(m, 2H), 1.86-1.82 (m, 2H), 1.71-1.97 (m, 2H); MS (ESI) m/z: 477.2
(M+H.sup.+).
Example 290
[0781] Using general method B, prop-1-en-2-yl
5-tert-butyl-1,3,4-thiadiazol-2-ylcarbamate (0.081 g, 0.33 mmol)
and Example A49 (0.11 g, 0.33 mmol) were combined to afford
1-(5-tert-butyl-1,3,4-thiadiazol-2-yl)-3-(2-fluoro-5-(8-isopropyl-2-(meth-
ylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
as a white solid (0.09 g, 52% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 11.17 (s, 1H), 9.02 (s, 1H), 8.73 (s, 1H),
8.42 (brs, 1H), 7.93 (s, 1H), 7.90-7.87 (m, 1H), 7.45-7.37 (m, 2H),
5.89 (brs, 1H), 3.00 (d, J=4.4 Hz, 3H), 1.69 (d, J=6.4 Hz, 6H),
1.47 (s, 9H); MS (ESI) m/z: 511.2 (M+H.sup.+).
Example 291
[0782] Using general method B, the carbamate of Example B19 (70 mg,
0.31 mmol) and Example A36 (80 mg, 0.28 mmol) were combined to
afford
1-(1-tert-butyl-1H-pyrazol-4-yl)-3-(2-fluoro-5-(7-(methylamino)-2-oxo-1-p-
henyl-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea (55 mg, 33%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.80 (s, 1H),
8.61 (s, 1H), 8.58 (brs, 1H), 8.53 (dd, J=1.6, and 7.6 Hz, 1H),
8.09 (s, 1H), 7.91 (s, 1H), 7.71 (m, 2H), 7.64 (m, 1H), 7.49 (s,
1H), 7.45 (m, 2H), 7.33 (m, 2H), 7.08 (q, J=4.0 Hz, 1H), 2.78 (d,
J=4.0 Hz, 3H), 1.57 (s, 9H); MS (ESI) m/z: 526.2 (M+H.sup.+).
Example 292
[0783] Using general method C, the TROC carbamate of Example B20
(80 mg, 0.27 mmol) and Example A36 (96 mg, 0.27 mmol) were combined
to afford
1-(2-fluoro-5-(7-(methylamino)-2-oxo-1-phenyl-1,2-dihydro-1,6-naphthyridi-
n-3-yl)phenyl)-3-(3-isopropylisoxazol-5-yl)urea (55 mg, 33% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.4 (s, 1H), 8.84 (s,
1H), 8.60 (s, 1H), 8.52 (dd, J=1.6, and 7.6 Hz, 1H), 8.12 (s, 1H),
7.67 (m, 3H), 7.41 (m, 4H), 7.09 (q, J=4.0 Hz, 1H), 6.12 (s, 1H),
5.40 (s, 1H), 2.98 (m, 1H), 2.77 (d, J=4.0 Hz, 1H), 1.28 (d, J=6.8
Hz, 3H); MS (ESI) m/z: 513.0 (M+H.sup.+).
Example 293
[0784] Using general method F, 3-(trifluoromethyl)phenylisocyanate
(50 mg, 0.274 mmol) and Example A40 (70 mg, 0.274 mmol) were
combined to afford
1-(2-fluoro-5-(2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)-3-(3-(trif-
luoromethyl)phenyl)urea (69 mg, 57% yield .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 12.2 (s, 1H), 9.44 (s, 1H), 8.93 (s, 1H),
8.72 (brs, 1H), 8.44 (m, 2H), 8.16 (s, 1H), 8.05 (brs, 1H), 7.52
(m, 2H), 7.41 (m, 1H), 7.32 (m, 2H), 7.22 (d, J=5.6 Hz, 1H); MS
(ESI) m/z: 443.0 (M+H.sup.+).
Example 294
[0785] Using general method C, the TROC carbamate of Example B20
(0.145 g, 0.482 mmol) and Example A26 (0.075 g, 0.0241 mmol) were
combined to afford
1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-
-1,6-naphthyridin-3-yl)phenyl)-3-(3-isopropylisoxazol-5-yl)urea
(0.0612 g, 55%) as white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 10.44 (s, 1H), 8.82 (s, 1H), 8.53 (s, 1H),
8.01 (d, J=8.4 Hz, 1H), 7.81 (s, 1H), 7.31 (d, J=12.4 Hz, 1H), 7.19
(m, 1H), 6.31 (s, 1H), 6.11 (s, 1H), 3.65 (s, 3H), 3.04-2.99 (m,
4H), 2.23 (s, 3H), 1.30 (d, J=7.2 Hz, 6H); MS (ESI) m/z: 465.2
(M+H.sup.+).
Example 295
[0786] Using general method C, the TROC carbamate of Example B20
(0.145 g, 0.482 mmol) and Example A30, 0.079 g, 0.0241 mmol) were
combined to afford
1-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-
-yl)-2-fluoro-4-methylphenyl)-3-(3-isopropylisoxazol-5-yl)urea
(0.017 g, 15%) as white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 10.31 (s, 1H), 8.68 (s, 1H), 8.41 (s, 1H), 7.88 (d, J=8.4
Hz, 1H), 7.68 (s, 1H), 7.17 (d, J=12.4 Hz, 1H), 7.01 (m, 1H), 6.25
(s, 1H), 5.98 (s, 1H), 4.15 (min, 1H), 2.91-2.86 (m, 4H), 2.09 (s,
3H), 1.24-1.16 (m, 9H); MS (ESI) m/z: 479.2 (M+H.sup.+).
Example 296
[0787] Using general method C, the TROC carbamate of Example B18
(0.152 g, 0.483 mmol) and Example A62, 0.079 g, 0.241 mmol) were
combined to afford
1-(3-tert-butylisoxazol-5-yl)-3-(4-chloro-3-(1-ethyl-7-(methylamino)-2-ox-
o-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea (0.0423 g, 36%) as
a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.25
(s, 1H), 9.02 (s, 1H), 8.45 (s, 1H), 7.78 (s, 1H), 7.58 (d, J=1.6
Hz, 1H), 7.50-7.41 (m, 2H), 7.10 (m, 1H), 6.28 (s, 1H), 6.08 (s,
1H), 4.18 (m, 2H), 2.90 (d, J=4.8 Hz, 3H), 1.27-1.19 (m, 12H); MS
(ESI) m/z: 495.2 (M+H.sup.+).
Example 297
[0788] A suspension of
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(methylt-
hio)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea from
Example 96 (15 mg, 0.030 mmol) in CH.sub.2Cl.sub.2 (1 mL) was
treated with mCPBA (70%, 8.94 mg, 0.036 mmol). After 30 min,
methanol (0.050 mL 1.2 mmol) and triethylamine (0.020 mL, 0.14
mmol) were added and the resultant mixture was heated to 40.degree.
C. overnight. The reaction was concentrated in vacuo and purified
by chromatography to provide
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(2-methoxy-8-methyl-7-oxo-7,8-
-dihydropyrido[2,3-d]pyrimidin-6-yl)-4-methylphenyl)urea. (8.6 mg,
59% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.32 (s,
1H), 8.93 (s, 1H), 8.72 (s, 1H), 7.93 (d, J=8.3 Hz, 1H), 7.90 (s,
1H), 7.20 (d, J=12.3 Hz, 1H), 6.00 (s, 1H), 4.02 (s, 3H), 3.63 (s,
3H), 2.09 (s, 3H), 1.21 (s, 9H); MS (ESI) m/z: 481.2
(M+H.sup.+).
Example 298
[0789] Using General Method F, Example A33 (100 mg, 0.288 mmol) and
cyclohexyl isocyanate (0.074 ml, 0.577 mmol) were reacted to afford
1-(4-chloro-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-
-3-yl)-2-fluorophenyl)-3-cyclohexylurea (37 mg, 27% yield) as a
white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.39 (s,
1H), 8.29 (d, J=2.0 Hz, 1H), 8.14 (d, J=8.8 Hz, 1H), 7.70 (s, 1H),
7.41 (D, J=11.2 Hz, 1H), 7.30 (brs, 1H), 6.80 (s, 1H), 6.61-6.58
(m, 2H), 6.28 (s, 1H), 4.08 (q, J=6.81 Hz, 2H), 3.40 (brm, 1H),
2.83 (s, 3H), 1.75-1.68 (m, 2H), 1.61-1.55 (m, 2H), 1.46-1.40 (m,
1H), 1.25-1.05 (m, 5H), 1.15 (t, J=7.2 Hz, 3H); MS (ESI) m/z: 472.2
(M+H), 474.2 (M+2+H.sup.+).
Example 299
[0790] By analogy to Example A11, Example A41 125 mg, 0.363 mmol),
mCPBA (107 mg, 0.436 mmol) and 2M MeNH.sub.2 in THF were reacted to
afford
6-(5-amino-4-fluoro-2-methylphenyl)-8-ethyl-2-(methylamino)pyrido[2,3-d]p-
yrimidin-7(8H)-one (67 mg, 0.205 mmol) which, in turn, was reacted
according to General Method F with cyclohexyl isocyanate (0.105 mL,
0.822 mmol) to afford
1-cyclohexyl-3-(5-(8-ethyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]-
pyrimidin-6-yl)-2-fluoro-4-methylphenyl)urea (11 mg, 12% yield) as
a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.60
(brs, 1H), 8.11-8.09 (m, 1H), 7.94-7.92 (m, 1H), 7.79 (brm, 1H),
7.62 (s, 1H), 7.05 (d, J=12.4 Hz, 1H), 6.54 (d, J=8.0 Hz, 1H), 4.33
(brq, 2H), 3.43-3.37 (m, 1H), 2.88 (d, J=4.0 Hz, 3H), 2.02 (s, 3H),
1.77-1.73 (m, 2H), 1.65-1.60 (m, 2H), 1.52-1.46 (m, 1H), 1.34-1.05
(m, 5H), 1.22 (brt, 3H); MS (ESI) m/z: 453.3 (M+H.sup.+).
Example 300
[0791] Using General Method F, Example A26 (0.100 g, 0.320 mmol)
and cyclohexyl isocyanate (0.041 ml, 0.320 mmol) were reacted to
afford
1-cyclohexyl-3-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-d-
ihydro-1,6-naphthyridin-3-yl)phenyl)urea (77 mg, 55% yield) as an
off-white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.38
(s, 1H), 8.10 (d, J=2.0 Hz, 1H), 7.93 (d, J=8.4 Hz, 1H), 7.63 (s,
1H), 7.06-7.02 (m, 2H), 6.54 (d, J=7.6 Hz, 1H), 6.17 (s, 1H), 3.50
(s, 3H), 3.46-3.36 (m, 1H), 2.85 (d, J=5.2 Hz, 3H), 2.03 (s, 3H),
1.81-1.75 (m, 2H), 1.73-1.56 (m, 2H), 1.48-1.45 (m, 1H), 1.38-1.09
(m, 5H); MS (ESI) m/z: 438.3 (M+H.sup.+).
Example 301
[0792] Using General Method B, Example B39 (125 mg, 0.66 mmol) and
Example A26 (114 mg, 0.366 mmol) were reacted to afford
1-(1-tert-butyl-1H-indazol-3-yl)-3-(2-fluoro-4-methyl-5-(1-methyl-7-(meth-
ylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea (77
mg, 40% yield) as a white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 10.04 (brs, 1H), 8.41 (s, 1H), 8.09 (dd,
J=8.4 and 14.0 Hz, 1H), 7.77 (d, J=8.4 Hz, 1H), 7.70 (s, 1H), 7.37
(dd, J=7.6 and 15.6 Hz, 1H), 7.20 (d, J=12.0 Hz, 1H), 7.09-7.05 (m,
2H), 6.19 (s, 1H), 3.52 (s, 3H), 2.86 (d, J=5.2 Hz, 3H), 2.09 (s,
3H), 1.72 (s, 9H); MS (ESI) m/z: 528.3 (M+H.sup.+).
Example 302
[0793] Using General Method B, Example B39 (125 mg, 0.66 mmol)
Example A28 (138 mg, 0.415 mmol) were reacted to afford
1-(1-tert-butyl-1H-indazol-3-yl)-3-(4-chloro-2-fluoro-5-(1-methyl-7-(meth-
ylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea (47
mg, 21% yield) as a white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 10.15 (brs, 1H), 8.42 (s, 1H), 8.33 (d,
J=8.8 Hz, 1H), 8.06 (d, J=7.6 Hz, 1H), 7.78 (dd, J=4.4 and 8.8 Hz,
1H), 7.62 (d, J=10.4 vHz, 1H), 7.40-7.36 (m, 1H), 7.13-7.06 (m,
2H), 6.18 (s, 1H), 3.51 (s, 3H), 2.86 (d, J=4.8 Hz, 3H), 1.72 (s,
9H); MS (ESI) m/z: 548.3 (M+H.sup.+), 550.3 (M+2+H.sup.+).
Example 303
[0794] Using general method D,
3-tert-butyl-1-methyl-1H-pyrazole-5-carboxylic acid (50 mg, 0.27
mmol) and Example A19 (0.10 g, 0.27 mmol) in presence of DPPA (65
.mu.L, 0.30 mmol) and Et.sub.3N (42 .mu.L, 0.30 mmol) were combined
to afford
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(5-(8-cyclopentyl-2-(methylth-
io)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluorophenyl)urea.
[0795] Using a procedure analogous to Example A1,
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(5-(8-cyclopentyl-2-(methylth-
io)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluorophenyl)urea
(150 mg, 0.27 mmol) was treated with mCPBA (70% wt, 74 mg, 0.30
mmol) and then 2 M methylamine (1.4 mL) to afford
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(5-(8-cyclopentyl-2-(methylam-
ino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluorophenyl)urea
(67 mg, 46% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major
isomer): .delta. 9.04 (s, 1H), 8.94 (d, J=2.4 Hz, 1H), 8.76 (brs,
1H), 8.46 (brd, J=7.6 Hz, 1H), 7.93 (s, 1H), 7.74 (brq, J=4.8 Hz,
1H), 7.38 (m, 2H), 6.21 (s, 1H), 6.04 (m, 1H), 3.73 (s, 3H), 3.01
(d, J=4.8 Hz, 3H), 2.49 (brs, 1H), 2.33 (brs, 1H), 2.11 (s, 3H),
2.11 (brs, 2H), 1.90 (brs, 2H), 1.74 (brs, 2H), 1.31 (s, 9H); MS
(ESI) m/z: 533.3 (M+H.sup.+).
Example 304
[0796] Using general method D, Example B45 (100 mg, 0.549 mmol),
triethylamine (64 mg, 0.631 mmol), Example A58 (179 mg, 0.549 mmol)
and DPPA (174 mg, 0.631 mmol) were coambined to provide
1-(1-tert-butyl-5-methyl-1H-pyrazol-4-yl)-3-(2-fluoro-5-(1-isopropyl-7-(m-
ethylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea
(101 mg, 36% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
1.68 (d, 6H), 1.69 (s, 9H), 2.46 (s, 3H), 3.00 (d, 3H), 4.16-4.18
(hep, 1H), 6.58 (br. s, 1H), 7.11 (br. s, 1H), 7.35-7.38 (m, 2H),
7.59 (s, 1H), 7.92 (s, 1H), 8.30 (s, 1H), 8.49-8.51 (m, 1H), 8.57
(s, 1H), 8.69 (br. s, 1H); MS (ESI) m/z: 506.2 (M+H.sup.+).
Example 305
[0797] Using general method D, Example B49 (134 mg, 0.501 mmol),
triethylamine (58 mg, 0.577 mmol), Example A13 (135 mg, 0.501 mmol)
and DPPA (159 mg, 0.577 nmol) were combined and purified by reverse
phase chromatography (Biotage C18-25 column, 30-100%
acetonitrile/water) to afford
1-(2-fluoro-5-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6--
yl)phenyl)-3-(2-methyl-4-(1-methyl-1H-indol-5-yl)pyrimidin-5-yl)urea
(34 mg, 12% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
2.60 (s, 3H), 3.69 (s, 3H), 3.83 (s, 3H), 6.55 (s, 1H), 7.30-7.32
(m, 2H), 7.41-7.42 (m, 1H), 7.48 (d, 1H), 7.60 (d, 1H), 7.91 (s,
1H), 8.13 (s, 1H), 8.47-8.49 (m, 1H), 8.58 (s, 1H), 9.05 (br. s,
1H), 9.10-9.25 (m, 2H), 9.11 (s, 1H); MS (ESI) m/z: 535.2
(M+H.sup.+).
Example 306
[0798] Using general method D, 2,3-difluorobenzoic acid (0.030 g,
0.190 mmol) was reacted with DPPA (0.0104 g, 0.380 mmol) in
presence of triethylamine (0.058 g, 0.569 mmol) in Dioxane (2 ml)
at room temp for 1 hour followed by treatment with Example A49
(0.062 g, 0.190 mmol) at 80.degree. C. for 2 hours to provide
1-(2,3-difluorophenyl)-3-(2-fluoro-5-(8-isopropyl-2-(methylamino)-7-oxo-7-
,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.065 g, 71%
yield). .sup.1HNMR (400 MHz, DMSO-d.sub.6): .delta. 9.31 (brs, 1H),
9.18 (s, 1H)), 8.72 s, 1H), 8.47 (d, J=7 Hz, 1H), 8.07 (m, 1H),
7.90 (s, 1H), 7.86 (m, 1H), 7.36 (d, J=8.5 Hz, 1H), 7.21 (m, 1H),
7.12 (m, 1H), 5.85 (brs, 1H), 2.90 (d, J=5 Hz, 3H), 1.67 (d, J=6
Hz, 6H); MS (ESI) m/z: 483.3 (M+H.sup.+).
Example 307
[0799] Using general method G, 2,2,2-trichloroethyl
pyridin-3-ylcarbamate (0.060 g, 0.223 mmol) was reacted with
Example A49 (0.073 g, 0.223 mmol) in presence of
N-methylpyrrolidine (0.019 g, 0.223 mmol) in dioxane (3 ml) at
90.degree. C. for 15 hours to provide
1-(2-fluoro-5-(8-isopropyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]-
pyrimidin-6-yl)phenyl)-3-(pyridin-3-yl)urea (0.025 g, 25% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.34 (s, 1H), 8.79 (s,
1H), 8.72 (s, 1H), 8.68 (d, J=2.5 Hz, 1H), 8.43 (d, J=8 Hz, 1H),
8.27 (m, 1H), 8.05 (m, 1H), 7.92 (s, 1H), 7.86 (m, 1H), 7.40 (dd,
J=9, 5 Hz, 1H), 7.37 (m, 2H), 5.85 (brs, 1H), 2.90 (d, J=5 Hz, 3H),
1.67 (d, J=6 Hz, 6H): MS (ESI) m/z: 448.2 (M+H.sup.+).
Example 308
[0800] Using general method F,
1-isocyanato-3-(rifluoromethyl)benzene (0.060 g, 0.321 mmol) was
reacted Example A49 (0.060 g, 0.183 mmol) in methylene chloride (2
ml) for 6 hours to provide
1-(2-fluoro-5-(8-isopropyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]-
pyrimidin-6-yl)phenyl)-3-(3-(trifluoromethyl)phenyl)urea (0.090 g,
95% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6: .delta. 9.52 (s,
1H), 8.79 (brs, 1H), 8.75 (s, 1H), 8.43 (d, J=8 Hz, 1H), 8.17 (s,
1H), 7.92 (s, 1H), 7.86 (m, 1H), 7.62 (m, 2H), 7.37 (m, 2H), 5.85
(brs, 1H), 2.90 (d, J=5 Hz, 3H), 1.67 (d, J=6 Hz, 6H); MS (ESI)
m/z: 515.2 (M+H.sup.+).
Example 309
[0801] Using general method F, 1-isocyanatobenzene (0.050 g, 0.420
mmol) was reacted with Example A49 (0.060 g, 0.183 mmol)in
methylene chloride (2 ml) for 6 hours to provide
1-(2-fluoro-5-(8-isopropyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]-
pyrimidin-6-yl)phenyl)-3-phenylurea (0.065 g, 79% yield). .sup.1H
NMR (400 MHz, DMSO-d.sub.6); .delta. 9.18 (s, 1H), 8.75 (s, 1N),
8.68 (brs, 1H), 8.48 (d, J=8 Hz, 1H), 7.93 (s, 1H), 7.89 (m, 1H),
7.56 (m, 2H), 7.38 (m, 4H), 7.10 (m, 1H), 5.85 (brs, 1H), 2.90 (d,
J=5 Hz, 3H), 1.67 (d, J=6 Hz, 6H); MS (ESI) m/z: 447.3
(M+H.sup.+).
Example 310
[0802] Using general method F, 1-isocyanatonaphthalene (0.060 g,
0.355 mmol) was reacted with Example A49 (0.060 g, 0.183 mmol) in
methylene chloride (2 ml) for 6 hours to provide
1-(2-fluoro-5-(8-isopropyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]-
pyrimidin-6-yl)phenyl)-3-(naphthalen-1-yl)urea, (0.070 g, 42%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.28 (s, 1H),
9.20 (s, 1H), 8.74 (s, 1H), 8.57 (d, J=8 Hz, 1H), 8.27 (d, J=9 Hz,
1H), 8.17 (m, 1H), 8.04 (m, 1H), 7.93 (s, 1H), 7.77-7.55 (m, 4H),
7.37 (m, 2H), 5.85 (brs, 1H), 2.90 (d, J=5 Hz, 3H), 1.67 (d, J=6
Hz, 6H); MS (ESI) m/z: 497.2.2 (M+H.sup.+).
Example 311
[0803] Using general method F,
1-chloro-4-isocyanato-2-(trifluoromethyl)benzene (0.06 g, 0.271
mmol) was reacted with Example A49 (0.06 g, 0.183 mmol) in
methylene chloride (2 ml) for 6 hours to provide
1-(4-chloro-3-(trifluoromethyl)phenyl)-3-(2-fluoro-5-(8-isopropyl-2-(meth-
ylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.080 g, 80% yield) .sup.1H NMR (400 MHz, DMSO-d.sub.6); .delta.
9.62 (s, 1H), 8.79 (s, 1H), 8.74 (s, 1H), 8.40 (d, J=8 Hz, 1H),
8.21 (s, 1H), 7.93 (s, 1H), 7.89 (m, 1H), 7.71 (s, 2H), 7.40 (m,
2H), 5.85 (brs, 1H), 2.90 (d, J=5 Hz, 3H), 1.67 (d, J=6 Hz, 6H): MS
(ESI) m/z: 549.0 (M+H.sup.+).
Example 312
[0804] Using general method F,
1-fluoro-2-isocyanato-4-(trifluoromethyl)benzene (0.060 g, 0.293
mmol) was reacted with Example A49 (0.06 g, 0.183 mmol) in
methylene chloride (2 ml) for 6 hours to provide
1-(2-fluoro-5-(8-isopropyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]-
pyrimidin-6-yl)phenyl)-3-(2-fluoro-5-(trifluoromethyl)phenyl)urea
(0.075 g, 48.2% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.51 (s, 1H), 9.31 (s, 1H), 8.76 (m, 2H), 8.50 (d, J=8 Hz,
1H), 7.95 (s, 1H), 7.90 (m, 1H), 7.63 (m, 1H), 7.52 (m, 1H), 7.42
(s, 1H), 7.40 (s, 1H), 5.85 (brs, 1H), 2.90 (d, J=5 Hz, 3H), 1.67
(d, J=6 Hz, 6H; MS (ESI) m/z: 533.0 (M+H.sup.+).
Example 313
[0805] Using general method F, 3-isocyanatobenzonitrile (0.06 g,
0.416 mmol) was reacted with Example A49 (0.06 g, 0.183 mmol) in
methylene chloride (2 ml) for 6 hours to provide
1-(3-cyanophenyl)-3-(2-fluoro-5-(8-isopropyl-2-(methylamino)-7-oxo-7,8-di-
hydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.068 g, 79% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.51 (s, 1H), 8.83 (s,
1H), 8.75 (s, 1H), 8.43 (d, J=8 Hz, 1H), 8.11 (m, 1H), 7.93 (s,
1H), 7.89 (m, 1H), 7.75 (m, 1H), 7.60 (t, J=8 Hz, 1H), 7.54 (m,
1H), 7.37 (m, 2H), 5.85 (brs, 1H), 2.90 (d, J=5 Hz, 3H), 1.67 (d,
J=6 Hz, 6H); MS (ESI) m/z: 472.2 (M+H.sup.+).
Example 314
[0806] Using general methode F, isocyanatocyclohexane (0.050 g,
0.399 mmol) was reacted with Example A49 (0.070 g, 0.214 mmol) in
pyridine (2 ml) at 50.degree. C. for 3 hours to provide
1-cyclohexyl-3-(2-fluoro-5-(8-isopropyl-2-(methylamino)-7-oxo-7,8-dihydro-
pyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.03 g, 31% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.74 (s, 1H), 8.47 d,
J=9 Hz, 1H), 8.31 (brs, 1H), 7.88 (s, 2H), 7.27 (m, 2H), 6.72 (d,
J=9 Hz, 1H), 5.87 (brs, 1H), 3.58 (m, 1H), 3.00 (d, J=5 Hz, 3H),
1.95-1.20 (m, 10H), 1.70 (d, J=6 Hz, 6H); MS (ESI) m/z: 453.3
(M+H.sup.+).
Example 315
[0807] Using general method F, isocyanatocyclohexane (0.050 g,
0.399 mmol) was reacted with Example A12 (0.070 g, 0.234 mmol) in
pyridine (2 ml) at 50.degree. C. for 3 hours provide
1-cyclohexyl-3-(2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyr-
ido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.045 g, 45% yield). .sup.1H
NMR (400 MHz, DMSO-d.sub.6:) .delta. 8.76 (s, 1H), 8.50 (d, J=9 Hz,
1H), 8.31 (brs, 1H), 7.88 (s, 2H), 7.29 (m, 2H), 6.72 (d, J=9 Hz,
1H), 3.71 (s, 3H), 3.58 (m, 1H), 3.00 (d, J=5 Hz, 3H), 1.95-1.20
(m, 10H); MS (ESI) m/z: 425.2 (M+H.sup.+).
Example 316
[0808] Using general Method F, isocyanatocyclohexane (0.100 g,
0.799 mmol) was reacted with Example A28 (0.100 g, 0.301 mmol) in
pyridine (2 ml) at 50.degree. C. for 2 hours to provide
1-(4-chloro-2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-cyclohexylurea (0.082 g, 60% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.39 (s, 1H), 8.32
(brs, 1H)), 8.17 (d, J=9 Hz, 1H), 7.70 (s, 1H), 7.43 (d, J=11.5 Hz,
1H), 7.08 (m, 1H), 6.62 (d, J=8 Hz, 1H), 6.15 (s, 1H), 3.49 (s,
3H), 3.41 (m, 1H), 2.86 (d, J=5 Hz, 3H), 1.85-1.45 (m, 5H),
1.35-1.20 (m, 5H); MS (ESI) m/z: 458.1 (M+H.sup.+).
Example 317
[0809] Using general method F, 1-isocyanatobenzene (0.050 g, 0.420
mmol) was reacted with Example A28 (0.070 g, 0.210 mmol) in
ethylacetate (2 ml) for 13 hours to provide
1-(4-chloro-2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-phenylurea (0.080 g, 84% yield). .sup.1H
NMR (400 MHz, DMSO-d.sub.6): .delta. 9.08 (s, 1H), 8.68 (brs, 1H)),
8.40 (s, 1H), 8.17 (d, J=9 Hz, 1H), 7.74 (s, 1H), 7.53 (d, J=11.5
Hz, 1H), 7.41 (m, 1H), 7.26 (m, 1H), 7.10 (m, 1H), 6.96 (m, 1H),
6.15 (s, 1H), 3.49 (s, 3H), 2.86 (d, J=5 Hz, 3H); MS (ESI) m/z:
452.0 (M+H.sup.+).
Example 318
[0810] Using general method F, 1-isocyanatonaphthalene (0.050 g,
0.296 mmol) was reacted with Example A28 (0.070 g, 0.210 mmol) in
ethylacetate (2 ml) at RT for 13 hours to provide
1-(4-chloro-2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(naphthalen-1-yl)urea, (0.07 g, 67%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.18 (s, 2H),
8.40 (s, 1H), 8.26 (d, J=9 Hz, 1H), 8.14 (d, J=9 Hz, 1H), 7.98 (d,
J=7 Hz, 1H), 7.90 (d, J=8 Hz, 1H), 7.74 (s, 1H), 7.60 (m, 3H), 7.43
(t, J=8 Hz, 1H), 7.11 (m, 1H), 7.26 (m, 1H), 6.16 (s, 1H), 3.49 (s,
3H), 2.86 (d, J=5 Hz, 3H); MS (ESI) m/z: 502.0 (M+H.sup.+).
Example 319
[0811] Using general method F,
1-chloro-4-isocyanato-2-(trifluoromethyl)benzene (0.070 g, 0.316
mmol) was reacted with Example A28 (0.070 g, 0.210 mmol) in ethyl
acetate (2 ml) for 13 hours to provide
1-(4-chloro-2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(4-chloro-3-(trifluoromethyl)phenyl)urea
(0.104 g, 89% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
9.54 (s, 1H), 8.83 (brs, 1H)), 8.43 (s, 1H), 8.12 (m, 2H), 7.77 (s,
1H), 7.65-7.50 (m, 3H), 7.12 (m, 1H), 6.15 (s, 1H), 3.52 (s, 3H),
2.86 (d, J=5 Hz, 3H); MS (ESI) m/z: 555.0 (M+H.sup.+).
Example 320
[0812] Using general method F,
1-fluoro-2-isocyanato-4-(trifluoromethyl)benzene (0.070 g, 0.341
mmol) was reacted with Example A28 (0.070 g, 0.210 mmol) in ethyl
acetae (2 ml) for 13 hours to provide 1-(4-chloro-2-fluoro-5
ethyl-7-(ethyl-7-methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phe-
nyl)-3-(2-fluoro-5-(trifluoromethyl)phenyl)urea (0.095 g, 84%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6) .delta. 9.41 (brs, 1H),
9.31 (brs, 1H)), 8.57 (dd, J=7, 2 Hz, 1H), 8.42 (s, 1H), 8.22 (d,
J=9 Hz, 1H), 7.77 (s, 1H), 7.58 (d, J=11.5 Hz, 1H), 7.51 (m, 1H),
7.40 (m, 1H), 7.10 (m, 1H), 6.15 (s, 1H), 3.51 (s, 3H), 2.86 (d,
J=5 Hz, 3H); MS (ESI) m/z:538.0 (M+H.sup.+).
Example 321
[0813] Using general method F, 3-isocyanatobenzonitrile (0.050 g,
0.347 mmol) was reacted with Example A28 (0.070 g, 0.210 mmol) in
ethyl acetate (2 ml) for 13 hours to provide
1-(4-chloro-2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(3-cyanophenyl)urea (0.090 g, 90% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.42 (s, 1H), 8.86
(brs, 1H), 8.44 (s, 1H), 8.17 (d, J=9 Hz, 1H), 7.99 (m, 1H), 7.77
(s, 1H), 7.63 (m, 1H), 7.58 (d, J=11.5 Hz, 1H), 7.51 (t, J=7 Hz,
1H), 7.45 (m, 1H), 7.14 (m, 1H), 6.19 (s, 1H), 3.52 (s, 3H), 2.86
(d, J=5 Hz, 3H); MS (ESI) m/z: 477.0 (M+H.sup.+).
Example 322
[0814] Using general method D, 2,3-difluorobenzoic acid (0.071 g,
0.449 mmol), triethylamine (0.091 g, 0.898 mmol), DPPA (0.124 g,
0.449 mmol) and Example A28 (0.100 g, 0.299 mmol) were combined to
provide
1-(4-chloro-2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(2,3-difluorophenyl)urea (0.070 g, 48%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.26 (brs,
1H), 9.22 (brs, 1H)), 8.42 (s, 1H), 8.20 (d, J=10 Hz, 1H), 7.94 (m,
1H), 7.77 (s, 1H), 7.57 (d, J=12 Hz, 1H), 7.12 (m, 2H), 7.04 (m,
1H), 6.18 (s, 1H), 3.51 (s, 3H), 2.86 (d, J=5 Hz, 3H); MS (ESI)
m/z: 488.0 (M+H.sup.+).
Example 323
[0815] Using general method F, isocyanatocyclohexane (0.100 g,
0.799 mmol) was reacted with Example A62 (0.100 g, 0.304 mmol) in
pyridine (2 ml) for 3 hours at 50.degree. C. to provide
1-(4-chloro-3-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-
-3-yl)phenyl)-3-cyclohexylurea (0.075 g, 54% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 8.46 (s, 1H), 8.40 (s, 1H)), 7.71
(s, 1H), 7.45 (s, 1H), 7.32 (brs, 2H), 7.04 (m, 1H), 6.24 (s, 1H),
6.11 (d, J=8 Hz, 1H), 6.25 (s, 1H), 6.00 (s, 1H), 4.15 (q, J=6 Hz,
2H), 3.43 (m, 1H), 2.86 (d, J=5 Hz, 3H), 1.85-1.50 (m, 5H),
1.35-1.20 (m, 5H), 1.20 (t, J=6 Hz, 3H); MS (ESI) m/z: 454.1
(M+H.sup.+).
Example 324
[0816] Using general method C, 2,2,2-trichloroethyl
3-isopropylisoxazol-5-ylcarbamnate (0.077 g, 0.255 mmol) was
reacted with Example A62 (0.070 g, 0.213 mmol) in dioxane (2 ml) in
presence of N-methylpyrrolidine (0.018 g, 0.213 mmol) at 80.degree.
C. for 4 hours to provide
1-(4-chloro-3-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naph-
thyridin-3-yl)phenyl)-3-(3-isopropylisoxazol-5-yl)urea (0.080 g,
78% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.2 (s,
1H), 9.00 (s, 1H)), 8.43 (s, 1H), 7.75 (s, 1H), 7.54 (d, J=2.5 Hz,
1H), 7.44 (m, 2H), 7.06 (m, 1H), 6.25 (s, 1H), 6.00 (s, 1H), 4.15
(q, J=6 Hz, 2H), 2.90 (m, 1H), 2.87 (d, J=6 Hz, 3H), 1.20 (m, 9H);
MS (ESI) m/z: 481.2 (M+H.sup.+).
Example 325
[0817] Using general method D,
3-tert-butyl-1-methyl-1H-pyrazole-5-carboxylic acid (50 mg, 0.27
mmol) and Example A21 (0.102 g, 0.27 mmol) in presence of DPPA (65
.mu.L, 0.30 mmol) and Et.sub.3N (42 .mu.L, 0.30 mmol) were combined
to afford
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(5-(8-cyclopentyl-2-(methylth-
io)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-methylphenyl)-
urea.
[0818] Using a procedure analogous to Example A1,
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(5-(8-cyclopentyl-2-(methylth-
io)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-methylphenyl)-
urea (150 mg, 0.27 mmol) was treated with mCPBA (70% wt, 74 mg,
0.30 mmol) and then 2 M methylamine (1.4 mL) to afford
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(5-(8-cyclopentyl-2-(methylam-
ino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-methylphenyl-
)urea (85 mg, 58% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major
isomer): .delta. 9.00 (s, 1H), 8.86 (d, J=2.0 Hz, 1H), 8.71 (brs,
1H), 8.04 (d, J=8.8 Hz, 1H), 7.90 (q, J=4.4 Hz, 1H), 7.75 (s, 1H),
7.26 (d, J=12.4 Hz, 1H), 6.17 (s, 1H), 6.06 (brm, 1H), 3.71 (s,
3H), 3.01 (d, J=4.4 Hz, 3H), 2.42 (brs, 2H), 2.18 (s, 3H), 2.07
(brs, 2H), 1.90 (brs, 2H), 1.72 (brs, 2H), 1.29 (s, 9H); MS (ESI)
m/z: 547.2 (M+H.sup.+).
[0819] The following examples are prepared by the methods described
in Schemes 1-12, General Methods A-G, the above Examples and the
methods described in WO 2006/071940. [0820]
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(2-fluoro-5-(1-isopropyl-7-(m-
ethylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-4-methylphenyl)urea,
1-(1-(2-(dimethylamino)ethyl)-5-isopropyl-1H-pyrazol-3-yl)-3-(2-fluoro-4--
methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-
-6-yl)phenyl)urea,
1-(2-tert-butyloxazol-5-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(methylami-
no)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(2-tert-butyloxazol-5-yl)-3-(4-chloro-2-fluoro-5-(8-methyl-2-(methylami-
no)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(2-tert-butyloxazol-5-yl)-3-(5-(8-ethyl-2-(methylamino)-7-oxo-7,8-dihyd-
ropyrido[2,3-d]pyrimidin-6-yl)-2-fluorophenyl)urea,
1-(5-tert-butyl-4-methylisoxazol-3-yl)-3-(5-(8-ethyl-2-(methylamino)-7-ox-
o-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)-2-fluoro-4-methylphenyl)urea,
1-(bicyclo[2.2.1]hept-5-en-2-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(meth-
ylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(bicyclo[2.2.1]heptan-2-yl)-3-(2-fluoro-4-methyl-5-(8-methyl-2-(methyla-
mino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-isopropylurea,
(R)-1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyr-
ido[2,3-d]pyrimidin-6-yl)phenyl)-3-(1-phenylethyl)urea,
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-(1-(pyridin-3-yl)ethyl)urea,
1-(2-fluoro-5-(1-(2-hydroxyethyl)-7-(methylamino)-2-oxo-1,2-dihydro-1,6-n-
aphthyridin-3-yl)-4-methylphenyl)-3-isopropylurea,
1-(5-(8-ethyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-y-
l)-2-fluorophenyl)-3-(5-(trifluoromethyl)pyridin-3-yl)urea,
1-(2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]pyr-
imidin-6-yl)phenyl)-3-(2-fluoro-5-(trifluoromethyl)phenyl)urea,
1-(2-fluoro-5-(8-(2-hydroxyethyl)-2-(methylamino)-7-oxo-7,8-dihydropyrido-
[2,3-d]pyrimidin-6-yl)phenyl)-3-(2-fluoro-5-(trifluoromethyl)phenyl)urea,
1-(4-chloro-2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-cyclohexylurea,
1-cyclohexyl-3-(2,4-difluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydr-
opyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(4-cyano-2-fluoro-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2-
,3-d]pyrimidin-6-yl)phenyl)-3-cyclohexylurea,
1-cyclohexyl-3-(5-(8-ethyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[2,3-d]-
pyrimidin-6-yl)-2-fluorophenyl)urea,
1-cyclohexyl-3-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-d-
ihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-cyclohexyl-3-(2-fluoro-5-(8-(2-hydroxyethyl)-2-(methylamino)-7-oxo-7,8--
dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-((1R,2R)-2-methylcyclohexyl)urea,
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-((1S,2S)-2-methylcyclohexyl)urea,
and
1-(2-fluoro-4-methyl-5-(8-methyl-2-(methylamino)-7-oxo-7,8-dihydropyrido[-
2,3-d]pyrimidin-6-yl)phenyl)-3-((1r,4r)-4-methylcyclohexyl)urea.
[0821] The following examples are prepared by the methods described
in Schemes 1-12, General Methods A-G, the above Examples and the
methods described in WO 2006/071940. [0822]
1-(4-tert-butylthiophen-2-yl)-3-(2-fluoro-4-methyl-5-(1-methyl-7-(methyla-
mino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(4-tert-butyl-3-methylthiophen-2-yl)-3-(2-fluoro-4-methyl-5-(1-methyl-7-
-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(4-tert-butyl-3-chlorothiophen-2-yl)-3-(2-fluoro-4-methyl-5-(1-methyl-7-
-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(4-tert-butyl-3-fluorothiophen-2-yl)-3-(2-fluoro-4-methyl-5-(1-methyl-7-
-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(4-tert-butyl-3-methylthiophen-2-yl)-3-(2-fluoro-5-(1-(2-hydroxyethyl)--
7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-4-methylphenyl)ur-
ea,
1-(1-tert-butyl-2-methyl-1H-pyrrol-3-yl)-3-(2-fluoro-4-methyl-5-(1-met-
hyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(1-tert-butyl-2-methyl-1H-pyrrol-3-yl)-3-(4-chloro-2-fluoro-5-(1-methyl-
-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(1-tert-butyl-2-methyl-1H-pyrrol-3-yl)-3-(2,4-difluoro-5-(1-methyl-7-(m-
ethylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(1-tert-butyl-2-methyl-1H-pyrrol-3-yl)-3-(5-(1-ethyl-7-(methylamino)-2--
oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoro-4-methylphenyl)urea,
1-(1-tert-butyl-2-methyl-1H-pyrrol-3-yl)-3-(5-(1-ethyl-7-(methylamino)-2--
oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)urea,
1-(1-tert-butyl-1H-pyrrol-3-yl)-3-(2-fluoro-4-methyl-5-(1-methyl-7-(methy-
lamino)-2-oxo-1,2-dihydro-1,6-naphthlyridin-3-yl)phenyl)urea,
1-(1-tert-butyl-4-chloro-1H-pyrrol-3-yl)-3-(2-fluoro-4-methyl-5-(1-methyl-
-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(4-tert-butyl-1-methyl-1H-pyrrol-2-yl)-3-(2-fluoro-4-methyl-5-(1-methyl-
-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(4-tert-butyl-1-methyl-1H-pyrrol-2-yl)-3-(5-(1-ethyl-7-(methylamino)-2--
oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)urea,
1-(4-tert-butyl-3-chloro-1-methyl-1H-pyrrol-2-yl)-3-(2-fluoro-4-methyl-5--
(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)u-
rea,
1-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-3-(2-fluoro-5-(1-isopropyl--
7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-4-methylphenyl)ur-
ea,
1-(2-tert-butyloxazol-5-yl)-3-(2-fluoro-4-methyl-5-(1-methyl-7-(methyl-
amino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(2-tert-butyloxazol-5-yl)-3-(4-chloro-2-fluoro-5-(1-methyl-7-(methylami-
no)-2-oxo-2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(2-tert-butyloxazol-5-yl)-3-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihyd-
ro-1,6-naphthyridin-3-yl)-2-fluorophenyl)urea,
1-(2-tert-butyloxazol-5-yl)-3-(2-fluoro-5-(1-(2-hydroxyethyl)-7-(methylam-
ino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-4-methylphenyl)urea,
1-(2-tert-butyloxazol-5-yl)-3-(4-chloro-2-fluoro-5-(1-(2-hydroxyethyl)-7--
(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(5-tert-butylisoxazol-3-yl)-3-(2-fluoro-5-(1-(2-hydroxyethyl)-7-(methyl-
amino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-4-methylphenyl)urea,
1-(5-tert-butyl-4-methylisoxazol-3-yl)-3-(5-(1-ethyl-7-(methylamino)-2-ox-
o-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoro-4-methylphenyl)urea,
1-(4-tert-butylfuran-2-yl)-3-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamin-
o)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(4-tert-butyl-3-chlorofuran-2-yl)-3-(2-fluoro-4-methyl-5-(1-methyl-7-(m-
ethylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(4-tert-butyl-3-fluorofuran-2-yl)-3-(2-fluoro-4-methyl-5-(1-methyl-7-(m-
ethylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(4-tert-butyl-3-methylfuran-2-yl)-3-(2-fluoro-5-(1-(2-hydroxyethyl)-7-(-
methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-4-methylphenyl)urea,
1-cyclopropyl-3-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2--
dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-isopropylurea,
(R)-1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,-
6-naphthyridin-3-yl)phenyl)-3-(1-phenylethyl)urea,
1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(1-(pyridin-3-yl)ethyl)urea,
1-(5-(1-cyclopentyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3--
yl)-2-fluoro-4-methylphenyl)-3-isopropylurea,
1-(2-fluoro-5-(1-((3R)-3-hydroxycyclopentyl)-7-(methylamino)-2-oxo-1,2-di-
hydro-1,6-naphthyridin-3-yl)-4-methylphenyl)-3-isopropylurea,
1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(5-(trifluoromethyl)pyridin-3-yl)urea,
1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(4-methyl-5-(trifluoromethyl)pyridin-3-yl)urea,
1-(2,4-difluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthy-
ridin-3-yl)phenyl)-3-(5-(trifluoromethyl)pyridin-3-yl)urea,
1-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2--
fluorophenyl)-3-(5-(trifluoromethyl)pyridin-3-yl)urea,
1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(4-fluoro-5-(trifluoromethyl)pyridin-3-yl)urea,
1-(4-chloro-2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(5-(trifluoromethyl)pyridin-3-yl)urea,
1-(2-fluoro-5-(1-(2-hydroxyethyl)-7-(methylamino)-2-oxo-1,2-dihydro-1,6-n-
aphthyridin-3-yl)phenyl)-3-(5-(trifluoromethyl)pyridin-3-yl)urea,
1-(5-(7-amino-1-methyl-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoro--
4-methylphenyl)-3-(3-(trifluoromethyl)phenyl)urea,
1-(2-fluoro-5-(1-(2-hydroxyethyl)-7-(methylamino)-2-oxo-1,2-dihydro-1,6-n-
aphthyridin-3-yl)-4-methylphenyl)-3-(3-(trifluoromethyl)phenyl)urea,
1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-(2-fluoro-5-(trifluoromethyl)phenyl)urea,
1-(2-fluoro-5-(1-(2-hydroxyethyl)-7-(methylamino)-2-oxo-1,2-dihydro-1,6-n-
aphthyridin-3-yl)-4-methylphenyl)-3-(2-fluoro-5-(trifluoromethyl)phenyl)ur-
ea,
1-(2-fluoro-5-(1-(2-hydroxyethyl)-7-(methylamino)-2-oxo-1,2-dihydro-1,-
6-naphthyridin-3-yl)phenyl)-3-(2-fluoro-5-(trifluoromethyl)phenyl)urea,
1-(1-tert-butyl-5-(hydroxymethyl)-H-pyrazol-4-yl)-3-(4-chloro-2-fluoro-5--
(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)u-
rea,
1-(1-tert-butyl-5-(hydroxymethyl)-1H-pyrazol-4-yl)-3-(2-fluoro-4-meth-
yl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phe-
nyl)urea,
1-(1-tert-butyl-5-(hydroxymethyl)-1H-pyrazol-4-yl)-3-(2,4-difluo-
ro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phe-
nyl)urea,
1-(1-tert-butyl-5-(1-hydroxyethyl)-1H-pyrazol-4-yl)-3-(4-chloro--
2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3--
yl)phenyl)urea,
1-(1-tert-butyl-5-(1-hydroxyethyl)-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl--
5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl-
)urea,
1-(1-tert-butyl-5-(1-hydroxyethyl)-1H-pyrazol-4-yl)-3-(2,4-difluoro-
-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)pheny-
l)urea,
1-(1-tert-butyl-5-ethyl-1H-pyrazol-4-yl)-3-(4-chloro-2-fluoro-5-(1-
-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)ure-
a,
1-(1-tert-butyl-5-ethyl-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-5-(1-meth-
yl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(1-tert-butyl-5-ethyl-1H-pyrazol-4-yl)-3-(2,4-difluoro-5-(1-methyl-7-(m-
ethylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(1-tert-butyl-5-methyl-1H-pyrazol-4-yl)-3-(2-fluoro-4-methyl-5-(1-methy-
l-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(1-tert-butyl-5-methyl-1H-pyrazol-4-yl)-3-(4-chloro-2-fluoro-5-(1-methy-
l-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(1-tert-butyl-5-methyl-1H-pyrazol-4-yl)-3-(2,4-difluoro-5-(1-methyl-7-(-
methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-cyclohexyl-3-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-d-
ihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-cyclohexyl-3-(5-(1-ethyl-7-(nethylamino)-2-oxo-1,2-dihydro-1,6-naphthyr-
idin-3-yl)-2-fluoro-4-methylphenyl)urea,
1-cyclohexyl-3-(2-fluoro-5-(1-isopropyl-7-(methylamino)-2-oxo-1,2-dihydro-
-1,6-naphthyridin-3-yl)-4-methylphenyl)urea,
1-cyclohexyl-3-(2-fluoro-5-(1-isopropyl-7-(methylamino)-2-oxo-1,2-dihydro-
-1,6-naphthyridin-3-yl)phenyl)urea,
1-cyclohexyl-3-(5-(1-cyclopentyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)-2-fluorophenyl)urea,
1-cyclohexyl-3-(5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyr-
idin-3-yl)-2-fluorophenyl)urea,
1-cyclohexyl-3-(2-fluoro-5-(1-((3R)-3-hydroxycyclopentyl)-7-(methylamino)-
-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-cyclohexyl-3-(2-fluoro-5-(1-((3R)-3-hydroxycyclopentyl)-7-(methylamino)-
-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-4-methylphenyl)urea,
1-cyclohexyl-3-(2-fluoro-5-(1-(1-hydroxypropan-2-yl)-7-(methylamino)-2-ox-
o-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(4-chloro-2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-cyclohexylurea,
1-cyclohexyl-3-(2,4-difluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydr-
o-1,6-naphthyridin-3-yl)phenyl)urea,
1-(4-cyano-2-fluoro-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-nap-
hthyridin-3-yl)phenyl)-3-cyclohexylurea,
1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-((1R,2R)-2-methylcyclohexyl)urea,
1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-((1S,2S)-2-methylcyclohexyl)urea,
1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
phthyridin-3-yl)phenyl)-3-((1r,4r)-4-methylcyclohexyl)urea,
1-(3-tert-butylisoxazol-5-yl)-3-(5-(1-cyclopentyl-7-(methylamino)-2-oxo-1-
,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)urea,
1-(3-cyclopentylisoxazol-5-yl)-3-(2-fluoro-4-methyl-5-(1-methyl-7-(methyl-
amino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(5-(7-amino-1-ethyl-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoroph-
enyl)-3-(3-tert-butylisoxazol-5-yl)urea,
1-(5-(7-amino-1-ethyl-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoro-4-
-methylphenyl)-3-(3-tert-butylisoxazol-5-yl)urea,
1-(3-tert-butylisoxazol-5-yl)-3-(4-chloro-2-fluoro-5-(1-(2-hydroxyethyl)--
7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(1-(2-hydroxyethyl)-7-(methyl-
amino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-4-methylphenyl)urea,
1-(2-fluoro-4-methyl-5-(1-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-na-
plhthyridin-3-yl)phenyl)-3-(3-isopropylisoxazol-5-yl)urea,
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(1-isopropyl-7-(methylamino)--
2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-4-methylphenyl)urea,
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(1-(2-hydroxyethyl)-7-(methyl-
amino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(5-(7-amino-1-methyl-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoro--
4-methylphenyl)-3-(3-tert-butylisoxazol-5-yl)urea,
1-(3-cyclopentylisoxazol-5-yl)-3-(2-fluoro-5-(1-(2-hydroxyethyl)-7-(methy-
lamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-4-methylphenyl)urea,
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(1-(2-hydroxyethyl)-7-(methyl-
amino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-4-methylphenyl)urea,
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(1-(2-hydroxyethyl)-7-(methyl-
amino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(1-((3R)-3-hydroxycyclopentyl-
)-7-(methylarino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-4-methylphenyl)-
urea,
1-(3-tert-butylisoxazol-5-yl)-3-(2-fluoro-5-(1-((3R)-3-hydroxycyclop-
entyl)-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea-
,
1-(3-tert-butyl-4-methylisoxazol-5-yl)-3-(2-fluoro-4-methyl-5-(1-methyl--
7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(3-tert-butyl-4-chloroisoxazol-5-yl)-3-(2-fluoro-4-methyl-5-(1-methyl-7-
-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(3-tert-butyl-4-fluoroisoxazol-5-yl)-3-(2-fluoro-4-methyl-5-(1-methyl-7-
-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(3-tert-butyl-4-methylisoxazol-5-yl)-3-(2-fluoro-5-(1-(2-hydroxyethyl)--
7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-4-methylphenyl)ur-
ea,
1-(3-tert-butyl-4-chloroisoxazol-5-yl)-3-(2-fluoro-5-(1-(2-hydroxyethy-
l)-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-4-methylphenyl-
)urea,
1-(3-tert-butyl-4-fluoroisoxazol-5-yl)-3-(2-fluoro-5-(1-(2-hydroxye-
thyl)-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-4-methylphe-
nyl)urea,
1-(5-tert-butyl-1,3,4-thiadiazol-2-yl)-3-(4-chloro-2-fluoro-5-(1-
-methyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)ure-
a,
1-(5-tert-butyl-1,3,4-thiadiazol-2-yl)-3-(5-(1-ethyl-7-(methylamino)-2--
oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)urea,
1-(5-tert-butyl-1,3,4-thiadiazol-2-yl)-3-(2-fluoro-5-(1-(2-hydroxyethyl)--
7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(5-tert-butyl-1,3,4-thiadiazol-2-yl)-3-(2-fluoro-5-(1-(2-hydroxyethyl)--
7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-4-methylphenyl)ur-
ea,
1-(5-tert-butyl-1,3,4-thiadiazol-2-yl)-3-(2,4-difluoro-5-(1-(2-hydroxy-
ethyl)-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea-
,
1-(1-tert-butyl-5-methyl-1H-imidazol-4-yl)-3-(2-fluoro-4-methyl-5-(1-met-
hyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(1-tert-butyl-5-chloro-1H-imidazol-4-yl)-3-(2-fluoro-4-methyl-5-(1-meth-
yl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(1-tert-butyl-5-fluoro-1H-imidazol-4-yl)-3-(2-fluoro-4-methyl-5-(1-meth-
yl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea,
1-(1-tert-butyl-5-methyl-1H-iidazol-4-yl)-3-(5-(1-ethyl-7-(methylamino)-2-
-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoro-4-methylphenyl)urea,
1-(1-tert-butyl-5-methyl-1H-imidazol-4-yl)-3-(5-(1-ethyl-7-(methylamino)--
2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)urea, and
1-(1-tert-butyl-5-methyl-1H-imidazol-4-yl)-3-(2-fluoro-5-(1-(2-hydroxyeth-
yl)-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)phenyl)urea.
[0823] B-Raf(V600E) Kinase Assay
[0824] The activity of B-Raf(V600E) kinase was determined by
following the formation of ADP from the reaction through coupling
with the pyruvate kinase/lactate dehydrogenase system (e.g.,
Schindler, et al. Science (2000) 289, 1938-1942). In this assay,
the oxidation of NADH (thus the decrease at A.sub.340nm) was
continuously monitored spectrophotometrically. The reaction mixture
(100 .mu.l) contained B-Raf(V600E) kinase (2.1 nM nominal
concentration), unphosphorylated, full-length MEK1 (45 nM),
MgCl.sub.2 (13 mM), pyruvate kinase (3.5 units), lactate
dehydrogenase (5.5 units), phosphoenolpyruvate (1 mM), and NADH
(0.28 mM), in 60 mM Tris buffer, containing 0.13% octyl-glucoside
and 3.5% DMSO concentration at pH 7.5. The test compounds were
incubated with the reaction mixture at 30.degree. C. for 2 h or 4
h. The reaction was initiated by adding ATP (0.2 mM, final
concentration). The absorption at 340 m was continuously monitored
for 3 h at 30.degree. C. on a Polarstar Optima plate reader (BMG).
The reaction rate was calculated using the 1.5 h to 2.5 h time
frame. Percent inhibition was obtained by comparison of reaction
rate with that of a control (i.e. with no test compound). IC.sub.50
values were calculated from a series of percent inhibition values
determined at a range of inhibitor concentrations using software
routines as implemented in the GraphPad Prism software package.
TABLE-US-00001 B-Raf(V600E)protein sequence used for screening:
(SEQ. ID NO. 1) EDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDV
AVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIV
TQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRD
LKSNNIFLHEDLTVKIGDFGLATEKSRWSGSHQFEQLSGSILWMAPEV
IRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRG
YLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARS LPKIHR MEK1
protein sequence used for screening: (SEQ. ID NO. 2)
MELKDDDFEKISELGAGNGGVVFKVSHRPSGLVMARKLIHLEIKPAIR
NQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLK
KAGRIPEQILGKVSIAVIKGLTYLREKHKIMERDVKPSNILVNSRGEI
KLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLS
LVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRIPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAE
RADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
[0825] C-Raf Kinase Assay
[0826] The activity of C-Raf kinase was determined by following the
formation of ADP from the reaction through coupling with the
pyruvate kinase/lactate dehydrogenase system (e.g., Schindler, et
al. Science (2000) 289, 1938-1942). In this assay, the oxidation of
NADH (thus thle decrease at A.sub.340nm) was continuously monitored
spectrophotometrically. The reaction mixture (100 .mu.l) contained
C-Raf kinase (0.28 nM nominal concentration, available from
Upstate, catalogue #14-352), unphosphorylated, full-length MEK1 (27
nM), MgCl.sub.2 (13 mM), pyruvate kinase (3.5 units), lactate
dehydrogenase (5.5 units), phosphoenolpyruvate (1 mM), and NADH
(0.28 mM), in 60 mM Tris buffer, containing 0.13% octyl-glucoside
and 3.5% DMSO concentration at pH 7.5. The test compounds were
incubated with the reaction mixture at 30.degree. C. for 2 h or 4
h. The reaction was initiated by adding ATP (0.2 mM, final
concentration). The absorption at 340 nm was continuously monitored
for 3 h at 30.degree. C. on a Polarstar Optima plate reader (BMG).
The reaction rate was calculated using the 1.0 h to 2.0 h time
framne. Percent inhibition was obtained by comparison of reaction
rate with that of a control (i.e. with no test compound). IC.sub.50
values were calculated from a series of percent inhibition values
determined at a range of inhibitor concentrations using software
routines as implemented in the GraphPad Prism software package.
[0827] In general, compounds 1-325 disclosed herein had >50%
inhibition activity at 0.2-2 uM concentration against V600E BRaf
and CRaf kinases utilizing the above assay conditions. Cell
Culture: A-375 cells were obtained from American Type Culture
Collection (Rockville, Md.). Briefly, cells were grown in
Dulbecco's Modified Eagle Medium with 4.5 g/L glucose, 6 mM
L-glutamine, and 10% certified fetal bovine serum (Invitrogen,
Carlsbad, Calif.) at 37 degrees Celsius, 5% CO2, 95% humidity.
Cells were allowed to expand until reaching 80% confluency at which
point they were subcultured or harvested for assay use.
[0828] Cell Proliferation Assay
[0829] A serial dilution of test compound was dispensed into a 96
well black clear bottom plate (Corning, Corning, N.Y.). Five
thousand cells (A375) were then added to each well in growth
medium. Plates were incubated for 72 hours at 37 degrees Celsius,
5% CO2, 95% humidity. At the end of the incubation period Cell
Titer Blue (Promega, Madison, Wis.) was added to each well and an
additional 4.5 hour incubation at 37 degrees Celsius, 5% CO2, 95%
humidity was performed. Plates were then read on a BMG Fluostar
Optima (BMG, Durham, N.C.) using an excitation of 544 nM and an
emission of 612 nM. Data was analyzed using Prism software
(Graphpad, San Diego, Calif.) to calculate IC.sub.50 values.
[0830] In general, compounds I-325 disclosed herein had >50%
inhibition activity at 1-10 uM concentration against A375 cells
utilizing the above assay conditions.
[0831] All references mentioned or referred to herein are
incorporated by reference into this disclosure.
Sequence CWU 1
1
21294PRTHomo sapiensMISC_FEATUREB-Raf(V600E) 1Glu Asp Arg Asn Arg
Met Lys Thr Leu Gly Arg Arg Asp Ser Ser Asp1 5 10 15Asp Trp Glu Ile
Pro Asp Gly Gln Ile Thr Val Gly Gln Arg Ile Gly 20 25 30Ser Gly Ser
Phe Gly Thr Val Tyr Lys Gly Lys Trp His Gly Asp Val 35 40 45Ala Val
Lys Met Leu Asn Val Thr Ala Pro Thr Pro Gln Gln Leu Gln 50 55 60Ala
Phe Lys Asn Glu Val Gly Val Leu Arg Lys Thr Arg His Val Asn65 70 75
80Ile Leu Leu Phe Met Gly Tyr Ser Thr Lys Pro Gln Leu Ala Ile Val
85 90 95Thr Gln Trp Cys Glu Gly Ser Ser Leu Tyr His His Leu His Ile
Ile 100 105 110Glu Thr Lys Phe Glu Met Ile Lys Leu Ile Asp Ile Ala
Arg Gln Thr 115 120 125Ala Gln Gly Met Asp Tyr Leu His Ala Lys Ser
Ile Ile His Arg Asp 130 135 140Leu Lys Ser Asn Asn Ile Phe Leu His
Glu Asp Leu Thr Val Lys Ile145 150 155 160Gly Asp Phe Gly Leu Ala
Thr Glu Lys Ser Arg Trp Ser Gly Ser His 165 170 175Gln Phe Glu Gln
Leu Ser Gly Ser Ile Leu Trp Met Ala Pro Glu Val 180 185 190Ile Arg
Met Gln Asp Lys Asn Pro Tyr Ser Phe Gln Ser Asp Val Tyr 195 200
205Ala Phe Gly Ile Val Leu Tyr Glu Leu Met Thr Gly Gln Leu Pro Tyr
210 215 220Ser Asn Ile Asn Asn Arg Asp Gln Ile Ile Phe Met Val Gly
Arg Gly225 230 235 240Tyr Leu Ser Pro Asp Leu Ser Lys Val Arg Ser
Asn Cys Pro Lys Ala 245 250 255Met Lys Arg Leu Met Ala Glu Cys Leu
Lys Lys Lys Arg Asp Glu Arg 260 265 270Pro Leu Phe Pro Gln Ile Leu
Ala Ser Ile Glu Leu Leu Ala Arg Ser 275 280 285Leu Pro Lys Ile His
Arg 2902333PRTHomo sapiensMISC_FEATUREMEK1 2Met Glu Leu Lys Asp Asp
Asp Phe Glu Lys Ile Ser Glu Leu Gly Ala1 5 10 15Gly Asn Gly Gly Val
Val Phe Lys Val Ser His Lys Pro Ser Gly Leu 20 25 30Val Met Ala Arg
Lys Leu Ile His Leu Glu Ile Lys Pro Ala Ile Arg 35 40 45Asn Gln Ile
Ile Arg Glu Leu Gln Val Leu His Glu Cys Asn Ser Pro 50 55 60Tyr Ile
Val Gly Phe Tyr Gly Ala Phe Tyr Ser Asp Gly Glu Ile Ser65 70 75
80Ile Cys Met Glu His Met Asp Gly Gly Ser Leu Asp Gln Val Leu Lys
85 90 95Lys Ala Gly Arg Ile Pro Glu Gln Ile Leu Gly Lys Val Ser Ile
Ala 100 105 110Val Ile Lys Gly Leu Thr Tyr Leu Arg Glu Lys His Lys
Ile Met His 115 120 125Arg Asp Val Lys Pro Ser Asn Ile Leu Val Asn
Ser Arg Gly Glu Ile 130 135 140Lys Leu Cys Asp Phe Gly Val Ser Gly
Gln Leu Ile Asp Ser Met Ala145 150 155 160Asn Ser Phe Val Gly Thr
Arg Ser Tyr Met Ser Pro Glu Arg Leu Gln 165 170 175Gly Thr His Tyr
Ser Val Gln Ser Asp Ile Trp Ser Met Gly Leu Ser 180 185 190Leu Val
Glu Met Ala Val Gly Arg Tyr Pro Ile Pro Pro Pro Asp Ala 195 200
205Lys Glu Leu Glu Leu Met Phe Gly Cys Gln Val Glu Gly Asp Ala Ala
210 215 220Glu Thr Pro Pro Arg Pro Arg Thr Pro Gly Arg Pro Leu Ser
Ser Tyr225 230 235 240Gly Met Asp Ser Arg Pro Pro Met Ala Ile Phe
Glu Leu Leu Asp Tyr 245 250 255Ile Val Asn Glu Pro Pro Pro Lys Leu
Pro Ser Gly Val Phe Ser Leu 260 265 270Glu Phe Gln Asp Phe Val Asn
Lys Cys Leu Ile Lys Asn Pro Ala Glu 275 280 285Arg Ala Asp Leu Lys
Gln Leu Met Val His Ala Phe Ile Lys Arg Ser 290 295 300Asp Ala Glu
Glu Val Asp Phe Ala Gly Trp Leu Cys Ser Thr Ile Gly305 310 315
320Leu Asn Gln Pro Ser Thr Pro Thr His Ala Ala Gly Val 325 330
* * * * *