U.S. patent application number 13/364279 was filed with the patent office on 2012-08-09 for methods and devices for immunodiagnostic applications.
This patent application is currently assigned to ARRYX, INC.. Invention is credited to Derek D. Doorneweerd, Haojun Fu, Christopher F. Grant, Sergio O. Guevara, Timothy R. Kline, Christopher R. Knutson, Sridevi Kurella, Daniel M. Mueth, Matthew K. Runyon.
Application Number | 20120202225 13/364279 |
Document ID | / |
Family ID | 46600877 |
Filed Date | 2012-08-09 |
United States Patent
Application |
20120202225 |
Kind Code |
A1 |
Knutson; Christopher R. ; et
al. |
August 9, 2012 |
METHODS AND DEVICES FOR IMMUNODIAGNOSTIC APPLICATIONS
Abstract
Methods and devices for evaluating a sample from a subject for
detecting a target red blood cell protein or antibody are
disclosed. In one embodiment, optimized antibody screening methods
and devices significantly reduce the level of non-specific binding
to a surface (e.g., a test surface bound with a red blood cell
preparation), thus allowing for more efficient detection and
reduced test time. In other embodiments, the invention provides
methods and devices for target capturing that include a
substantially planar surface, optionally having an optimized angle,
for capture. Alternative solid phase geometries for capture are
disclosed. Optimized methods for cell deposition are also
disclosed. Thus, optimized methods, devices, kits, assays for
evaluating a sample are disclosed.
Inventors: |
Knutson; Christopher R.;
(Chicago, IL) ; Grant; Christopher F.; (Chicago,
IL) ; Kline; Timothy R.; (State College, PA) ;
Doorneweerd; Derek D.; (Lockport, IL) ; Kurella;
Sridevi; (Aurora, IL) ; Mueth; Daniel M.;
(Chicago, IL) ; Runyon; Matthew K.; (Chicago,
IL) ; Fu; Haojun; (Naperville, IL) ; Guevara;
Sergio O.; (Chicago, IL) |
Assignee: |
ARRYX, INC.
Chicago
IL
|
Family ID: |
46600877 |
Appl. No.: |
13/364279 |
Filed: |
February 1, 2012 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
61438645 |
Feb 1, 2011 |
|
|
|
61438571 |
Feb 1, 2011 |
|
|
|
Current U.S.
Class: |
435/7.25 ;
435/287.2 |
Current CPC
Class: |
G01N 21/07 20130101;
G01N 33/80 20130101; B04B 5/04 20130101 |
Class at
Publication: |
435/7.25 ;
435/287.2 |
International
Class: |
G01N 33/53 20060101
G01N033/53; C12M 1/34 20060101 C12M001/34; G01N 33/561 20060101
G01N033/561; G01N 33/563 20060101 G01N033/563; G01N 33/558 20060101
G01N033/558 |
Claims
1. A method of evaluating a sample from a subject for an antibody
of a G isotype (IgG antibody) against a red blood cell antigen
(RBC), comprising: (a) contacting a first red blood cell membrane
preparation (a rbcm preparation) comprising a first RBC antigen,
with the sample from said subject, under conditions sufficient for
the formation of an immune complex between said first RBC antigen
and an anti-first-RBC antigen IgG antibody in said sample; and (b)
providing a detection reagent under conditions sufficient for the
formation of the immune complex between said detection reagent and
the first-RBC antigen IgG antibody in said sample, said detection
reagent comprising an IgG-specific binding moiety, wherein a
parameter corresponding to the behavior of, or related to the
positional distribution of, the detection reagent is correlated
with the presence or absence of said anti-RBC antigen antibody in
said sample, thereby evaluating a sample for an anti-RBC antigen
IgG antibody.
2. The method of claim 1, wherein said IgG-specific binding moiety
has one or more of the following properties: (i) it comprises mAb
MS-278, or an antigen binding fragment thereof; (ii) it competes
with mAb MS-278 for binding to IgG; (iii) it comprises at least one
antigen binding region from mAb MS-278; (iv) it comprises at least
one, two or three complementarity determining regions (CDRs) from a
heavy chain variable region of mAb MS-278; (v) it comprises at
least one, two or three CDRs from a light chain variable region of
mAb MS-278; (vi) it comprises a heavy chain variable region from
mAb MS-278; (vii) it comprises a light chain variable region from
mAb MS-278; (viii) it binds to an epitope bound by mAb MS-278; (ix)
it binds to rbcm preparations at a level, which is no more than
1.2, 1.5, 1.75, 2, 3, 4 or 5 times that of mAb MS-278; (x) it binds
to IgG at a level which is at least 20, 30, 40, 50, 60, 70, 80, 90,
or 100% of MS-278; (xi) when bound to rbcm preparation, e.g., as
prepared as described herein, at least 20, 40, 60% of said binding
is to IgG; (xii) it binds to IgG with sufficient specificity that,
under conditions described herein, it can distinguish between the
presence and absence of a pre-selected anti-red blood cell antigen
in less than 30, 25, 20, 15, 10, or 5 minutes; (xiii) it is
substantially free of binding to an rbcm preparation; (xiv) its
level of binding to a rbcm preparation is reduced by less than 10,
20, 30, 40, or 50% by pre-incubation of the rbcm preparation with
an anti-IgG Fab or F(ab).sub.2 fragment; (xv) its level of binding
to a rbcm preparation is reduced by less than 10, 20, 30, 40, or
50% by pre-incubation of the rbcm preparation with an enzyme that
disrupts or alters an IgG- or an IgG-like molecule; (xvi) its level
of binding to a rbcm preparation is less than 1, 2, 5, 10, 25, or
50% of the binding of antibody chosen from 16H8 [Immucor], rabbit
polyclonal [Alba #Z356], rabbit polyclonal [Biotest #804501],
material from cell line CG-7 [Sigma-Aldrich I6260], or goat
polyclonal [Sigma-Aldrich #I2136] to a rbcm preparation; (xvii) it
comprises an anti-IgG light chain antibody (mAb LCSIgG), e.g., an
anti-light chain antibody chosen from Sigma-Aldrich #K4377 Cell
Line KP-53, Sigma-Aldrich #L6522 cell line HP-6054, Sigma-Aldrich
#K3502-polyclonal, or Sigma-Aldrich #L7646-polyclonal, or an
antigen binding fragment thereof; (xviii) it competes with the mAb
LCSIgG for binding to IgG; (xix) it binds to an epitope bound by
the mAb LCSIgG; or (xx) its level of binding to an rbcm preparation
is less than 1, 2, 5, 10, 25, or 50% of the binding of mAb LCSIgG
to a rbcm preparation.
3. The method of claim 1, wherein the detection reagent further
comprises an indicator moiety chosen from one or more of a red
blood cell or an immunoglobulin-binding agent.
4. The method of claim 1, wherein said method comprises evaluating
sample from said subject for an antibody to at least 1, 2, 3, 4, 5,
6, 7, 8, 9, 10, 11, 12, or all of the following RBC antigens: a
Rhesus antigen chosen from one or more or all of D, C, c, E, or e;
a MNS antigen chosen from one or more or all of M, N, S, or s; a
Kidd antigen chosen from one or both of Jk.sup.a or Jk.sup.b; a
Duffy antigen chosen from one or both of Fy.sup.a or Fy.sup.b; a
Kell antigen chosen from one or both of K or k; a Lewis antigen
chosen from one or both of Le.sup.a or Le.sup.b; or P antigen.
5. The method of claim 1, wherein the rbcm preparation provides a
substrate having a density of between 14000-24000 cells/mm.sup.2,
24000-34000 cells/mm.sup.2, 34000-40000 cells/mm.sup.2, or 26,000
cells/mm.sup.2 on the surface.
6. The method of claim 1, wherein said rbcm preparation is
contacted with an agent that alters or disrupts an IgG or an
IgG-like molecule, thereby providing a mimic optimized rbcm
preparation.
7. The method of claim 6, wherein the agent is an enzyme that
cleaves the IgG or an IgG-like molecule.
8. The method of claim 1, where said first rbcm preparation is
disposed on a surface or substrate, and the angle between said
surface or substrate, and the direction of an applied force that
causes migration of the detection reagent, is non-orthogonal or
other than 90 degrees, wherein the applied force is chosen from one
or more of a centrifugal, a gravitational, a fluid magnetic, an
electric or a fluid force.
9. The method of claim 8, wherein said method includes applying the
centrifugal force in at least two phases: a first phase having FN1,
the force normal to the surface or substrate, and FT1, the force
tangential to said surface or substrate, and a second phase having
FN2, the force normal to the surface or substrate, and FT2, the
force tangential to said surface or substrate, wherein said first
phase occurs before said second phase.
10. The method of claim 9, wherein said angle is chosen as a
constant angle during said first and second phase, and FN1 is
greater than FN2, and FT1 is greater than FT2, or FN1 is less than
FN2 and FT1 is less than FT2.
11. The method of claim 1, wherein the presence or absence of the
anti-RBC antigen antibody in the sample is indicated by a value of
a parameter corresponding to the behavior of, or related to the
positional distribution of, the detection reagent chosen from one
or more of: the amount of the detection reagent; an increased or
decreased presence of the detection reagent; the pattern of
coverage of the substrate or surface by the detection reagent; the
amount of coverage of the substrate or surface by the detection
reagent; the distribution of the detection reagent on a surface or
substrate; the amount of aggregation of the detection reagent; or
the strength of adherence of the detection reagent to the rbcm
preparation.
12. The method of claim 11, wherein the detection reagent is
present at a concentration that results in coverage of less than or
about 5%, 10%, 15%, 20%, 25% or 30% of the area of the
substrate.
13. The method of claim 11, wherein the concentration of detection
reagent is such that at least 30, 40, 50, 60, 70, 80, 90, or 100%
of the substrate is covered with at least a monolayer of the
detection reagent.
14. The method of claim 11, wherein the detection reagent is
present in an amount that is at least 10, 20, 30, 40, 50, 60, 70,
80, 90, or 100, and typically at least 50 times the amount that
would give 20% coverage of the substrate with a monolayer.
15. The method of claim 11, wherein the positive readout is
detected by having a uniform pattern of coverage of the substrate
by the detection reagent of at least 80%, 90%, 95%, 96%, 97%, 98%,
99% or 100% of the substrate area.
16. The method of claim 11 wherein a negative readout is detected
by having a coverage of the substrate by the detection reagent of
less than 99%, 95%, 90%, 85%, 80%, 75%, 70%, 60%, 50%, 40% or 30%
of the substrate area relative to what would be covered in a
positive sample.
17. A method of evaluating a sample for a red blood cell antigen,
comprising: (a) contacting a red blood cell antigen antibody
disposed on a surface with a sample containing one or more red
blood cells, under conditions sufficient for the formation of a
complex between said red blood cell (RBC) antigen antibody, and a
red blood cell in said sample to occur, wherein said red blood cell
comprises the red blood cell antigen (referred to herein as
"complexed cells"); (b) separating the complexed cells by causing
differential migration of red blood cells not complexed with said
red blood cell antigen binding antibody ("uncomplexed cells"),
relative to the complexed cells, across said substrate, wherein an
increase or a decrease in the amount of complexed and/or
uncomplexed red blood cells is correlated with the presence or
absence of binding between said red blood cell (RBC) antigen
antibody and said sample, thereby evaluating a sample for a red
blood type antigen.
18. The method of claim 17, wherein the red blood cell antigen is a
blood-type antigen chosen from an A, B, AB, or a D antigen.
19. The method of claim 17, wherein the red blood cell antigen is
chosen from one, two, three, four, five, six, seven, eight, nine,
ten, eleven, twelve, or more, or all of: a Rhesus antigen chosen
from one or more or all of D, C, c, E, or e; a MNS antigen chosen
from one or more or all of M, N, S, or s; a Kidd antigen chosen one
or both of Jk.sup.a or Jk.sup.b; a Duffy antigen chosen one or both
of Fy.sup.a or Fy.sup.b; a Kell antigen chosen one or both of K or
k; a Lewis antigen chosen one or both of Le.sup.a or Le.sup.b; or a
P antigen.
20. The method of claim 17, wherein said red blood cell antigen
binding antibody is disposed on a surface, and the angle between
said surface, and the direction of an applied force, that causes
migration of the detection reagent, is non-orthogonal or other than
90 degrees, wherein the applied force is chosen from one or more of
a centrifugal, a gravitational, a fluid magnetic, an electric or a
fluid force.
21. The method of claim 20, wherein said method includes applying
centrifugal force in at least two phases: a first phase having FN1,
the force normal to the surface, and FT1, the force tangential to
said surface or substrate, and a second phase having FN2, the force
normal to the surface, and FT2, the force tangential to said
surface, wherein said first phase occurs before said second
phase.
22. The method of claim 21, wherein said angle is chosen as a
constant angle during said first and second phase, and FN1 is
greater than FN2, and FT1 is greater than FT2, or FN1 is less than
FN2 and FT1 is less than FT2.
23. The method of claim 17, wherein the presence or absence of the
anti-RBC antigen antibody in the sample is indicated by a value of
a parameter corresponding to the behavior of, or related to the
positional distribution of, the detection reagent chosen from one
or more of the amount of the detection reagent; an increased or
decreased presence of the detection reagent; the pattern of
coverage of the surface by the detection reagent; the amount of
coverage of the surface by the detection reagent; the distribution
of the detection reagent on a surface; or the strength of adherence
of the detection reagent bound to the binding agent on the
surface.
24. A method of evaluating a sample for a red blood cell (RBC)
antigen-specific antibody for reverse grouping or typing,
comprising: (a) contacting a rbcm preparation which specifically
presents or lacks one or more red blood cell antigens disposed as a
substrate or a surface, with sample, under conditions sufficient
for the formation of a complex between said rbcm preparation and an
anti-red blood cell antigen-specific antibody, in said sample; (b)
providing one or more indicator cells which specifically present or
lack said red blood cell antigen, under conditions sufficient for
the formation of an immune complex between said rbcm preparation
and the indicator cells; (c) providing a multi-valent binding agent
that can promote clumping between the indicator cells, under
conditions sufficient for the formation of the immune complex, of
said indicator cells, via said multi-valent binding agent, (d)
applying an acceleration chosen from a centrifugal, a
gravitational, a fluid magnetic, an electric or a fluid, force,
wherein said indicator cells indicate the presence or absence of
said red blood cell antigen by the distribution of indicator cells,
or by the strength of adhesion of unbound indicator cells to the
substrate, thereby evaluating said sample.
25. The method of claim 24, wherein the indicator cell is a red
blood cell chosen from one or more of A+, B+, or O+ indicator
cells.
26. The method of claim 24, wherein the multi-valent binding agent
is an IgM antibody that binds to a moiety that is present on said
indicator cells, but not present on said rbcm.
27. The method of claim 24, wherein the moiety is D antigen and the
multivalent binding agent is an anti-D antibody; the rbcm
preparation is negative for D antigen; and the indicator cells are
positive for D antigen.
28. The method of claim 24, wherein said rcbm is disposed on a
surface, and the angle between said surface, and the direction of
an applied force, that causes migration of said indicator cells, is
non-orthogonal or other than 90 degrees, wherein the applied force
is chosen from one or more of a centrifugal, a gravitational, a
fluid magnetic, an electric or a fluid force.
29. The method of claim 28, wherein said method includes applying
centrifugal force in two phases: a first phase having FN1, the
force normal to the surface, and FT1, the force tangential to said
surface or substrate, and a second phase having FN2, the force
normal to the surface, and FT2, the force tangential to said
surface, wherein said first phase occurs before said second phase,
and one or both of the following is true: FN1 is greater than FN2,
and FT2 is greater than FT1.
30. A method of evaluating a sample for an analyte, comprising: (a)
contacting a capture agent with the sample, under conditions
sufficient for the formation of a complex between a capture agent,
and said analyte in said sample, wherein, said capture agent is
disposed on a substrate or a surface, and the angle between said
substrate or a surface and the direction of an applied force chosen
from a centrifugal, a gravitational, a fluid magnetic, an electric
or a fluid, force, that causes migration of detection reagent, is
non-orthogonal or other than 90 degrees; (b) providing a detection
reagent under conditions sufficient for the formation of a complex
between said detection reagent and the analyte in said sample, (c)
applying a centrifugal acceleration, at said angle such that
detection reagent that does not bind to said capture agent migrates
across said substrate, wherein the behavior, or the positional
distribution, of said detection reagent is correlated with the
presence or absence of said analyte in said sample.
31. The method of claim 30, wherein the capture agent is an
antibody, an anti-RBC antibody, an antigen, an RBC antigen, an rbcm
preparation, or an optimized rbcm preparation.
32. The method of claim 30, wherein the analyte is chosen from an
antigen, an antibody or other protein having specific binding for
said capture agent
33. The method of claim 30, wherein said detection reagent can
comprise a red blood cell and one or more immunoglobulin binding
agents as an indicator moiety.
34. The method of claim 30, wherein the parameter is chosen from
one or more of: the amount of the detection reagent; an increased
or decreased presence of the detection reagent; the pattern of
coverage of the substrate by the detection reagent; the amount of
coverage of the substrate by the detection reagent; the
distribution of the detection reagent on a substrate; the amount of
aggregation of the detection reagent; or the strength of adherence
of the detection reagent, to the rbcm preparation.
35. The method of claim 30, wherein the method is applied to one or
more forward typing or grouping, reverse typing or grouping,
antibody screening, antibody identification, extended phenotyping,
or pathogen analysis, alone or in combination.
36. The method of claim 30, wherein the capture agent includes at
least 1, 2, 3, 4, 5, 6, 9, 10, 11, 12 or all of an RBC antigens
chosen from: a Rhesus antigen chosen from one or more or all of D,
C, c, E, or e; an MNS antigen chosen from one or more or all of M,
N, S, or s; a Kidd antigen chosen from one or both of Jk.sup.a or
Jk.sup.b; a Duffy antigen chosen from one or both of Fy.sup.a or
Fy.sup.b; a Kell antigen chosen from one or both of K or k; a Lewis
antigen chosen from one or both of Le.sup.a or Le.sup.b; or P
antigen.
37. The method of claim 30, wherein the capture agent comprises an
antibody against one or more of: a Rhesus antigen chosen from one
or more or all of D, C, c, E, or e; an MNS antigen chosen from one
or more or all of M, N, S, or s; a Kidd antigen chosen from one or
both of Jk.sup.a or Jk.sup.b; a Duffy antigen chosen from one or
both of Fy.sup.a or Fy.sup.b; a Kell antigen chosen from one or
both of K or k; a Lewis antigen chosen from one or both of Le.sup.a
or Le.sup.b; or a P antigen.
38. The method of claim 30, wherein two different forces are
applied, a first force to provide force normal to the substrate or
a surface and a second force to provide force tangential to said
substrate or a surface.
39. A method of evaluating a sample from a subject, for an anti-red
blood cell (RBC) antigen antibody, comprising: (a) contacting a
first red blood cell membrane (rbcm) preparation with sample from
said subject, under conditions sufficient for the formation of an
immune complex between a first RBC antigen and anti-first RBC
antigen antibody in said sample, wherein, said first rbcm
preparation is disposed on a substrate, and the angle between said
substrate, and the direction of an applied force chosen from a
centrifugal, gravitational, fluid magnetic, electric or fluid,
force, that causes migration of a detection reagent, is
non-orthogonal or other than 90 degrees; (b) providing a detection
reagent under conditions sufficient for the formation of a complex
between said detection reagent and an anti-RBC antigen antibody in
said sample, (c) applying a centrifugal force, at said angle such
that detection reagent that does not bind to said first rbcm
preparation migrates across said substrate, wherein the presence or
absence of the detection reagent in the sample is indicated by a
value of a parameter in the detection reagent, wherein the
parameter is the amount of the detection reagent; an increased or
decreased presence of the detection reagent; the pattern of
coverage of the substrate by the detection reagent; the amount of
coverage of the substrate by the detection reagent; the
distribution of the detection reagent on a substrate; the amount of
aggregation of the detection reagent; or the strength of adherence
of the detection reagent, to the rbcm preparation.
40. The method of claim 39, wherein said method comprises applying
centrifugal force in two phases: a first phase having FN1, the
force normal to the surface, and FT1, the force tangential to said
surface or substrate, and a second phase having FN2, the force
normal to the surface, and FT2, the force tangential to said
surface, wherein said first phase occurs before said second
phase.
41. The method of claim 39, wherein: (i) the detection reagent is
present at a concentration that results in coverage of less than or
about 5%, 10%, 15%, 20%, 25% or 30% of the area of the substrate;
(ii) the concentration of detection reagent is such that at least
30, 40, 50, 60, 70, 80, 90, or 100% of the substrate is covered
with at least a monolayer of the detection reagent; or (iii) the
detection reagent is present in an amount that is at least 10, 20,
30, 40, 50, 60, 70, 80, 90, or 100, and typically at least 50 times
the amount that would give 20% coverage of the substrate with a
monolayer.
42. The method of claim 39, wherein the positive readout is
detected by having a uniform pattern of coverage of the substrate
by the detection reagent of at least 90%, 95%, 96%, 97%, 98%, 99%
or 100% of the substrate area; and wherein a negative readout is
detected by having a coverage of the substrate by the detection
reagent of less than 99%, 95%, 90%, 85%, 80%, 75%, 70%, 60%, 50%,
40% or 30% of the substrate area relative to what would be covered
in a positive sample.
43. A method of providing a substrate having red blood cells, or a
red blood cell membrane preparation, bound thereto comprising:
providing a substrate capable of binding red blood cells;
contacting said substrate with a solution of red blood cells to
form a solution-contacted-substrate; centrifuging said
solution-contacted-substrate for a time sufficient to cause red
blood cells in said solution to settle onto said substrate;
optionally, washing said substrate to remove unbound red blood
cells; optionally, lysing red blood cells bound to said substrate
to provide a rbcm preparation bound to said substrate; thereby
providing a substrate having red blood cells, or a rbcm
preparation, bound thereto, wherein, optionally, said substrate
having red blood cells, or a rbcm preparation, bound thereto, has
one of the following properties: said centrifugation is sufficient
in force and duration such that, if red blood cells are dispersed
on the substrate having red blood cells, or rbcm preparation, bound
thereto, less than 10, 5, or 1% of the dispersed red blood cells
are non-specifically bound, e.g., as determined by optical trap
measurement; said centrifugation is sufficient in force and
duration such that if red blood cells are dispersed on the
substrate having red blood cells, or rbcm preparation, bound
thereto, the non-specific binding of red blood cells to said
substrate having red blood cells, or rbcm preparation, bound
thereto, is less than 50, 40, 30, 20, 10, 1.0, 0.1, or 0.01% of the
non-specific binding of red blood cells to a substrate having red
blood cells, or rbcm preparation, bound thereto, prepared in a
similar manner except that the red blood cells are deposited on the
substrate by gravitational settling as opposed to
centrifugation.
44. A method of evaluating a sample from a subject, for an
anti-RBC-antigen antibody of G isotype, comprising: (a) contacting
a first mimic-optimized red blood cell membrane preparation (a
mo-rbcm preparation) comprising a first RBC antigen with sample
from said subject, under conditions sufficient for the formation of
an immune complex between said first RBC antigen and anti-first-RBC
antigen antibody in said sample; and (b) providing a detection
reagent under conditions sufficient for the formation of a complex,
e.g., an immune complex, between said detection reagent and an IgG
antibody in said sample, said detection reagent comprising an IgG
binding moiety, wherein, the behavior, or positional distribution,
of said detection reagent e.g., in a preselected location, is
correlated with the presence or absence of said anti-RBC antigen
antibody in said sample, thereby evaluating a sample for an
anti-RBC antigen antibody of G isotype.
45. The method of claim 44, wherein said mimic optimized rbcm
preparation is a rbcm preparation that has been contacted with a
proteolytic enzyme.
46. The method of claim 45, wherein the enzyme is an immunoglobulin
G-degrading enzyme.
47. A substrate having red blood cells, or a rbcm preparation, or a
mimic optimized-rbcm preparation, bound thereto, wherein if red
blood cells are dispersed on the substrate having red blood cells,
or rbcm preparation, bound thereto, less than 10, 5, or 1% of the
dispersed red blood cells are non-specifically bound.
48. A substrate having red blood cells, or a rbcm preparation, or a
mimic optimized-rbcm preparation, bound thereto, wherein if red
blood cells are dispersed on the substrate having red blood cells,
or rbcm preparation, bound thereto, the non-specific binding of
dispersed red blood cells to said substrate having red blood cells,
or a rbcm preparation, bound thereto, is less than 50, 40, 30, 20,
10, 1.0, 0.1, or 0.01% of the non-specific binding of dispersed red
blood cells to a reference substrate, e.g., a substrate having red
blood cells, or rbcm preparation, bound thereto, prepared in a
similar manner except that the red blood cells are deposited on the
substrate by gravitational settling as opposed to
centrifugation.
49. A device for evaluating a sample from a subject, for a an
anti-RBC antigen antibody, comprising: a channel comprising a) a
substrate having red blood cells, or a rbcm preparation, e.g., a
mo-rbcm preparation, bound thereto, wherein if red blood cells are
dispersed on the substrate having red blood cells, or rbcm
preparation, bound thereto, less than 10, 5, or 1% of the dispersed
red blood cells are non-specifically bound, e.g., as determined by
optical trap measurement; or if red blood cells are dispersed on
the substrate having red blood cells, or rbcm preparation, bound
thereto, the non-specific binding of dispersed red blood cells to
said substrate having red blood cells, or a rbcm preparation, bound
thereto, is less than 50, 40, 30, 20, 10, 1.0, 0.1, or 0.01% of the
non-specific binding of dispersed red blood cells to a reference
substrate, e.g., a substrate having red blood cells, or rbcm
preparation, bound thereto, prepared in a similar manner except
that the red blood cells are deposited on the substrate by
gravitational settling as opposed to centrifugation; wherein the
device is configured such that, upon application of a force, e.g.,
centrifugal, gravitational, fluid magnetic, electric or fluid,
force, detection reagent that has not formed an immune complex can:
form a detection reagent complex, e.g., to form an aggregate;
migrate into a negative readout region; or, both from a detection
reagent complex, e.g., form an aggregate and migrate into a
negative readout region.
50. A device for evaluating a sample from a subject, for an
anti-RBC antigen antibody, comprising: a channel comprising red
blood cells, or a first rbcm preparation e.g., a mo-rbcm
preparation, disposed on a substantially planar substrate, and the
angle between said substantially planar substrate and the direction
of applied force, e.g., centrifugal, gravitational, fluid magnetic,
electric or fluid, force, that causes migration of detection
reagent, is other than 90 degrees; wherein the device is configured
such that, upon application of a force, e.g., centrifugal,
gravitational, fluid magnetic, electric or fluid, force, detection
reagent that has not formed an immune complex can: form a detection
reagent complex, or an aggregate; or, both form a detection reagent
complex, or an aggregate.
51. A device for evaluating a sample from a subject, for one or a
plurality of different anti-RBC antigen antibodies comprising: a
plurality of channels, each channel comprising a) a capture region
for receiving RBC, a rbcm preparation, or a mimic optimized-rbcm
preparation, disposed on a substantially planar substrate, and the
angle between said substantially planar substrate and the direction
of applied force chosen from a centrifugal, gravitational, fluid
magnetic, electric or fluid, force, that causes migration of
detection reagent, is other than 90 degrees; wherein the device is
configured such that, upon application of a centrifugal or a
gravitational force, the detection reagent that has not formed an
immune complex forms a detection reagent complex or an
aggregate.
52. A kit comprising a detection reagent having an indicator moiety
and a binding moiety, wherein said kit comprises one or more, or
all of: (a) a rbcm preparation or a mimic optimized-rbcm
preparation; (b) a device according to claim 54; (c) a detection
reagent complexing agent that promotes detection reagent
complexation between base units of detection reagent; (d) a
positive control sample, said positive control sample having an
antibody to a preselected blood type antigen; (e) a negative
control sample, said negative control sample lacking an antibody to
a preselected blood type antigen; and (f) an agent that alters or
disrupts an IgG molecule or an IgG-like molecule for preparing a
mimic optimized -rbcm preparation.
Description
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of priority under 35
U.S.C. .sctn.119(e) to U.S. Provisional Application Ser. No.
61/438,645, entitled "METHODS AND DEVICES FOR IMMUNODIAGNOSTIC
APPLICATIONS," and U.S. Provisional Application Ser. No.
61/438,571, entitled "CENTRIFUGE ROTOR FOR SEPARATION AND
PROCESSING OF COMPLEX FLUIDS," both of which were filed Feb. 1,
2011. The contents of the aforesaid applications are hereby
incorporated by reference in their entirety. This application also
incorporates by reference the entire contents of PCT/US 12/23553,
entitled "METHODS AND DEVICES FOR IMMUNODIAGNOSTIC APPLICATIONS,"
and PCT/US12/023,503, entitled "CENTRIFUGE ROTOR FOR SEPARATION AND
PROCESSING OF COMPLEX FLUIDS," both of which were filed Feb. 1,
2012.
BACKGROUND
[0002] Approximately 30 human blood group systems are recognized by
the International Society of Blood Transfusion (ISBT). These 30
systems are composed of over 600 blood group antigens. The most
clinically significant system is the ABO blood group system that,
amongst others, includes the A, B, AB, and O blood groups. The
second most clinically significant blood-group system is the Rh
system. The Rh system currently includes over 50 antigens--the most
significant of which is the D antigen. Thus, red blood cells (RBCs)
have many antigens on their surfaces, some of which may be
associated with "blood group" (Groups A, B, AB, and O), and the
most common antigens, known as the A, B, and D antigens, give rise
to one's ABO Rh "blood type" commonly listed on the donor cards for
people who donate blood (e.g., A Rh Pos, A Rh Neg, B Rh Pos, B Rh
Neg, O Rh Pos, O Rh Neg, AB Rh Pos, AB Rh Neg).
[0003] Testing for those surface antigens is commonly called either
"forward typing" (FT) or "ABO/Rh antigen typing". This test is
performed on every blood donor and every potentially transfused
patient, typically at least twice for redundancy.
[0004] "Reverse grouping" (RG) or "reverse typing," refers to
determining whether an individual's plasma contains antibodies
specific to the A antigen (Anti-A) and/or antibodies specific to
the B antigen (Anti-B) in it. If a subject does not have the A
antigen on their RBCs, they will have the Anti-A antibody in their
plasma. Similarly, if a subject does not have the B antigen on
their RBCs, they will have the Anti-B antibody in their blood
plasma. In other words, if the subject has the A antigen alone on
their RBCs (and thus, Anti-B antibodies are present), their blood
type is Group A, and if they have the B antigen alone on their RBCs
(and only Anti-A antibodies present), they have Group B blood.
Group AB will have both A, B, and AB antigens on the RBCs, but
neither Anti-A or Anti-B antibodies present, and Group O will have
no A, B, or AB antigens on the RBCs and both Anti-A and Anti-B
antibodies present. Effectively, this test provides redundant
information to the forward group, and is thus, another check on the
result of the forward group. There are many details, but for the
most part, there is a simple correspondence.
[0005] Hence, to perform a full "ABO/Rh blood type," forward typing
is performed to determine the presence or absence of the A, B, and
D antigens on RBCs, and reverse grouping is performed to determine
the presence or absence of the Anti-A, Anti-B, or Anti-AB
antibodies in the plasma.
[0006] The intrinsic presence of antibodies specific to foreign ABO
blood groups gives the ABO system its clinical significance. If a
transfusion of non-ABO matched red cells occurs, the transfusion
recipient will likely experience a transfusion reaction--which may
be fatal.
[0007] However, as stated above, numerous other antigens
corresponding to other blood group systems are present on human red
blood cells, generally referred to as "minor antigens." Amongst
these antigens, there are 18 that fall into a second tier of
clinical significance after the A, B, and D antigens. These systems
are not characterized by the intrinsic presence of antibodies
specific to foreign blood groups. Hence, a mismatch between donor
and recipient RBC's does not typically result in an immediate
transfusion reaction. Instead, a person who is exposed to these
foreign antigens through transfused RBCs may, over time, develop
antibodies specific to these foreign antigens--i.e., immunization.
This can occur through pregnancy (a mother may be exposed to a
child's blood and thus antigens on the child's RBCs) or through a
blood transfusion. If a subject is transfused with RBCs, they will
likely be given RBCs that present one or more these 18 antigens
that the subject's own RBCs do not present and the subject may have
an immune response. This is typically not medically detrimental to
the individual unless the subject is later exposed to additional
RBCs (e.g., a second transfusion) that present an antigen to which
they have established immunity. If such a second exposure occurs,
the immune response will typically be much stronger as antibodies
specific to these foreign antigens have been pre-formed and the
immune system is primed for rapid production of these antibodies.
As a result, the subject's immune system is primed to attack the
transfused blood, destroying the donor RBCs and giving rise to
various clinical problems. For these reasons, anyone who receives a
blood transfusion is screened to determine whether they have
antibodies specific to these 18 antigens. This is called "antibody
screening" (AbS).
[0008] A subject is screened and characterized as either positive
or negative for one or more these "unexpected antibodies" that
possess specificity for one of the 18 antigens. If the subject has
a positive antibody screen, it is then necessary to determine the
specificity(ies) of the(se) antibody(ies). This process is called
"antibody identification" (AbID). Thus, a patient sample that
yields a positive AbS, will undergo an AbID to identify the
specificity of the antibodies that are present. Then the hospital
or lab must find "antigen negative blood" which does not present
the antigens corresponding to the specificity (ies) of the
unexpected antibody (ies). Red cell blood units can be tested for
the presence or absence of particular minor antigens by performing
"extended phenotyping" or "antigen characterization" tests,
depending on whether one identifies the presence or absence of many
or all 18 antigens (extended phenotyping), or targets one or few
specific antigens of interest (minor antigen characterization).
Collectively, these are often referred to as "antigen typing."
Generally, units are considered ideal for transfusion if they are
compatible with the patient's blood type and are negative for the
antigens corresponding to antibodies the patient presents. Minor
antigen characterization and extended phenotyping can also
performed on patient blood at times, depending on hospital
practices. Generally, if a patient has one or more unexpected
antibodies, the lab will confirm the patient does not present the
corresponding antigen on the red cells. Further, if a patient falls
into certain groups, typically groups expected to be multiply
transfused, extended phenotypes may be performed. Some hospitals
perform an extended phenotype on any patient that presents with
antibodies.
[0009] Finally, before the transfusion occurs, the hospital
performs a "crossmatch", which, in the U.S., typically requires a
"serological crossmatch". patient plasma and donor RBCs are
combined and examined for a reaction (agglutination of the RBCs).
If the patient does not have any unexpected antibodies (ie. the AbS
was negative), a simple "immediate spin crossmatch" (ISXM) is
performed in which the patient plasma and donor RBCs are mixed at
room temperature and then inspected for agglutination. If the
patient had a positive AbS test the ISXM is performed as well as a
"Coombs crossmatch" or "TAT crossmatch" (IATXM) which involves
mixing the patients plasma with the donor RBCs, incubating, washing
the RBCs, adding anti-human globulin (AHG), allowing for
agglutination of the RBCs such as through centrifugation, and then
inspection for agglutination. If the crossmatch does not produce a
reaction, the blood is released for transfusion.
[0010] Common historical methods used for blood typing include
combining RBCs of unknown type with antibodies specific to each
antigen of interest, or combining RBCs of known type with plasma
with unknown antibody content. For example, to perform a forward
type, RBCs are combined with three separate solutions--each
containing one of anti-A, anti-B, and anti-D IgM class antibodies.
If the RBCs present the antigen corresponding to the specificity of
the antibody (i.e., RBCs presenting the A antigen combined with
anti-A), the antibody will bind to the antigen presented on the
surface of the RBCs, produce a `bridge` between the cells, and
induce aggregation (hemagglutination). If the RBCs agglutinate when
mixed with anti-A, the subject has group A antigens present on the
RBCs. If the RBCs agglutinate when mixed with anti-B, the subject
has group B RBCs. If the RBCs agglutinate when mixed with both
Anti-A and Anti-B antibodies (or anti-AB), then the subject has
Group AB RBCs. If the RBCs do not agglutinate with either Anti-A,
Anti-B, or anti-AB antibodies, then the subject has Group O RBCs.
If the RBCs agglutinate when mixed with anti-D, then the subject
has RhD positive RBCs. Finally, if the RBC do not agglutinate when
mixed with anti-D, the subject has RhD negative RBCs.
[0011] Reverse grouping tests are performed in a similar fashion.
However, in this case, plasma or serum of unknown group is combined
with separate solutions each containing RBCs of a singular known
group (i.e., A, B, or O RBCs). If the plasma or serum contains
antibodies specific to the antigens presented on the RBCs, the RBCs
will agglutinate. As an example, if plasma is combined with A, B,
and O cells and agglutination is observed only in the sample
containing A cells, the plasma contains only anti-A and, therefore,
the subject has Group B blood. If only the sample containing B
cells agglutinates, the plasma only contains anti-B, and,
therefore, the subject has Group A blood. If the samples containing
A cells and B cells agglutinate, the sample contains both Anti-A
and Anti-B, and, therefore, the subject has Group O blood. Finally,
if none of the samples containing A cells, B cells, or O cells
agglutinate, the sample contains neither Anti-A nor Anti-B, and,
therefore, the subject has Group AB blood.
[0012] In the broadest sense, therefore, blood typing includes
screening for RBC surface antigens, along with antibodies to RBC
surface antigens. Technology that can identify the presence/absence
of antigens (or receptors/binding sites) on cells and the
presence/absence/concentration of antibodies (or possibly other
molecules) in solution, is valuable in many fields of medical
diagnostic screening and testing, pharmaceuticals, among others.
Thus, the need exists for developing improved assays and methods
for screening and blood typing, including forward typing, reverse
grouping, antibody screening (e.g., IgG class antibodies), antibody
identification, minor antigen typing, and extended phenotyping.
Such assays and methods can also be generally applicable to other
immunodiagnostics, such as infectious disease screening and allergy
testing.
SUMMARY
[0013] The present invention provides, at least in part, methods
and devices for evaluating a sample (e.g., a plasma sample, a serum
sample, or a whole blood sample), from a subject, for detecting a
target molecule, e.g., an antibody (e.g., an antibody that binds to
a red blood cell (RBC) antigen, a viral antigen, or a pathogenic
antigen); or an antigen (e.g., an RBC antigen, a viral antigen, or
a pathogenic antigen). In one embodiment, optimized antibody
screening methods and devices are disclosed that significantly
reduce the level of non-specific binding to a surface (e.g., a test
surface bound with a red blood cell (rbcm) preparation), thus
allowing for more efficient detection and reduced test time. In one
embodiment, the optimized antibody screening method includes an
immunoglobulin G (IgG) binding moiety that binds selectively and
specifically to the plasma IgG present, relative to the binding to
the lysed red blood cell membrane (rbcm) preparation. In another
embodiment, an optimized antibody screening method is disclosed
whereby non-specific binding caused by lysed red blood cell
membrane preparations can be reduced by an agent that specifically
cleaves a human IgG in the hinge region. In yet other embodiments,
the invention provides methods and devices for target capturing
that include a surface, e.g., a substantially planar surface,
optionally having an optimized angle, for capture. Alternative
solid phase geometries for capture are disclosed. Optimized methods
for cell deposition are also disclosed. Thus, methods, devices,
kits, and assays that include one or more of the aforesaid
embodiments are disclosed.
[0014] The present invention can be applied to screening and blood
typing, including, but not limited to, forward typing, reverse
grouping, and antibody screening (e.g., IgG class antibody
screening), antibody identification, minor antigen typing, and
extended phenotyping. In other embodiments consistent with the
present invention, the methods and devices disclosed herein are
suitable for infectious disease screening (e.g., human
immunodeficiency (HIV) virus, hepatitis B virus (HBV), syphilis,
human T-lymphotropic virus (HTLV), hepatitis C virus (HCV),
syphilis, among others), by testing for antibodies to these
infectious agents, or, in some cases, testing for the agents
themselves. In yet other embodiments, the invention can be applied
to allergy testing (e.g., IgE antibody testing).
Method of Detecting an Anti-RBC Antigen Antibody of G Isotype
[0015] Accordingly, in one aspect, the invention features a method
of evaluating a sample (e.g., a plasma sample, a serum sample, or a
whole blood sample), from a subject, for an anti-RBC-antigen
antibody of G isotype. The method can be used, e.g., in antibody
screening, antibody identification, or in pathogen analysis. The
method includes:
[0016] (a) contacting a first red blood cell membrane preparation
(an "rbcm preparation") comprising a first RBC antigen, e.g., an Rh
or Kell antigen, with the sample from the subject, under conditions
sufficient for the formation of an immune complex between the first
RBC antigen and the anti-first-RBC antigen antibody in the sample;
and
[0017] (b) providing a detection reagent under conditions
sufficient for the formation of a complex, e.g., an immune complex,
between the detection reagent and an immunoglobulin G (IgG)
antibody in the sample, said detection reagent comprising an
IgG-specific binding moiety,
[0018] wherein the presence or absence of the anti-RBC antigen
antibody in the sample is indicated by a value of a parameter,
e.g., a measurable parameter, corresponding to the behavior of, or
related to the positional distribution of, the detection reagent.
E.g., a preselected value for a parameter related to the detection
reagent, is indicative of the presence or absence of the anti-RBC
antigen antibody. The parameter can be, by way of example, the
amount of the detection reagent (e.g., an increased or decreased
presence of the detection reagent); the pattern of coverage of the
substrate by the detection reagent; the amount of coverage of the
substrate by the detection reagent; the distribution of the
detection reagent, e.g., on a substrate; the amount of aggregation
of the detection reagent; the strength of adherence of the
detection reagent, to the rbcm preparation (e.g., as detected by
optical trapping), thereby evaluating a sample for an anti-RBC
antigen antibody of G isotype.
[0019] In one embodiment, the IgG-specific binding moiety of the
detection reagent used in the method is an antibody molecule (e.g.,
an antibody, e.g., a monoclonal antibody (mAb), or an antigen
binding fragment thereof), having one or more of the following
properties:
[0020] (i) it comprises mAb MS-278, or an antigen binding fragment
thereof;
[0021] (ii) it competes with mAb MS-278 for binding to IgG;
[0022] (iii) it comprises at least one antigen binding region from
mAb MS-278;
[0023] (iv) it comprises at least one, two or three complementarity
determining regions (CDRs) from a heavy chain variable region of
mAb MS-278;
[0024] (v) it comprises at least one, two or three CDRs from a
light chain variable region of mAb MS-278;
[0025] (vi) it comprises a heavy chain variable region from mAb
MS-278;
[0026] (vii) it comprises a light chain variable region from mAb
MS-278;
[0027] (viii) it binds to an epitope bound by mAb MS-278;
[0028] (ix) it binds to rbcm preparations at a level, which is no
more than 1.2, 1.5, 1.75, 2, 3, 4 or 5 times that of mAb MS-278,
e.g., as determined by an assay described herein;
[0029] (x) it binds to IgG at a level which is at least 20, 30, 40,
50, 60, 70, 80, 90, or 100% of MS-278, e.g., as determined by an
assay described herein;
[0030] (xi) when bound to rbcm preparation, e.g., as prepared as
described herein, at least 20, 40, 60% of said binding is to
IgG;
[0031] (xii) it binds to IgG with sufficient specificity that,
under conditions described herein, it can distinguish between the
presence and absence of a pre-selected anti-red blood cell antigen
in less than 30, 25, 20, 15, 10, or 5 minutes;
[0032] (xiii) it is substantially free of binding to an rbcm
preparation (e.g., an rbcm preparation described herein);
[0033] (xiv) its level of binding to a rbcm preparation is reduced
by less than 10, 20, 30, 40, or 50% by pre-incubation of the rbcm
preparation with an anti-IgG Fab or F(ab).sub.2 fragment;
[0034] (xv) its level of binding to a rbcm preparation is reduced
by less than 10, 20, 30, 40, or 50% by pre-incubation of the rbcm
preparation with an enzyme that alters or disrupts, e.g., cleaves,
an IgG- or an IgG-like molecule (e.g., an IgG mimic), e.g., a
cysteine proteinase with specificity for immunoglobulin G, such as
an immunoglobulin-degrading enzyme of S. pyrogenes (IdeS), e.g.,
FabRICATOR.RTM.;
[0035] (xvi) its level of binding to a rbcm preparation is less
than 1, 2, 5, 10, 25, or 50% of the binding of antibody chosen from
16H8 [Immucor], rabbit polyclonal [Alba #Z356], rabbit polyclonal
[Biotest #804501], material from cell line CG-7 [Sigma-Aldrich
16260], or goat polyclonal [Sigma-Aldrich #12136] to a rbcm
preparation;
[0036] (xvii) it comprises an anti-IgG light chain antibody (mAb
LCSIgG), e.g., an anti-light chain antibody chosen from
Sigma-Aldrich #K4377 Cell Line KP-53, Sigma-Aldrich #L6522 cell
line HP-6054, Sigma-Aldrich #K3502--polyclonal, or Sigma-Aldrich
#L7646-polyclonal, or an antigen binding fragment thereof;
[0037] (xviii) it competes with the mAb LCSIgG for binding to
IgG;
[0038] (xix) it binds to an epitope bound by the mAb LCSIgG; or
[0039] (xx) its level of binding to an rbcm preparation is less
than 1, 2, 5, 10, 25, or 50% of the binding of mAb LCSIgG to a rbcm
preparation, e.g., as described by an assay herein.
[0040] In one embodiment of the method, the IgG-specific binding
moiety of the detection reagent comprises at least one antigen
binding region, e.g., a variable region, from mAb MS-278. In one
embodiment, the IgG-specific binding moiety comprises at least one
or two variable region(s) from the heavy chain of mAb MS-278. In
other embodiments, the IgG-specific binding moiety comprises at
least one or two variable region(s) from the light chain of mAb
MS-278. In one embodiment, the IgG-specific binding moiety
comprises at least one or two variable region from the heavy chain,
and at least one or two variable region(s) from the light chain, of
mAb MS-278. In one embodiment, the IgG-specific binding moiety is a
monomer of at least one or two variable region(s) from the heavy
chain, and at least one or two variable region(s) from the light
chain, of mAb MS-278. In other embodiments, the IgG-specific
binding moiety is a dimeric, trimeric, tetrameric or pentameric
form thereof. In one embodiment, the IgG-specific binding moiety is
a pentamer of five monomers, each of which includes at least one or
two variable region(s) from the heavy chain, and at least one or
two variable region(s) from the light chain, of mAb MS-278. In one
embodiment, the IgG-specific binding moiety is an IgM antibody that
include at least one, two, three, four, five, six, seven, eight,
nine, or ten heavy chain variable regions of mAb MS-278; and/or at
least one, two, three, four, five, six, seven, eight, nine, or ten
light chain variable regions of mAb MS-278. In one embodiment, the
light chain variable region of mAb MS-278 comprises the amino acid
sequence of SEQ ID NO: 1, or an amino acid sequence substantially
identical thereto (e.g., at least 80%, 85%, 90%, 95%, or 99%
identical to the amino acid sequence of SEQ ID NO: 1, or which
differs by at least 1 or 5 residues, but less than 40, 30, 20, or
10 residues from SEQ ID NO: 1). In one embodiment, the heavy chain
variable region of mAb MS-278 comprises the amino acid sequence of
SEQ ID NO: 14, or an amino acid sequence substantially identical
thereto (e.g., at least 80%, 85%, 90%, 95%, 99% identical to the
amino acid sequence of SEQ ID NO: 14, or which differs by at least
1 or 5 residues, but less than 40, 30, 20, or 10 residues from SEQ
ID NO: 14).
[0041] In one embodiment of the method, the IgG-specific binding
moiety comprises at least one, two or three CDRs from the light
chain variable region of mAb MS-278. In one embodiment, the
IgG-specific binding moiety comprises at least one, two or three
CDRs from the heavy chain variable region of mAb MS-278. In one
embodiment, the IgG-specific binding moiety comprises at least one,
two or three CDRs from the light chain variable region, and at
least one, two or three CDRs heavy chain variable regions of mAb
MS-278. In one embodiment, the IgG-specific binding moiety is a
monomer of at least one, two or three CDRs (e.g., CDRs 1-3) from
the light chain variable region, and at least one, two or three
CDRs (e.g., CDRs 1-3) from the heavy chain variable regions of mAb
MS-278. In one embodiment, the IgG-specific binding moiety is a
monomer comprising all six CDRs from MS-278. In other embodiments,
the IgG-specific binding moiety is a dimeric, trimeric, tetrameric
or pentameric form thereof. In one embodiment, the IgG-specific
binding moiety is a pentamer of five monomers, each of which
includes at least one, two or three CDRs (e.g., CDRs 1-3) from the
light chain variable region, and at least one, two or three CDRs
(e.g., CDRs 1-3) from the heavy chain variable regions of mAb
MS-278.
[0042] In one embodiment, the light chain CDRs of mAb MS-278
comprise the amino acid sequence of SEQ ID NO: 2 (CDR1), SEQ ID NO:
3 (CDR2), or SEQ ID NOs: 4-12 (CDR3), or CDRs that have at least
one amino acid alteration, but no more than two, three or four
alterations (e.g., substitutions, deletions, or insertions (e.g.,
conservative substitutions)), compared to SEQ ID NOs:2-12. In one
embodiment, the light chain CDR3 comprises the amino acid sequence,
DPRT (SEQ ID NO: 4) or SEQ ID NO: 7. In other embodiments, the
light chain CDR3 comprises the following consensus sequence:
X.sub.1 X.sub.2 X.sub.3 X.sub.4 X.sub.5 X.sub.6 D P R T (SEQ ID NO:
5), wherein X.sub.1=Q, A, G, or absent; X.sub.2=A, G, F, Q, or
absent; X.sub.3=G, Q, P, Q, A or T; X.sub.4=T, L or G;
X.sub.5.dbd.N, E or G; and X.sub.6=E, N or V.
[0043] In other embodiments, the heavy chain CDRs of mAb MS-278
comprise the amino acid sequence of SEQ ID NOs: 15-21 (CDR1), SEQ
ID NOs: 22-34 (CDR2), or SEQ ID NOs: 35-37 (CDR3), or CDRs that
have at least one amino acid alteration, but no more than two,
three or four alterations (e.g., substitutions, deletions, or
insertions (e.g., conservative substitutions)), compared to
compared to SEQ ID NOs:15-37. In one embodiment, the heavy chain
CDR1 comprises the following consensus sequence:
X.sub.1 X.sub.2 X.sub.3S L S T S G M G V S (SEQ ID NO: 15), wherein
X.sub.1 is G or Y; X.sub.2 is F, G or Y; and X.sub.3 is A or
absent.
[0044] In one embodiment, the IgG-specific binding comprises a
framework region (FR) (e.g., a region including at least FR1, FR2,
FR3 and/or FR4) of mAb MS-278. In one embodiment, the framework
region is a heavy chain variable framework region of mAb MS-278. In
one embodiment, the heavy chain variable framework region comprises
at least FR1, FR2, FR3 and/or FR4 according to SEQ ID NO: 14, or an
amino acid sequence substantially identical thereto (e.g., at least
80%, 85%, 90%, 95%, 99% identical to the amino acid sequence of SEQ
ID NO: 14, or which differs by at least 1 or 5 residues, but less
than 40, 30, 20, or 10 residues from SEQ ID NO: 14). In other
embodiments, the framework region is a heavy chain variable
framework region of mAb MS-278. In one embodiment, the light chain
variable framework region comprises at least FR1, FR2, FR3 and/or
FR4 according to SEQ ID NO: 1, or an amino acid sequence
substantially identical thereto (e.g., at least 80%, 85%, 90%, 95%,
99% identical to the amino acid sequence of SEQ ID NO: 14, or which
differs by at least 1 or 5 residues, but less than 40, 30, 20, or
10 residues from SEQ ID NO: 1).
[0045] In one embodiment, the detection reagent further comprises
an indicator moiety, e.g., a red blood cell, and (optionally) one
or more binding agents, e.g., IgG-specific binding agents. In one
embodiment, the detection reagent includes an IgG-sensitized red
blood cell. In such embodiments, a base unit (or unit) of the
detection reagent comprises the indication moiety, e.g., the red
blood cell, optionally, containing the binding agents. In certain
embodiments, base units of the detection are capable of complexing
to form aggregates.
[0046] In another embodiment of the method, less than 1, 2, 3, 5,
10, 15, 20, or 25% (and more typically, less than 5, 10, 15, 20, or
25%) of the IgG-sensitized red blood cells bind, e.g., as
determined by optical trapping, to the rbcm preparation that has
been incubated with the IgG-specific binding moiety, e.g., an
IgG-specific antibody or antigen binding fragment thereof, e.g., as
determined by a method described herein.
[0047] In one embodiment of the method, the IgG-specific binding
moiety, e.g., an IgG-specific antibody or antigen binding fragment
thereof, binds IgG at a pre-selected concentration of IgG. E.g., it
provides a pre-selected limit of detection, e.g., a limit of
detection described herein.
[0048] In another embodiment of the method, the IgG-specific
binding moiety, e.g., an IgG-specific antibody or antigen binding
fragment thereof, has the following property:
[0049] when plasma containing an antibody to a first red blood cell
antigen is incubated with an rbcm preparation that includes the
first red blood cell antigen (the positive preparation) and with
rbcm preparation which does not include the first red blood cell
antigen (the negative preparation), at least 15, 20, 25, or 30% of
red blood cells functionalized with the IgG-specific binding
moiety, e.g., an IgG-specific antibody or antigen binding fragment
thereof, show specific binding, and less than 5 or 10% show
non-specific binding, e.g., as determined by a method described
herein. In an embodiment, the specific binding increases over time,
e.g., over 4, 5, 6, or 7 minutes, to at least 40%, while the
nonspecific signal increases by less than 20%, e.g., to a control
preparation, e.g., a negative preparation, as determined by a
method described herein.
[0050] In yet another embodiment of the method, the IgG-specific
binding moiety is an anti-light chain antibody, and displays
specific binding of at least 10, 20, or 30% and non specific
binding of less than 2 or 5%, e.g., as determined by a method
described herein.
[0051] In certain embodiments, the rbcm preparation is disposed on
a surface to form a substrate. In one embodiment, the rbcm
preparation is bound (e.g., non-covalently or covalently) to a
surface, e.g., a functionalized surface. For example, an rbcm
preparation containing pre-selected red blood cells can be disposed
(e.g., by centrifugation or gravitational settling) onto a surface
capable of binding red blood cells. In embodiments, the rbcm
preparation provides a substrate having a density of between
14000-24000, 24000-34000 and 34000-40000, cells/mm.sup.2, e.g.,
26,000 cells/mm.sup.2 on the surface. Protocols and exemplary
surfaces to be used in the methods are described herein below.
[0052] As described above, the detection reagent can include a red
blood cell as an indicator moiety. Such detection reagents may
(optionally) include one or more binding agents, e.g., IgG-specific
binding agents. In one embodiment, the detection reagent includes
an IgG-sensitized red blood cell.
[0053] In one embodiment, the detection reagent is present at a
concentration that results in less than the entire substrate being
covered with a monolayer. E.g., the detection reagent is present in
an amount that provides a sparse coating of the substrate. In
embodiments, the detection reagent is present in an amount that
results in coverage of less than or about 5%, 10%, 15%, 20%, 25% or
30% of the area of the substrate.
[0054] In other embodiments, the concentration of detection reagent
is such that at least 30, 40, 50, 60, 70, 80, 90, or 100% of the
substrate is covered with at least a monolayer of the detection
reagent. In embodiments, the detection reagent is present at a
concentration that results in the entire substrate being covered
with at least a monolayer. In embodiments portions of the substrate
are covered with more than one layer of the detection reagent,
e.g., portions of the substrate are covered by multilayer of
detection reagent. In embodiments, the detection reagent is present
in an amount that is at least 10, 20, 30, 40, 50, 60, 70, 80, 90,
or 100, and typically at least 50 times the amount that would give
20% coverage of the substrate with a monolayer.
[0055] In certain embodiments, the presence or absence of the
anti-RBC antigen antibody in the sample is indicated by a value for
a parameter, e.g., a measurable parameter, corresponding to the
behavior of, or related to the positional distribution of, the
detection reagent. E.g., a preselected value for a parameter
related to indicator moieties, e.g., indicator cells, is indicative
of the presence or absence of the anti-RBC antigen antibody. The
parameter can be, by way of example, the amount of the indicator
moieties, e.g., indicator cells (e.g., an increased or decreased
presence of the indicator moiety, e.g., indicator cell); the
pattern of coverage of the substrate by the indicator moieties,
e.g., indicator cells; the amount of coverage of the substrate by
the indicator moieties, e.g., indicator cells; the distribution of
the indicator moieties, e.g., indicator cells, e.g., on a
substrate; the amount of aggregation of the indicator moieties,
e.g., indicator cells; the strength of adherence of the indicator
moieties, e.g., indicator cells, to the rbcm preparation (e.g., as
detected by optical trapping).
[0056] In one embodiment, the difference in the detection reagent
includes in one or more of: a difference in the amount of the
detection reagent (e.g., an increased or decreased presence of the
detection reagent); a difference in the pattern of coverage of the
substrate by the detection reagent; a difference in the amount of
coverage of the substrate by the detection reagent; a difference in
the distribution of the detection reagent, e.g., on a substrate; a
difference in the amount of aggregation of the detection reagent;
or a difference in the strength of adherence of the detection
reagent to the rbcm preparation (e.g., as detected by optical
trapping).
[0057] In certain embodiments, the presence or absence of the
anti-RBC antigen antibody in the sample is indicated by a parameter
related to the indicator moieties, e.g., indicator cells.
[0058] In one embodiment, the presence of the anti-RBC antigen
antibody in the sample (or a positive readout) is detected by a
uniform, homogenous distribution of the detection reagent on the
substrate. In one embodiment, the positive readout is detected by
having a coverage of the substrate by the detection reagent of at
least 90%, 95%, 96%, 97%, 98%, 99% or 100% of the substrate area.
An exemplary representation of a uniform distribution of the
detection reagent is provided in FIG. 16C.
[0059] In another embodiment, the absence of the anti-RBC antigen
antibody in the sample (or a negative read out) is detected by a
non-homogeneous distribution of the detection reagent on the
substrate. In one embodiment, the negative readout is detected by
having a coverage of the substrate by the detection reagent of less
than 99.9%, 99%, 95%, 90%, 85%, 80%, 75%, 70%, 60%, 50%, 40% or 30%
of the substrate area (e.g., relative to what would be covered in a
positive sample). An exemplary representation of a non-homogeneous
distribution of the detection reagent is provided in FIG. 16D. In
one embodiment, the negative readout is detected as a localized
concentration of the detection reagent, e.g., as a button or a
pellet.
[0060] In certain embodiments, the difference in the detection
reagent is detected by an increased or decreased formation of an
aggregate.
[0061] In one embodiment, base units of non-bound detection reagent
(detection reagent not bound to the rbcm preparation) form
detection reagent complexes with one another, e.g., to form
aggregates of non-bound detection reagent. In embodiments, said
aggregate comprises at least 2, 10, 20, 50, 100, 200, 1,000,
100,000, 1,000,000, 10,000,000 or 50,000,000 base units of
detection reagent. In one embodiment, the aggregate is of
macroscopic dimension, e.g., an aggregate having an average
dimension, e.g., at its largest point, of between 10-500 um, 75
um-1 mm, 100 um and 10 mm.
[0062] In one embodiment, non-bound detection reagent, e.g.,
detection reagent complexes, e.g., an aggregate, is separated from
detection reagent bound to an anti-RBC antibody, which anti-RBC
antibody is bound to said first rbcm preparation (e.g., detection
reagent in an immune complex with an said RBC antigen on said first
rbcm preparation).
[0063] In an embodiment of the method, detection reagent unit
traverses the substrate and collides with a second (or subsequent)
detection reagent unit, e.g., a detection reagent unit that
traverses more slowly or is bound.
[0064] In one embodiment of the method, the detection reagent,
e.g., detection reagent complexes, e.g., an aggregate, that fails
to bind to said first rbcm preparation migrates across a substrate,
e.g., into said first negative readout region of said carrier.
[0065] In other embodiments, the method further includes providing
sufficient conditions, e.g., tangential velocity and sufficient
time for a detection reagent, e.g., detection reagent complexes,
e.g., an aggregate, that has not formed an immune complex to
migrate across the substrate. In an embodiment, this results in
uncovering substrate or reducing the amount of substrate covered by
detection reagent. In embodiments, the aggregate can migrate a
first negative readout region.
[0066] In another embodiment, the difference in the detection
reagent is detected by evaluating the strength of adherence of the
detection reagent to the rbcm preparation, e.g., to the substrate
(e.g., as detected by optical trapping). In one embodiment, the
displacement of non-bound detection reagent is evaluated by the
optical trapping.
[0067] In one embodiment of the method, the presence or absence of
detection reagent complexes, e.g., an aggregate, e.g., in a
pre-selected location, is correlated with, respectively, the
absence or presence, of said anti-RBC antigen antibody in said
sample.
[0068] In another embodiment of the method, the presence, absence,
or amount of detection reagent complexes, e.g., an aggregate, is
detected in a readout region. In one embodiment, the readout region
is on the rbcm preparation.
[0069] In one embodiment of the method, the detection of the
presence of detection reagent complexes, e.g., an aggregate, e.g.,
in said readout region, is correlated with the absence or the
presence of said anti-RBC antigen antibody in said sample.
[0070] The readout region can be disposed in a chamber, e.g., a
well or tube.
[0071] In one embodiment of the method, said first rbcm preparation
is disposed on a carrier and the presence of detection reagent that
is not in detection reagent complexes, e.g., an aggregate, e.g., in
a first positive readout region, of said carrier is positively
correlated with the presence of an anti-first RBC antigen antibody
in said sample. In another embodiment, the presence of detection
reagent, e.g., detection reagent complexes, e.g., an aggregate,
e.g., in a first negative readout region disposed on said carrier,
or on another carrier, is negatively correlated with the presence
of an anti-first RBC-antigen antibody in said sample.
[0072] In certain embodiment, the detection reagent, e.g.,
detection reagent complexes, e.g., an aggregate, that has not
formed an immune complex migrates from said positive readout region
into said negative readout region.
[0073] In other embodiments, a detection reagent which has not
formed an immune complex or a detection reagent complex does not
migrate to negative readout region, but detection reagent which has
not formed an immune complex but has formed a detection reagent
complex, e.g., a macroscopic reagent complex, migrates to a
negative readout region.
[0074] In other embodiments, the first positive readout region and
first negative readout regions are spatially distinct, e.g.,
separated, on said carrier. In one embodiment, the first readout
region is disposed in a chamber, e.g., a well or tube. In another
embodiment, the first negative readout region is disposed in a
chamber, e.g., a well or tube. In other embodiments, the first
negative readout region and a first positive readout region are
disposed in a chamber, e.g., a well or tube.
[0075] In other embodiments, the method includes:
[0076] contacting said first rbcm preparation with sample from said
subject under conditions sufficient for the formation of an immune
complex between said first RBC antigen and anti-first RBC antigen
antibody to form a first reaction mixture;
[0077] contacting said first reaction mixture with said detection
reagent under conditions sufficient for the formation of an immune
complex between said detection reagent and an IgG antibody in said
sample,
[0078] allowing sufficient time for detection reagent that has not
formed an immune complex be detected, e.g., by detection of
detection reagent complexes, e.g., an aggregate.
[0079] In yet other embodiments, the method further includes:
[0080] (c) contacting a second rbcm preparation comprising a second
RBC antigen, e.g., a Duffy antigen, and optionally, being
substantially free of said first pre-selected RBC antigen, with
sample from said subject under conditions sufficient for the
formation of an immune complex between said second RBC antigen and
anti-second RBC antigen antibody in said sample;
[0081] (d) providing detection reagent under conditions sufficient
for the formation of a complex, e.g., an immune complex, between
said detection reagent and an IgG antibody in said sample,
[0082] optionally, wherein said first blood cell membrane
preparation is substantially free of said second RBC antigen,
and
[0083] wherein the presence or absence of said detection reagent,
e.g., in a preselected location, is correlated with the presence or
absence of said anti-second RBC antigen antibody in said sample,
thereby evaluating a sample for an anti-second RBC antigen antibody
of G isotype.
[0084] In other embodiments of the method, the method includes
antibody identification and a second rbcm preparation comprising a
second RBC antigen that is substantially free of said first
pre-selected RBC antigen, and said first blood cell membrane
preparation is substantially free of said second RBC antigen.
[0085] In certain embodiments, steps (a) and (c) of the methods are
performed at least partially simultaneously. In other embodiments,
steps (b) and (d) of the methods are performed at least partially
simultaneously.
[0086] In other embodiments of the methods, said second rbcm
preparation is spatially distinct, e.g., separate, from said first
rbcm preparation.
[0087] In other embodiments, the method further includes evaluating
said sample for an N.sup.th, e.g., third, anti-RBC antigen antibody
of IgG isotype by:
[0088] (e) contacting an N.sup.th, e.g., third, rbcm preparation
comprising an N.sup.th, e.g., third, pre-selected RBC antigen (and
optionally being substantially free of at least one or more or all
other antigens tested for) with sample from said subject, under
conditions sufficient for the formation of an immune complex
between said N.sup.th, e.g., third, RBC antigen and anti-N.sup.th,
e.g., third, RBC antigen antibody in said sample,
[0089] (f) providing detection reagent under conditions sufficient
for the formation of a complex, e.g., an immune complex, between
said detection reagent and an antibody of said pre-selected isotype
in said sample,
[0090] optionally, wherein one, some or all of said N-1th first
blood cell membrane preparations are substantially free of said
Nth, e.g., third, pre-selected-RBC antigen and
[0091] wherein the presence or absence of said detection reagent,
e.g., in a preselected location, is correlated with the presence or
absence of said anti-N.sup.th, e.g., third, RBC antigen antibody in
said sample,
[0092] thereby evaluating a sample for an anti-N.sup.th, e.g.,
third, RBC antigen antibody.
[0093] In certain embodiments, steps (a) and (e) of the methods are
performed at least partially simultaneously. In other embodiments,
steps (b) and (f) of the methods are performed at least partially
simultaneously.
[0094] The methods of the invention can be used to evaluate a
sample, e.g., a plasma sample, from said subject for an antibody to
at least 1, 2, 3, 4, or all of the RBC antigens provided in Table
1. In one embodiment, the method includes evaluating sample from
said subject for an antibody to at least 1, 2, 3, 4, or all of the
following RBC antigens: a Rhesus antigen, e.g., one or more or all
of D, C, c, E, or e; an MNS antigen, e.g., one or more or all of M,
N, S, or s; a Kidd antigen, e.g., one or both of Jk.sup.a or
Jk.sup.b; a Duffy antigen, e.g., one or both of Fy.sup.a or
Fy.sup.b; a Kell antigen, e.g., one or both of K or k; a Lewis
antigen, e.g., one or both of Le.sup.a or Le.sup.b; or a P antigen,
e.g., P1. In certain embodiments, the method includes evaluating
sample from said subject for an antibody to at least the following
RBC antigens: (1) D, C, E, e, c, and K; (2) D, C, E, e, c, K,
Fy.sup.a and Jk.sup.a; and (3) D, C, E, e, c, K, Fy.sup.a,
Fy.sup.b, Jk.sup.a, Jk.sup.b, S, and s.
[0095] In certain embodiments, the method includes at least X rbcm
preparations, wherein each of the antigens listed above is present
in at least one of said preparations and absent from another,
wherein X=2, 3, 4, 5, 10, 15 or 20. For example, the sample from
said subject with a panel of rbcm preparations includes: a first
rbcm preparation comprising RBC antigen K and being substantially
free of RBC antigens D and Fy.sup.a; a second rbcm preparation
comprising RBC antigen Fy.sup.a and being substantially free of RBC
antigens K and D; and a third rbcm preparation comprising RBC
antigen D and being substantially free of RBC antigens Fy.sup.a and
K.
[0096] In other embodiments, the method includes:
[0097] providing a panel comprising a plurality of rbcm
preparations disposed on a surface or carrier, each rbcm
preparation of said plurality being spatially distinct, e.g.,
separated, from the other rbcm preparations on said surface or
carrier;
[0098] contacting a plurality of said rbcm preparations with sample
from said subject under conditions sufficient for the formation of
an immune complex between a RBC antigen and anti-RBC antigen
antibody in said sample, to form a plurality of first reaction
mixtures;
[0099] contacting each of said plurality of first reaction mixtures
with a detection reagent under conditions sufficient for the
formation of an immune complex between said detection reagent and
an IgG from said sample, to form a plurality of second reaction
mixtures; and
[0100] for each of a plurality of said second reaction mixtures,
allowing sufficient time for detection reagent that has not formed
an immune complex to form detection reagent complexes, e.g., to
aggregate; to migrate into a negative readout region; or, to form
detection reagent complexes, e.g., to aggregate, and migrate into a
negative readout region; wherein the formation of detection reagent
complexes, e.g., an aggregate; the presence or absence of said
detection reagent in a negative readout region; the formation of
detection reagent complexes, e.g., an aggregate, in said negative
readout region, is correlated with the presence or absence an
anti-blood-type-antigen antibody in said sample.
[0101] In other embodiments, the sample is incubated with said rbcm
preparation in an incubation phase; optionally, said rbcm
preparation is washed; detection reagent is added; and said
incubated rbcm preparation is centrifuged to allow formation of
detection reagent complexes, e.g., aggregates, of base units of
unbound detection reagent, in a readout phase. In one embodiment,
the duration of said readout phase is 1-6, 2-4, 1-2, e.g., 3, or
less, minutes. In other embodiments, the duration of said
incubation phase is 1-8, 2-7, 3-6, e.g., 5, or less, minutes. In
yet other embodiments, the duration of said incubation and readout
phases is 2-15, 5-15, 10-15, e.g., 12, or less, minutes.
[0102] In another embodiment, the rbcm preparation (e.g., the first
rbcm preparation) is disposed on a surface, e.g., a substantially
planar surface or substrate, and the angle between said surface,
e.g., a substantially planar surface or substrate, and the
direction of applied force, e.g., centrifugal, gravitational, fluid
magnetic, electric or fluid, force, that causes migration, e.g.,
sedimentation, of detection reagent, is other than 90 degrees.
[0103] In other embodiments, the method further includes forming a
rbcm preparation from a sample comprising red blood cells. In one
embodiment, the method includes disposing first rbcm preparation on
said carrier. In other embodiments, the method includes lysing red
blood cells in said sample comprising red blood cells.
[0104] In other embodiments, the method includes contacting the
sample from said subject with anti-first first-blood-type-antigen
to evaluate the presence of said first-blood-type-antigen in said
subject.
[0105] In one embodiment, the subject is a donor of an organ or
tissue, e.g., blood. In another embodiment, the subject is a
recipient of an organ or tissue, e.g., blood.
[0106] Alternatively, or in combination with the methods described
herein, said rbcm preparation is contacted with an agent, e.g., an
enzyme, e.g., IdeS (immunoglobulin G-degrading enzyme of S.
pyrogenes), e.g., FabRICATOR.RTM., that cleaves a protein, e.g., an
IgG- or an IgG-like molecule, e.g., an IgG mimic. In such
embodiments, the invention provides a method of evaluating a
sample, e.g., a plasma sample, from a subject, for an
anti-RBC-antigen antibody of G isotype. The method includes:
[0107] (a) contacting a first red blood cell membrane preparation
(a rbcm preparation) comprising a first RBC antigen, e.g., an Rh or
Kell antigen, with an agent that alters or cleaves an IgG- or an
IgG-like molecule, e.g., an IgG mimic; thereby forming an optimized
rbcm preparation;
[0108] (b) contacting the optimized rbcm preparation with a sample
from the subject, under conditions sufficient for the formation of
an immune complex between said first RBC antigen and anti-first-RBC
antigen antibody in said sample; and
[0109] (c) providing a detection reagent under conditions
sufficient for the formation of a complex, e.g., an immune complex,
between said detection reagent and an IgG antibody in said sample,
said detection reagent comprising an IgG-specific binding
moiety,
[0110] wherein the presence or absence of the anti-RBC antigen
antibody in the sample is indicated by a value of a parameter,
e.g., a measurable parameter, corresponding to the behavior of, or
related to the positional distribution of, the detection reagent.
E.g., a preselected value for a parameter related to the detection
reagent, is indicative of the presence or absence of the anti-RBC
antigen antibody. The parameter can be, by way of example, the
amount of the detection reagent (e.g., an increased or decreased
presence of the detection reagent); the pattern of coverage of the
substrate by the detection reagent; the amount of coverage of the
substrate by the detection reagent; the distribution of the
detection reagent, e.g., on a substrate; the amount of aggregation
of the detection reagent; the strength of adherence of the
detection reagent, to the rbcm preparation (e.g., as detected by
optical trapping), as described herein.
[0111] In one embodiment, the agent is an enzyme, e.g., a cysteine
proteinase with specificity for immunoglobulin G. In one
embodiment, the enzyme is an immunoglobulin-degrading enzyme of S.
pyrogenes (IdeS), e.g., FabRICATOR.RTM..
[0112] The invention additionally provides optimized or
mimic-optimized rbcm preparation, e.g., made by the methods
described herein.
[0113] In yet another aspect, the invention features a method of
evaluating a sample, e.g., a plasma sample, from a subject, for an
anti-RBC-antigen antibody of a G isotype (IgG antibody),
comprising:
[0114] (a) contacting a first mimic-optimized red blood cell
membrane preparation (a mo-rbcm preparation) comprising a first RBC
antigen, e.g., an Rh or Kell antigen, with sample from said
subject, under conditions sufficient for the formation of an immune
complex between said first RBC antigen and anti-first-RBC antigen
antibody in said sample; and
[0115] (b) providing a detection reagent under conditions
sufficient for the formation of a complex, e.g., an immune complex,
between said detection reagent and an IgG antibody in said sample,
said detection reagent comprising an IgG binding moiety, e.g., an
IgG binding moiety is an IgG-specific binding moiety as described
herein,
[0116] wherein the presence or absence of the anti-RBC antigen
antibody in the sample is indicated by a value of a parameter,
e.g., measurable parameter, corresponding to the behavior of, or
related to the positional distribution of, the detection reagent.
E.g., a preselected value for a parameter related to the detection
reagent, is indicative of the presence or absence of the anti-RBC
antigen antibody. The parameter can be, by way of example, the
amount of the detection reagent (e.g., an increased or decreased
presence of the detection reagent); the pattern of coverage of the
substrate by the detection reagent; the amount of coverage of the
substrate by the detection reagent; the distribution of the
detection reagent, e.g., on a substrate; the amount of aggregation
of the detection reagent; the strength of adherence of the
detection reagent, to the rbcm preparation (e.g., as detected by
optical trapping) as described herein,
[0117] thereby evaluating a sample for an anti-RBC antigen antibody
of G isotype.
[0118] In one embodiment, the mimic-optimized-rbcm preparation is a
rbcm preparation that has been contacted with a proteolytic enzyme,
e.g., IdeS (immunoglobulin G-degrading enzyme, e.g., of S.
pyrogenes), e.g., FabRICATOR.RTM..
Methods of Evaluating a Sample for a Red Blood Cell Antigen
[0119] In another aspect, the invention features a method of
evaluating a sample for a red blood cell antigen, e.g., forward
typing, minor antigen typing, or extended phenotyping,
comprising:
[0120] (a) contacting a red blood cell antigen binding agent, e.g.,
an anti-red blood cell antigen antibody, disposed on a surface
(e.g., a functionalized surface as described herein) with the
sample, e.g., a sample containing one or more red blood cells,
under conditions sufficient for the formation of a complex between
said red blood cell antigen binding agent, e.g., anti-red blood
cell antigen antibody, and a red blood cell in said sample to
occur, wherein said red blood cell comprises the red blood cell
antigen (referred to herein as "complexed cells");
[0121] (b) separating the complexed cells, e.g., by causing
differential migration of red blood cells not complexed with said
red blood cell antigen binding agent, e.g., anti-red blood cell
antigen antibody ("uncomplexed cells"), relative to the complexed
cells, across said substrate, wherein a change, e.g., an increase
or decrease, in the amount of complexed and/or uncomplexed red
blood cells, is correlated with the amount of said red blood cell
antigen in said sample, thereby evaluating a sample for a red blood
type antigen.
[0122] In an embodiment, the red blood cell antigen is a blood-type
antigen, e.g., an A, B, or AB antigen.
[0123] In an embodiment, the red blood cell antigen is a blood-type
antigen, e.g., a D antigen.
[0124] In one embodiment, the method is a forward typing method,
e.g., comprises the detection of a red blood cell antigen chosen
from an A, B, or D antigen.
[0125] In an embodiment the red blood cell antigen is chosen from
at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or all of the RBC
antigens provided in Table 1.
[0126] In one embodiment, the red blood cell antigen is a minor
antigen.
[0127] In one embodiment, the red blood cell antigen is chosen from
one, two, three, four, five, six, seven, eight, nine, ten, eleven,
twelve, or more, or all of:
[0128] a Rhesus antigen, e.g., one or more or all of D, C, c, E, or
e;
[0129] a MNS antigen, e.g., one or more or all of M, N, S, or
s;
[0130] a Kidd antigen, e.g., one or both of Jk.sup.a or
Jk.sup.b;
[0131] a Duffy antigen, e.g., one or both of Fy.sup.a or
Fy.sup.b;
[0132] a Kell antigen, e.g., one or both of K or k;
[0133] a Lewis antigen, e.g., one or both of Le.sup.a or Le.sup.b;
or
[0134] P antigen, e.g., P1.
[0135] In certain embodiments, the red blood cell antigen analyzed
includes at least the following RBC antigens: (1) D, C, E, e, c,
and K; (2) D, C, E, e, c, K, Fy.sup.a and Jk.sup.a; or (3) D, C, E,
e, c, K, Fy.sup.a, Fy.sup.b, Jk.sup.a, Jk.sup.b, S, and s.
[0136] In one embodiment, the red blood cell antigen binding agent
is a molecule that binds to a red blood cell antigen, e.g., a
protein, a peptide or a carbohydrate. In one embodiment, the red
blood cell antigen binding agent is an anti-red blood cell antigen
antibody (e.g., an IgG or an IgM, or a combination thereof). In
other embodiments, the red blood cell antigen binding agent is a
plant-derived binding agent, e.g., a lectin.
[0137] In an embodiment, the change, e.g., presence or absence, of
detection uncomplexed cells is detected by in one or more of: a
difference in the amount of the detection reagent (e.g., an
increased or decreased presence of the detection reagent); a
difference in the distribution of the detection reagent, e.g., on a
surface; a difference in the amount of aggregation of the detection
reagent; or a difference in the strength of adherence of the
detection reagent to the rbcm preparation (e.g., as detected by
optical trapping).
[0138] In one embodiment, the separation is effected by applying
acceleration, e.g., centrifugal, fluid magnetic, electric or fluid,
that causes migration of the complexed and uncomplexed cells.
[0139] In an embodiment, the surface is configured such that the
applied acceleration results in migration of uncomplexed cells into
a defined region, e.g., at the bottom of a chamber (e.g., a well or
a tube). In an embodiment, the detection of the presence of
uncomplexed cells (e.g., a negative readout) is correlated with the
absence of binding between said anti-RBC antigen antibody in said
sample. In certain embodiments, the negative readout is a button or
a pellet. Exemplary schematics of negative readouts are shown in
FIGS. 1D and 3D as samples E and F.
[0140] In one embodiment, the detection of the presence of
complexed cells (e.g., a positive readout) is correlated with the
presence of binding between said anti-RBC antigen antibody in said
sample. In certain embodiments, the positive readout is detected as
a haze. A schematic of the top views of the readout in chamber is
depicted in FIGS. 1D and 3D, where a positive readout is detected
as a haze in sample D of FIGS. 1D and 3D.
[0141] Representative images of positive and negative readouts of
some of the forward typing assays described herein are shown in
FIGS. 1E-1G. For example, FIGS. 1E and 1G provide a representative
image of a positive readout showing a `haze` of blood cells in the
sample, which indicates that binding between the sample blood cells
and the surface has occurred. FIG. 1F provides an image of a
representative negative readout showing a pellet of red blood
cells, which indicates that binding between the sample red blood
cells and the surface has not occurred.
[0142] In an embodiment, the readout region is disposed in a
chamber, e.g., a well or tube.
[0143] In an embodiment, the chamber is disposed on a carrier,
e.g., a multi-chamber or multi-well plate, e.g., a 96 well
plate.
[0144] In an embodiment, the angle between said carrier and the
direction of force is normal, e.g., 0 degrees.
[0145] In an embodiment, the angle between said carrier and the
direction of force is non normal, e.g., between 25-5, 20-7.5, or 10
degrees.
[0146] In certain embodiments, the anti-red blood cell antigen
antibody is an IgG, an IgM or a combination thereof. In an
embodiment, the red blood cell binding agent, e.g., antigen
antibody, is disposed on the inner surface of a chamber, e.g., well
or tube (e.g., as depicted by the side views of the chambers for
forward typing shown in FIGS. 1A-1C; or the extended phenotypic
chambers depicted in FIGS. 3A-3C).
Methods of Evaluating a Sample for a Red Blood Cell
Antigen-Specific Antibody
[0147] In another aspect, the invention features a method of
evaluating a sample for a red blood cell (RBC) antigen-specific
antibody, e.g., reverse grouping or typing. The method
comprises:
[0148] (a) contacting a rbcm preparation which specifically
presents or lacks certain red blood cell antigens, e.g., A- cells
presenting the A antigen and not the B antigen, B- cells presenting
the B antigen and not the A antigen, and O- cells presenting
neither the A antigen or B antigen, disposed as a substrate of a
surface, with sample, under conditions sufficient for the formation
of a complex between said rbcm preparation and an anti-red blood
cell antigen-specific antibody, e.g., anti-A or anti-B antibody, in
said sample;
[0149] (b) providing indicator moieties, e.g., one or more
indicator cells which specifically presents or lacks said red blood
cell antigen (e.g., A+, B+, or O+ indicator cells), under
conditions sufficient for the formation of a complex, e.g., an
immune complex, between said rbcm preparation and the indicator
moieties, e.g., the indicator cells;
[0150] (c) providing an agent (e.g., a multi-valent binding agent,
e.g., anti-D antibody of M isotype) that can promote clumping
between the indicator moieties, e.g., the indicator cells, under
conditions sufficient for the formation of a complex, e.g., an
immune complex, of said indicator moieties, via said agent (e.g.,
the multi-valent binding agent),
[0151] (d) applying an acceleration, e.g., from a centrifugal, a
gravitational, a fluid magnetic, an electric or a fluid, force,
[0152] wherein said indicator moieties, e.g., by the distribution
of indicator moieties, or by the strength of adhesion of unbound
indicator moieties to the substrate, indicate the presence or
absence of said red blood cell antigen-specific antibody,
[0153] thereby evaluating said sample.
[0154] In an embodiment, the indicator moiety is a red blood
cell.
[0155] In an embodiment, the multi-valent binding agent, e.g., an
IgM antibody, binds a moiety that is present on said indicator
cells, but not present on said rbcm. In an example, the moiety is a
red blood cell antigen other than the red blood cell antigen being
analysed. In an embodiment, the moiety is other than a blood group
antigen. In an embodiment, the moiety is D antigen, and the
multi-valent binding agent, e.g., an IgM antibody, is an anti-D
antibody. In an embodiment, the rbcm preparation is negative for D
antigen and the indicator cells are positive for D antigen.
[0156] In certain embodiments, the rbcm preparation is disposed on
a surface to form a substrate. In one embodiment, the rbcm
preparation is bound (e.g., non-covalently or covalently) to a
surface, e.g., a functionalized surface. For example, an rbcm
preparation containing pre-selected red blood cells can be disposed
(e.g., by centrifugation or gravitational settling) onto a surface
capable of binding red blood cells. In embodiments, the rbcm
preparation provides a substrate having a density of between
14000-24000, 24000-34000 and 34000-40000, cells/mm.sup.2, e.g.,
26,000 cells/mm.sup.2 on the surface. Protocols and exemplary
surfaces to be used in the methods are described herein below.
[0157] In one embodiment, the indicator moieties, e.g., the
indicator cells, are present at a concentration that results in
less than the entire substrate being covered with a monolayer of
indicator moieties, e.g., indicator cells. E.g., the indicator
moieties, e.g., the indicator cells, are present in an amount that
provides a sparse coating of the substrate. In embodiments, the
indicator moieties, e.g., indicator cells, are present in an amount
that results in coverage of less than or about 5%, 10%, 15%, 20%,
25% or 30% of the area of the substrate.
[0158] In other embodiments, the concentration of indicator
moieties, e.g., indicator cells, is such that at least 30, 40, 50,
60, 70, 80, 90, or 100% of the substrate is covered with at least a
monolayer of indicator moieties. In embodiments, the indicator
moieties are present at a concentration that results in the entire
substrate being covered with at least a monolayer. In embodiments
portions of the substrate are covered with more than one layer of
indicator moieties, e.g., portions of the substrate are covered by
a multilayer of indicator moieties. In embodiments, the detection
indicator moieties, e.g., indicator cells, are present in an amount
that is at least 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, and
typically at least 50 times the amount that would give 20% coverage
of the substrate with a monolayer.
[0159] In certain embodiments, the presence or absence of the
anti-RBC antigen antibody in the sample is indicated by a
parameter, e.g., a measurable parameter, related to the behavior or
positional distribution of indicator moieties, e.g., indicator
cells. E.g., a preselected value for a parameter related to
indicator moieties, e.g., indicator cells, is indicative of the
presence or absence of the anti-RBC antigen antibody. The parameter
can be, by way of example, the amount of the indicator moieties,
e.g., indicator cells (e.g., an increased or decreased presence of
the indicator moiety); the pattern of coverage of the substrate by
the indicator moieties, e.g., indicator cells; the amount of
coverage of the substrate by the indicator moieties, e.g.,
indicator cells; the distribution of the indicator moieties, e.g.,
indicator cells, e.g., on a substrate; the amount of aggregation of
the indicator moieties, e.g., indicator cells; the strength of
adherence of the indicator moieties, e.g., indicator cells, to the
rbcm preparation (e.g., as detected by optical trapping).
[0160] In one embodiment, the presence of the anti-RBC antigen
antibody in the sample (or a positive readout) is detected by a
uniform, homogenous distribution of the indicator moieties, e.g.,
indicator cells, on the substrate. In one embodiment, the positive
readout is detected by having a coverage of the substrate by the
indicator moieties, e.g., indicator cells, of at least 20%, 30%,
40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% of
the substrate area. An exemplary representation of a uniform
distribution of the indicator moieties, e.g., indicator cells, is
provided in FIG. 12B.
[0161] In another embodiment, the absence of the anti-RBC antigen
antibody in the sample (or a negative read out) is detected by a
non-homogeneous distribution of the indicator moieties, e.g.,
indicator cells, on the substrate. In one embodiment, the negative
readout is detected by having a coverage of the substrate by the
indicator moieties, e.g., indicator cells, of less than 99%, 95%,
90%, 85%, 80%, 75%, 70%, 60%, 50%, 40% or 30% of the substrate area
(e.g., relative to what would be covered in a positive sample). In
one embodiment, the negative readout is detected as a localized
concentration of indicator moieties, e.g., indicator cells, e.g.,
as a button or a pellet. An exemplary representation of a localized
(e.g., pellet) distribution of the indicator moieties, e.g.,
indicator cells, is provided in FIGS. 12A and 12C.
[0162] In certain embodiments, the difference in the behavior or
positional distribution of the indicator moieties, e.g., indicator
cells, is detected by an increased or decreased formation of an
aggregate.
[0163] In one embodiment, base units of non-bound indicator
moieties, e.g., indicator cells, (indicator moieties, e.g.,
indicator cells, not bound to the rbcm preparation) form indicator
moiety, e.g., indicator cell, complexes with one another, e.g., to
form aggregates of non-bound indicator moieties, e.g., indicator
cells. In embodiments, said aggregate comprises at least 2, 10, 20,
50, 100, 200, 1,000, 100,000, 1,000,000, 10,000,000 or 50,000,000
base units of indicator moieties, e.g., indicator cells. In one
embodiment, the aggregate is of macroscopic dimension, e.g., an
aggregate having an average dimension, e.g., at its largest point,
of between 140-500 um, 75 um-1 mm, 100 um and 10 mm.
[0164] In an embodiment of the method, indicator moieties, e.g.,
indicator cells, traverse the substrate and collides with a second
(or subsequent) indicator moieties, e.g., indicator cells, e.g., a
indicator moieties, e.g., indicator cells, that traverses more
slowly or is bound.
[0165] In one embodiment of the method, the indicator moieties,
e.g., indicator cells, e.g., indicator moiety e.g., indicator cell,
complexes, e.g., an aggregate, that fails to bind to said first
rbcm preparation, migrates across a substrate, e.g., into said
first negative readout region of said carrier.
[0166] In other embodiments, the method further includes providing
sufficient conditions, e.g., tangential velocity and sufficient
time for indicator moieties, e.g., indicator cells, e.g., indicator
moiety, e.g., indicator cell, complexes, e.g., an aggregate, that
has not formed an immune complex to migrate across the substrate.
In an embodiment, this results in uncovering substrate or reducing
the amount of substrate covered by indicator moieties, e.g.,
indicator cells. In embodiments, the aggregate can migrate a first
negative readout region.
[0167] In another embodiment, the difference in the indicator
moieties, e.g., indicator cells, is detected by evaluating the
strength of adherence of indicator moieties, e.g., indicator cells,
to the rbcm preparation, e.g., to the substrate (e.g., as detected
by optical trapping). In one embodiment, the displacement of
non-bound indicator moieties, e.g., indicator cells, is evaluated
by the optical trapping.
[0168] In one embodiment of the method, the presence or absence of
indicator moiety, e.g., indicator cell, complexes, e.g., an
aggregate, e.g., in a pre-selected location, is correlated with,
respectively, the absence or presence, of said anti-RBC antigen
antibody in said sample.
[0169] In another embodiment of the method, the presence, absence,
or amount of detection indicator moiety, e.g., indicator cell,
complexes, e.g., an aggregate, is detected in a readout region. In
one embodiment, the readout region is on the rbcm preparation.
[0170] In one embodiment of the method, the detection of the
presence of indicator moiety, e.g., indicator cell, complexes,
e.g., an aggregate, e.g., in said readout region, is correlated
with the absence or the presence of said anti-RBC antigen antibody
in said sample.
[0171] The readout region can be disposed in a chamber, e.g., a
well or tube.
[0172] In one embodiment of the method, said first rbcm preparation
is disposed on a carrier and the presence of indicator moieties,
e.g., indicator cells, that is not in indicator moiety, e.g.,
indicator cell, complexes, e.g., an aggregate, e.g., in a first
positive readout region, of said carrier is positively correlated
with the presence of an anti-first RBC antigen antibody in said
sample.
[0173] In another embodiment, the presence of indicator moieties,
e.g., indicator cells, e.g., indicator moiety, e.g., indicator
cell, complexes, e.g., an aggregate, e.g., in a first negative
readout region disposed on said carrier, or on another carrier, is
negatively correlated with the presence of an anti-first
RBC-antigen antibody in said sample.
[0174] In certain embodiment, indicator moiety, e.g., indicator
cell, complexes, e.g., an aggregate, that has not formed an immune
complex migrate from said positive readout region into said
negative readout region.
[0175] In other embodiments, indicator moieties, e.g., indicator
cells, which have not formed an immune complex or as indicator
moiety, e.g., indicator cell, complex does not migrate to negative
readout region, but indicator moieties, e.g., indicator cells,
which has not formed an immune complex but has formed a indicator
moiety, e.g., indicator cell, complex, e.g., a macroscopic complex,
migrates to a negative readout region.
[0176] In other embodiments, the first positive readout region and
first negative readout regions are spatially distinct, e.g.,
separated, on said carrier. In one embodiment, the first readout
region is disposed in a chamber, e.g., a well or tube. In another
embodiment, the first negative readout region is disposed in a
chamber, e.g., a well or tube. In other embodiments, the first
negative readout region and a first positive readout region are
disposed in a chamber, e.g., a well or tube.
[0177] In other embodiments, the method includes:
[0178] contacting said first rbcm preparation with sample from said
subject under conditions sufficient for the formation of an immune
complex between said first RBC antigen and anti-first RBC antigen
antibody to form a first reaction mixture;
[0179] contacting said first reaction mixture with said indicator
moieties, e.g., indicator cells, under conditions sufficient for
the formation of an immune complex between said detection reagent
and the antibody in said sample,
[0180] allowing sufficient time for indicator moieties, e.g.,
indicator cells, that have not formed an immune complex be
detected, e.g., by detection of indicator moiety, e.g., indicator
cell, complexes, e.g., an aggregate.
Methods for Evaluating a Sample using a Capture Agent Disposed on a
Substrate or a Surface by Differential Applied Forces
[0181] In another aspect, the invention features a method of
evaluating a sample for an analyte. The method can be applied to
forward typing or grouping, reverse typing or grouping, antibody
screening, antibody identification, extended phenotyping, or
pathogen analysis. The method includes:
[0182] (a) contacting a capture agent (e.g., an antibody (e.g., an
anti-RBC antibody), an antigen
[0183] (e.g., an RBC antigen), an rbcm preparation, an optimized
rbcm preparation) with the sample, under conditions sufficient for
the formation of a complex between a capture agent, and said
analyte (e.g., an antigen, an antibody or other protein having
specific binding for said capture agent, e.g., in an anti-red blood
cell antibody and a rbcm preparation) in said sample,
[0184] wherein, said capture agent is disposed on a substrate or a
surface, e.g., a substantially planar substrate or surface, and the
angle between said substrate or a surface and the direction of
applied force, e.g., centrifugal, gravitational, fluid magnetic,
electric or fluid, force, that causes migration of detection
reagent, is non-orthogonal or other than 90 degrees (in the case of
a centrifugally applied force, theta, the angle formed by the
substrate or a surface and a line perpendicular to the direction of
centrifugal force, is nonzero);
[0185] (b) providing a detection reagent (wherein said detection
reagent can comprise a cell, e.g., a red blood cell and one or more
binding agents (e.g., IgG binding agents), e.g., as an indicator
moiety) under conditions sufficient for the formation of a complex,
e.g., an immune complex, between said detection reagent and the
analyte, e.g., anti-capture agent antibody in said sample,
[0186] (c) applying acceleration, centrifugal acceleration, at said
angle such that detection reagent that does not bind to said
capture agent migrates across said substrate, e.g., substantially
planar substrate,
[0187] wherein the presence or absence of the analyte of interest
in the sample is indicated by a value of a parameter, e.g., a
measurable parameter, related to the behavior of, or positional
distribution of, the detection reagent. E.g., a preselected value
for a parameter related to the detection reagent, is correlated
with the presence or absence of said analyte, e.g., anti-capture
agent antibody, in said sample. The parameter can be, by way of
example, the amount of the detection reagent (e.g., an increased or
decreased presence of the detection reagent); the pattern of
coverage of the substrate by the detection reagent; the amount of
coverage of the substrate by the detection reagent; the
distribution of the detection reagent, e.g., on a substrate; the
amount of aggregation of the detection reagent; the strength of
adherence of the detection reagent, to the rbcm preparation (e.g.,
as detected by optical trapping), as described herein,
[0188] thereby evaluating a sample for an analyte.
[0189] In one embodiment, the capture agent is a RBC antigen, e.g.,
at least 1, 2, 3, 4, 5, 6, 9, 10, 11, 12 or all of the RBC antigens
provided in Table 1. Exemplary RBC antigens include at least 1, 2,
3, 4, 5, 6, 9, 10, 11, 12 or all of the following RBC antigens: a
Rhesus antigen, e.g., one or more or all of D, C, c, E, or e; a MNS
antigen, e.g., one or more or all of M, N, S, or s; a Kidd antigen,
e.g., one or both of Jk.sup.a or Jk.sup.b; a Duffy antigen, e.g.,
one or both of Fy.sup.a or Fy.sup.b; a Kell antigen, e.g., one or
both of K or k; a Lewis antigen, e.g., one or both of Le.sup.a or
Le.sup.b; or P antigen, e.g., P1. In certain embodiments, the
method includes evaluating sample from said subject for an antibody
to at least the following RBC antigens: (1) D, C, E, e, c, and K;
(2) D, C, E, e, c, K, Fy.sup.a and Jk.sup.a; and (3) D, C, E, e, c,
K, Fy.sup.a, Fy.sup.b, Jk.sup.a, Jk.sup.b, S, and s.
[0190] In another embodiment, the capture agent is a pathogen
antigen, e.g. a viral antigen, e.g., a viral antigen chosen from
one or more of human immunodeficiency (HIV) virus, hepatitis B
virus (HBV), syphilis, human T-lymphotropic virus (HTLV), hepatitis
C virus (HCV), or syphilis. Exemplary pathogen antigens include an
HIV 1/2 antigen, e.g., p24, p15, p17, gp36, or gp 41; a Hep B
antigen, e.g., HepBsAg, or HepBcAg; or a Syphilis antigen, e.g.,
TmpA, p15, 17, or 47.
[0191] In other embodiments, the capture agent is an anti-RBC
antigen antibody, e.g., an antibody against at least 1, 2, 3, 4, 5,
6, 9, 10, 11, 12 or all of the RBC antigens provided in Table 1,
e.g., an RBC antigen described herein. Exemplary anti-RBC antigen
antibodies include antibodies against at least 1, 2, 3, 4, 5, 6, 9,
10, 11, 12 or all of the following RBC antigens: a Rhesus antigen,
e.g., one or more or all of D, C, c, E, or e; a MNS antigen, e.g.,
one or more or all of M, N, S, or s; a Kidd antigen, e.g., one or
both of Jk.sup.a or Jk.sup.b; a Duffy antigen, e.g., one or both of
Fy.sup.a or Fy.sup.b; a Kell antigen, e.g., one or both of K or k;
a Lewis antigen, e.g., one or both of Le.sup.a or Le.sup.b; or P
antigen, e.g., P1. In certain embodiments, the method includes
evaluating sample from said subject for an antibody to at least the
following RBC antigens: (1) D, C, E, e, c, and K; (2) D, C, E, e,
c, K, Fy.sup.a and Jk.sup.a; and (3) D, C, E, e, c, K, Fy.sup.a,
Fy.sup.b, Jk.sup.a, Jk.sup.b, S, and s.
[0192] In yet other embodiments, the capture agent is an
anti-pathogen antigen antibody, e.g., an antibody against a viral
antigen, e.g., a viral antigen chosen from one or more of human
immunodeficiency (HIV) virus, hepatitis B virus (HBV), syphilis,
human T-lymphotropic virus (HTLV), hepatitis C virus (HCV), or
syphilis, e.g., a viral antigen as described herein.
[0193] In yet other embodiments, the capture agent is a CMV, WNV,
HTLV-1 and -2, or platelet antigen, or an antibody against
same.
[0194] In certain embodiments, two different forces are applied, a
first force to provide force normal to the substrate or a surface
and a second force to provide force tangential to said substrate or
a surface. In one embodiment, the first force, e.g., a magnetic
force, is applied to produce force normal to said substrate or a
surface on a detection reagent complex or aggregate, and a second
force, e.g., fluid force, is applied to produce force tangential to
said substrate or a surface on a detection reagent complex or
aggregate.
[0195] In another aspect, the invention features a method of
evaluating a sample, e.g., a plasma sample, from a subject, for an
anti-RBC antigen antibody. The method can be applied to reverse
typing or grouping, antibody screening, or antibody identification.
The method includes:
[0196] (a) contacting a first red blood cell membrane (rbcm)
preparation with sample from said subject, under conditions
sufficient for the formation of an immune complex between a first
RBC antigen and the anti-first RBC antigen antibody in said
sample,
[0197] wherein, said first rbcm preparation is disposed on a
substrate, e.g., a substantially planar substrate, and the angle
between said substrate, e.g., substantially planar substrate, and
the direction of applied force, e.g., centrifugal, gravitational,
magnetic, electric or fluid, force, that causes migration of
detection reagent, is non-orthogonal or other than 90 degrees (in
other words, theta, the angle formed by the substrate and a line
perpendicular to the direction of centrifugal force, is
nonzero);
[0198] (b) providing a detection reagent under conditions
sufficient for the formation of a complex, e.g., an immune complex,
between said detection reagent and an anti-RBC antigen antibody in
said sample,
[0199] (c) applying force, e.g., centrifugal force, at said angle
such that detection reagent that does not bind to said first rbcm
preparation migrates across said substrate,
[0200] wherein the presence or absence of the analyte of interest
in the sample is indicated by a value of a parameter, e.g., a
measurable parameter, related to the behavior of, or positional
distribution of, the detection reagent. E.g., a preselected value
for a parameter related to the detection reagent, is correlated
with the presence or absence of said anti-first RBC antigen
antibody, in said sample. The parameter can be, by way of example,
the amount of the detection reagent (e.g., an increased or
decreased presence of the detection reagent); the pattern of
coverage of the substrate by the detection reagent; the amount of
coverage of the substrate by the detection reagent; the
distribution of the detection reagent, e.g., on a substrate; the
amount of aggregation of the detection reagent; the strength of
adherence of the detection reagent, to the rbcm preparation (e.g.,
as detected by optical trapping), as described herein,
[0201] thereby evaluating a sample for an anti-RBC antigen
antibody.
[0202] In an embodiment, force is applied such the ratio of normal
force/tangential force will decrease with time, e.g., decrease in a
continuous or non-continuous (e.g., in discrete steps), e.g., by
increase of the tangential force over time.
[0203] In another aspect, the invention features a method of
evaluating a sample, e.g., a plasma sample, from a subject, for an
anti-RBC antigen IgG antibody comprising:
[0204] (a) contacting a first red blood cell membrane (rbcm)
preparation with sample from said subject, under conditions
sufficient for the formation of an immune complex between a first
RBC antigen and anti-first RBC IgG antigen antibody in said
sample,
wherein, [0205] (i) said first rbcm preparation is disposed on a
substrate, e.g., a substantially planar substrate, and the angle
between said substrate and the direction of applied force, e.g.,
centrifugal, gravitational, magnetic, electric or fluid, force,
that causes migration of detection reagent, is non-orthogonal or
other than 90 degrees (theta, the angle formed by the substrate and
a line perpendicular to the direction of centrifugal force, is
nonzero); [0206] (ii) said substrate having said first rbcm
preparation, bound thereto, has one of the following properties:
[0207] (A) if red blood cells are dispersed on said substrate
having said first rbcm preparation bound thereto, less than 10, 5,
or 1% of the dispersed red blood cells are non-specifically bound,
e.g., as determined by optical trap measurement; [0208] (B) if red
blood cells are dispersed on said substrate having said rbcm
preparation bound thereto, the non-specific binding of dispersed
red blood cells to said substrate having said first rbcm
preparation bound thereto, is less than 50, 40, 30, 20, 10, 1.0,
0.1, or 0.01% of the non-specific binding of red blood cells to a
reference substrate, e.g., a substantially planar substrate having
a rbcm preparation, bound thereto, prepared in a similar manner
except that the red blood cells which are lysed to form a rbcm
preparation are deposited on the substrate by gravitational
settling as opposed to centrifugation; and [0209] (iii) optionally,
said rbcm preparation is a mo-rbcm preparation, e.g., it was
contacted with an agent that cleaves IgG molecules, e.g., an
enzyme, e.g., IdeS (immunoglobulin G-degrading enzyme of S.
pyrogenes), e.g., FabRICATOR.RTM.;
[0210] (b) providing a detection reagent that specifically binds
IgG antibodies under conditions sufficient for:
[0211] (i) the formation of a complex, e.g., an immune complex,
between said detection reagent and an anti-RBC antigen IgG antibody
in said sample; and
[0212] (ii) the detection reagent complexation of base units of
detection reagent with one another; and
[0213] (c) applying centrifugal acceleration at said angle such
that detection reagent that does not bind to said first rbcm
preparation complexes with itself and migrates across said
substrate, wherein, the position and degree of detection reagent
complex or aggregate formation of detection reagent is correlated
with the presence or absence of said anti-first RBC antigen
antibody in said sample, thereby evaluating a sample for an
anti-RBC antigen antibody.
[0214] In one embodiment, the substrate is configured such that
said angle of said substrate can be altered, e.g., to provide a
first angle for a first phase of centrifugation, and a second angle
for a second phase of centrifugation.
[0215] In yet another aspect, the invention features a method of
evaluating a sample for an analyte comprising:
[0216] (a) contacting a capture agent (e.g., an antibody, an
antigen, e.g., a rbcm preparation, e.g., an mimic optimized-rbcm
preparation) with sample, under conditions sufficient for the
formation of a complex between a capture agent, and said analyte
(e.g., an antigen, an antibody or other protein having specific
binding for said capture agent, e.g., in an anti-red blood cell
antibody and a rbcm preparation) in said sample,
wherein, said capture agent is disposed on a substrate or surface,
e.g., a substantially planar substrate or surface;
[0217] (b) providing a detection reagent comprising a deformable
entity, e.g., a cell, e.g., a red blood cell, or another entity
having similar deformability or size, and a binding agent, under
conditions sufficient for the formation of a complex, e.g., an
immune complex, between said detection reagent and analyte, e.g.,
anti-capture agent antibody in said sample,
[0218] (c) applying acceleration, centrifugal acceleration, at said
angle such that detection reagent that does not bind to said
capture agent migrates across said substrate or surface, e.g., a
substantially planar substrate or surface,
[0219] wherein the presence or absence of the analyte of interest
in the sample is indicated by a value of a parameter, e.g., a
measurable parameter, related to the behavior of, or positional
distribution of, the detection reagent. E.g., a preselected value
for a parameter related to the detection reagent, is correlated
with the presence or absence of said analyte, e.g., anti-capture
agent antibody, in said sample. The parameter can be, by way of
example, the amount of the detection reagent (e.g., an increased or
decreased presence of the detection reagent); the pattern of
coverage of the substrate by the detection reagent; the amount of
coverage of the substrate by the detection reagent; the
distribution of the detection reagent, e.g., on a substrate; the
amount of aggregation of the detection reagent; the strength of
adherence of the detection reagent, to the rbcm preparation (e.g.,
as detected by optical trapping), as described herein,
[0220] In one embodiment, base units of non-bound detection reagent
(e.g., detection reagent not bound to a capture agent) form
detection reagent complexes with one another, e.g., to form
aggregates of non-bound detection reagent.
[0221] In yet other embodiment, non-bound detection reagent, e.g.,
detection reagent complexes, e.g., an aggregate, is separated from
detection reagent bound to a capture agent.
[0222] In one embodiment, the deformable entity, e.g., a red blood
cell, allows the cell to explore more surface area (e.g., have more
surface to surface contact) as it transits the substantially planar
substrate, e.g., as it transits said substantially planar substrate
in response to the applied tangential force.
[0223] In one embodiment, the deformability of the deformable
entity, e.g., a red blood cell, promotes detection reagent
complexation in a negative sample and promotes migration across the
substantially planar substrate.
Method of Providing a Substrate
[0224] In another aspect, the invention features a method of
providing a substrate having red blood cells, or a red blood cell
membrane preparation, bound thereto comprising:
[0225] providing a substrate capable of binding red blood
cells;
[0226] contacting said substrate with a solution of red blood cells
to form a solution-contacted-substrate;
[0227] centrifuging said solution-contacted-substrate for a time
sufficient to cause red blood cells in said solution to settle onto
said substrate;
[0228] optionally, washing said substrate to remove unbound red
blood cells;
[0229] optionally, lysing red blood cells bound to said substrate
to provide a rbcm preparation bound to said substrate;
thereby providing a substrate having red blood cells, or a rbcm
preparation, bound thereto,
[0230] wherein, optionally, said substrate having red blood cells,
or a rbcm preparation, bound thereto, has one of the following
properties: [0231] said centrifugation is sufficient in force and
duration such that, if red blood cells are dispersed on the
substrate having red blood cells, or rbcm preparation, bound
thereto, less than 10, 5, or 1% of the dispersed red blood cells
are non-specifically bound, e.g., as determined by optical trap
measurement; [0232] said centrifugation is sufficient in force and
duration such that if red blood cells are dispersed on the
substrate having red blood cells, or rbcm preparation, bound
thereto, the non-specific binding of red blood cells to said
substrate having red blood cells, or rbcm preparation, bound
thereto, is less than 50, 40, 30, 20, 10, 1.0, 0.1, or 0.01% of the
non-specific binding of red blood cells to a reference substrate,
e.g., a substrate having red blood cells, or rbcm preparation,
bound thereto, prepared in a similar manner except that the red
blood cells are deposited on the substrate by gravitational
settling as opposed to centrifugation.
[0233] In certain embodiments, the method further includes lysing
red blood cells bound to said substrate, thereby providing a
substrate having a rbcm preparation bound thereto.
[0234] In one embodiment, the solution-contacted-substrate is
centrifuged at 400 g for 5 minutes at 20 degree C., in saline, or
under conditions sufficient to give a similar level of non-specific
binding.
[0235] The substrate can include glass or plastic. In one
embodiment, the substrate is derivatized with
aminopropyltriethoxysilane, poly-1-lysine, or Alcian Blue.
[0236] In certain embodiments, the substrate is a multi-well plate,
e.g., a 96 well plate, e.g., a polystyrene 96 well plate.
[0237] In other embodiments, the red blood cells, or rbcms, are
present on the substrate at between 14000-24000, 24000-34000 and
34000-40000, cells/mm.sup.2, e.g., at 26,000 cells/mm.sup.2.
[0238] In yet other embodiments, the centrifugation is sufficient
in force and duration such that if red blood cells are dispersed on
the substrate having red blood cells, or rbcm preparation, bound
thereto, less than 10, 5, or 1% of the dispersed red blood cells
are non-specifically bound, e.g., as determined by optical trap
measurement.
[0239] In one embodiment, the centrifugation is sufficient in force
and duration such that if red blood cells are dispersed on the
substrate having red blood cells, or rbcm preparation, bound
thereto, the non-specific binding of red blood cells to said
substrate having red blood cells, or rbcm preparation, bound
thereto, is less than 50, 40, 30, 20, 10, 1.0, 0.1, or 0.01% of the
non-specific binding of red blood cells to a reference substrate,
e.g., a substrate having red blood cells, or rbcm preparation,
bound thereto, prepared in a similar manner except that the red
blood cells are deposited on the substrate by gravitational
settling as opposed to centrifugation.
[0240] In one embodiment, the rbcm preparation is contacted with an
agent that cleaves IgG molecules, e.g., an enzyme, e.g., IdeS
(immunoglobulin G-degrading enzyme of S. pyrogenes), e.g.,
FabRICATOR.RTM., thereby producing a mimic optimized-rbcm
preparation.
Substrates
[0241] In another aspect, the invention features a substrate having
red blood cells, or a rbcm preparation, e.g., a mimic
optimized-rbcm preparation, bound thereto, wherein if red blood
cells are dispersed on the substrate having red blood cells, or
rbcm preparation, bound thereto, less than 10, 5, or 1% of the
dispersed red blood cells are non-specifically bound, e.g., as
determined by optical trap measurement.
[0242] In yet another aspect, the invention features substrate
having red blood cells, or a rbcm preparation, e.g., a mo-rbcm
preparation, bound thereto, wherein if red blood cells are
dispersed on the substrate having red blood cells, or rbcm
preparation, bound thereto, the non-specific binding of dispersed
red blood cells to said substrate having red blood cells, or a rbcm
preparation, bound thereto, is less than 50, 40, 30, 20, 10, 1.0,
0.1, or 0.01% of the non-specific binding of dispersed red blood
cells to a reference substrate, e.g., a substrate having red blood
cells, or rbcm preparation, bound thereto, prepared in a similar
manner except that the red blood cells are deposited on the
substrate by gravitational settling as opposed to
centrifugation.
[0243] In another aspect, the invention features a substrate having
red blood cells, or a rbcm preparation, e.g., a mo-rbcm
preparation, bound thereto, made by the method of claim 96, wherein
if red blood cells are dispersed on the substrate having red blood
cells, or rbcm preparation, bound thereto, less than 10, 5, or 1%
of the dispersed red blood cells are non-specifically bound, e.g.,
as determined by optical trap measurement.
[0244] In one aspect, the invention features a substrate having red
blood cells, or a rbcm preparation, e.g., a mo-rbcm preparation,
bound thereto, made by the method of claim 96, wherein if red blood
cells are dispersed on the substrate having red blood cells, or
rbcm preparation, bound thereto, the non-specific binding of
dispersed red blood cells to said substrate having red blood cells,
or a rbcm preparation, bound thereto, is less than 50, 40, 30, 20,
10, 1.0, 0.1, or 0.01% of the non-specific binding of dispersed red
blood cells to a reference substrate, e.g., a substrate having red
blood cells, or rbcm preparation, bound thereto, prepared in a
similar manner except that the red blood cells are deposited on the
substrate by gravitational settling as opposed to
centrifugation.
Devices
[0245] In another aspect, the invention features a device for
evaluating a sample, e.g., a plasma sample, from a subject, for an
anti-RBC antigen antibody, comprising:
[0246] a channel comprising [0247] a) a substrate having red blood
cells, or a rbcm preparation, e.g., a mo-rbcm preparation, bound
thereto, wherein [0248] if red blood cells are dispersed on the
substrate having red blood cells, or rbcm preparation, bound
thereto, less than 10, 5, or 1% of the dispersed red blood cells
are non-specifically bound, e.g., as determined by optical trap
measurement; or [0249] if red blood cells are dispersed on the
substrate having red blood cells, or rbcm preparation, bound
thereto, the non-specific binding of dispersed red blood cells to
said substrate having red blood cells, or a rbcm preparation, bound
thereto, is less than 50, 40, 30, 20, 10, 1.0, 0.1, or 0.01% of the
non-specific binding of dispersed red blood cells to a reference
substrate, e.g., a substrate having red blood cells, or rbcm
preparation, bound thereto, prepared in a similar manner except
that the red blood cells are deposited on the substrate by
gravitational settling as opposed to centrifugation;
[0250] wherein the device is configured such that, upon application
of a force, e.g., centrifugal, gravitational, fluid magnetic,
electric or fluid, force, detection reagent that has not formed an
immune complex can: form a detection reagent complex, e.g., to form
an aggregate; migrate into a negative readout region; or, both from
a detection reagent complex, e.g., form an aggregate and migrate
into a negative readout region.
[0251] In another aspect, the invention features a device for
evaluating a sample, e.g., a plasma sample, from a subject, for an
anti-RBC antigen antibody, comprising:
[0252] a channel comprising [0253] red blood cells, or a first rbcm
preparation e.g., a mo-rbcm preparation, disposed on a
substantially planar substrate, and the angle between said
substantially planar substrate and the direction of applied force,
e.g., centrifugal, gravitational, magnetic, electric or fluid,
force, that causes migration of detection reagent, is other than 90
degrees;
[0254] wherein the device is configured such that, upon application
of a force, e.g., centrifugal, gravitational, magnetic, electric or
fluid, force, detection reagent that has not formed an immune
complex can: form a detection reagent complex, e.g., form an
aggregate; migrate into a negative readout region; or, both form a
detection reagent complex, e.g., form an aggregate, and migrate
into a negative readout region.
[0255] Additional features of the devices of the invention include
one or more of the following:
[0256] In one embodiment, the detection reagent complexation, e.g.,
aggregation, in the presence or absence of said detection reagent
in a negative readout region; or detection reagent complexed, e.g.,
aggregated, detection reagent in said negative readout region, is
correlated with the presence or absence an anti-blood-type-antigen
antibody in said sample.
[0257] In one embodiment, the device includes a plurality of said
channels, each having a different rbcm preparation. In yet other
embodiment, each channel in said plurality is fluidically isolated
from the other channels of the plurality.
[0258] In one embodiment, the device has a first channel comprising
a first rbcm having a first RBC antigen (e.g., an RBC antigen as
described herein) and a second channel comprising a second rbcm
having a second RBC antigen. For example, the first antigen can be
antigen A and said second antigen can be antigen B.
[0259] In other embodiment, the rbcm preparation in the device is
contacted with an agent that cleaves IgG molecules, e.g., an
enzyme, e.g., IdeS (immunoglobulin G-degrading enzyme of S.
pyrogenes), e.g., FabRICATOR.RTM..
[0260] In other embodiments, the device is configured such that
said angle of said substantially planar substrate can be altered,
e.g., to provide a first angle for a first phase of centrifugation,
and a second angle for a second phase of centrifugation.
[0261] In another aspect, the invention features a device for
evaluating a sample, e.g., a plasma sample, from a subject, for one
or a plurality of different anti-RBC antigen antibodies
comprising:
[0262] a plurality of channels, e.g., at least 3, 6, 12, or 24
channels, each channel comprising [0263] a) a capture region for
receiving RBC or a rbcm preparation, e.g., a mo-rbcm preparation,
disposed on a substantially planar substrate, and the angle between
said substantially planar substrate and the direction of applied
force, e.g., centrifugal, gravitational, magnetic, electric or
fluid, force, that causes migration of detection reagent, is other
than 90 degrees;
[0264] wherein the device is configured such that, upon application
of a force, e.g., centrifugal or gravitational force, detection
reagent that has not formed an immune complex can: form detection
reagent complex, e.g., form an aggregate; migrate into a negative
readout region; or, both from a detection reagent complex, e.g.,
form an aggregate, and migrate into a negative readout region.
[0265] Methods of making the aforesaid devices are also encompassed
by the present invention.
Kits
[0266] In yet another aspect, the invention features a kit that
includes the rbcm preparation as described herein. In certain
embodiments, the kit further includes one or some or all of:
[0267] (a) detection reagent having a binding moiety as described
herein;
[0268] (b) a detection reagent complexing agent that promotes
detection reagent complexation between base units of detection
reagent;
[0269] (c) a positive control sample, e.g., a sample having an
antibody to a pre-selected blood type antigen;
[0270] (d) a negative control sample, e.g., a sample lacking an
antibody to a pre-selected blood type antigen;
[0271] (e) a first rbcm preparation, e.g., made by a method
described herein;
[0272] (f) a carrier on which said rbcm is or can be disposed;
and
[0273] (g) an agent that cleaves IgG, e.g., IdeS (immunoglobulin
G-degrading enzyme of S. pyrogenes), e.g., FabRICATOR.RTM., for
preparing a mo-rbcm preparation.
[0274] In certain embodiments, a panel of rbcm preparations
described herein is disposed on capture regions of said device.
[0275] Thus, in an embodiment the substrate is a substantially
planar substrate, and the angle between said substantially planar
substrate and the direction of applied force, e.g., centrifugal,
gravitational, fluid magnetic, electric or fluid, force, that
causes migration of forward detection reagent, is non-orthogonal or
other than 90 degrees (theta, the angle formed by the substantially
planar substrate and a line perpendicular to the direction of
centrifugal force, is nonzero.
[0276] Any of the features and embodiments described herein, e.g.,
methods (e.g., forward typing, reverse typing, antibody screening,
antibody isolation, Ig detection), IgG-specific binding moieties,
optimized substrates and substrate angles, and rbcm preparations
(e.g., density optimized rbcm preparations and mimic-optimized
preparations) described herein, can be combined in any order with
the described methods, and/or implemented on devices and kits
described herein. In one embodiment, a forward typing, antibody
screening and/or reverse typing method or assay is combined, e.g.,
on the same carrier, and/or processed simultaneously.
[0277] The term "or" is used herein to mean, and is used
interchangeably with, the term "and/or", unless context clearly
indicates otherwise.
[0278] "About" and "approximately" shall generally mean an
acceptable degree of error for the quantity measured given the
nature or precision of the measurements. Exemplary degrees of error
are within 20 percent (%), typically, within 10%, and more
typically, within 5% of a given value or range of values.
[0279] All publications, patent applications, patents, and other
references mentioned herein are incorporated by reference in their
entirety.
[0280] Other features, objects, and advantages of the invention
will be apparent from the description and drawings, and from the
claims.
DESCRIPTION OF THE FIGURES
[0281] FIGS. 1A-1D illustrate side views of an embodiment of
forward typing well configurations and testing, and a top view of
the readout regions.
[0282] FIGS. 1E-1G show a representative panel of photographs
depicting the positive and negative readouts of the forward typing
assays.
[0283] FIGS. 2A-2E illustrate side views of an embodiment of
reverse grouping well configurations and testing, and a top view of
the readout regions.
[0284] FIGS. 3A-3D illustrate side views of an embodiment of
extended phenotyping well configurations and testing, and a top
view of the readout regions.
[0285] FIGS. 4A-4D illustrate side views of the stepwise changes in
the well configurations according to one embodiment of the antibody
screening assays.
[0286] FIGS. 5A-5D illustrate side views of the stepwise changes in
the chamber configurations according to one embodiment of the
antibody screening assays after performing a centrifugation step,
and a top view of the readout regions.
[0287] FIGS. 6A-6C illustrate side views of the stepwise changes in
the chamber configurations according to the antibody screening
assays after performing optical trapping detection.
[0288] FIGS. 7A-7B depict a schematic representation of one
embodiment of the antibody screening assays described herein, and a
representative graph showing the percentage of red blood cells
detected as bound as a function of secondary incubation time.
[0289] FIG. 7C depicts a representative graph showing the
percentage of red blood cells detected as bound as a function of
secondary incubation time using the antibody screening assays
described herein.
[0290] FIGS. 8A-8D provide a stepwise representation of the
components of the antibody screening assays described in FIG.
7A.
[0291] FIG. 9 provides a representative graph showing a comparison
of the nonspecific binding to a red blood cell membrane preparation
using a panel of anti-IgG antibodies. The percentage of red blood
cells detected as bound as a function of secondary incubation time
is depicted.
[0292] FIG. 10 provides a representative graph depicting binding of
MS-278 monoclonal anti-IgG to two different red blood cell membrane
preparations, one positive for the D RBC antigen (#2 Cells D+) and
one negative for the D RBC antigen (#3 Cells D-), in the presence
of anti-D, as revealed by indicator cells (IgG-coated red
cells).
[0293] FIG. 11 provides a representative graph depicting binding of
rabbit polyclonal anti-IgG (Alba #Z356) to non-treated and enzyme
treated red blood cell membrane preparations.
[0294] FIGS. 12A-12C show a representative panel of photographs
depicting the positive and negative readouts of the ABO reverse
grouping assays.
[0295] FIG. 13A is a schematic top plane view of a centrifuge
operating in a clockwise direction.
[0296] FIGS. 13B-13C are schematic views illustrating forces as
applied to objects on an incline plane disposed in an operating
centrifuge.
[0297] FIG. 14 illustrates schematic and/or perspective view
representations of exemplary chamber configurations.
[0298] FIGS. 15A-15C are schematic views of a reverse grouping
configuration and testing.
[0299] FIGS. 16A-16B are representative photographs of positive and
negative readouts for antibody screening assays detected using a
low concentration of indicator cells.
[0300] FIGS. 16C-16D are representative photographs of positive and
negative readouts for antibody screening assays detected using a
high concentration of indicator cells.
[0301] FIGS. 17A-17F illustrate side and perspective views of a
number of exemplary substrate configurations.
[0302] FIG. 18 is a representative photograph of positive and
negative readouts detected using antigen typing assays.
DETAILED DESCRIPTION
[0303] The present invention provides, at least in part, methods
and devices for evaluating a sample, e.g., a plasma sample, from a
subject, for detecting a target molecule, e.g., an antibody (e.g.,
IgM-, IgG, IgE, an anti-red blood cell (RBC)-antigen antibody, and
an anti-pathogenic antibody); an RBC antigen, a viral or pathogenic
antigen). In one embodiment, the antigen is a RBC antigen, e.g., a
Rhesus antigen, an MNS antigen, a Kidd antigen, a Duffy antigen, a
Kell antigen, a Lewis antigen, or one or more antigens according to
Table 1). The present invention can be applied to screening and
blood typing, including forward typing, reverse grouping, antibody
screening (IgM and IgG class antibodies), antibody identification,
minor antigen typing, and extended phenotyping. In other
embodiments consistent with the present invention, methods and
devices disclosed herein are suitable for infectious disease
screening (e.g., human immunodeficiency (HIV) virus, hepatitis B
virus (HBV), syphilis, human T-lymphotropic virus (HTLV), hepatitis
C virus (HCV), syphilis, among others), by testing for antibodies
to these infectious agents or in some cases testing for the agents
themselves. In yet other embodiments, the invention can be applied
to allergy testing (e.g., IgE antibody testing).
[0304] In one embodiment, Applicants have discovered optimized
antibody screening methods and devices that significantly reduce
the level of background, non-specific binding to a surface (e.g., a
test surface bound with a red blood cell (RBC) membrane preparation
that includes an RBC antigen described herein), thus allowing for
more efficient detection and reduced test time.
[0305] In another embodiment, Applicants have discovered that
ruptured human red blood cells (e.g., a human red blood cell
membrane preparation described herein) lead to non-specific binding
of several commercially available anti-IgG antibodies. Without
wishing to be bound by theory, it is believed that rupturing red
blood cells to produce the rbc membrane preparation unmasks an
IgG-mimic that is recognized by such antibodies. At least two
different embodiments for decreasing the non-specific binding
caused by the ruptured red blood cell membrane preparations are
disclosed in the present application.
[0306] In one embodiment, IgG binding moieties that bind
selectively and specifically to the plasma IgG present, relative to
the binding to the rbcm preparation, are disclosed. In one
embodiment, the IgG binding moieties' non-specific binding to the
rbcm preparation is decreased by at least 10%, 20%, 30% or more
(e.g., as determined by optical trapping). In another embodiment,
the IgG-specific binding moiety includes an antibody molecule that
binds to an IgG, e.g., an antibody molecule that binds to a
constant region (e.g., a heavy chain Fc region or a light chain
constant region) of the IgG, or a heavy or light chain variable
domain of the IgG. In certain embodiments, the IgG-specific binding
moiety includes an antibody molecule that has one or more of the
properties of monoclonal antibody MS-278 (e.g., the IgG-specific
binding moiety comprises a monoclonal antibody MS-278, or an
antigen binding fragment thereof). In other embodiments, the
IgG-specific binding moiety includes an antibody molecule that
binds to a light chain constant region.
[0307] Alternatively, or in combination with, the methods described
herein, non-specific binding caused by the lysed red blood cell
membrane preparation can be reduced by an agent that disrupts the
IgG mimic (e.g., an enzyme that cleaves IgG) present on the rbcm
preparations, thereby producing a mimic-optimized rbcm preparation.
In one embodiment, the agent is an enzyme, e.g., a cysteine
proteinase, with specificity for immunoglobulin G. In one
embodiment, the enzyme is an immunoglobulin-degrading enzyme of S.
pyogenes (e.g., IdeS). Mimic-optimized rbcm preparation are also
encompassed by the present invention.
[0308] In another aspect, the invention provides methods and
devices for target capturing that include a surface or substrate,
e.g., a substantially planar surface or substrate, optionally
having an optimized angle, for capture. Alternative solid phase
geometries for capture are disclosed.
[0309] In another aspect, optimized methods for cell deposition are
disclosed.
[0310] In another aspect, the invention provides methods and
devices for determining the presence or absence of red blood cell
minor group antigens using surfaces presenting antibodies to each
said minor red cell antigen. Applicants have developed a simplified
system including the preparation of the antibodies, preparation of
suitable surfaces presenting said antibodies, and the parameters
which enable such a test to be performed successfully. These
devices and methods are suitable for minor antigen typing, as well
as red cell phenotyping.
[0311] The invention also discloses devices, kits, assays that rely
on one of more of the embodiments disclosed herein.
DEFINITIONS
[0312] Certain terms are first defined.
[0313] "Antibody identification," as used herein, refers to a
series of tests used to determine the specificity of the one or
more antibodies present in a plasma sample which give rise to a
positive antibody screening test result. For example, if a positive
blood group antibody screen is obtained, blood group antibody
identification will comprise a series of tests of the reactivity of
the plasma sample with substrates or reagents to determine the
particular blood group antigen specificity(ies) of the
antibody(s).
[0314] "Antibody screening," as used herein, refers to the
detection of non-native (elicited) antibodies specific to an
antigen. These antibodies can be IgG and IgM antibodies. In one
embodiment, the antigen is a red blood cell (RBC) antigen. Red
blood cell antigens are antigens found on the surface of the red
blood cells, and include, but are not limited to, the roughly 600
blood group antigens known to date. In certain embodiments, the
blood group antigens include the A and B antigens, as well as
antigens of the Rh system, e.g., D antigens. Other exemplary red
blood cell antigens include an MNS antigen, a Kidd antigen, a Duffy
antigen, a Kell antigen, a Lewis antigen and a P antigen (e.g., an
antigen listed in Table 1).
[0315] In other embodiments, the antigen detected by antibody
screening is a viral antigen (e.g., human immunodeficiency (HIV)
virus, hepatitis B virus (HBV), syphilis, human T-lymphotropic
virus (HTLV), hepatitis C virus (HCV), among others).
[0316] "Antibody testing," as used herein, can refer to testing for
the presence of one or more plasma antibodies, e.g., anti-IgG
antibodies.
[0317] "Blood group," or "blood type," as used herein refers to any
of the immunologically distinct, genetically determined classes of
human blood that are based on the presence or absence of certain
antigens. Blood groups are typically clinically identified by
characteristic agglutination reactions. Blood group antigens which
are typically associated with the ABO blood group system, and
includes the A, B, AB, and O blood groups.
[0318] "Blood typing," as used herein, refers to ABO and D
antigens. Blood types are typically classified as ABO Rh "blood
type" commonly listed on the donor cards for blood donors (e.g., A
Rh Pos, A Rh Neg, B Rh Pos, B Rh Neg, O Rh Pos, O Rh Neg, AB Rh
Pos, AB Rh Neg).
[0319] "Detection reagent complex" or "detection reagent
aggregate," as used herein, refers to a plurality of base units of
detection reagent held together by an interaction, e.g., an
interaction mediated by non-covalent bonds. It refers to an
interaction between base units of detection reagents and not to an
interaction between detection reagent and a target analyte, e.g.,
antigen. A detection reagent complex or a detection reagent
aggregate migrates as a single entity, e.g., across the surface of
a rbcm preparation on a substantially planar substrate. In an
embodiment a detection reagent complex is easier to detect than non
complexed detection reagent, e.g., because it presents an aggregate
that can be optically detected, e.g., by spectroscopy or by visual
inspection.
[0320] Typically, an aggregate is of macroscopic dimension, e.g.,
comprising greater than 100 base units of detection reagent.
Typically, an aggregate is of detectably distinct character,
comprising enough distinct units to have qualitatively distinct
behavior and appearance from non-aggregated units. Typically an
aggregate is of distinct character under external forcing, e.g.,
moving at a much larger speed under centrifugation than uncomplexed
base units of detection reagent. An aggregate can comprise at least
2, 10, 20, 50, 100, 200, 1,000, 10,000, 1,000,000, 10,000,000, or
50,000,000 base units of detection reagent. An aggregate can have
macroscopic dimension, e.g., an aggregate having a dimension, e.g.,
along its largest dimension, of between 140-500 um, 75 um-1 mm, 50
um and 10 mm.
[0321] In one embodiment, the detection reagent comprises a
deformable component, e.g., a cell (e.g., a red blood cell), or an
entity which is similarly deformable.
[0322] "Detection reagent," as used herein, has a binding moiety
capable of binding to an analyte, e.g., binding to an antibody,
e.g, an IgG-specific binding moiety. A base unit (or unit) of
detection reagent typically comprises an indicator moiety, e.g., a
red blood cell, and one or more binding agents, e.g., IgG binding
agents, e.g., IgG-specific binding agents. In embodiments base
units of detection reagent are capable of complexing to form
aggregates. A detection reagent can include a moiety that promotes
aggregation between detection reagent units, e.g., and anti-D
antibody.
[0323] "Extended phenotyping", as used herein, refers to testing
for the presence or absence of each of a collection of red cell
minor blood group antigens on the surface of a sample of red blood
cells. For example, an extended phenotype could test for each of D,
C, c, E, e, and K. As another example, and extended phenotype could
test for each of D, C, c, E, e, K, Jk.sup.a, Jk.sup.b, Fy.sup.a,
Fy.sup.b, S, and s. As another example, an extended phenotype could
test for each of D, C, c, E, e, K, k, Jk.sup.a, Jk.sup.b, Fy.sup.a,
Fy.sup.b, M, N, S, s, Le.sup.a, Le.sup.b, and P1, which may be
referred to specifically as a "complete extended phenotype" or
"full extended phenotype".
[0324] "Forward typing," as used herein, refers to determination of
the A/B/O/D type by detecting the presence or absence of A, B, and
D antigens on red blood cells.
[0325] "IgG mimic," as used herein, refers to an epitope on rbcm
preparations that is bound by some anti-IgG antibodies, e.g., Alba
Z356. In certain embodiments, the IgG mimic can be partially
inactivated by treatment with a proteolytic enzyme, e.g., IdeS
(immunoglobulin G-degrading enzyme of S. pyrogenes), e.g.,
FabRICATOR.RTM..
[0326] "IgG-specific binding moiety," is a moiety that shows
sufficient specificity for IgG, as opposed to an rbcm preparation
(e.g., as mediated by an IgG mimic on rbcm preparations) to allow
for use in the method described herein, e.g., it shows a
specificity described herein.
[0327] "Mimic-optimized (mo) rbcm preparation," as used herein, is
a rbcm preparation that has been exposed to a treatment that partly
or entirely neutralizes, the IgG mimic. In embodiments, the rbcm
preparation is contacted with an agent that binds to or cleaves
IgG, antibodies, e.g., in the Fc region. The treatment inactivates,
e.g., by cleavage or binding or masking, epitopes on the rbcm
preparations that mimic IgG and are associated with binding of
anti-IgG antibodies to rbcm preparations. In an embodiment a mimic
optimized-rbcm preparation is produced by contacting the rbcm
preparation (or cells from which it is made) with a proteolytic
enzyme, e.g., IdeS (immunoglobulin G-degrading enzyme of S.
pyrogenes), e.g., FabRICATOR.RTM.. In an embodiment the agent is an
anti-IgG antibody that is itself not bound by an IgG-specific
binding agent. E.g., it can be an anti-IgG fragment or an anti-IgG
antibody of other than G isotype.
[0328] "Minor antigen typing," as used herein, refers to testing
for the presence or absence of one or several specific red cell
minor blood group antigens on the surface of a sample of red blood
cells. For example, a minor antigen type test may test for the E
antigen. As another example, one may perform minor antigen typing
for both the K antigen and Jk.sup.a antigen, wherein one performs a
minor antigen test for each of K and Jk.sup.a.
[0329] "Negative readout region," as used herein, is a region in
which a signal can indicate the absence of an analyte.
[0330] "Positive readout region," as used herein, is a region in
which a signal can indicate the presence of an analyte.
[0331] "Readout region," as used herein, is a region, e.g., a
pre-selected region, from which a signal, e.g., a signal
corresponding to the presence or absence of an analyte, is
collected.
[0332] "Red blood cell membrane preparation" (a rbcm preparation)
as used herein, refers to lysed red blood cells. Typically, the
lysed red blood cell membranes are bound to a substrate, e.g., a
substantially planar substrate with sufficient affinity to allow
the manipulations in the methods described herein.
[0333] "Reverse grouping," as used herein, refers to the
determination of A/B/O group by detecting the presence or absence
of native antibodies, typically IgM antibodies, specific to A and B
antigens (ie. anti-A, anti-B, anti-AB) in blood plasma or
serum.
[0334] "Substantially planar substrate," as used herein, means a
substrate or a region of a substrate, which has one or more of the
following properties:
[0335] (1) it is sufficiently planar that the desired ratio of
normal force and tangent force can be maintained precisely or
approximately throughout the substantially planar substrate;
[0336] (2) the surface vector S (which is normal to the surface of
the substantially planar substrate region) is constant or does not
does not vary in angle, relative to its average, by more than 2, 5,
or 10 degrees across the substantially planar substrate:
[0337] (3) the angle between the surface vector S (which is normal
to the surface of the substantially planar substrate region) and a
reference vector R, e.g., the symmetry axis of a cone, is constant,
or varies by no more than 2, 5, or 10 degrees, across the
substantially planar substrate substrate (thus, the surface of a
perfect cone is a substantially planar substrate, as is a region of
a paraboloid in the vicinity of its symmetry axis); or
[0338] (4) the ratio of the normal force to the tangent force does
not exceed 110%, 130%, or 200%, or fall below 90%, 70% or 50%, of
its average value within the substantially planar substrate.
[0339] When disposed in a well, tube or other enclosure, the
substantially planar substrate need not occupy the entire bottom of
the enclosure. The substantially planar substrate may be continuous
with other substrate regions that are not substantially planar. In
an embodiment, the substantially planar substrate has a surface
area of 20-200, 4-40, 0.4-10, or 0.2-10 mm.sup.2. In an embodiment
the substantially planar substrate is of sufficient area that it
allows development of a substantial difference in migration between
a detection reagent aggregate, e.g., one that includes at least 50,
100, or 200 base units of detection reagent and detection reagent
base units that are not detection reagent complexed.
[0340] A well, tube, or other enclosure, for use in a method of
device described herein can comprise one or a plurality of
substantially planar substrates. Substantially planar substrates
can be disposed on the same, or different substrates. In an
embodiment having a plurality of substantially planar substrates in
one well tube or other enclosure, the surface area of the plurality
is 20-200, 4-40, 0.4-10, or 0.2-10 mm.sup.2.
[0341] Substantially planar does not require a smooth surface. In
embodiments, substantially planar substrate can have surface
texturing, e.g., it can be grooved or have a roughened or dimpled
surface. In an embodiment the average displacement between the
lowest and highest points of the features is less than 10 microns,
1-100 microns, or 10-50 microns. For the preceding determination of
the surface vector in cases where the surface has structure or
texture on length scales smaller than 5, 10, 25, or 50 microns, the
surface vector is taken to be the vector normal to the "average
surface" at that point, where the average surface is calculated by
fitting the neighborhood of size 5, 10, 25, or 50 microns to a
plane. In one embodiment, the surface of the substantially planar
substrate resides substantially in a plane.
[0342] The substantially planar substrate can be disposed on a
substrate which comprises a substantially planar region or
substrate and a region which is not substantially planar substrate.
A region which is not a substantially planar substrate could be:
(a) a "capture feature" for capturing cells as they travel across
the surface, which, in embodiments, optimizes the detection, e.g.,
optical detection, of unbound cells, (b) an "aggregate nucleation
region" which, in embodiments is steeper than the substantially
planar region and, relative to the direction traverse of cells
across the substantially planar substrate, is upstream of it,
which, in embodiments facilitates formation of aggregates, e.g.,
small aggregates, to more quickly clear off the substantially
planar region for negative samples, and (c) a negative readout
region which may or may not be part of the substantially planar
region, and which, in embodiments, is where aggregates, e.g., large
aggregates, to traverse to. FIGS. 13B-13C show exemplary
substantially planar substrates.
[0343] The methods, devices and kits of the present invention
encompass polypeptides and nucleic acids having the sequences
specified, or sequences substantially identical or similar thereto,
e.g., sequences at least 85%, 90%, 95% identical or higher to the
sequence specified. In the context of an amino acid sequence, the
term "substantially identical" is used herein to refer to a first
amino acid that contains a sufficient or minimum number of amino
acid residues that are i) identical to, or ii) conservative
substitutions of aligned amino acid residues in a second amino acid
sequence such that the first and second amino acid sequences can
have a common structural domain and/or common functional activity.
For example, amino acid sequences that contain a common structural
domain having at least about 85%, 90%. 91%, 92%, 93%, 94%, 95%,
96%, 97%, 98% or 99% identity to a reference sequence, e.g., SEQ ID
NO: 1-SEQ ID NO: 37 are termed substantially identical.
[0344] Calculations of homology or sequence identity between
sequences (the terms are used interchangeably herein) are performed
as follows.
[0345] To determine the percent identity of two amino acid
sequences, or of two nucleic acid sequences, the sequences are
aligned for optimal comparison purposes (e.g., gaps can be
introduced in one or both of a first and a second amino acid or
nucleic acid sequence for optimal alignment and non-homologous
sequences can be disregarded for comparison purposes). In a
preferred embodiment, the length of a reference sequence aligned
for comparison purposes is at least 30%, preferably at least 40%,
more preferably at least 50%, 60%, and even more preferably at
least 70%, 80%, 90%, 100% of the length of the reference sequence.
The amino acid residues or nucleotides at corresponding amino acid
positions or nucleotide positions are then compared. When a
position in the first sequence is occupied by the same amino acid
residue or nucleotide as the corresponding position in the second
sequence, then the molecules are identical at that position (as
used herein amino acid or nucleic acid "identity" is equivalent to
amino acid or nucleic acid "homology").
[0346] The percent identity between the two sequences is a function
of the number of identical positions shared by the sequences,
taking into account the number of gaps, and the length of each gap,
which need to be introduced for optimal alignment of the two
sequences.
[0347] The comparison of sequences and determination of percent
identity between two sequences can be accomplished using a
mathematical algorithm. In a preferred embodiment, the percent
identity between two amino acid sequences is determined using the
Needleman and Wunsch ((1970) J. Mol. Biol. 48:444-453) algorithm
which has been incorporated into the GAP program in the GCG
software package (available at http://www.gcg.com), using either a
Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14,
12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6. In
yet another preferred embodiment, the percent identity between two
nucleotide sequences is determined using the GAP program in the GCG
software package (available at http://www.gcg.com), using a
NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and
a length weight of 1, 2, 3, 4, 5, or 6. A particularly preferred
set of parameters (and the one that should be used unless otherwise
specified) are a Blossum 62 scoring matrix with a gap penalty of
12, a gap extend penalty of 4, and a frameshift gap penalty of
5.
[0348] The percent identity between two amino acid or nucleotide
sequences can be determined using the algorithm of E. Meyers and W.
Miller ((1989) CABIOS, 4:11-17) which has been incorporated into
the ALIGN program (version 2.0), using a PAM120 weight residue
table, a gap length penalty of 12 and a gap penalty of 4.
[0349] The nucleic acid and protein sequences described herein can
be used as a "query sequence" to perform a search against public
databases to, for example, identify other family members or related
sequences. Such searches can be performed using the NBLAST and
XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol.
Biol. 215:403-10. BLAST nucleotide searches can be performed with
the NBLAST program, score=100, wordlength=12 to obtain nucleotide
sequences homologous to a nucleic acid (SEQ ID NO: 1) molecules of
the invention. BLAST protein searches can be performed with the
XBLAST program, score=50, wordlength=3 to obtain amino acid
sequences homologous to protein molecules of the invention. To
obtain gapped alignments for comparison purposes, Gapped BLAST can
be utilized as described in Altschul et al., (1997) Nucleic Acids
Res. 25:3389-3402. When utilizing BLAST and Gapped BLAST programs,
the default parameters of the respective programs (e.g., XBLAST and
NBLAST) can be used. See http://www.ncbi.nlm.nih.gov.
Forward Typing, Minor Antigen Typing and Extended Phenotyping
[0350] In one aspect, the invention provides methods, devices and
kits for evaluating a sample for a red blood cell antigen, e.g.,
forward typing, minor antigen typing, or extended phenotyping. The
method includes:
[0351] (a) contacting a red blood cell antigen binding agent, e.g.,
an anti-red blood cell antigen antibody, disposed on a surface
(e.g., a functionalized surface as described herein) with the
sample, e.g., a sample containing one or more red blood cells,
under conditions sufficient for the formation of a complex between
said red blood cell antigen binding agent, e.g., anti-red blood
cell antigen antibody, and a red blood cell in said sample to
occur, wherein said red blood cell comprises the red blood cell
antigen (referred to herein as "complexed cells");
[0352] (b) separating the complexed cells, e.g., by causing
differential migration of red blood cells not complexed with said
red blood cell antigen binding agent, e.g., anti-red blood cell
antigen antibody ("uncomplexed cells"), relative to the complexed
cells, across said substrate, wherein a change, e.g., an increase
or decrease, in the amount of complexed and/or uncomplexed red
blood cells, is correlated with the amount of said red blood cell
antigen in said sample, thereby evaluating a sample for a red blood
type antigen.
[0353] In an embodiment, the red blood cell antigen is a blood-type
antigen, e.g., an A, B, AB or D antigen. In one embodiment, the
method is a forward typing method, e.g., comprises the detection of
a red blood cell antigen chosen from an A, B, or D antigen.
[0354] An embodiment of a forward typing assay is depicted in FIGS.
1A-1D. Referring to FIG. 1A, a side view of three forward typing,
U-shaped wells labeled D, E, and F is depicted. Each well is
modified to contain a red blood cell binding agent disposed on
(e.g., covalently or non-covalently bound to) its inner surface. In
one embodiment, the red blood cell binding agent is an anti-red
blood cell antigen antibody (e.g., an IgG or an IgM (as shown), or
a combination thereof). In other embodiments, the red blood cell
antigen binding agent can be a molecule that binds to a red blood
cell antigen, e.g., a protein, a peptide or a carbohydrate. In
other embodiments, the red blood cell antigen binding agent is a
plant-derived binding agent, e.g., a lectin. In the embodiments
shown in FIGS. 1A-1D, each well contains a different IgM antibody,
e.g., an antibody against antigen D, E, and F disposed on the
inner, lower portion of the well. A sample, e.g., plasma, serum or
whole blood sample containing red blood cells (depicted as open
circles in FIG. 1B), is added under conditions sufficient for the
formation of a complex between said red blood cell antigen binding
agent, e.g., anti-red blood cell antigen antibody, and a red blood
cell in said sample to occur (referred to herein as "complexed
cells"). In certain embodiments, the complexed cells are separated
from the uncomplexed cells, e.g., by causing differential migration
of red blood cells not complexed with said red blood cell antigen
binding agent, e.g., anti-red blood cell antigen antibody
("uncomplexed cells"), relative to the complexed cells, across said
substrate. The formation of complexed cells is represented well D
in FIG. 1C. The positive readout is represented as a uniform
distribution of the complexed cells across the inner surface of the
well, represented in FIG. 1D as a homogeneous distribution across
the entire top view of well D. Negative readouts are shown in a
side view of wells E and F, depicted as an aggregate of uncomplexed
cells. A top view of the negative readout is shown in schematic
form in FIG. 1D, where the aggregated, uncomplexed cells are
clustered in the center portion of the wells. FIGS. 1E and 1G show
representative positive readouts, and FIG. 1F shows a
representative negative readout for the forward typing assays
described herein.
[0355] In other embodiments, the red blood cell antigen is chosen
from at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or all of the
RBC antigens provided in Table 1. In one embodiment, the red blood
cell antigen is a minor antigen. In one embodiment, the red blood
cell antigen is chosen from one, two, three, four, five, six,
seven, eight, nine, ten, eleven, twelve, or more, or all of: a
Rhesus antigen, e.g., one or more or all of D, C, c, E, or e; an
MNS antigen, e.g., one or more or all of M, N, S, or s; a Kidd
antigen, e.g., one or both of Jk.sup.a or Jk.sup.b; a Duffy
antigen, e.g., one or both of Fy.sup.a or Fy.sup.b; a Kell antigen,
e.g., one or both of K or k; a Lewis antigen, e.g., one or both of
Le.sup.a or Le.sup.b; or aP antigen, e.g., P1. In certain
embodiments, the red blood cell antigen analyzed includes at least
the following RBC antigens: (1) D, C, E, e, c, and K; (2) D, C, E,
e, c, K, Fy.sup.a and Jk.sup.a; or (3) D, C, E, e, c, K, Fy.sup.a,
Fy.sup.b, Jk.sup.a, Jk.sup.b, S, and s.
[0356] FIGS. 3A-3D provide a schematic of one embodiment of
extended phenotyping assays. Similar to the forward typing assays,
three wells, labeled D, E and F, are depicted, each one containing
a different red blood cell antigen binding agent. The red blood
cell antigen binding agent can be any molecule that binds to a red
blood cell antigen, e.g., a protein, a peptide or a carbohydrate.
In one embodiment, the red blood cell antigen binding agent is an
anti-red blood cell antigen antibody (e.g., an IgG or an IgM, or a
combination thereof). In other embodiments, the red blood cell
antigen binding agent is a plant-derived binding agent. In the
embodiments shown in FIGS. 3A-3D, each well contains a different
IgM antibody (depicted as a pentameric structure in well D), IgG
antibody (depicted as a "Y" in well E), or a combination of IgM and
IgG antibodies (in well F), e.g., disposed on the inner, lower
portion of the well. A sample, e.g., plasma, serum or whole blood
sample containing red blood cells (depicted as open circles in FIG.
3B), is added under conditions sufficient for the formation of a
complex between said red blood cell antigen binding agent, e.g.,
anti-red blood cell antigen antibody, and a red blood cell in said
sample to occur (referred to herein as "complexed cells"). In
certain embodiments, the complexed cells are separated from the
uncomplexed cells, e.g., by causing differential migration of red
blood cells not complexed with said red blood cell antigen binding
agent, e.g., anti-red blood cell antigen antibody ("uncomplexed
cells"), relative to the complexed cells, across said substrate.
The formation of complexed cells is represented well D in FIG. 3C.
The positive readout is represented as a uniform distribution of
the complexed cells across the inner surface of the well,
represented in FIG. 3D as a homogeneous distribution across the
entire top view of well D. Negative readouts are shown in a side
view of wells E and F, depicted as an aggregate of uncomplexed
cells. A top view of the negative readout is shown in schematic
form in FIG. 3D, where the aggregated, uncomplexed cells are
clustered in the center portion of the wells
[0357] In an embodiment, the change, e.g., presence or absence, of
detection uncomplexed cells is detected by in one or more of: a
difference in the amount of the detection reagent (e.g., an
increased or decreased presence of the detection reagent); a
difference in the distribution of the detection reagent, e.g., on a
surface; a difference in the amount of aggregation of the detection
reagent; or a difference in the strength of adherence of the
detection reagent to the rbcm preparation (e.g., as detected by
optical trapping).
[0358] In one embodiment, the separation is effected by applying
acceleration, e.g., centrifugal, fluid magnetic, electric or fluid,
that causes migration of the complexed and uncomplexed cells.
[0359] In an embodiment, the surface is configured such that the
applied acceleration results in migration of uncomplexed cells into
an agglutination complex, e.g., at the bottom of a chamber (e.g., a
well or a tube). In an embodiment, the detection of the presence of
uncomplexed cells (e.g., a negative readout) is correlated with the
absence of said anti-RBC antigen antibody and said sample. In
certain embodiments, the negative readout is a button or a pellet.
Exemplary schematics of negative readouts are shown in FIGS. 1D and
3D as samples E and F.
[0360] In one embodiment, the detection of the presence of
complexed cells (e.g., a positive readout) is correlated with the
presence of binding between said anti-RBC antigen antibody and said
sample. In certain embodiments, the positive readout is detected as
a haze. A schematic of the top views of the readout in chamber is
depicted in FIGS. 1D and 3D, where a positive readout is detected
as a haze in sample D of FIGS. 1D and 3D.
[0361] In an embodiment, the readout region is disposed in a
chamber, e.g., a well or tube.
[0362] In an embodiment, the chamber is disposed on a carrier,
e.g., a multi-chamber or multi-well plate, e.g., a 96 well
plate.
[0363] In an embodiment, the angle between said carrier and the
direction of force is non normal, e.g., between 25-5, 20-7.5, or 10
degrees.
Reverse Grouping
[0364] In another aspect, the invention features a method of
evaluating a sample for a red blood cell (RBC) antigen-specific
antibody, e.g., reverse grouping or typing. The method
comprises:
[0365] (a) contacting a rbcm preparation which comprises a red
blood cell antigen, e.g., a blood group antigen, e.g., an A, B, or
O antigen, disposed as a substrate of a surface, with sample, under
conditions sufficient for the formation of a complex between said
rbcm preparation and an anti-red blood cell antigen-specific
antibody, e.g., anti-A, anti-B, or anti-C antibody, in said
sample;
[0366] (b) providing indicator moieties, e.g., indicator cells
(e.g., one or more red blood cells), positive for said red blood
cell antigen, e.g., A+, B+, or O+ indicator cells, and an agent
that can promote clumping between indicator moieties, e.g.,
indicator cells, under conditions sufficient for the formation of a
complex, e.g., an immune complex, between said multi-valent binding
agent and indicator moieties, e.g., indicator cells,
[0367] (c) applying acceleration, e.g., from centrifugal,
gravitational, fluid magnetic, electric or fluid, force,
[0368] wherein said indicator moieties, e.g., indicator cells,
e.g., by the distribution of indicator moieties, e.g., indicator
cells, or by the strength of adhesion of unbound indicator
moieties, e.g., indicator cells, to the substrate, indicate the
presence or absence of said red blood cell antigen, thereby
evaluating said sample.
[0369] In an embodiment, the multi-valent binding agent, e.g., an
IgM antibody, binds a moiety that is present on said indicator
cells but not present on said rbcm. In an example the moiety is a
red blood cell antigen other than the red blood cell antigen being
analysed. In an embodiment the moiety is other than a blood group
antigen. In an embodiment the moiety is D antigen, and the
multi-valent binding agent, e.g., an IgM antibody, is an anti-D
antibody. In an embodiment the rbcm are negative for D antigen the
indicator cells are positive for D antigen.
[0370] Referring to FIGS. 2A-2E, one embodiment of the reverse
grouping preparation and testing is represented in schematic form.
FIG. 2A provides three wells having different rbcm preparations
disposed on the inner surface of the bottom of the wells to form a
substrate. From left to right in FIG. 2A, each well is labeled A-
(corresponding to the cells in the rbcm, e.g., A1 cells, RhD-
cells); B- (corresponding to B cells, RhD- cells); and O-
(corresponding to O cells, RhD- cells). A multi-valent binding
agent, e.g., an IgM antibody, that binds a moiety that is present
on said indicator cells, but not present on said rbcm is added in
FIG. 2B, in this case, the multu-valent binging agent is an anti-D
IgM antibody. In FIG. 2C, the sample is added and the corresponding
indicator cell according to the rbcm preparation; e.g., from left
to right, A+ cells, B+ cells, and O+ cells are added. The bound and
unbound samples are separate, e.g., by centrifugation, and the
results are depicted in FIGS. 2D and 2E (side and top views,
respectively). The left hand well in FIGS. 2D and 2E depict a
positive readout, showing a haze or uniform distribution of the
indicator cells on the surface. The middle and right hand wells in
FIGS. 2D and 2E show a representation of a negative readout, with a
cluster of aggregated, non-bound antibody and cells at the bottom
of the wells.
[0371] In certain embodiments, the rbcm preparation is disposed on
a surface to form a substrate. In one embodiment, the rbcm
preparation is bound (e.g., non-covalently or covalently) to a
surface, e.g., a functionalized surface. For example, an rbcm
preparation containing pre-selected red blood cells can be disposed
(e.g., by centrifugation or gravitational settling) onto a surface
capable of binding red blood cells. In embodiments, the rbcm
preparation provides a substrate having a density of between
14000-24000, 24000-34000 and 34000-40000, cells/mm.sup.2, e.g.,
26,000 cells/mm.sup.2 on the surface. Protocols and exemplary
surfaces to be used in the methods are described herein.
[0372] In one embodiment, the indicator moieties, e.g., indicator
cells, are present at a concentration that results in less than the
entire substrate being covered with a monolayer of indicator
moieties, e.g., indicator cells. E.g., the indicator moieties,
e.g., indicator cells, are present in an amount that provides a
sparse coating of the substrate. In embodiments, the indicator
moieties, e.g., indicator cells, are present in an amount that
results in coverage of less than or about 5%, 10%, 15%, 20%, 25% or
30% of the area of the substrate.
[0373] In other embodiments, the concentration of indicator
moieties, e.g., indicator cells, is such that at least 30, 40, 50,
60, 70, 80, 90, or 100% of the substrate is covered with at least a
monolayer of indicator moieties, e.g., indicator cells. In
embodiments, the indicator moieties, e.g., indicator cells, are
present at a concentration that results in the entire substrate
being covered with at least a monolayer. In embodiments portions of
the substrate are covered with more than one layer of indicator
moieties, e.g., indicator cells, e.g., portions of the substrate
are covered by a multilayer of indicator moieties, e.g., indicator
cells. In embodiments, the detection indicator moieties, e.g.,
indicator cells, are present in an amount that is at least 10, 20,
30, 40, 50, 60, 70, 80, 90, or 100, and typically at least 50 times
the amount that would give 20% coverage of the substrate with a
monolayer.
[0374] In certain embodiments, the presence or absence of the
anti-RBC antigen antibody in the sample is indicated by a
parameter, e.g., a measurable parameter, related to the behavior
of, or positional distribution of, indicator moieties, e.g.,
indicator cells. E.g., a preselected value for a parameter related
to indicator moieties, e.g., indicator cells, is indicative of the
presence or absence of the anti-RBC antigen antibody. The parameter
can be, by way of example, the amount of the indicator moieties,
e.g., indicator cells (e.g., an increased or decreased presence of
the indicator moiety, e.g., indicator cell); the pattern of
coverage of the substrate by the indicator moieties, e.g.,
indicator cells; the amount of coverage of the substrate by the
indicator moieties, e.g., indicator cells; the distribution of the
indicator moieties, e.g., indicator cells, e.g., on a substrate;
the amount of aggregation of the indicator moieties, e.g.,
indicator cells; the strength of adherence of the indicator
moieties, e.g., indicator cells, to the rbcm preparation (e.g., as
detected by optical trapping).
[0375] In one embodiment, the presence of the anti-RBC antigen
antibody in the sample (or a positive readout) is detected by a
uniform, homogenous distribution of the indicator moieties, e.g.,
indicator cells, on the substrate. In one embodiment, the positive
readout is detected by having a coverage of the substrate by the
indicator moieties, e.g., indicator cells, of at least 95%, 96%,
97%, 98%, 99% or 100% of the substrate area. An exemplary
representation of a uniform distribution of the indicator moieties,
e.g., indicator cells, is provided in FIG. 16C.
[0376] In another embodiment, the absence of the anti-RBC antigen
antibody in the sample (or a negative read out) is detected by a
non-homogeneous distribution of the indicator moieties, e.g.,
indicator cells, on the substrate. In one embodiment, the negative
readout is detected by having a coverage of the substrate by the
indicator moieties, e.g., indicator cells, of less than 95%, 90%,
85%, 80%, 75%, 70%, 60%, 50%, 40% or 30% of the substrate area
(e.g., relative to what would be covered in a positive sample). An
exemplary representation of a non-homogeneous distribution of the
indicator moieties, e.g., indicator cells, is provided in FIG. 16D.
In one embodiment, the negative readout is detected as a localized
concentration of indicator moieties, e.g., indicator cells, e.g.,
as a button or a pellet.
[0377] In certain embodiments, the difference in the indicator
moieties, e.g., indicator cells, is detected by an increased or
decreased formation of an aggregate.
[0378] In one embodiment, base units of non-bound indicator
moieties, e.g., indicator cells, (indicator moieties, e.g.,
indicator cells, not bound to the rbcm preparation) form indicator
moiety, e.g., indicator cell, complexes with one another, e.g., to
form aggregates of non-bound indicator moieties, e.g., indicator
cells. In embodiments, said aggregate comprises at least 2, 10, 20,
50, 100, 200, 1,000, 100,000, 1,000,000, 10,000,000 or 50,000,000
base units of indicator moieties, e.g., indicator cells. In one
embodiment, the aggregate is of macroscopic dimension, e.g., an
aggregate having an average dimension, e.g., at its largest point,
of between 40-500 um, 75 um-1 mm, 100 um and 10 mm.
[0379] In an embodiment of the method, indicator moieties, e.g.,
indicator cells, traverse the substrate and collides with a second
(or subsequent) indicator moieties, e.g., indicator cells--e.g., a
indicator moieties, e.g., indicator cells, that traverses more
slowly or is bound.
[0380] In one embodiment of the method, the indicator moieties,
e.g., indicator cells, e.g., indicator moiety, e.g., indicator
cell, complexes, e.g., an aggregate, that fails to bind to said
first rbcm preparation, migrates across a substrate, e.g., into
said first negative readout region of said carrier.
[0381] In other embodiments, the method further includes providing
sufficient conditions, e.g., tangential velocity and sufficient
time for indicator moieties, e.g., indicator cells, e.g., indicator
moiety, e.g., indicator cell, complexes, e.g., an aggregate, that
has not formed an immune complex to migrate across the substrate.
In an embodiment, this results in uncovering substrate or reducing
the amount of substrate covered by indicator moieties, e.g.,
indicator cells. In embodiments, the aggregate can migrate a first
negative readout region.
[0382] In another embodiment, the difference in the indicator
moieties, e.g., indicator cells, is detected by evaluating the
strength of adherence of indicator moieties, e.g., indicator cells,
to the rbcm preparation, e.g., to the substrate (e.g., as detected
by optical trapping). In one embodiment, the displacement of
non-bound indicator moieties, e.g., indicator cells, is evaluated
by the optical trapping.
[0383] In one embodiment of the method, the presence or absence of
indicator moiety, e.g., indicator cell, complexes, e.g., an
aggregate, e.g., in a pre-selected location, is correlated with,
respectively, the absence or presence, of said anti-RBC antigen
antibody in said sample.
Antibody Screening Methods and Devices
[0384] The present invention provides, at least in part, methods
and devices for evaluating a sample, e.g., a plasma sample, from a
subject, for detecting a target protein (e.g., an antibody (e.g.,
IgM-, IgG, IgE, an anti-red blood cell (RBC)-antigen antibody); an
RBC antigen, e.g., an A, B, C, D, E, Rh, Kell antigen).
[0385] In one aspect, the invention features a method of evaluating
a sample, e.g., a plasma sample, from a subject, for an
anti-RBC-antigen antibody of G isotype. The method includes:
[0386] (a) contacting a first red blood cell membrane preparation
(a rbcm preparation) comprising a first RBC antigen, e.g., a RBC
antigen as described herein, with sample from said subject, under
conditions sufficient for the formation of an immune complex
between said first RBC antigen and anti-first-RBC-antigen antibody
in said sample; and
[0387] (b) providing a detection reagent under conditions
sufficient for the formation of a complex, e.g., an immune complex,
between said detection reagent and an IgG antibody in said sample,
said detection reagent comprising an IgG-specific binding
moiety,
[0388] wherein the presence or absence of said detection reagent is
correlated with the presence or absence of said anti-RBC antigen
antibody in said sample, thereby evaluating a sample for an
anti-RBC antigen antibody of G isotype.
[0389] A schematic of an exemplary assay format is shown in FIGS.
4A-4D and FIG. 7A. In these embodiments, a red blood cell membrane
preparation is bound to a surface and, optionally, lysed, thereby
forming a substrate, depicted in FIG. 4A. A sample, e.g., a serum,
plasma or whole blood sample, containing an anti-RBC antigen
antibody of a G isotype (e.g., one or more anti-RBC antigen
antibodies of a G isotype) is incubated with the red blood cell
membrane preparation under conditions that allow for a formation of
an immune complex between the RBC antigen and the anti-RBC antigen
antibody of a G isotype (FIG. 4B). Unbound IgG can be reduced by
one or more washing steps, depicted in FIG. 4C. A detection reagent
that includes an IgG-specific binding moiety is added to the
incubated sample, thereby allowing detection of the immune complex.
In one embodiment, the detection reagent includes an IgG binding
reagent (e.g., a monoclonal IgM class anti-human IgG from clone
MS-278). The detection reagent can further include an indicator
cell, optionally, having one or more IgG-specific binding agents
depicted in FIG. 4D, e.g., an indicator Alba Bioscience IgG
sensitized cells, thereby allowing measurement of the presence of
IgG class antibodies which are specific to rbcm antigens from the
plasma by way of detection of bound red blood cells, e.g., by
detecting binding of the indicator cells to the test surface.
[0390] In another embodiment, detection of bound red blood cell can
be effected by optical trapping, depicted in schematic form in
FIGS. 6A-6C. Referring to FIG. 6A, three side views of wells
containing a sample anti-RBC antigen antibody of a G isotype bound
to the rbcm preparation are shown in the first and second wells
(from left to right views of FIG. 6A). An unbound detection reagent
is shown on the right-side well in FIG. 6A. FIGS. 6B-6C show the
effect of optical trapping in displacing the unbound detection
reagent (see right-hand panel in FIG. 6C), compared to the
undisplaced, bound detection reagent at the bottom of the wells in
the left-most and middle panels of FIG. 6C.
IgG Binding Moieties
[0391] In one embodiment, IgG binding moieties that bind
selectively and specifically to plasma IgG relative to the binding
to the rbcm preparation are disclosed (see FIGS. 7B, 7C, 9, and 10,
described in the Examples).
[0392] In certain embodiments, the IgG-specific binding moiety
includes an antibody molecule that binds to an IgG, e.g., an
antibody molecule that binds to a constant region (e.g., a heavy
chain Fc region or a light chain constant region) of the IgG, or a
heavy or light chain variable domain of the IgG. In one embodiment,
the antibody molecule binds to an IgG constant region chosen from
one, two, three or all four of IgG1, IgG2, IgG3, or IgG4. In
another embodiment, the antibody molecule binds to a light chain
constant region of an IgG chosen from, e.g., the (e.g., human)
light chain constant regions of kappa or lambda.
[0393] As used herein, the term "antibody molecule" refers to a
protein comprising at least one immunoglobulin variable domain
sequence. The term antibody molecule includes, for example,
full-length, mature antibodies and antigen-binding fragments of an
antibody. For example, an antibody molecule can include a heavy (H)
chain variable domain sequence (abbreviated herein as VH), and a
light (L) chain variable domain sequence (abbreviated herein as
VL). In another example, an antibody molecule includes two heavy
(H) chain variable domain sequences and two light (L) chain
variable domain sequence, thereby forming two antigen binding
sites, such as Fab, Fab', F(ab').sub.2, Fc, Fd, Fd', Fv, single
chain antibodies (scFv for example). In yet other embodiments, the
antibody molecule has a heavy chain constant region chosen from,
e.g., the heavy chain constant regions of IgM, IgG1, IgG2, IgG3,
IgG4, IgA1, IgA2, IgD, and IgE. In another embodiment, the antibody
molecule has a light chain constant region chosen from, e.g., the
(e.g., human) light chain constant regions of kappa or lambda.
[0394] In one embodiment, the IgG-specific binding moiety includes
an antibody molecule that binds to an IgG-common site in the
constant region. In other embodiments, the IgG-specific binding
moiety includes antibody molecule that binds to an IgG-common site
in the light chain variable region. In other embodiments, the
IgG-specific binding moiety includes an antibody molecule that
binds to a light chain constant region.
[0395] In one embodiment, the IgG-specific binding moiety includes
an antibody molecule that has one or more of the properties (e.g.,
binding properties) of monoclonal antibody MS-278 (e.g., the
IgG-specific binding moiety comprises a monoclonal antibody MS-278,
or an antigen binding fragment thereof). Monoclonal antibody MS-278
is a murine IgM from clone MS-278. It reacts with all four subtypes
of human IgG. Monoclonal antibody (mAb) MS-278 can be obtained from
Millipore Corporation.
[0396] In certain embodiments, the IgG-specific binding moiety,
e.g., an antibody, e.g., a mAb, or an antigen binding fragment
thereof, has one or more of the following properties: (i) it
comprises mAb MS-278, or an antigen binding fragment thereof; (ii)
it competes with mAb MS-278 for binding to IgG; (iii) it binds to
an epitope bound by mAb MS-278 (e.g., the same or an overlapping
epitope); (iv) it binds to rbcm preparations at a level which is no
more than 1.2, 1.5, 1.75, 2, 3, 4 or 5 times that of mAb MS-278,
e.g., as determined by an assay described herein; (v) it binds to
IgG at a level which is at least 20, 30, 40, 50, 60, 70, 80, 90, or
100% of mAb MS-278, e.g. as determined by an assay described
herein.
[0397] In one embodiment, the IgG-specific binding moiety has a
specificity for plasma IgG relative to an rbcm preparation as shown
for mAb MS-278 in FIG. 1B. In embodiments, the IgG-specific binding
moiety shows a reduction in non-specific binding to the rbcm
preparation of at least 10%, 20%, 30% or more compared to an
IgG-specific antibody chosen from 16H8 [Immucor], rabbit polyclonal
[Alba #Z356], rabbit polyclonal [Biotest #804501], material from
cell line CG-7 [Sigma-Aldrich 16260], or goat polyclonal
[Sigma-Aldrich #12136].
[0398] In other embodiments, the IgG-specific binding moiety
includes an anti-IgG light chain antibody molecule. In one
embodiment, the anti-IgG light chain antibody molecule has one or
more of the properties (e.g., binding properties) of an anti-light
chain antibody chosen from Sigma-Aldrich #K4377 Cell Line KP-53,
Sigma-Aldrich #L6522 cell line HP-6054, Sigma-Aldrich
#K3502-polyclonal, or Sigma-Aldrich #L7646-polyclonal). In certain
embodiments, the anti-IgG light chain antibody molecule has one or
more of the following properties: (i) competes with the anti-IgG
light chain antibody molecule for binding to IgG; (ii) binds to an
epitope bound by the anti-IgG light chain antibody molecule (e.g.,
the same or an overlapping epitope); (iii) its level of binding to
a rbcm preparation is less than 1, 2, 5, 10, 25, or 50% of the
binding of the anti-IgG light chain antibody molecule to rbcm
preparation; (iv) it binds to IgG with an affinity that is at least
20, 30, 40, 50, 60, 70, 80, 90, or 100% of the affinity with which
the anti-IgG light chain antibody molecule binds IgG; or (v)
displays specific binding to and IgG of at least 10, 20, or 30% and
non specific binding of less than 2 or 5%, e.g., as determined by a
method described herein.
[0399] The binding properties of an IgG-specific binding moiety can
be measured by methods know in the art, e.g., one of the following
methods: BIACORE. analysis, Enzyme Linked Immunosorbent Assay
(ELISA), x-ray crystallography, sequence analysis and scanning
mutagenesis. The ability of an IgG-specific binding moiety to
selectively bind to plasma IgG relative to an rbcm preparation can
be tested by the assays described herein (e.g., Example 1). The
binding interaction of IgG-specific binding moiety and a target
(e.g., IgG or an IgG mimic) can be analyzed using surface plasmon
resonance (SPR). For example, SPR can be used to identify the
binding epitope of the IgG-specific binding moiety. SPR or
Biomolecular Interaction Analysis (BIA) detects bio-specific
interactions in real time, without labeling any of the
interactants. Changes in the mass at the binding surface
(indicative of a binding event) of the BIA chip result in
alterations of the refractive index of light near the surface. The
changes in the refractivity generate a detectable signal, which are
measured as an indication of real-time reactions between biological
molecules. Methods for using SPR are described, for example, in
U.S. Pat. No. 5,641,640; Raether (1988) Surface Plasmons Springer
Verlag; Sjolander and Urbaniczky (1991) Anal. Chem. 63:2338-2345;
Szabo et al. (1995) Curr. Opin. Struct. Biol. 5:699-705 and on-line
resources provide by BIAcore International AB (Uppsala,
Sweden).
[0400] Information from SPR can be used to provide an accurate and
quantitative measure of the equilibrium dissociation constant (Kd),
and kinetic parameters, including Kon and Koff, for the binding of
a molecule to a target. Such data can be used to compare different
molecules. Information from SPR can also be used to develop
structure-activity relationships (SAR). For example, the kinetic
and equilibrium binding parameters of different antibody molecule
can be evaluated. Variant amino acids at given positions can be
identified that correlate with particular binding parameters, e.g.,
high affinity and slow Koff. This information can be combined with
structural modeling (e.g., using homology modeling, energy
minimization, or structure determination by x-ray crystallography
or NMR). As a result, an understanding of the physical interaction
between the protein and its target can be formulated and used to
guide other design processes.
[0401] The binding properties, e.g., specificity, of the
IgG-specific binding moiety for plasma IgG relative to the rbcm
preparation can be evaluated as follows. Candidate anti-IgG (such
as material from cell line MS-278, 16H8 [Immucor], rabbit
polyclonal [Alba #Z356], rabbit polyclonal [Biotest #804501],
material from cell line CG-7 [Sigma-Aldrich 16260], goat polyclonal
[Sigma-Aldrich #12136]) can be first tested for its ability to
agglutinate human red blood cells coated with human or humanized
IgG (such as Alba #Z441). Alternatively, if such red blood cells
are not commercially available, human plasma units that contain
abnormal antibodies specific to human blood groups can be acquired
from local and regional blood centers. For instance, a plasma unit
that contains anti-D may be used to functionalized D+ red blood
cells with IgG. The cell should be washed using processes known to
those skilled in the art to remove unbound IgG.
[0402] Next, the functionalized red cells are dispersed with
varying concentration of candidate anti-IgG and graded for
hemagglutination by eye. The titration produces a bell curve and
the peak of this curve represents the optimal concentration of the
anti-IgG. Control experiments with non-functionalized red cells can
be conducted simultaneously to ensure reaction specificity. Once
the reaction specificity and optimal concentration have been
determined, optical trapping based experiments can be used to
evaluate binding properties.
[0403] In one embodiment, an optical trap can be used to probe the
binding of indicator cells to the prepared surface. Briefly, a
collimated 0.5 W 1064 nm continuous laser beam (via a laser such as
IPG #YLR-25V-SM-NC) with a diameter of 7-12 mm (measured at the
back aperture of the objective) is shone through a Nikon Plan APO
40.times. (NA 0.95) objective mounted in a research grade inverted
microscope (Nikon TE-200 or Olympus IX2 series). The beam diameter
can be adjusted via two lenses [Thorlabs LB1309 and LB 1630]. Those
skilled in the art should be familiar with the importance of
optical alignment and such. The sample should be maneuvered via a
precision stage. Optical trapping techniques, including instrument
design considerations, position detection schemes and calibration
techniques are reviewed in Neuman, K. C. and Block, S, (2004) Rev.
Sci. Instrum. 75(9):2787-2809, the contents of which are hereby
incorporated by reference in their entirety. Further experimental
conditions for testing the candidate anti-IgG antibodies are
described in detail in Example 1 and summarized briefly herein. The
candidate anti-IgG antibody (at its optimal concentration) is
incubated over a red blood cell coated-surface at various
temperatures and times, for example, 20.degree. C. for 10 minutes.
The red cell surface can be washed with normal saline to remove
unbound anti-IgG. Next, IgG-sensitized red cells can be added to
the test well and allowed to sediment to the test surface. Binding
can then be probed with optical trapping. In one embodiment, the
anti-IgG antibody yields fewer than 15% bound cells when probed
with an optical trap.
[0404] Protocols for preparing suitable surfaces coated with red
blood cell membrane preparations are described in Example 1.
Briefly, a suitable surface should be positively charged at neutral
pH and substantially free of surface contamination. Any number of
surface treatments can be used. For example, a native polystyrene
surface can be rendered positively charged via a molecule with a
hydrophobic character and an appropriate electrostatic character
(for instance, poly-L-lysine). Silica can be rendered positively
charged via an amine terminated silane (such as
aminopropyltriethoxysilane--APTES) or similar agents. The
uniformity of the film can be probed by exposing the surface to
amine reactive fluorescent tags such as fluorescein isothiocyanate
and examining with fluorescence microscopy. Red blood cells can be
deposited and lysed as described in Example 1.
[0405] In certain embodiments, the candidate anti-IgG antibody must
also bind appropriately to true IgG at low concentrations (i.e.,
enable an assay with a relevant limit of detection). In order to
determine the limit of detection, proficiency standards that
represent a minimum level of performance (as defined by existing
commercially available tests) can be obtained. For instance, an
anti-D proficiency kit can be obtained from Alba Bioscience
(#Z261). If such standards are unavailable, plasma units containing
abnormal antibodies can be obtained from local and regional blood
centers. These plasma units can be titrated (i.e., diluted with
normal human plasma) to various levels and tested on relevant
commercial platforms until a defined threshold for detection is
obtained.
[0406] Once these benchmarks are established, the titrated plasma
sample can be incubated over the red blood cell coated surface in
conditions known to those skilled in the art. An exemplary
incubation condition is 37.degree. C., 15 minutes, 1:1 ratio 0.025
M NaCl (Low Ionic Strength Saline--LISS). The test can be run in
parallel such that red blood cell surfaces expressing and not
expressing the antigen corresponding to the antibody specificity
are examined. The test surfaces can be washed with normal saline
until sufficiently free of unbound IgG. Candidate anti-IgG can be
blended with the IgG-coated red cells and then dispersed over the
test surfaces. Three minutes are allotted for sedimentation of the
cells to the test surfaces.
[0407] After the three minute sedimentation time, an appropriate
candidate anti-IgG antibody typically yields specific binding
greater than 20% and nonspecific binding under 10%. The specific
binding signal typically continues to increase to a level of 40% or
more bound red cells after six minutes. The nonspecific signal
should not appreciably (i.e., surpass 20%) increase.
[0408] Similar protocols can be used to evaluate candidate
light-chain specific anti-IgG antibodies. Candidate light-chain
specific anti-IgG antibodies (such as Sigma-Aldrich #K4377 Cell
Line KP-53, Sigma-Aldrich #L6522 cell line HP-6054, Sigma-Aldrich
#K3502--polyclonal, Sigma-Aldrich #L7646-polyclonal) are titrated
to an appropriate level. A titration can be conducted by first
sensitizing human red blood cells with a fully human IgG. Such
samples can be obtained from local and regional blood centers.
After the cells are sensitized, they are washed to remove unbound
IgG. Next, the cells are incubated with the light chain specific
anti-IgG (at some concentration) and then washed to remove unbound
anti-IgG. As a light chain specific anti-IgG is typically unable to
agglutinate native red blood cells, a third antibody is needed to
bind to the heavy chain of the light chain specific anti-IgG. If
the light chain specific anti-IgG is murine, a murine specific
anti-IgG (such as Sigma #M1397) can be used. Control experiments to
evaluate trivial cross-species reactivity can also be conducted.
The third antibody is added to the sensitized red blood cells at
various concentrations (i.e., titrate) and agglutination graded.
Such experiments will yield a bell curve for each concentration of
light chain specific anti-IgG. These curves can be condensed to a
master curve and the peak amplitude represents the ideal
concentration of light chain specific anti-IgG.
[0409] Once the optimal concentration of light chain specific
anti-IgG is identified, the indicator red blood cell can be
enzymatically treated to reduce the negative charge to enable
binding. Such cells may be obtained from commercial sources (Alba
#Z452) or prepared via those skilled in the arts (numerous
procedures reside within the public domain--for instance, the AABB
Technical Manual). The cells can be functionalized with IgG via a
fully human antibody. Such samples can be obtained from local or
regional blood centers. As the enzyme treatment often allows IgG to
agglutinate red blood cells, high titer antibody units (i.e., units
that display high agglutinating power at strong dilutions) can be
used in an attempt to saturate all antigen sites on the red blood
cell surfaces. If agglutins form during the sensitization of the
red blood cells, they can be disrupted via vigorous pipetting.
After the cells are sensitized, they should be washed via saline to
remove unbound IgG.
[0410] The candidate light chain specific anti-IgG antibody can
then be incubated over the test surface at 20.degree. C. for 10
minutes. The test surface should not possess the antigen system
used to label the indicator red cells (i.e., if anti-D is used to
sensitize the indicator red blood cells, D-cells should be used on
the test surface). The test surface can be washed with normal
saline. Next, IgG sensitized enzymatically treated red cells are
dispersed over the surface and allowed to sediment. Binding should
be probed with optical trapping. In one embodiment, the anti-light
chain specific anti-IgG antibody yields binding less than 3%.
[0411] If such a candidate light chain specific antibody is
encountered, its specific binding activity can also be
demonstrated. This can be accomplished by incubating an appropriate
reference sample (see discussion above on relevant limits of
detection) over the test surface and then washing the surface to
remove unbound IgG. The antibody system of interest can be chosen
such that: 1) The substrate does not possess the antigen used to
label the indicator cell (i.e., if anti-D is used to label the
indicator, D- cell should be used on the substrate; and/or 2) The
indicator does not possess the antigen used to probe specific
binding (i.e., if the plasma unit contains anti-c, the indicator
should be c-). These precautions ensure that specific binding can
only occur through the anti-light chain antibody.
[0412] The anti-light chain antibody is then dispersed with the
prepared indicator cells and then added to the test surface and
three minutes allotted for sedimentation. The system is then probed
with optical trapping. In one embodiment, the anti-light chain
antibody displays specific binding exceeding 10% and non-specific
binding less than 2%.
[0413] The IgG-specific binding moiety can be modified to be
coupled (e.g., covalently or non-covalently) to a detection
reagent, e.g., an indicator moiety such as a fluorescent, cellular,
or colloidal indicator. In one embodiment, the detection reagent
includes a red blood cell, and optionally, a second antibody
molecule that binds to the IgG-specific binding moiety (e.g., an
IgG sensitized red blood cell obtained from Alba Bioscience). In
such embodiments, a positive readout is the formation of red blood
cell aggregates. In other embodiments, the detection reagent (e.g.,
a second antibody molecule) is directly or indirectly labeled with
a detectable substance to facilitate detection of the bound or
unbound antibody. Suitable detectable substances include various
enzymes, prosthetic groups, fluorescent materials, luminescent
materials and radioactive materials. A variety of suitable
fluorescers and chromophores are described by Stryer (1968)
Science, 162:526 and Brand, L. et al. (1972) Annual Review of
Biochemistry, 41:843-868. The binding agents can be labeled with
fluorescent chromophore groups by conventional procedures such as
those disclosed in U.S. Pat. Nos. 3,940,475, 4,289,747, and
4,376,110. Other examples of fluorescers include fluoresceins,
rhodamines, and naphthylamines. Procedures for labeling
polypeptides with the radioactive isotopes (such as 14C, 3H, 35S,
125I, 99 mTc, 32P, 33P, and 131I) are generally known. See, e.g.,
U.S. Pat. No. 4,302,438; Goding, J. W. (Monoclonal antibodies:
principles and practice: production and application of monoclonal
antibodies in cell biology, biochemistry, and immunology 2nd ed.
London; Orlando: Academic Press, 1986. pp 124-126).
[0414] Solid substrates for antibody screening are known in the
art. For example, solid phase blood typing using red cell membrane
preparations are described in U.S. Pat. No. 5,030,560, incorporated
herein by reference. Other solid support substrates include array
systems, e.g., microarrays, as described in WO 2008/122793, also
incorporated by reference. In embodiments where screening for blood
antibodies is desired, a plurality of blood group antigens (e.g.,
rbcm preparations) which are capable of binding specifically to an
anti-RBC antigen antibody are immobilized on a substrate, e.g., a
microarray substrate, at pre-defined positions. The sample, e.g.,
plasma sample, is added under conditions suitable for specific
binding of the sample antibodies to the blood group antigens. The
presence of the bound antibodies is detected in the microarray.
Mimic-Optimized rbcm Preparations
[0415] Alternatively or in combination with the methods described
herein, non-specific binding caused by the lysed red blood cell
membrane preparation can be reduced by an agent that disrupts the
IgG mimic (e.g., an enzyme that cleaves IgG) present on the rbcm
preparations, thereby producing a mimic-optimized rbcm preparation.
In one embodiment, the agent is an enzyme, e.g., a cysteine
proteinase, with specificity for immunoglobulin G. In one
embodiment, the enzyme preferentially cleaves human IgG in the
hinge region with a high degree of specificity. In one embodiment,
the enzyme is an immunoglobulin-degrading enzyme of S. pyogenes
(e.g., IdeS). The IdeS enzyme is described in von Pawel-Rammingen,
et al. (2002) EMBO Journal 21 (7): 1607-1615 and WO 03/051914, the
contents of which are incorporated by reference. FabRICATOR.RTM.
(Genovis #A0-FR1-020) is commercially available. Red blood cell
membrane preparations pre-treated with the immunoglobulin-degrading
enzyme (e.g., IdeS) show a significant decrease in non-specific
binding to the red cell membrane preparation, compared to
non-treated red cell membrane preparations (FIG. 11). Experimental
conditions for pre-treatment of the rbcm preparation with the
immunoglobulin-degrading enzyme are provided in Example 1. Briefly,
a rbcm preparation (e.g., lysed red cells deposited onto a test
surface) was incubated in the presence of FabRICATOR.RTM. under
conditions suitable to effect FabRICATOR.RTM.'s lysing activity.
Control rbcm preparations were lysed deposited cells that not
exposed to FabRICATOR.RTM.. Non-specific binding of an anti-IgG
antibody (e.g., Alba #Z356) was detected. The results are shown in
FIG. 11.
Methods and Devices for Improving the Performance of Solid-Phase
Capturing Methods
[0416] In another aspect, the invention provides a method of, or
device for, evaluating a sample for an analyte. The method
includes:
[0417] (a) contacting a capture agent (e.g., an antibody, an
antigen (e.g., an RBC antigen, an rbcm preparation, an optimized
rbcm preparation) with sample, under conditions sufficient for the
formation of a complex between a capture agent, and said analyte
(e.g., an antigen, an antibody or other protein having specific
binding for said capture agent, e.g., in an anti-red blood cell
antibody and a rbcm preparation) in said sample,
wherein, said capture agent is disposed on a substantially planar
substrate, and the angle between said substantially planar
substrate and the direction of applied force, e.g., centrifugal,
gravitational, fluid magnetic, electric or fluid, force, that
causes migration of detection reagent, is non-orthogonal or other
than 90 degrees (theta, the angle formed by the substantially
planar substrate and a line perpendicular to the direction of
centrifugal force, is nonzero);
[0418] (b) providing a detection reagent (wherein said detection
reagent can comprise a cell, e.g., a red blood cell, e.g., as an
indicator moiety) under conditions sufficient for the formation of
a complex, e.g., an immune complex, between said detection reagent
and analyte, e.g., anti-capture agent antibody in said sample,
[0419] (c) applying acceleration, centrifugal acceleration, at said
angle such that detection reagent that does not bind to said
capture agent migrates across said substrate or surface, e.g.,
substantially planar substrate oe surface,
[0420] wherein, the presence or absence of detection reagent, e.g.,
in a preselected location, is correlated with the presence or
absence of said analyte, e.g., anti-capture agent antibody, in said
sample, thereby evaluating a sample for an analyte.
[0421] In one embodiment, the capture agent is a RBC antigen, e.g.,
at least 1, 2, 3, 4, or all of the RBC antigens provided in Table
1. Exemplary RBC antigens include at least 1, 2, 3, 4, or all of
the following RBC antigens: a Rhesus antigen, e.g., one or more or
all of D, C, c, E, or e; a MNS antigen, e.g., one or more or all of
M, N, S, or s; a Kidd antigen, e.g., one or both of Jka or Jkb; a
Duffy antigen, e.g., one or both of Fya or Fyb; a Kell antigen,
e.g., one or both of K or k; a Lewis antigen, e.g., one or both of
Lea or Leb; or P antigen. In another embodiment, the capture agent
is a pathogen antigen, e.g. a viral antigen, e.g., a viral antigen
chosen from one or more of human immunodeficiency (HIV) virus,
hepatitis B virus (HBV), syphilis, human T-lymphotropic virus
(HTLV), hepatitis C virus (HCV), or syphilis. Exemplary pathogen
antigens include an HIV 1/2 antigen, e.g., p24, p15, p17, gp36, or
gp 41; a Hep B antigen, e.g., HepBsAg, or HepBcAg; or a Syphilis
antigen, e.g., TmpA, p15, 17, or 47.
[0422] In other embodiments, the capture agent is an anti-RBC
antigen antibody, e.g., an antibody against at least 1, 2, 3, 4, or
all of the RBC antigens provided in Table 1, e.g., an RBC antigen
described herein. In yet other embodiments, the capture agent is an
anti-pathogen antigen antibody, e.g., an antibody against a viral
antigen, e.g., a viral antigen chosen from one or more of human
immunodeficiency (HIV) virus, hepatitis B virus (HBV), syphilis,
human T-lymphotropic virus (HTLV), hepatitis C virus (HCV), or
syphilis, e.g., a viral antigen as described herein.
[0423] In yet other embodiments, the capture agent is a CMV, WNV,
HTLV-1 and 2, or platelet antigen, or an antibody against same.
[0424] In certain embodiment, target antibodies are obtained from a
blood sample, and testing is carried out against an array of
uniquely treated surfaces to determine an antibody profile. In one
embodiment, the target antibodies are obtained from a blood sample
for the purposes of detecting viral infection. Antigens that occur
on the surface of a given virus can be immobilized on the surface
(i.e., solid phase) thereby being able to capture the specific
antibody to that virus. In addition, particles coated with
antibodies complementary to another region of the virus antibody
can be present in the test, such that in the presence of the target
virus antibody, immobilization of particles may occur, signaling
the presence of the antibody in the blood sample. Such measurements
are performed in order to diagnose infection, or quantify target
antibody concentration, with suitable controls.
[0425] In certain embodiments, two different forces are applied, a
first force to provide a force substantially normal to the
substrate or surface, e.g., substantially planar substrate and a
second force to provide an additional force tangential to said
substrate or surface, e.g., substantially planar substrate. In one
embodiment, the first force, e.g., a magnetic force, is applied to
produce force normal to said substantially planar substrate on a
detection reagent complex or aggregate, and a second force, e.g.,
fluid force, is applied to produce force tangential to said
substantially planar substrate on a detection reagent complex or
aggregate.
[0426] In another aspect, the invention features a method of, or
device for, evaluating a sample, e.g., a plasma sample, from a
subject, for an anti-RBC antigen antibody. The method includes:
[0427] (a) contacting a first red blood cell membrane (rbcm)
preparation with sample from said subject, under conditions
sufficient for the formation of an immune complex between a first
RBC antigen and anti-first RBC antigen antibody in said sample,
wherein, said first rbcm preparation is disposed on a substrate,
e.g., a substantially planar substrate, and the angle between said
substrate and the direction of applied force, e.g., centrifugal or
, gravitational, fluid magnetic, electric or fluid, force, that
causes migration of detection reagent, is non-orthogonal or other
than 90 degrees (in other words, theta, the angle formed by the
substantially planar substrate and a line perpendicular to the
direction of centrifugal force, is nonzero);
[0428] (b) providing a detection reagent under conditions
sufficient for the formation of a complex, e.g., an immune complex,
between said detection reagent and an anti-RBC antigen antibody in
said sample,
[0429] (c) applying force, e.g., centrifugal force, at said angle
such that detection reagent that does not bind to said first rbcm
preparation migrates across said substrate,
[0430] wherein the presence or absence of detection reagent, e.g.,
in a preselected location, is correlated with the presence or
absence of said anti-first RBC antigen antibody in said sample,
thereby evaluating a sample for an anti-RBC antigen antibody.
[0431] In other embodiments, the method or the device further
includes:
[0432] (d) contacting a second rbcm preparation with sample from
said subject, under conditions sufficient for the formation of an
immune complex between a second RBC antigen and anti-second RBC
antigen antibody in said sample, [0433] wherein, said second rbcm
preparation is disposed on a substrate, e.g., a substantially
planar substrate, and the angle between said substrate and the
direction of applied force, e.g., centrifugal, gravitational, fluid
magnetic, electric or fluid, force, that causes migration of
detection reagent, is non-orthogonal or other than 90 degrees;
[0434] (e) providing a detection reagent under conditions
sufficient for the formation of a complex, e.g., an immune complex,
between said detection reagent and an anti-RBC antigen antibody in
said sample,
[0435] (f) applying centrifugal force at said angle such that
detection reagent that does not bind to said second rbcm
preparation migrates across said substrate,
[0436] wherein the presence or absence of detection reagent, e.g.,
in a preselected location, is correlated with the presence or
absence of said anti-second RBC antigen antibody in said
sample,
[0437] thereby evaluating a sample for an anti-second
blood-type-antigen antibody of pre-selected isotype.
[0438] In certain embodiments, steps (a) and (d) are performed at
least partially simultaneously. In other embodiments, steps (b) and
(e) are performed at least partially simultaneously. In yet other
embodiments, steps (c) and (f) are performed at least partially
simultaneously.
[0439] In other embodiments, the method or the device further
includes evaluating said sample for an N.sup.th, e.g., third,
anti-RBC antigen by:
[0440] (g) contacting an N.sup.th, e.g., third, rbcm preparation
with sample from said subject, under conditions sufficient for the
formation of an immune complex between an N.sup.th, e.g., third,
RBC antigen and anti- an N.sup.th, e.g., third, RBC antigen
antibody in said sample, [0441] wherein, said N.sup.th rbcm
preparation is disposed on a substrate, e.g., a substantially
planar substrate, and the angle between said substantially planar
substrate and the direction of applied force, e.g., centrifugal,
gravitational, fluid magnetic, electric or fluid, force, that
causes migration of detection reagent, is non-orthogonal or other
than 90 degrees;
[0442] (h) providing a detection reagent under conditions
sufficient for the formation of a complex, e.g., an immune complex,
between said detection reagent and an anti-RBC antigen antibody in
said sample,
[0443] (i) applying centrifugal force at said angle such that
detection reagent that does not bind to said N.sup.th, e.g., third,
rbcm preparation migrates across said substrate,
[0444] wherein the presence or absence of detection reagent, e.g.,
in a preselected location, is correlated with the presence or
absence of said anti-N.sup.th, e.g., third, RBC antigen antibody in
said sample,
[0445] thereby evaluating a sample for an anti-N.sup.th, e.g.,
third, RBC -antigen antibody of pre-selected isotype, wherein in is
equal to or greater than 3.
[0446] In certain embodiments, steps (a) and (g) are performed at
least partially simultaneously. In other embodiments, steps (b) and
(h) are performed at least partially simultaneously. In yet other
embodiments, steps (c) and (i) described above are performed at
least partially simultaneously.
[0447] In certain embodiments, the angle is optimized to allow one
or more of:
[0448] (i) the migration of unbound detection reagent across said
substrate;
[0449] (ii) the rapid migration of non-bound detection reagent
across said portion, e.g., from said first positive readout region
into said first negative readout region;
[0450] (iii) the migration of large aggregates, e.g., aggregates of
100, 1000, 10000, 100,000, 1,000,000, 10,000,000, 50,000,000
comparatively more rapid than the migration of smaller aggregates,
e.g., 1, 2, or 4, or base units of detection reagent that are not
detection reagent complexed into aggregates; or
[0451] (iv) the separation of non-bound detection reagent from
detection reagent bound to an anti-RBC antibody, which anti-RBC
antibody is bound to said first rbcm preparation (e.g., detection
reagent in an immune complex with an said RBC antigen on said first
rbcm preparation) on said substrate, e.g., substantially planar
portion.
[0452] In other embodiments, the angle is between 2.5 and 10;
between 10 and 35 (e.g., between 10 and 20; or between 20 and 35
degrees (e.g., typically, 10 degrees).
[0453] In another embodiment, the centrifugal acceleration is
between 50-100, 100-300, or 300-1000 times normal gravitational
acceleration. In certain embodiments, the centrifugal acceleration
is applied for between 4-6, 2-4, and 0.5-2 minutes.
[0454] In yet other embodiment, the path of transit between a first
positive readout region and a first negative readout region is
between 8-50, 8-75, 8-100, 16-50, 16-75 or 16-100 microns.
[0455] In another embodiment, the method, or device, includes
applying centrifugal force in two phases:
[0456] a first phase, having FN1, the force normal to the
substrate, e.g., the substantially planar substrate, and FT1, the
force tangential to said substrate, e.g., substantially planar
substrate; and
[0457] a second phase, having FN2, the force normal to the
substrate, e.g., substantially planar substrate, and FT2, the force
tangential to said substrate, e.g., substantially planar substrate,
wherein, said first phase occurs before said second phase, FN1 is
greater than FN2, and FT2 is greater than FT1.
[0458] In yet other embodiment, the angle is constant during said
first and second phase and the acceleration of the second phase
differs from that of the first phase.
[0459] In one embodiment, the angle is constant during said first
and second phase, and FN1 is greater than FN2, and FT1 is greater
than FT2.
[0460] In another embodiment, the angle is constant during said
first and second phase, and FN1 is less than FN2, and FT1 is less
than FT2.
[0461] In one embodiments, the angle is dynamic and has a first
average value during said first phase; and the angle has a second
average value during said second phase, and said first average
value is less than said second average value, e.g., the second
average value is at least 1.1, 2, 3, 4, 5, 10, or 100 times greater
than said first average value. In one embodiment, the first average
value is less than 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1, e.g., said
angle is 0. In other embodiments, the second average value is
between 5-60, 10-40 and 15-25 degrees. In yet other embodiments,
the first average value is less than 1, e.g., it is 0, and said
second average value is 15-25 degrees.
[0462] In other embodiments, the average value is less than 1,
e.g., it is 0, and 50-150, 5-125, 90-110, e.g., 100 g, are applied;
and said second average value is 15-25 degrees and 100-300,
150-200, 175-225, e.g., 200 g, are applied.
[0463] In one embodiment, the second phase has a duration of
between 10-270, 20-180, and 30-90 seconds. In other embodiments,
the second phase has a duration of between 10-360, 20-240, and
30-120 seconds.
[0464] In yet another embodiment, the first phase and said second
phase each has a duration of at least 10, 20 or 30 seconds but less
than 360 seconds.
[0465] In another embodiment, the average centrifugal acceleration
applied during said first phase is greater than that applied in
said second phase, e.g., at least 2, 3, 4, 5, or 6 fold
greater.
[0466] In other embodiments, the average centrifugal acceleration
applied during said second phase is between, 100-3000, 150-2000 and
300-1,000 g.
[0467] In another embodiment, the average centrifugal acceleration
applied during said first phase is between, 15-600, 30-400 and
50-200 g.
[0468] In other embodiments, in a regime where the number of cells
is less than a mono layer, the length of time the cells move
independently (i.e., the binding phase) is controlled. The longer
the cells travel independently the greater the odds that a specific
binding event will occur. Once the cells begin agglutinating and
forming avalanches, specific binding, even if present, is typically
not sufficiently large to stop the agglutins.
[0469] In certain embodiments, the duration of the `binding phase`
is governed by cell concentration, cell velocity, and non-specific
binding. Hence, the centrifuge angle and acceleration effect cell
velocity. An expression for the cell velocity follows:
v cell .apprxeq. .alpha. .beta. r 2 sin ( .theta. ) ##EQU00001##
.alpha. = .rho. cell - .rho. so ln .beta. = V 2 R ##EQU00001.2##
[0470] V=velocity of centrifuge [0471] R=radius arm of centrifuge
[0472] r=radius of cell [0473] .eta.=viscosity of solution [0474]
.rho..sub.cell=density of cell [0475] .rho..sub.so ln=density of
solution [0476] .theta.=angle of incline Alpha, in the above
expression, is made up of physical parameters (densities,
viscosity). Beta is proportional to the centrifugal acceleration
(i.e., g's). sin(theta) is the angle of incline.
[0477] At the same time, the test time must be short. Therefore,
the cell velocity (and indicator cell agglutination rate) needs to
be sufficiently large that should specific binding be absent, the
indicators can run into each other and form the avalanches.
[0478] In a regime where the concentration of indicator cells is
larger than a monolayer, the behavior of a membrane of indicator
cells is analyzed. In this regime, the indicator cell concentration
is optimized in concert with centrifuge angle, acceleration, and
time to produce a system in which a three-dimensional network of
indicator cells is forced across a biologically active surface.
[0479] In other embodiments, said centrifugal acceleration and said
angle result in an acceleration acting on indicator moieties in the
direction normal to said substrate, e.g., substantially planar
substrate, in the range of 15-1000, 50-500 and 35-800 g's and an
acceleration acting on indicator moieties in the direction
tangential to said substrate, e.g., substantially planar substrate,
in the range of 0-500, 25-130 and 10-400 g's.
[0480] In yet other embodiments, said centrifugal acceleration and
said angle result in a ratio between the tangential acceleration
and the normal acceleration to said substrate, e.g., substantially
planar substrate, in the range of 0-0.5, 0.1-0.25 and 0.05-0.4.
[0481] In one embodiment, said angle is between 10 and 25 degrees;
said centrifugal acceleration is between 50-1000 g; and said
centrifugal acceleration is applied for between 0.5-4 minutes
[0482] In one embodiment, the negative readout region is located on
said substrate, e.g., substantially planar substrate. In other
embodiments, the negative readout region is not located on said
substrate, e.g., substantially planar substrate.
[0483] In yet other embodiments, the method or device further
includes detecting the presence of said detection reagent in a
first positive readout region, e.g., on said substrate, e.g.,
substantially planar substrate.
[0484] In other embodiments, the method or device further includes
comparing a value for the amount of detection reagent present in
said first positive readout region with a pre-selected criterion,
and if said value meets said pre-selected criterion classifying
said sample, e.g., as positive.
[0485] In other embodiments, the method or device further includes
detecting the presence of said detection reagent in said first
negative region.
[0486] In other embodiments, the method or device further includes
comparing a value for the amount of detection reagent present in
said first negative readout region with a pre-selected criterion,
and if said value meets said pre-selected criterion classifying
said sample, e.g., as negative.
[0487] In certain embodiments, the detection reagent includes an
IgG-specific binding moiety as described herein. In one embodiment,
the detection reagent includes a binding moiety having specificity
for an isotype-common site on said anti-blood-type-antigen antibody
of a pre-selected isotype, e.g., IgG.
Detection Reagents
[0488] In other embodiments, the method or device, further includes
forming detection reagent complexes, e.g., aggregates between
detection moieties, e.g. between the indicator moieties of
detection moieties. The method includes contacting a detection
reagent with a detection moiety complexing agent that promotes the
formation of a detection reagent complex between base units of
detection reagent. For example, a human red blood cell sensitized
with a monoclonal anti-D, e.g., Alba Z441.
[0489] In one embodiment, the detection reagent comprises a moiety
that promotes detection reagent complexing between base units of
detection reagent.
[0490] In other embodiments, the level of detection reagent
complexing between detection moieties is sufficient that it
increases the signal from detection reagent in a positive readout
region, a negative readout region, or both.
[0491] In other embodiments, a base unit of detection reagent,
e.g., a base unit of detection reagent bound to a rbcm preparation,
acts as a nucleation site for growth by detection reagent
complexation with another base unit of detection reagent.
[0492] In yet other embodiments, a base unit of detection reagent,
e.g., a base unit of detection reagent bound to a rbcm preparation,
is detection reagent complexed to a second base unit of detection
reagent.
[0493] In other embodiments, a base unit of detection reagent,
e.g., a base unit of detection reagent is bound to a rbcm
preparation, is detection reagent complexed to a second unbound
base unit of detection reagent.
[0494] In yet other embodiments, a base unit of detection reagent,
e.g., a first base unit of detection reagent bound to a rbcm
preparation, enhances the ability of a second base unit of
detection reagent to bind to said rbcm preparation, e.g., by
detection reagent complexing between said first and second base
unit.
[0495] In other embodiments, the detection reagent complexing is
sufficient such that the time required for a non-specifically bound
detection reagent to migrate into a negative readout region is less
than the time required in the absence of detection reagent
complexation.
[0496] In other embodiments, the time with detection reagent
complexing is less than 90, 80, 70, 60, 50, 40, 30, 20, or 10% of
the time in the absence of detection reagent complexing.
[0497] In another embodiment, the detection reagent complexing is
sufficient such that non-specific binding of detection reagent to
rbcm is less than that in the absence of detection reagent
complexing.
[0498] In other embodiments, the non-specific binding with
detection reagent complexing is less than 90, 80, 70, 60, 50, 40,
30, 20, or 10% in the absence of detection reagent complexing.
[0499] In other embodiments, the detection reagent further includes
an indicator moiety, e.g., a cell, e.g., a red blood cell.
[0500] In one embodiment, the detection reagent includes a
deformable component, e.g., a cell, e.g., a red blood cell, or an
entity which is similarly deformable.
[0501] In one embodiment, the method, or device, includes using a
detection reagent comprising a deformable component, e.g., a cell,
e.g., a red blood cell, or an entity which is similarly deformable;
applying a normal force, e.g., centrifugation under condition
wherein said centrifugal force is normal or within 30 degrees of
normal, to said substantially planar substrate;
[0502] and applying a tangential force, wherein said normal force
is greater than said tangential force, e.g., at least 4, 3, 2 fold
greater.
[0503] In one embodiment, a specifically bound component, if
compliant under applied forces, can be flattened (inclusive of
stretching, flattening, or other changes in morphology) upon
application of a force.
Exemplary Configurations and Applied Forces for Solid-Phase
Capturing Methods
[0504] This aspect of the invention described below is exemplified
in the context of solid phase antibody screening antibody
screening. However, same techniques can be applied to any system in
which a particle is specifically bound to a surface (for instance,
antibody identification and immunodiagnostics).
[0505] In conventional solid-phase antibody screening, a substrate
is coated with red blood cell membranes of known antigen content.
Plasma is incubated over this surface and then removed via washing.
Antibodies with specificity for antigens existing on the substrate
blood cells will remain. At this point, some form of anti-human
globulin (AHG) attached to an indicator (e.g., fluorescent,
cellular, colloidal) is added to the system. The AHG will bind to
human immune globulin (if present) and the indicator provides means
of visualizing binding.
[0506] Conventional assays rely on indicators generated by first
coating a red blood cell with an IgG antibody specific for an
antigen present on the indicator (for instance, the D antigen). The
cells are washed and then anti-IgG antibody is added to generate an
anti-IgG coated particle. The anti-IgG antibody is added at a
sufficient concentration such that virtually all of the IgG
existing on the indicator is coated with anti-IgG antibody. This
renders the indicators stable against agglutination.
[0507] Once the indicators are added to the system, a force is
typically applied in order to produce a more clear measurement. For
instance, if a round or `U` bottom well is used in conjunction with
a swinging bucket centrifuge, unbound cells will be forced to the
bottommost portion of the well. If a specific bond is formed
between an indicator and the solid phase, and the centrifugal force
acting on the indicator is less than the binding force existing
between the indicator and solid-phase, the indicator will remain
(to some degree) dispersed across the solid-phase. If binding is
insufficient to counter the centrifugal force, the indicator will
migrate to the lowest position in the well. Hence, if a `button` of
indicator particles is present at the bottommost portion of the
well, a negative result can be inferred. If such a `button` is
absent (or diminished) a positive result can be inferred.
[0508] Conventional assays that utilize round bottom or non-planar
geometries do not produce optimal sensitivity. To begin, the
geometry of the well and the configuration of the centrifuge
control the magnitude and the direction of the forces applied to
the indicator. For instance, if a flat-bottom surface is used in
conjunction with a swinging bucket centrifuge, an indicator cell
will only experience a normal force that drives it to the surface
and no differentiation between bound an unbound can be made.
Alternatively, if an inclined plane is introduced such that the
plate resides at a non-orthogonal angle relative to the radial
direction, a tangential force will be applied to the indicator. The
magnitude of the relevant forces in the directions tangent and
normal to the inclined plane are given by the product of the
centrifugal force (Fc) times the sin (tangential) or cos(normal) of
the inclined plane angle. These configurations are represented in
schematic form in FIGS. 13A-13C. FIG. 13A is a schematic top plane
view of a swinging bucket centrifuge operating in a clockwise
direction. The arrow indicates the axis of rotation. FIGS. 13B-13C
is a free body diagram representing the normal and tangential
forces acting on a cell (Fc is a centrifugal force). In this
context, if no other limiting factors (for instance, non-specific
binding) are significant in magnitude, a small theta combined with
a minimal centrifugal force is ideal. Such a situation would first
drive and then push an indicator into close proximity with the
surface of interest. A small lateral force would push the indicator
across the surface at a rate dependant on the particle size, solute
viscosity, and centrifugal force. In this regime (low angle and low
centrifugal force) the indicator would slowly travel across the
solid-phase and probe potential binding sites. The low speed (as
compared to those induced by high centrifugal forces or angles)
increases the interaction time existing between an indicator and
potential binding sites. Ultimately, this increase in time should
lead to a higher percentage of indicators bound to the surface.
Furthermore, a large normal component acting on the indicator can
increase the area of interaction between a deformable particle and
the solid-phase. This should further increase binding between an
indicator and the solid phase.
[0509] Moreover, the low centrifugal force and low angle produce
less tension on a specific bond once it is formed. This should lead
to a greater percentage of indicators bound to the surface once a
measurement is conducted.
[0510] Non-planar geometries are now compared to the proposed
optimal geometry. A round bottom or `U` bottom well of typical
design produces low angle inclines only at the very bottom of the
well. Hence, most of the well area produces relatively large
tangential forces and relatively weak normal forces. In addition,
the bottom portion of the well that may produce optimal binding
conditions is typically occupied by truly unbound cells and
therefore is inaccessible to measurement. This is quite non-ideal
and can be significantly improved upon by utilizing a planar
geometry combined with a small incline.
[0511] In addition to the geometry and configuration of the
centrifuge, the preparation of the indicator can strongly influence
test performance. Conventional indicators are rendered incapable of
agglutination via saturation with anti-IgG. However, it is
advantageous to allow the cells to adhere to one another. For
instance, if an indicator cell binds specifically to the surface
and another unbound indicator cell contacts this cell, it may
become part of the complex that is specifically bound to the
substrate. Essentially the first specifically bound particle acts
as a nucleation site for growth and therefore the overall effect
can be amplification of the number of indicators adhered to the
surface. Such an effect is useful on both macroscopic (i.e.,
reading by `eye`) and microscopic levels.
[0512] In addition, cooperative effects may occur in such a system.
If a free indicator cell is captured by a solid-phase bound cell,
the rate at which new solid-phase/indicator bonds form may increase
due to the fact that the originally unbound indicator is now
localized to a specific region.
[0513] Thus, the binding of individual indicator cells can
encourage the binding of other individual indicator cells. This
indicator preparation also has the effect wherein unbound
indicators can encourage other indicators to not bind. This occurs
because two unbound indicator cells which are traveling along the
surface may naturally travel at speeds which differ from their
average speed, thereby allowing unbound indicators to bump into
each other and aggregate. Such coupled indicator cells, or
aggregates, may travel more quickly and may more readily overcome
interactions with the surface. Thus, aggregates have a tendency to
speed up and collect further indicator cells. In this way, there is
collective behavior which tends to amplify the presence or absence
or binding to the surface and to make such a result readily
apparent at shorter forcing times and with shorter incubation
steps.
[0514] This change in preparation can also significantly reduce
both the time required to run the assay and the magnitude of the
signal presented by negative samples. To begin, the centrifugal
force acting on a cell is proportional to mv 2/r where m is the
effective mass of the particle, v is the velocity of rotation, and
r is the radius arm. This force is opposed by the viscous drag
induced on the cell by the solution. This force is proportional to
6.pi..eta.rv where .eta. is the viscosity of the solution, r is the
cell radius, and v is the cell velocity. If the indicator cells are
capable of agglutinating, the mass of such complexes will increase
as the number of cells residing in a complex increases. This change
in mass produces a larger force which, if the cells are unbound,
produces a larger complex velocity. As the length of time the
centrifugal force must be applied is set by the unbound cell
velocity and distance needed to travel, this change in velocity
allows the test to be conducted in less time.
[0515] Furthermore, these complexes, if controlled properly, can
effectively reduce the magnitude of non-specific binding. To begin,
the rate at which the indicators agglutinate is set by: the density
of labeling IgG, the concentration and binding characteristics of
the AHG, the concentration and volume of the indicator cells, the
rate of centrifugation, the angle of centrifugation, and the
interaction with the surface. As an example, if too few indicators
reside on the solid phase, the cells will only occasionally be in
close enough proximity to agglutinate and the rate of agglutination
will be low. If a tangential force is applied to these cells they
will effectively travel independently. Alternatively, if too many
of the indicators reside on the surface, they will rapidly
agglutinate. If a tangential force is applied to these complexes,
they will travel at a rate greater than single cells. If these
complexes reach sufficient size, they essentially form an avalanche
of indicators that rapidly moves across the substrate and may
scavenge both bound and unbound cells. Hence, if this avalanche is
triggered properly, it can effectively reduce the magnitude of
non-specific binding.
[0516] Enabling the particles to adhere to one another can be
achieved by a number of techniques. For instance, simply adding the
anti-IgG at an appropriate concentration to the IgG-coated
indicators immediately before conducting a solid-phase test will
produce such behavior.
[0517] The distinction of enabling the particles to adhere to one
another can be vital to these techniques. In one regime, the
concentration of indicator particles is less than that required to
form a monolayer of particles. In this case, the particles spend a
non-trivial portion of time as independent objects and the
aforementioned discussion applies. In another regime, the
concentration of indicator particles is significantly higher
(3-10.times.) than that required to form a monolayer. In this case,
the motion of individual cells is no longer relevant as once the
cells are added to the well and centrifugation has started, they
spontaneously self-assemble into a three dimensional membrane. In
this situation, the membrane of indicator cells is forced across
the coated well surface and its behavior is used to deduce the test
result. If IgG is specifically bound to the test surface, the
membrane of indicator cells binds to the IgG and motion is
suppressed. If IgG is absent, the membrane or portions of the
membrane can travel across the surface and produce a portion of the
well-bottom that largely lacks indicator cells.
[0518] In these embodiments, the indicator is a red cell coated
with IgG. However, coated microparticles, vesicles, and other cells
could also be used as indicators as long as they are prepared in
such a way that enables complexation once added to the test well.
In addition, the acceleration applied to such indicators should be
adjusted to counter any change in indicator effective mass,
characteristic dimension, solid-phase binding rate, and
complexation rate.
[0519] In certain embodiments, maximization of specific binding and
reduction of test time can be accomplished by one or more of:
[0520] (i) applying a high normal force/low tangential force and
proper indicator/anti-human globulin preparation can increase
specific binding; or
[0521] (ii) controlling the indicator cell
concentration/agglutination rate and high tangential force can
decrease test time.
[0522] The following parameters can be considered to optimize
antibody screening test quality:
[0523] 1. Specific binding/non-specific binding ratio: A minimum
signal/noise threshold is necessary to properly trigger this
effect.
[0524] 2. Centrifuge Angle and Rate:
[0525] Magnitude of normal force [rate of specific binding is
enhanced by larger normal force--i.e., shallower angle of
incline]
[0526] Magnitude of tangential force [rate of specific binding is
enhanced by low tangential force, rate of avalanche formation is
enhanced by large tangential force--i.e., larger angle of
incline]
[0527] 3. Anti-Human Globulin Concentration
[0528] Effects rate of specific binding [the AHG concentration
should be balanced such that binding sites are neither starved nor
quenched]
[0529] Effects rate of avalanche formation [the AHG concentration
should be balanced such that binding sites are neither starved nor
quenched]
[0530] 4. Indicator Cell Concentration/Volume
[0531] Sub-monolayer concentrations produce a system influenced by
individual cell effects. Concentrations exceeding a monolayer
produce a system driven by bulk effects linked to the motion of a
membrane driven across a surface.
Effects the magnitude of the motion of the indicator cell membrane
Effects rate of avalanche formation [the greater the cell
concentration the higher the odds that two indicator cells will see
each other and trigger the avalanche process]
[0532] 5. Indicator Cell Preparation
[0533] Effects rate of specific binding [the number of IgG sites on
the indicator cell should, ideally, be large]
[0534] Effects rate of avalanche formation [the number of IgG sites
on the indicator should be large--this is a minor feature]
[0535] 6. Ionic Strength
[0536] Effects rate of specific binding [low ionic strengths
typically enhance binding]
[0537] 7. Centrifugation Time
[0538] Effects degree of Avalanche formation (i.e., size of
agglutins and position), and, to some extent, the degree of
specific binding (i.e., if you spin for too long specific bonds
will break)
[0539] 8. Multi-stage and/or angle of incline
[0540] As there are two distinct phases of this portion of the test
(optimal conditions for specific binding followed by optimal
conditions for triggering the avalanche process) varying the
centrifugal acceleration or angle of incline produces overall
optimal performance.
Exemplary Solid Phase Configurations
[0541] In other embodiments, the methods and devices of the
invention can be carried out using one or more of the exemplary
well plate configurations depicted in FIG. 14. Such plate
geometries are believed to create the right balance of normal force
and tangential force; to have different normal forces and
tangential forces in different wells; to eliminate the radius arm
problem and tilted plate problem (i.e., ensure two wells have
identical force profiles even though they are in different
locations, such as distance from the central rotational axis, when
being centrifuged); to do different tests in different wells at the
same time; to accelerate (nucleate) the avalanche effect; to do
multiple tests within a single well on a single sample; or to
generally improve the imaging and/or discernment of positive vs.
negative samples. (Note that in many cases, it may make imaging
more difficult to detect.)
[0542] The 19 well plate geometries shown in FIG. 14 are described
as follows:
[0543] (1) Basic commercial well plate.
[0544] (2) Basic commercial well-plate inclined at angle theta to
produce correct ratio of F_normal to F_tangent.
[0545] (3) Custom well plate designed to have angle introduced into
well bottom (manufactured into plate) rather than to be centrifuged
at an angle. Note: Each well could have a different angle if
required, such as for different tests. This would function
similarly to (2) which we are doing now. It requires a custom well
plate and a suitable reader, but eliminates the complexity of
centrifuging with an angle. It also allows for different wells to
be under different conditions, which is not presently possible with
(2).
[0546] (4) This plate can be operated in either of two ways: (a) It
can be placed into an angled centrifuge to have two angles in a
given well. This may have the benefit of having a region of higher
angle where the RBCs more quickly move and form aggregates of a
certain size, if free. This may speed up the aggregate formation
and avalanche for negative samples. The remainder of the well is at
a normal, lower angle. (b) It can be centrifuged without an angle
so as to have the clusters stop at a place away from the wall for
easier reading.
[0547] (5) V Well Plate: This can be centrifuged without an angle.
It has the benefit that unbound aggregates go to the centerline
which is easier to see and measure.
[0548] (6) Asymmetric V Well Plate: As with (5) above, except the
asymmetry can be used to either measure the response at two angles
or to allow one to perform the test using the shallow slope side,
giving more distance and area to work with.
[0549] (7) 2-Step-Wedged Well Plate: This is similar to (4) above
but doesn't need to be centrifuged at an angle to obtain the two
non-zero angle case. The idea is that cells first sprinkle down
uniformly. Then cells quickly slide down the steeper slope and form
some smallish aggregates (if they do not bind to surface). When
they reach the lower slope, for negative samples, the aggregates
start with significant size meaning that negative samples will have
a much stronger avalanche, faster. If it is positive, the avalanche
will not be initiated. Thus, this is meant as a means to nucleate
and speed up the avalanching process for negative samples.
[0550] (8) 3-Step-Wedged Well Plate: This is like the 2-step-wedged
well plate, except it has another wedge. The steepest wedge quickly
nucleates small clusters. The next wedge allows these to grow to a
certain size if the sample is negative. The main wedge allows them
to grow to the "unstable" size if still no binding occurs.
[0551] (9) Asymmetric 2-Step Wedge: This is like (8) except it is
symmetric so that the negative region is more easily read, since it
is in the centerline.
[0552] (10) Rounded Wedged Wells Plate: The rounding at one edge
achieves something equivalent to the 3-step wedged well plate.
[0553] (11) This combines the rounded wedged well plate simplicity
with the convenience of symmetry so that cells collect in the
centerline for negative samples, for easy and accurate reading.
(Note that these rounded wells are quite distinct from what some
others use at present, since most of the well is still essentially
planar and at a prescribed (low) range of angles. The cells that
collect do not obscure the important angle region).
[0554] (12) Double V Well Plate: This allows each sample to
simultaneously be tested under two angles. This may be used for
quantization, among other things.
[0555] (13) Triple Wedge Well Plate: As with the double-V well
plate, this allows one to perform multiple tests on the same blood
in one well. It can be used to get data at different angles, such
as for quantization.
[0556] (14) Single Groove Well Plate: This has a single groove in
the surface which catches unbound cells or aggregates (perhaps of a
certain size or less). This makes it easier to read negative
samples.
[0557] (15) Double Groove Well Plate: This has two grooves (or
more) of the same or differing sizes or shapes. This can help
discriminate a low level of aggregation and a higher level of
aggregation.
[0558] (16) Single Hump Well Plate: This is functionally fairly
similar to the Single Groove Well Plate.
[0559] (17) Single Wedge-Hump Well Plate: This is functionally
pretty similar to the Single Hump Well Plate.
[0560] (18) Conical Well Plate: This is like a V Well Plate but has
azimuthal symmetry.
[0561] (19) Two-Step Conical Well Plate: This is like a Symmetric
Two-Step V Well Plate (#9) but has azimuthal symmetry.
Exemplary Substrate Configurations
[0562] Methods and devices of the invention use substrates, e.g.,
substantially planar substrates, on which a variety of entities are
disposed including, for example, capture reagents, antibodies, and
rbcm preparations. In certain embodiments, cells, aggregates,
detection reagent or aggregated detection reagent, migrate across
said surfaces. The behavior of these entities can be important in
the performance of a test. By way of example, the ability of an
entity to migrate across a surface, to encounter other entities not
complexed with the surface, associate with those other entities,
e.g., to form aggregates, and to form a detectable formation, can
be important. Numerous approaches for optimizing one or more of
these behaviors are disclosed herein.
[0563] FIGS. 17A-17F illustrate a number of exemplary substrate
configurations described herein as follows.
[0564] Substrate (A) shows a surface with two adjacent surface
regions with different surface treatments. For example, surface
treatment #1 can be a treatment (or lack of a treatment) such that
probe cells do not adhere to the surface, and surface treatment #2
can be a treatment such that binding occurs for positive samples.
Surface region #1 could be optimized such that aggregates of a
desired size generally form before reaching region #2.
[0565] Substrate (B) depicts a surface similar to A above, except
with angled bottom.
[0566] Substrate (C) depicts a surface with multiple surface
regions wherein multiple surfaces of a desired size and shape and
location are treated with surface treatment #1; a treatment or lack
of a treatment such that binding does not occur) are adjacent to a
surface with treatment #2 (e.g., a surface where binding occurs
only if the sample is positive, or only if the sample is negative).
The former regions may be located in a position and of a size and
shape so as to cause aggregates of a given size (range) to form
before reaching the surface region with treatment #2.
[0567] Substrate (D) depicts a surface similar to Substrate (C)
except on inclined plane.
[0568] Substrate (E) depicts a surface with one or more regions
which have steeper angles which are continuous (and "upstream") of
a region (which can be a substantially planar) which is of a given
angle. These regions may have a "funnel" characteristic, able to
collect together those objects which move along the surface with
the steeper angle. Such features may be used to collect together a
number of particles which are close in number to a desired number,
such as to create (nucleate) aggregates of a desired size.
[0569] Substrate (F) depicts a surface similar to D except on
inclined plane.
[0570] With a simple planar surface (which can be a substantially
planar), a negative sample may reveal that it is negative through
the random process of particles contacting each other as they slide
down the surface, forming aggregates which move more quickly and
gather additional particles. Thus, an avalanche occurs. This
process is random in nature, and thus may require large surfaces or
be subject to random or unusual events. To mitigate this effect,
the nucleation of aggregates can be controlled through the design
of the surface. The simplest way of doing so is to put an
"acceleration" region above a substantially planar surface. This
acceleration region could be a substantially planar surface at a
steeper angle, it could be a non-planar surface such as a curved
surface, or it could be a region with different surface properties
(see FIGS. 17A-17B). To control the formation of aggregates even
more precisely, the surface may be patterned with a treatment such
that regions of a desired size, shape, and location may be placed
to encourage the formation of aggregates of an approximate size
(see FIGS. 17C-17D). Another way to create aggregates of an
approximate size is to create features (eg. geometric features)
which may gather a certain approximate number of particles and
encourage them to form an aggregate (eg. a "funnel"-type surface
region which gathers cells as they fall and collects them into one
or more aggregates) (see FIGS. 17E-17F).
[0571] Any of the methods or devices described herein can
incorporate one or more of the following features:
[0572] In one embodiment, the substantially planar substrate is
adjacent a region having a steeper angles, e.g., an angle which
minimizes binding of cells, aggregates, detection reagent or
aggregated detection reagent.
[0573] In another embodiment, the substantially planar substrate is
adjacent a region having a different surface treatment.
[0574] In an embodiment, the substantially planar substrate is
adjacent a region having is configured so as to enhance nucleation,
e.g., a region which increases the concentration of particles in
the direction of migration.
[0575] In an embodiment, the substantially planar substrate is
adjacent a region having which concentrations migrating particles,
e.g., a region configured as a funnel.
[0576] In an embodiment, the substantially planar substrate is
adjacent a region having a feature which improves the detectability
of negative samples, e.g., a feature which impedes the passage,
captures, or concentrates migrating entities, e.g., cells,
aggregates, detection reagent or aggregated detection reagent. By
way of example, the region can comprise a depression, e.g., a pit
or groove, or an elevation, e.g., a bump or ridge, or a
discontinuity or interface, e.g., between two regions.
[0577] In an embodiment the substrate comprises an interface
between two surface regions wherein migrating cells, aggregates,
detection reagent or aggregated detection reagent, can collect, and
the presence, absence, or quantity of cells in this region can
inform a test result.
[0578] In an embodiment, a substrate comprises a plurality of
surfaces, e.g., planar or substantially planar in sufficient
proximity allow performance of a plurality of tests, e.g., two
tests, with different properties, e.g., sensitivities, e.g., to
quantitate the test result.
[0579] In one embodiment, a substantially planar surface region is
azimuthally symmetric.
[0580] In another embodiment, a carrier, e.g., a plate, having a
plurality of substantially planar surface regions, disposed at more
than 1 different angle, so that tests can be performed at different
conditions, such as for doing two different tests with different
parameters at the same time on the same plate.
Detection of Aggregate Related Features
[0581] Migration of detection reagent units across a substrate,
e.g., substantially planar substrate, can result in a detectable
event. E.g., migration of a detection reagent unit across a rbcm
preparation on such a substrate can result in aggregation of the
migrating detection reagent unit with other detection reagent
units, e.g., more slowly migrating detection reagent subunits,
forming an aggregate. The aggregate is an example of, or can serve
as the basis of a detectable event. E.g., the existence, number, or
location of aggregates can be a detectable event. Aggregate
formation and migration can be accompanied by regions of substrate
that differ from regions having no aggregate formation and
migration. While not wishing to be bound by theory it is believed
that the area of the path taken by an aggregate will be depleted,
as compared to an otherwise similar are of the substrate, of
unbound detection reagent. The area of the path can be
distinguished, e.g., from a reference, e.g., from an otherwise
similar area than has not been depleted by aggregate formation. The
depleted path is an example of, or can serve as the basis of, a
detectable event. E.g., the existence, number, or location of
depleted paths can be a detectable event. E.g., one can compare a
first region or field with a second region or field for differences
in a detectable event. In an embodiment a preselected value for a
parameter related to such a detectable event, e.g., the presence,
level, distribution, or location of one or more detectable events,
e.g., aggregates or depleted regions, is indicative of the presence
or absence of an analyte. E.g., the presence of an aggregate of
depleted area or path can be indicative of the absence of analyte.
Detection devices, e.g., scanners and associated analytic software
and readout devices can be configured for evaluating detectable
events.
Devices and Methods for Separating a Plasma Sample from Whole
Blood
[0582] Plasma samples can be obtained by methods known in the art.
In one embodiment, the plasma sample can be separated from a whole
blood sample using a rotor described in U.S. Ser. No. 61/438,571,
entitled "Centrifuge Rotor for Separation and Processing of Complex
Fluids" filed on Feb. 1, 2011, incorporated herein by reference. In
certain embodiments, the rotor is used in a centrifuge system. The
rotor includes a housing fabricated from a lightweight, transparent
or translucent material, such as plastic. In one embodiment, the
housing is generally disc-shaped, and includes a central opening
that is configured to be secured to the centrifuge. The rotor may
be further configured with alignment features that enable the rotor
to be registered in a specific orientation with respect to the
centrifuge system for indexing the position of the rotor. The rotor
is configured with one or more chambers, e.g., twelve, each chamber
receiving a sample of whole blood, or some other type of biological
fluid requiring separation. The arrangement is such that the
centrifuge spins the rotor to separate plasma from red blood cells
contained within the whole blood. In a certain embodiment, each
chamber includes a first chamber portion having an opening that
serves as an inlet/outlet opening for the chamber and a second
chamber portion in fluid communication with the first chamber
portion. The first chamber portion has a port formed therein, with
the second chamber portion being in fluid communication with the
port of the first chamber portion. In a particular embodiment, the
second chamber portion has a fill line disposed generally below the
port of the first chamber portion. This construction ensures that
when a centrifuge operation takes place, red blood cells are
retained in the second chamber portion and plasma is retained in
the first chamber portion. Thus, the red blood cells are retained
in the second chamber portion, both during and after the relaxation
and removal of the plasma within the first chamber portion. In
another embodiment, the first chamber portion and the second
chamber portion extend along a radial axis of the rotor. The first
chamber portion and the second chamber portion are configured so
that when a centrifuge operation takes place, a first biological
fluid type (e.g., plasma) is retained in the first chamber portion
and a second biological fluid type (e.g., red blood cells) is
retained in the second chamber portion. The second chamber portion
has a capacity greater than an amount of the second biological
fluid type retained in the second chamber portion. In yet another
embodiment, a channel provides fluid communication between the
first chamber portion and the second chamber portion. The channel
is configured so that when a centrifuge operation takes place, a
first biological fluid type is retained in the first chamber
portion and a second biological fluid type is retained in the
second chamber portion. In another embodiment, the rotor is
configured to receive a plurality of disposable containers, e.g.,
twelve, which are designed to receive complex fluids for
processing.
EXAMPLES
[0583] The invention now being generally described, it will be more
readily understood by reference to the following examples, which
are included merely for purposes of illustration of certain aspects
and embodiments of the present invention, and are not intended to
limit the invention.
Example 1
Antibody Screening Assays
Background:
[0584] This example describes the experimental conditions for an
antibody screening assay to detect a red blood cell antigen
antibody of G isotype, wherein a red blood cell membrane
preparation is bound to a functionalized test surface. In this
case, the number of indicator moieties is chosen such that they
form sub-monolayer coverage on the bottom of the well plate
surface. Although described in the context of antibody screening,
optimization of relevant parameters (centrifuge angle, indicator
concentration, specificity, etc.) should extend the utility of this
invention to any system in which a particle is specifically bound
to a surface.
Materials
[0585] The following available materials are used in this
example:
[0586] (i) Antibody screening panel (Z451), IgG sensitized cells
(Z441), O cells (Z416), polyclonal anti-IgG (Z356) obtained from
Alba Bioscience;
[0587] (ii) Blood bank saline (22-026-401) obtained from
Fisher;
[0588] (iii) Anti-human IgG, including monoclonal murine IgM from
clone MS-278, rabbit polyclonal antibody Alba #Z356, monoclonal
antibody Immucor 16H8;
[0589] (iv) Thermo: SmartPlex 96 well multiplexing platform
[SMARTPLEX-C22-05]
[0590] (v) Low Ionic Strength Saline (LISS): 25 mM NaCl, 250 mM
glycine, 0.05% sodium azide. pH adjusted to 7.1 with isotonic NaOH.
Osmolarity is approximately 280 mOsm
Preparation of Surfaces:
[0591] Suitable glass surfaces are positively charged at neutral pH
and free of surface contamination. Any number of surface treatments
can be used. For example, a native polystyrene surface can be
rendered positively charged via a molecule with a hydrophobic
character and an appropriate electrostatic character (for instance,
poly-L-lysine). Silica can be rendered positively charged via an
amine terminated silane (such as
aminopropyltriethoxysilane--APTES). All surfaces should be prepared
and stored carefully to avoid fouling of common atmospheric
contaminants (hydrocarbons, for instance).
[0592] In particular, #1 glass coverglass should be cleaned via
chromic sulfuric acid, piranha, or appropriate surfactant to obtain
a pristine substrate. The substrate should be rinsed with ultra
pure water and dried with compressed air. The glass should be
cleaned to a level such that the contact angle between the surface
and a distilled/deionized water droplet is less than 5 degrees. The
surface can then be amine functionalized using
aminopropyltriethoxysilane (APTES) or similar species. The surface
can be coated through a CVD process or a liquid dip process. If
APTES is utilized, the contact angle between distilled/deionized pH
7.0 water and the surface should be at least 50 degrees. The
uniformity of the film can be probed by exposing the surface to
amine reactive fluorescent tags such as fluorescein isothiocyanate
and examining with fluorescence microscopy.
Preparation of Screening Cells:
[0593] A 2-3% concentration of human red blood cells can be
obtained from a commercial supplier, e.g., Alba Bioscience. The
human red blood cells can be brought to room temperature using a
non-inverting rocker. An aliquot of 60 uL of the red cells can be
placed into a 1 mL microcentrifuge tube, and 500 uL saline are
added. The microcentrifuge tube is centrifuged at 400 g's for 4
minutes. The supernatant is removed and the cell pellet is
re-dispersed in 500 uL saline. These steps can be repeated (about
five times) or until the OD at 280 nm<0.01. The supernatant can
be removed, and 60 uL saline can be added. 100 uL of saline can be
added to a fresh microcentrifuge tube. 10 uL of the washed red
cells solution can be added to the fresh microcentrifuge tube.
Preparation of Plate:
[0594] After removing the protective strip on the bottom of a
SmartPlex 96 well multiplexing platform [SMARTPLEX-C22-05], a piece
of amine-functionalized glass is placed on the bottom of the
SmartPlex plate. The plate is heated gently with a heat gun to
soften the adhesive material. The amine-functionalized glass is
firmly pressed into the softened adhesive with a 100 uL pipette
tip. The plate is allowed to cool to room temperature.
Preparation of Test Surface:
[0595] 100 uL of the prepared red cell solution is loaded to one of
the wells on the SmartPlex plate. The loaded plate is immediately
placed into a swinging bucket centrifuged and spun at 400 g's for 5
minutes (20.degree. C.). The surface of the plate is visually
inspected to ensure uniform coverage. The test surface is gently
washed with saline (3.times.100 uL) to remove excess cells. 100 uL
of distilled/deionized water is added to the well and gently shaken
for 1 minute. After lysis is complete, the surface is washed with
100 uL saline.
Test Procedure (Optical Trapping):
[0596] The binding of indicator cells to the prepared surface can
be probed using an optical trap. An optical trapping system can be
constructed using a collimated 0.5 W 1064 nm continuous wave (CW)
laser beam (via a laser such as IPG Photonics #YLR-20-1064-LP) with
a beam diameter of 7-12 mm (at objective back aperture) is directed
through a Nikon Plan APO 40.times. (NA 0.95) Air objective mounted
in a research grade inverted microscope (Nikon Eclipse TE-200,
TE-2000, or Ti or Olympus IX series). The beam diameter and
collimation can be controlled using two lenses [Thorlabs LB1309 and
LB 1630] using routine optical alignment techniques familiar to
those skilled in the art. The sample is maneuvered via a precision
microscope stage.
[0597] The test sample is processed as follows. An aliquot of 50 uL
of plasma of interest is transferred into a microcentrifuge tube.
50 uL of LISS is added and mixed with the pipettor. 100 uL of the
LISS/plasma solution is added to the treated well. The well is
covered with Scotch magic tape, and immediately placed into a
37.degree. C. incubator on top of an aluminum plate that is stored
permanently in the incubator (heat block) such that good thermal
contact and transfer is achieved between the plate and the lower
surface of the glass. The LISS/plasma solution is allowed to
incubate in the well for the desired time (e.g., 5, 8, 15 minutes).
The plate is removed from incubator, and the tape is removed from
the well top. The plasma/LISS mixture is extracted from the well
using a vacuum aspirator. 100 uL of saline is added to the well
drop-wise. The saline is vacuum extracted from the well. These two
steps are repeated thrice. 10 uL of a 5% solution of Alba
IgG-coated cells is added to 1 mL saline.
[0598] An anti-IgG solution is prepared following manufacturer's
protocols. 100 uL of the diluted IgG-coated cell solution is added
to 1 mL of anti-IgG solution. 100 uL of this indicator cell
solution is used to test for the presence of IgG bound to the well
surface. The indicator cells are allowed to settle to glass surface
by incubating for 3 minutes. Probe binding was detected via optical
trapping using the optical trapping system described above.
[0599] FIGS. 7A-7B summarize one embodiment of the antibody
screening assay. Experimental protocols are as follows. A red blood
cell membrane preparation is bound to a functionalized test
surface. A sample (e.g., a plasma sample) containing a red blood
cell antigen antibody of a G isotype is incubated with the bound
red blood cell membrane preparation under conditions that allow for
binding, thereby forming a complex. Unbound IgG is reduced by one
or more washing steps. An IgG binding reagent (e.g., monoclonal IgM
class anti-human IgG from clone MS-278) is added to bind to the
complex. A detection agent, e.g., an indicator Alba Bioscience IgG
sensitized cells, is added, thereby allowing measurement of the
presence of IgG class antibodies which are specific to rbcm
antigens from the plasma by way of detection of bound red blood
cells, e.g., by detecting binding of the indicator cells to the
test surface.
[0600] FIGS. 7C depicts representative graphs showing the
percentage of red blood cells detected as bound using the antibody
screening assays described herein as a function of secondary
incubation time. FIGS. 7B and 7C depict antigen negative or
antibody negative sample/cell. In FIG. 7B, Curve #1 (referred to in
the figure as "#1 Cell," lower/squares) represents the results of
an assay using a control anti-RBC antigen antibody-negative sample;
curve #2 (referred to in the figure as "#2 Cell,") represents the
results of an assay using an anti-RBC antigen antibody positive
sample. In FIG. 7C, Curve #3 represents the results of an assay
using a control antigen-negative surface cell; curve #2 represents
the results of an assay using an antigen positive surface cell.
[0601] FIGS. 8A-8D provide a stepwise representation of the
components of the antibody screening assays described in FIG. 7A. A
red blood cell membrane preparation bound to a functionalized test
surface is shown FIG. 8A. In FIG. 8B ("primary incubation step"),
the rbcm bound test surface is incubated with a plasma sample
containing a red blood cell antigen antibody of a G isotype. In
FIG. 8C ("wash"), unbound IgG is reduced by one or more washing
steps. In FIG. 8D ("secondary incubation step"), a secondary
incubation is carried out by adding an IgG binding reagent to bind
to the complex and a detection agent, e.g., an indicator Alba
Bioscience IgG sensitized cells, thereby allowing measurement of
the presence of IgG class antibodies which are specific to rbcm
antigens from the plasma by way of detection of binding of the
indicator cells to the test surface.
[0602] Representative results of antibody screening assays as
described herein are shown in FIGS. 9-10. FIG. 9 shows a comparison
of the nonspecific binding to a red blood cell membrane preparation
using a panel of anti-IgG antibodies. The percentage bound red
blood cells detected as a function of secondary incubation time was
measured. Each of the anti-IgG antibodies were used at
approximately 0.01 mg/mL. In this case, each of MS-278 (also
referred to as cell line MS-278), anti-IgG rabbit poly #1 (a
Millipore antibody product), anti-IgG rabbit poly #2 (Alba #Z356),
and monoclonal antibody Immucor 16H8, was used in its raw bottled
(for use in a manual tube test) format. The polyclonal antibodies
are a blend of IgG and IgM class antibody (approximately 60-80%
IgG). The monoclonal antibodies (Immucor and Millipore) are both
IgM class anti-IgG's (both mouse) and are also approximately 0.01
mg/mL. The experimental conditions for this study were as follows.
Surface and rbcm preparation were carried out as described above. A
candidate anti-IgG antibody (at its optimal concentration) was
incubated over the red blood cell coated-surface at various
temperatures and times. Typical, temperature and time of incubation
were 20.degree. C. and 10 minutes. The red cell surface was washed
with normal saline solution (4.times.200 uL) to remove unbound
anti-IgG antibody. Next, IgG-sensitized red cells (Alba Bioscience,
at base concentration described above) were added to the test well,
and allowed sedimentation of the cells to the test surface for
three minutes. Binding was probed with optical trapping.
[0603] A significant decrease in non-specific binding to the red
cell membrane preparation was detected using the MS-278 anti-IgG
antibody compared to the other antibodies tested. These results
were reproduced in different experimental runs.
[0604] FIG. 10 shows a graph depicting binding of MS-278 monoclonal
anti-IgG to two different red blood cell membrane preparations, one
positive for the D RBC antigen (#2 Cells D+) and one negative for
the D RBC antigen (#3 Cells D-), in the presence of anti-D, as
revealed by indicator cells (IgG-coated red cells). The percentage
bound red blood cells detected as a function of secondary
incubation time was measured. The experimental conditions were
carried out at described above. Briefly, once the benchmarks
representing limits of detection were established, the titrated
plasma sample was incubated over the red blood cell coated surface
in conditions known to those skilled in the art. In this case, Alba
anti-D proficiency (0.025 IU-#Z264) was used. In particular, the
conditions used were 37.degree. C., 15 minutes, 1:1 ratio 0.025 M
NaCl (Low Ionic Strength Saline). The test was carried out in
parallel such that red blood cell surfaces expressing and not
expressing the antigen corresponding to the antibody specificity
were examined. The test surfaces were washed with normal saline
until sufficiently free of unbound IgG (4.times.200 uL). Candidate
anti-IgG was blended with the IgG-coated red cells and then
dispersed over the test surfaces. In particular, Millipore MS-278
was diluted 10 fold with normal saline. IgG coated red cells (Alba
#Z441) were diluted 100 fold with normal saline. 100 uL of the
IgG-coated cell solution was added to 1 mL of the diluted anti-IgG
and then 100 uL of this solution was added to the well. Three
minutes were allotted for sedimentation of the cells to the test
surfaces. Binding was probed with optical trapping.
Preparation and Testing of Mimic Optimized RBCM Preparations
[0605] FIG. 11 shows a representative graph depicting binding of
anti-IgG rabbit poly #2 (Alba #Z356) to non-treated and enzyme
treated red blood cell membrane preparations. (1) Surface and red
cell preparations were carried out as described above. (2) To
enzyme treat surfaces: (a) FabRICATOR.RTM. (Genovis #A0-FR1-020)
was dissolved in 30 uL DD H2O. (b) 5 uL of this material was
diluted into 100 uL 50 mM sodium phosphate 150 mM NaCl pH 6.6, (6)
this solution was added to the red blood cell coated surface
(post-lysis) and incubated for 30 mins at 37C, and (7) the surface
was washed 4-6 times with 200 uL saline. (3) The rest of the test
is as described above.
[0606] A significant decrease in non-specific binding to the red
cell membrane preparation was detected after treatment of the cell
with the FabRICATOR.RTM., compared to non-treated red cell membrane
preparations. These results were reproduced in different
experimental runs.
Test Procedure (Centrifuge):
[0607] The test sample is processed as follows. An aliquot of 50 uL
of plasma of interest is transferred into a microcentrifuge tube.
50 uL of LISS is added and mixed via pipettor. 100 uL LISS/plasma
is added to coated the well. The well is covered with Scotch magic
tape, and immediately placed into 37.degree. C. incubator on top of
an aluminum plate that is stored permanently in the incubator (heat
block). The LISS/plasma is incubate for desired time (5, 8, 15
minutes). The plate is removed from incubator, and the tape is
removed from the well top. The plasma/LISS mixture is extracted
from the well via a vacuum aspirator. 100 uL of saline were added
to the well drop-wise. Saline was vacuum extracted from the well.
These steps can be repeated twice. 10 uL of Alba IgG-coated cell is
added to 1 mL saline. Alba IgG sensitized cells are diluted with
saline (1:10 dilution with saline). The anti-IgG antibody is
diluted with LISS. Millipore MS-278 monoclonal antibody, rabbit
polyclonal antibody Alba #Z356, monoclonal antibody Immucor 16H8
are each used at approximately 1 mg/mL. 800 uL Millipore/LISS
material are combined with 100 uL diluted cell material. 100 uL of
this solution is added to the well of interest and placed into a
swinging bucket centrifuge with a 25 degree inclined plane in the
bottom. A strip of lead was placed in the opposite corner of the
swinging bucket to counter balance the incline. Spin at 200 g's for
1.5 minutes and 500 g's at 1.5 mins. Read test results via visual
inspection/microscopic examination.
[0608] FIGS. 16A-16B show two images representative of the
centrifuge-based assay described above when a 5 minute primary
incubation is used in conjunction with a sample containing anti-D
at its limit of detection. FIG. 16A displays the result of this
assay when D+ cells are used as the red cell membrane preparation.
The surface appears largely uniform and large aggregates are
abscent from the center of the well. This result indicates that
binding between the indicator cells and red cell preparation on the
well is present. This binding prevents large scale agglutination of
the indicators. FIG. 16B displays the result of this assay when D-
cells are used as the red cell membrane preparation. The surface
appears non-uniform and many large aggregates are present in
various places on the lower surface of the well. This result
indicates that binding between the indicator cells and the red cell
preparation on the well is absent. The lack of this binding enables
the indicator cells to agglutinate and move rapidly down the well
surface.
Example 2
Antibody Screening
Background:
[0609] This example describes experimental conditions for an
antibody screening assay to detect a red blood cell antigen
antibody of G isotype, wherein a red blood cell membrane
preparation is bound to a functionalized test surface. In this
example, the number of indicator cells added to each well is
significantly larger (>3.times.) than the number of cell
required to form a monolayer. The functionalized test surface may
consist of a polystyrene surface, modified to promote the adhesion
of red blood cells. This may be employed using any number of
surface treatments understood to those experienced in the art.
Examples include but are not limited to treatment with lectins
(i.e. concanavalin A or wheat germ agglutinin from triticum
vulgaris), hydrophobic molecules which under certain experimental
conditions possess a net positive charge (i.e. Alcian Blue/yellow
or poly-1-lysine) or more elaborate measures including a plasma
treatment followed by chemical grafting of silanes. All surfaces
should be prepared and stored carefully to avoid surface fouling
caused by common atmospheric contaminants (e.g. hydrocarbons).
Although described in the context of antibody screening,
optimization of relevant parameters (centrifuge angle, indicator
concentration, specificity, etc.) should extend the utility of this
invention to any system in which a particle is specifically bound
to a surface.
Materials:
[0610] The following materials are used in this example: i.
Antibody screening panel (Z451), IgG sensitized cells (Z441), O
cells (Z416), polyclonal anti-IgG (Z356) obtained from Alba
Bioscience; ii. Blood bank saline (22-026-401) obtained from
Fisher; iii. Anti-human IgG, including monoclonal murine IgM from
clone MS-278, rabbit polyclonal antibody Alba #Z356, monoclonal
antibody Immucor 16H8; iv. Microlon 200 96 well medium bind plate
(762070) and microplate lid (656170) from Grenier Bio-one; v. Low
Ionic Strength Saline (LISS): 25 mM NaCl, 250 mM glycine, 0.05%
sodium azide with a pH adjusted to 7.1 with isotonic NaOH.
Osmolarity of approximately 280 mOsm vi. Zero Ionic Strength
Solution (ZISS): 300 mM glycine, 0.05% sodium azide with a pH
adjusted to 7.1 with isotonic NaOH. Osmolarity of approximately
280-300 mOsm; vii. Ultra Low Ionic Strength Saline (ULISS): 1 part
LISS+49 parts ZISS; viii. BupH phosphate buffered saline packs
(28372) from Thermo Scientific; ix. Alcian blue 8GX (A5268),
Methanol (322415), and Minipax absorbent packets (Z163589) from
Sigma-Aldrich; x. VWR vacuum filtration system with 0.2 um PES
membrane (87006-062); xi. Modified Alservere's solution 100 g
dextrose, 40 g trisodium citric acid, 10 g NaCl, 4.69 g inosine,
0.1 g citric acid, 1.7 g chloramphenicol, 0.5 g neomycin
sulfate--volume to 5 L with distilled water.
Preparation of Alcian Blue 8GX Solution:
[0611] A 1 mg/mL solution of Alcian Blue 8GX is prepared by mixing
equal parts methanol and saline. For example, if one mixes 200 mL
of methanol with 200 mL of saline then 400 mg of Alcian Blue 8GX
should be added to the methanol/saline solution and mixed well
(i.e. mixed until when the container is inverted there is no solid
on the bottom of the vessel nor visible solid suspended in
solution). The solution is filtered using a 0.2 um PES membrane
vacuum filtration system from VWR.
Preparation of Surface:
[0612] The prepared Alcian solution is delivered to the polystyrene
well plate (100 uL per well) and the plate is covered with a plate
lid. The Alcian solution is incubated with the well plate at
4.degree. C. for 12-24 hours. Following incubation, the plates are
allowed to warm to room temperature and then unbound Alcian is
removed through washing. The wash steps include tapping the Alcian
solution out of the plate followed by sequential washing by
immersion and shaking in bins containing deionized water (twice)
and saline. Following the saline wash the plates are vacuum
aspirated and stored in heat sealed mylar bags under nitrogen with
desiccant packs. Each mylar bag contains 1-3 plates with
approximately 10 grams of desiccant.
Preparation of Screening Cells:
[0613] A 2-5% concentration of human red blood cells can be
obtained from a commercial supplier, e.g. Alba Biosciences. The
human red blood cells can be brought to room temperature and
re-suspended in the bulk solution using a non-inverting rocker. The
cells may be washed with saline until the supernatant of the cell
solution following centrifugation has an OD at 280 nm<0.01
absorbance units. The cells should be diluted with saline to a
final concentration of approximately 0.3%.
Preparation of Test Surface:
[0614] The test surfaces are prepared using a Biotek EL406 and a
Beckman Coulter swinging bucket centrifuge. All wash/solution
handling/agitation steps mentioned in this section are performed
using the Biotek EL406. The surface is prepared by delivering 100
uL of an approximately 0.3% solution of prepared red cell solution
to each of the desired wells of a Alcian modified well plate. The
loaded plate is immediately placed into a swinging bucket
centrifuge and spun at 500 g's for 5 minutes (20.degree. C.).
Following centrifugation, the unbound/loosely bound red cells are
removed through a series of plate agitations and saline washes.
This series entails first agitating the plate for 40 seconds
followed by four cycles consisting of a 200 uL saline wash followed
by 10 seconds of plate agitation. Following the last cycle the
plate is washed with an additional 200 uL of saline per well. Cell
lysis is then performed using distilled/deionized water under the
following conditions: two wash cycles with 200 uL and one with 50
uL distilled/deionized water per well, 30 seconds of plate
agitation, followed by a wash with 200 uL distilled/deionized
water. Following the final wash, the water solution is replaced
with Modified Alsevere's storage solution, covered with a plate lid
and stored at 4.degree. C.
Test Procedure (Centrifuge):
[0615] The test sample is processed as follows. A 50 uL aliquot of
plasma to be tested is transferred to a microcentrifuge tube. To
this, 50 uL of ULISS is added and mixed via pipettor. 100 uL of the
ULISS/Plasma is added to the test well. The well is covered with
Scotch magic tape or a plate lid, and immediately placed into a
37.degree. C. incubator on top of an aluminum plate that is stored
permanently in the incubator (heat block). The well plate with
plasma/ULISS is incubated for a desired time (5, 8, 15 minutes).
The plate is removed from the incubator, the lid/tape is removed,
and test well is washed. The washing involves the extraction of the
plasma/ULISS mixture via a vacuum aspirator followed by repeated
washings with 100 uL of saline (added drop-wise) followed by vacuum
aspiration. These steps may be repeated twice.
[0616] A solution of Anti-IgG, preferably monoclonal murine IgM
from clone MS-278, is prepared in BupH PBS or saline at a ratio of
between 1:20-1:50. This solution is sufficiently mixed to ensure a
homogeneous mixture is achieved. Alba IgG sensitized cells are
rocked or mixed to ensure re-suspension of cells followed by
addition of 5-10% volume of sensitized cells to the volume of IgM
solution. This solution is mixed and 200 uL is added to the test
well. The plate is placed into a swinging bucket centrifuge with a
10 degree inclined plane in the bottom. A strip of lead was placed
in the opposite corner of the swinging bucket to counter balance
the incline. Spin at 80 g's for one minute and 500 g's for 3
minutes. Read the test results via visual inspection/microscopic
examination.
[0617] FIGS. 16C-16D show two images representative of the
centrifuge-based assay described above when a 5 minute primary
incubation is used in conjunction with a sample containing anti-D
at its limit of detection. FIG. 16C displays the result of this
assay when D+ cells are used as the red cell membrane preparation.
The surface appears uniform and large tears or defects are absent
from the well. This result indicates that a bridge between the
indicator membrane and the red cell preparation on the well surface
is present. This is the test result obtainted from a weakly
positive antibody screen test. FIG. 16D displays the result of this
assay when D- cells are used as the red cell membrane preparation.
The surface appears non-uniform and large tears and open areas are
present across much of the well. This result indicates that a
bridge between the indicator membrane and the red cell preparation
on the well surface is absent. This is the test result obtained
from a negative antibody screen test.
Example 3
ABO Reverse Grouping Assays
Background:
[0618] This example describes experimental conditions for a
solid-phase ABO reverse grouping assay. Although described in the
context of ABO reverse grouping, similar conditions can be applied
to any immunoassay where an erythrocyte antigen specific IgM
immunoglobulin needs to be detected.
[0619] In a conventional reverse typing assay, A.sub.1 and B cells
are typically combined with patient plasma in a U or round bottom
microtiter plate. The plate is centrifuged and then agitated to
disperse non-agglutinated cells.
[0620] Another pathway is to immobilize A1 and B cells to the
bottom of a flat bottom, round bottom, or U bottom microtiter
plate. This pathway can simplify the hardware requirements required
to automate these assays. To perform the test, plasma is added to
wells pre-coated with lysed A1 and B cells, and then intact A1 and
B cells are added to the appropriate wells. The plate is
centrifuged and read. If binding occurs (indicating the presence of
anti-A or anti-B), the indicator cells will remain dispersed across
the bottom of the well plate surface. If binding is absent, the
indicator cells will pellet (in the case of round or U bottom well
plate) or travel to the bottom-most portion of the flat bottom
plate (if centrifuged at a non-zero angle)
[0621] Experiments performed by Applicants show that indicator
cells can mistakenly appear to bind to the surface, even in the
absence of specific antibodies. This particular effect is mostly
evident when forward typing and reverse grouping are both conducted
on the same disposable. To remove these non-bound cells, surface
cells of RhD negative phenotype and indicator cells of RhD positive
phenotype (anti-D IgM is added to the test plasma in addition to
the RhD positive indicator cells) were used. Use of anti-D IgM
causes indicator cells which are not bound to a surface to
agglutinate and subsequently travel to the lowest edge of the well
during centrifugation, thus eliminating apparent false positives.
Importantly, the surface cells are of RhD negative phenotype, and
thus no anti-D induced surface/indicator interaction was
observed.
Materials:
[0622] The following available materials are used in this example:
[0623] (i) A1 Rh(D-), B Rh(D)-, O Rh(D)- cells (Z401, Z411, Z421)
obtained from Alba Bioscience [0624] (ii) A Rh(D) Positive, B Rh(D)
Positive, O Rh(D) Positive cells obtained from Heartland Blood
Center, Aurora IL [0625] (ii) Blood bank saline (22-026-401)
obtained from Fisher; [0626] (iii) Anti-D (Z031) obtained from Alba
Bioscience [0627] (iv) Round bottom microtiter plate (767-070)
obtained from Greiner BioOne [0628] (v) Modified Alsevere's
solution: 100 g dextrose, 40 g trisodium citric acid, 10 g NaCl,
4.69 g inosine, 0.1 g citric acid, 1.7 g chloramphenicol, 0.5 g
neomycin sulfate--volume to 5 L with distilled water. [0629] (vi)
Poly-L-Lysine HBr (P1524) obtained from Sigma-Aldrich
Preparation of Plate:
[0630] For deposition of erythrocytes, suitable surfaces include
several organic polymers and glass which is modified to carry a
positive charge to keep the erythrocytes adsorbed through the
deposition, washing, drying and testing process. Specifically, to
each well of a Greiner medium binding 96 well "strip" polystyrene
plate (Microlon-200), 100 uL of 0.5 mg/mL poly-1-lysine is added,
sealed with tape and stored overnight at 4.degree. C. When ready to
use, each well within a strip is aspirated and washed three times
with 200 uL of 0.9% saline.
Preparation of Test Surface:
[0631] To the poly-1-lysine treated wells, 100 uL of a 1% solution
of Rh(D) negative, washed A1, B, or O cells in 0.9% saline are
added to separate wells. The cells are then centrifuged at 400 g
for 5 minutes and washed three times with 200 uL 0.9% saline. The
cells are next lysed by the addition of 200 uL of water for two
minutes, followed by two washes with 200 uL water. After the last
wash 75 uL of a solution composed of 0.2% anti-D (Alba Z031) in
BupH PBS is added to the well. The plate is then ready for use.
Test Procedure:
[0632] To carry out the test, a sufficient amount of plasma
(typically 50-75 uL) is added to the test well, followed by 4 uL of
a 3% solution of A, B, or O cells. The plate was placed into a
swinging-bucket centrifuge and spun at 200 g for 1.5 minutes and
500 g for an additional 1.5 minutes. The plate is then examined for
both adherent cells (monolayer to multilayer with uniform coating)
and non-adherent cells (in the case of a round or U bottom plate, a
pellet)). If the plasma contains antibodies to the A antigen, there
will be a uniform layer of cells stuck within the "A" well
Likewise, if the plasma contains antibodies to the B antigen, there
will be a uniform layer of cells stuck within the "B" well. In the
event that you have cells stuck in the "O" well, this indicates the
presence of antibody to the H antigen, and thus it is likely the
patient would be of the Bombay phenotype.
[0633] FIGS. 12A-12C shows a representative panel of photographs
depicting the readout of the ABO reverse grouping assays described
above. FIG. 12A contains A+ indicator cells and a pellet is obvious
indicating that the sample does not contain anti-A. FIG. 12B
contains B+ indicator cells and a pellet is absent indicating that
the sample contains anti-B. FIG. 12C contains O+ indicator cells
and a pellet is present indicating that the sample does not contain
anti-H or other confounding antibodies.
Example 4
Forward Typing
Materials:
[0634] The following available materials are used in this example:
[0635] (i) Anti-A, anti-B, anti-D--material from cell lines LA2,
LB2, LDM1 obtained from Alba Biosciences--purified to greater than
90% and concentrated to 1 mg/mL [0636] (ii) Round bottom microtiter
plate (767-070) obtained from Greiner BioOne [0637] (iii) Blood
bank saline (C) obtained from Fisher Scientific [0638] (iv) BSA
(A7906) obtained from Sigma-Aldrich [0639] (v) BupH PBS (28372)
obtained from Pierce [0640] (vi) Poly-1-lysine (P1524) obtained
from Sigma-Aldrich [0641] (vii) Tween 20 (P9416) obtained from
Sigma-Aldrich [0642] (viii) 96 well microtiter plate lid (656-170)
obtained from Greiner BioOne
Preparation of Antibody Solutions:
[0643] 20 mL of BupH PBS is added to each of three tubes and the
tubes are marked as "LA2", "LB2", and "LDM1". Each tube receives 80
.mu.L of purified anti-A (LA2), anti-B (LB2) or anti-D (LDM1) (each
antibody into respectively marked tube) and the tubes are
thoroughly mixed.
Preparation of Test Surface:
[0644] Greiner medium binding round bottom 96 well plates are
loaded with 100 uL of the appropriate antibody solution. The plate
is covered with a lid and stored in a refrigerator at 4 C
overnight. The next morning, the plate is then washed at least six
times with 200 uL of saline to remove unbound protein.
Plate Blocking:
[0645] The wells are then aspirated and 200 uL of a blocking
solution (3% BSA, 0.1% Tween 20 in BupH PBS) is added to each. This
is repeated for all rows. The plate is then covered with a lid and
stored at 4C for 36 hours. After this time has elapsed, the plate
is ready for use.
Preparation of Red Cells:
[0646] Red blood cells are diluted into 0.9% saline to a final
concentration of 0.04% (i.e. first 10 uL packed RBCs mixed with 90
uL 0.9% saline and 4 uL of this dilution is mixed with 1000 uL 0.9%
saline).
Test Procedure:
[0647] 100 uL of the 0.04% RBC solution is added to one well of
LA2,1 LB2 and LDM1. The strip (being held by the 96-well plate
frame) is placed into a swinging bucket centrifuge and spun for 1.5
minutes at 200 g's and an additional 1.5 minutes at 500 g's.
Result Interpretation:
[0648] The plate is then examined for binding--a negative binding
event is designated as the formation of a red cell button in the
well; a positive binding event is designated as the lack of a red
cell button (there is a red "haze" present from the red cells
binding over the surface of the well).
[0649] FIGS. 1E-1G display a typical result of this assay. FIG. 1E
is an image of a well coated with anti-A as described herein,
exposed to sample, and then centrifuged. FIG. 1E shows a `haze` of
blood cells indicating that binding between the cells and the
surface is present and that the cells in the sample present the A
antigen. FIG. 1F is an image of well coated with anti-B as
described herein, exposed to sample, and then centrifuged. The
figure shows a pellet of red blood cells indicating that binding
between the cells and the surface is absent. Thus, the cells in the
sample do not present the B antigen. FIG. 1G is an image of the
well coated with anti-D as described herein, exposed to sample, and
then centrifuged. The figure shows a `haze` of blood cells
indicating that binding between the cell and the surface is
present. Thus, the cells contained in the sample present the D
antigen. Therefore, the blood type of this particular sample may be
interpreted as A+.
Example 5
Minor Antigen Typing and Extended Phenotyping
[0650] Materials:
[0651] (i) Protein L from Peptostreptococcus magnus (P3101)
obtained from Sigma Aldrich
[0652] (ii) Anti-D (Z031) obtained from Alba Bioscience
[0653] (iii) Anti-c (Z083) obtained from Alba Bioscience
[0654] (iv) Anti-C (Z063) obtained from Alba Bioscience
[0655] (v) Anti-e (Z094A) obtained from Alba Bioscience
[0656] (vi) Anti-E (Z073) obtained from Alba Bioscience
[0657] (vii) Anti-Jka (Z162) obtained from Alba Bioscience
[0658] (viii) BupH phosphate buffered saline obtained from
Pierce
[0659] (ix) Blood bank saline (22-026-401) obtained from Fisher
Scientific
[0660] (x) Round bottom 96 well plates (767-070) obtained from
Greiner BioOne
[0661] (xi) 96 well plate lids (656-170) obtained from Greiner
BioOne
Plate Preparation:
[0662] Protein L was dissolved in PBS at a concentration of 1
mg/mL. It was then diluted 5000-fold with PBS and 75 uL of this
solution was pipetted into each well. The plate was covered with a
lid and allowed to incubate overnight at 4C. After incubation was
complete, each well was washed with 200 uL of saline 5.times. and
then 75 uL of the desired antibody (anti-D, anti-c, anti-C, anti-e,
anti-E, anti-Jka) was added to each well and the reaction allowed
to proceed for 4 hours at room temperature. The wells were once
again washed with 200 uL of saline 4.times..
Test Procedure:
[0663] 100 uL of a 0.04% suspension of test red blood cells are
added to each well. The plate is centrifuged at 50 g's for 8 mins
in a swinging bucket centrifuge and then the plate is read. A
tightly packed pellet at the bottom of the well indicates that the
sample is negative for the antigen in question, and a dispersed or
`hazy` layer of test cells indicates a positive.
[0664] FIG. 18 is an image of three samples tested using the assay
described herein. Each row represents one distinct sample. Each
column represents one distinct specificity (D, c, C, e, E,
Jk.sup.a). The figure shows that Sample 1 has the following antigen
profile D-, c+, C-, e+, E-, Jka+. Sample 2 has the following
antigen profile: D+, c+, C-, e-, E+, Jka+. Sample 3 has the
following antigen profile: D+, c-, C+, e+, E-, Jka-.
Example 6
Sequencing of Monoclonal Antibody MS-278
[0665] This example describes experimental conditions used for
sequencing of the variable region of the IgM monoclonal antibody
MS-278.
[0666] The materials and methods used in this example are as
follows:
Reduction and Alkylation of Disulfide Bonds
[0667] Protein samples were re-solubilized in 50 mM
triethylammonium bicarbonate (TEAB) buffer prior to reduction by
addition of tris(2-carboxyethyl)phosphine (TCEP) to a final
concentration of 5 mM and incubation at 37.degree. C. for 20 min.
Subsequently io doacetamide to a 10 mM final concentration was
added and the sample was incubated at room temperature for another
20 mins in the dark.
SDS-PAGE
[0668] To separate the two species of antibody subunits (LC, HC)
the antibody sample was solubilized in sample loading buffer
(Lammli, 1970). Aliquots of 5 .mu.g sample were loaded onto an
SDSPAGE gel. After the gel run (150 V, max. 400 mA, 75 min) the gel
was incubated in 50% ethanol, 10% acetic acid for 30 min prior to
gel staining with Coomassie Brilliant Blue (CBB G250) according to
standard techniques.
In Gel Enzymatic Cleavage
[0669] Gel slices from SDS-PAGE gels were prepared to enzymatic
cleavage by 3 times swelling /shrinking in 100 mM ABC or 50 mM ABC,
60% ACN respectively. Each step was carried out for 30 min at room
temperature. After the last shrinking step the gels slices were
dried in open eppendorf cups for 15 min. Proteolysis was started by
adding 3 volumes of enzyme solutions with an enzyme/protein ratio
of 1:50. Table 2 lists the enzyme solutions used for the
proteolyses.
TABLE-US-00001 TABLE 2 List of proteolytic enzymes with their
appropiate buffer solutions and incubation temperatures.
Tr/TL/PK/Elastase: 50 mM ammonium bicarbonate, 10% acetonitrile
(v/v) @ 37.degree. C. CT: 100 mM Tris-HCl, 10 mM CaCl2, 5% ACN
(v/v), pH 8.0 @ 37.degree. C. LysC: 50 mM Tris-HCl, 1 mM EDTA, 10%
ACN (v/v), pH 8.5 @ 37.degree. C. GluC: 50 mM Tris-HCl, 0.5 mM
Glu-Glu, pH 8.0 @ 25.degree. C.
[0670] Each proteolysis was carried out over night. The resulting
peptides were acidified with 1/2 volume of 2% FA prior to mass
spectrometry.
Proteolysis in Solution with Cysteine Derivatization
[0671] The protein samples were denatured by 8M urea with 5 mM TCEP
for 30 minutes. Next IAA to a final concentration of 10 mM was
added and the reaction was incubated 30 min in the dark at room
temperature. After dilution to 0.8M urea with appropriate protease
buffer (Table 2), the sample was digested separately by
endoproteases (trypsin, chymotrypsin, G1uC or LysC, respectively;
enzyme to protein ratio (w/w): 1:50) according to standard
procedures.
High-Resolution Mass Spectrometry
[0672] The HPLC system was coupled to an Advion NanoMate 100
chip-electrospray system (Advion, Ithaca, N.Y.), and detection was
performed on a Finnigan LTQ-FT mass spectrometer (ThermoFisher,
Bremen, Germany) equipped with a 6T magnet.
[0673] Samples from proteolyses were applied to nanoLC-ESI-MS/MS
after acidification. After trapping and desalting the peptides on
enrichment column (Zorbax SB C18, 0.3 mm.times.5 mm, Agilent) using
1% acetonitrile/0.5% formic acid solution for five minutes peptides
were separated on Zorbax 300 SB C18, 75 .mu.m.times.150 mm column
(Agilent, Waldbronn) using an acetonitrile/0.1% formic acid
gradient from 5% to 40% acetonitrile. MS overview spectra were
automatically taken in FT-mode according to manufacturer's
instrument settings for nanoLC-ESI-MSMS analyses, peptide
fragmentation and detection was accomplished in the instrument's
LTQ ion trap.
[0674] Beside one dimensional nanoLC-ESI-MSMS several analyses were
performed by two-dimensional nanoLC-ESI-MSMS (MudPIT) using a
strong cation column (SCX) online coupled to the C18 trapping
column. By increasing NaCl salt steps (10-300 mM) peptides which
were previously trapped to the SCX column were eluted to the C18
trap column before nanoLC-ESIMSMS analysis.
HPLC Separation and Edman Sequencing
[0675] Peptides were separated and fractionated by an Agilent 1100
HPLC system using a Phenomenex Kinetex C18 column with a
water/acetonitrile/0.1% TFA gradient according to standard
procedures. Peptide fractions were applied to an Applied Biosystems
Procise 494 Edman sequencer for amino acid sequencing.
Database Searches
[0676] Data sets acquired by high-resolution mass spectrometry were
used for database searches against a custom database of known
antibody sequences utilizing the Mascot search engine
[0677] (Matrix Science Ltd., London) or OMSSA. The databases used
were either derived from the constantly updated NCBInr database or
generated in-silico. The search parameters were set according to
the expected protein modifications and to the MS instrument used in
this study.
In-Silico Database Generation
[0678] In-silico databases were produced with respect to their
calculated size and complexity. For databases containing a final
set of 20 6 or less sequence candidates a brute force algorithm was
used to generate the full set of sequences.
For databases that would contain more than 20 6 sequences and
therefore exceed current computation and storage capacities a two
step methodology was used. In a first step, anagram-like isobaric
peptide sequences were reduced to a set of degenerated
pre-candidates. The data reduction of sequence candidates can be
exemplified as follows.
ANNA-anchor
NANA-anchor
ANAN-anchor 2A2N-anchor
NAAN-anchor
NNAA-anchor
AANN-anchor
[0679] complete set degenerated single pre-candidate anchor=known
conserved/indentified sequence tag
[0680] The set of candidates from the first step were used for a
database search. Pre-candidates matching MS data were manually
reviewed and selected according to the cleavage enzymes specifity,
known consensus sequences in front and behind antibodies' CDR
regions and fragment ions of the fixed anchor sequence. Selected
pre-candidates were used for the regeneration of a complete
sequence set (as exemplified above) and used for a database search.
This procedure was iteratively repeated.
Example 7
Amino Acid Sequences of the Variable Region of Monoclonal Antibody
MS-278
[0681] This example describes the amino acid sequence analysis of
the IgG light and heavy chain variable regions of monoclonal
antibody MS-278.
Light Chain Variable Region
[0682] The amino acid sequence of the light chain variable region
shown below was derived from analytical data. The amino acid
sequence is a composite of peptides detected after the different
proteolytic digests described in Example 6. CDR regions are
underlined and in bold. "X" indicates non-detected sequence
parts.
TABLE-US-00002 (SEQ ID NO: 1) 1
DIVLTQSPASLAVSLGQRATISCRASESVDSYGNSFMHWY 41
QQKPGQPPKLLIYRASNLESGIPARFSGSGSGTDFTLTIN 81
PVEADDVATYYCQQTNEDPRTFGGGTKLELKRADAAPTVS 121
IFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQ 161
NGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEA 201 THKTSTSPIVKSF
CDR1 of the light chain variable region includes the following
sequence:
TABLE-US-00003 (SEQ ID NO: 2) RASESVDSYGNSFMH
CDR2 of the light chain variable region includes the following
sequence:
TABLE-US-00004 (SEQ ID NO: 3) RASNLES
CDR3 of the light chain variable region includes the amino acid
sequence: DPRT (SEQ ID NO: 4). In one embodiment, the CDR3 of the
light chain includes the amino acid sequence
TABLE-US-00005 (SEQ ID NO: 7) QQTNEDPRT.
CDR3 can have the following consensus sequence: X.sub.1 X.sub.2
X.sub.3 X.sub.4 X.sub.5 X.sub.6 D P R T (SEQ ID NO: 5), wherein:
X.sub.1=Q, A, G, or absent; X.sub.2=A, G, F, Q, or absent;
X.sub.3=G, Q, P, Q, A or T;
X.sub.4=T, L or G;
X.sub.5=N, E or G; and
X.sub.6=E, N or V.
[0683] Exemplary sequences for CDR3 of the light chain variable
region include:
TABLE-US-00006 (SEQ ID NO: 6) QAGTNEDPRT (SEQ ID NO: 7) QQTNEDPRT
(SEQ ID NO: 8) AGQTENDPRT (SEQ ID NO: 9) AGQTNEDPRT (SEQ ID NO: 10)
FPLGVSDPRT (SEQ ID NO: 11) GAQTENDPRT (SEQ ID NO: 12) QGATNEDPRT
(SEQ ID NO: 13) QQTGGEDPRT
Heavy Chain Variable Region
[0684] The amino acid sequence of the heavy chain variable region
shown below was derived from analytical data. The amino acid
sequence is a composite of peptides detected after the different
proteolytic digests described in Example 6. CDR regions are
underlined and in bold. "X" indicates non-detected sequence
parts.
TABLE-US-00007 (SEQ ID NO: 14) 1 QVTLKESGPG ILQPSQTLSL TCSFSGFSLS
TSGMGVSWIR QPSGKGLEWL 51 AHIYWDDDKR YNPSLKSRLT ISKDTSRNQV
FLKITSVDTA DTATYYCARx 101 xxxxxxLDYW GQGTTLTVSS ESQSFPNVFP
LVSCESPLSD KNLVAMGCLA 151 RDFLPSTISF TWNYQNNTEV IQGIRTFPTL
RTGGKYLATS QVLLSPKSIL 201 EGSDEYLVCK IHYGGKNRDL HVPIPAVAEM
NPNVNVFVPP RDG
CDR1 of the heavy chain variable region can have the following
consensus sequence: X.sub.1 X.sub.2 X.sub.3S L S T S G M G V S (SEQ
ID NO: 15), wherein
X.sub.1 is G or Y;
X.sub.2 is F, G or Y; and
[0685] X.sub.3 is A or absent. CDR1 of the heavy chain can have one
of the following amino acid sequences:
TABLE-US-00008 (SEQ ID NO: 16) GFSLSTSGMGVS (SEQ ID NO: 17)
GYASLSTSGMGVS (SEQ ID NO: 18) YGASLSTSGMGVS (SEQ ID NO: 19) MEEFLL
(SEQ ID NO: 20) LLLFGL or (SEQ ID NO: 21) NSDYYK.
CDR2 of the heavy chain variable region includes the following
sequence:
TABLE-US-00009 (SEQ ID NO: 22) HIYWDDDKRYNPSLKS.
Exemplary candidate sequences for CDR2 of the heavy chain variable
region include one of the following amino acid sequences:
TABLE-US-00010 (SEQ ID NO: 23) DYVQEDISKDTSR (SEQ ID NO: 24)
FMVQEDISKDTSR (SEQ ID NO: 25) DYNLEDISKDTSR (SEQ ID NO: 26)
LFFVPHISK (SEQ ID NO: 27) RHNVPHISK (SEQ ID NO: 28) AALQELISK (SEQ
ID NO: 29) FKTVDRTISKD (SEQ ID NO: 30) GYRVDRTISKD (SEQ ID NO: 31)
VEAFQTTISK (SEQ ID NO: 32) NNAFKTTISK (SEQ ID NO: 33) DIAFQTTISK,
or (SEQ ID NO: 34) YPEAWETISK.
CDR sequences are bolded and underlined. CDR3 of the heavy chain
variable region can have one of the following amino acid
sequences:
TABLE-US-00011 (SEQ ID NO: 35) TYYCARTTGY (SEQ ID NO: 36)
TYYCARSDGY, or (SEQ ID NO: 37) DYWGQGTSVTVSS.
TABLE-US-00012 TABLE 1 Blood group antigens within systems Antigen
number System 001 002 003 004 005 006 007 008 009 010 011 012 001
ABO A B A, B A1 . . . 002 MNS M N S s U He Mi.sup.a M.sup.c Vw Mur
M.sup.g Vr 003 P P1 . . . . . . 004 RH D C E c e f Ce C.sup.w
C.sup.x V E.sup.w G 005 LU Lu.sup.a Lu.sup.b Lu3 Lu4 Lu5 Lu6 Lu7
Lu8 Lu9 . . . Lu11 Lu12 006 KEL K k Kp.sup.a Kp.sup.b Ku Js.sup.a
Js.sup.b . . . . . . Ul.sup.a K11 K12 007 LE Le.sup.a Le.sup.b
Le.sup.ab Le.sup.bH ALe.sup.b BLe.sup.b 008 FY Fy.sup.a Fy.sup.b
Fy3 Fy4 Fy5 Fy6 009 JK Jk.sup.a Jk.sup.b Jk3 010 DI Di.sup.a
Di.sup.b Wr.sup.a Wr.sup.b Wd.sup.a Rb.sup.a WARR ELO Wu Bp.sup.a
Mo.sup.a Hg.sup.a 011 YT Yt.sup.a Yt.sup.b 012 XG Xg.sup.a CD99 013
SC Sc1 Sc2 Sc3 Rd STAR SCER SCAN 014 DO Do.sup.a Do.sup.b Gy.sup.a
Hy Jo.sup.a DOYA 015 CO Co.sup.a Co.sup.b Co3 016 LW . . . . . . .
. . . . . LW.sup.a LW.sup.ab LW.sup.b 017 CH/RG Ch1 Ch2 Ch3 Ch4 Ch5
Ch6 WH Rg1 Rg2 018 H H 019 XK Kx 020 GE . . . Ge2 Ge3 Ge4 Wb
Ls.sup.a An.sup.a Dh.sup.a GEIS 021 CROM Cr.sup.a TC.sup.a TC.sup.b
TC.sup.c Dr.sup.a Es.sup.a IFC WES.sup.a WES.sup.b UMC GUTI SERF
022 KN Kn.sup.a Kn.sup.b McC.sup.a Sl1 Yk.sup.a McC.sup.b Sl2 Sl3
KCAM 023 IN In.sup.a In.sup.b INFI INJA 024 OK OK.sup.a 025 RAPH
MER2 026 JMH JMH JMHK JMHL JMHG JMHM 027 I I 028 GLOB P 029 GIL GIL
030 RHAG Duclos Ol.sup.a Duclos- like Antigen Number System 013 014
015 016 017 018 019 020 021 022 023 024 002 MNS M.sup.e Mt.sup.a
St.sup.a Ri.sup.a Cl.sup.a Ny.sup.a Hut Hil M.sup.v Far S.sup.D Mit
004 RH . . . . . . . . . . . . Hr.sub.o Hr hr.sup.S VS C.sup.G CE
D.sup.W . . . 005 LU Lu13 Lu14 . . . Lu16 Lu17 Au.sup.a Au.sup.b
Lu20 Lu21 006 KEL K13 K14 . . . K16 K17 K18 K19 Km Kp.sup.c K22 K23
K24 010 DI Vg.sup.a Sw.sup.a BOW NFLD Jn.sup.a KREP Tr.sup.a
Fr.sup.a SW1 021 CROM ZENA CROV CRAM Antigen number System 025 026
027 028 029 030 031 032 033 034 035 002 MNS Dantu Hop Nob En.sup.a
En.sup.aKT `N' Or DANE TSEN MINY MUT 004 RH . . . c-like cE
hr.sup.H Rh29 Go.sup.a hr.sup.B Rh32 Rh33 Hr.sup.B Rh35 006 KEL
VLAN TOU RAZ VONG KALT KTIM KYO KUCI KANT KASH Antigen number
System 036 037 038 039 040 041 042 043 044 045 046 002 MNS SAT ERIK
Os.sup.a ENEP ENEH HAG ENAV MARS ENDA ENEV MNTD 004 RH Be.sup.a
Evans . . . Rh39 Tar Rh41 Rh42 Crawford Nou Riv Sec Antigen Number
System 047 048 049 050 051 052 053 054 055 056 057 004 RH Dav JAL
STEM FPTT MAR BARC JAHK DAK LOCR CENR CEST . . . = obsolete;
provisional numbers are in italic
EQUIVALENTS
[0686] Those skilled in the art will recognize, or be able to
ascertain using no more than routine experimentation, many
equivalents to the specific embodiments of the invention described
herein. Such equivalents are intended to be encompassed by the
following claims.
Sequence CWU 1
1
431213PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 1Asp Ile Val Leu Thr Gln Ser Pro Ala Ser Leu
Ala Val Ser Leu Gly1 5 10 15Gln Arg Ala Thr Ile Ser Cys Arg Ala Ser
Glu Ser Val Asp Ser Tyr 20 25 30Gly Asn Ser Phe Met His Trp Tyr Gln
Gln Lys Pro Gly Gln Pro Pro 35 40 45Lys Leu Leu Ile Tyr Arg Ala Ser
Asn Leu Glu Ser Gly Ile Pro Ala 50 55 60Arg Phe Ser Gly Ser Gly Ser
Gly Thr Asp Phe Thr Leu Thr Ile Asn65 70 75 80Pro Val Glu Ala Asp
Asp Val Ala Thr Tyr Tyr Cys Gln Gln Thr Asn 85 90 95Glu Asp Pro Arg
Thr Phe Gly Gly Gly Thr Lys Leu Glu Leu Lys Arg 100 105 110Ala Asp
Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln 115 120
125Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr
130 135 140Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu
Arg Gln145 150 155 160Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp
Ser Lys Asp Ser Thr 165 170 175Tyr Ser Met Ser Ser Thr Leu Thr Leu
Thr Lys Asp Glu Tyr Glu Arg 180 185 190His Asn Ser Tyr Thr Cys Glu
Ala Thr His Lys Thr Ser Thr Ser Pro 195 200 205Ile Val Lys Ser Phe
210215PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 2Arg Ala Ser Glu Ser Val Asp Ser Tyr Gly Asn Ser
Phe Met His1 5 10 1537PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 3Arg Ala Ser Asn Leu Glu Ser1
544PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 4Asp Pro Arg Thr1510PRTArtificial
SequenceDescription of Artificial Sequence Synthetic consensus
sequence 5Xaa Xaa Xaa Xaa Xaa Xaa Asp Pro Arg Thr1 5
10610PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 6Gln Ala Gly Thr Asn Glu Asp Pro Arg Thr1 5
1079PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 7Gln Gln Thr Asn Glu Asp Pro Arg Thr1
5810PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 8Ala Gly Gln Thr Glu Asn Asp Pro Arg Thr1 5
10910PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 9Ala Gly Gln Thr Asn Glu Asp Pro Arg Thr1 5
101010PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 10Phe Pro Leu Gly Val Ser Asp Pro Arg Thr1 5
101110PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 11Gly Ala Gln Thr Glu Asn Asp Pro Arg Thr1 5
101210PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 12Gln Gly Ala Thr Asn Glu Asp Pro Arg Thr1 5
101310PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 13Gln Gln Thr Gly Gly Glu Asp Pro Arg Thr1 5
1014243PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 14Gln Val Thr Leu Lys Glu Ser Gly Pro Gly Ile
Leu Gln Pro Ser Gln1 5 10 15Thr Leu Ser Leu Thr Cys Ser Phe Ser Gly
Phe Ser Leu Ser Thr Ser 20 25 30Gly Met Gly Val Ser Trp Ile Arg Gln
Pro Ser Gly Lys Gly Leu Glu 35 40 45Trp Leu Ala His Ile Tyr Trp Asp
Asp Asp Lys Arg Tyr Asn Pro Ser 50 55 60Leu Lys Ser Arg Leu Thr Ile
Ser Lys Asp Thr Ser Arg Asn Gln Val65 70 75 80Phe Leu Lys Ile Thr
Ser Val Asp Thr Ala Asp Thr Ala Thr Tyr Tyr 85 90 95Cys Ala Arg Xaa
Xaa Xaa Xaa Xaa Xaa Xaa Leu Asp Tyr Trp Gly Gln 100 105 110Gly Thr
Thr Leu Thr Val Ser Ser Glu Ser Gln Ser Phe Pro Asn Val 115 120
125Phe Pro Leu Val Ser Cys Glu Ser Pro Leu Ser Asp Lys Asn Leu Val
130 135 140Ala Met Gly Cys Leu Ala Arg Asp Phe Leu Pro Ser Thr Ile
Ser Phe145 150 155 160Thr Trp Asn Tyr Gln Asn Asn Thr Glu Val Ile
Gln Gly Ile Arg Thr 165 170 175Phe Pro Thr Leu Arg Thr Gly Gly Lys
Tyr Leu Ala Thr Ser Gln Val 180 185 190Leu Leu Ser Pro Lys Ser Ile
Leu Glu Gly Ser Asp Glu Tyr Leu Val 195 200 205Cys Lys Ile His Tyr
Gly Gly Lys Asn Arg Asp Leu His Val Pro Ile 210 215 220Pro Ala Val
Ala Glu Met Asn Pro Asn Val Asn Val Phe Val Pro Pro225 230 235
240Arg Asp Gly1513PRTArtificial SequenceDescription of Artificial
Sequence Synthetic consensus sequence 15Xaa Xaa Xaa Ser Leu Ser Thr
Ser Gly Met Gly Val Ser1 5 101612PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 16Gly Phe Ser Leu Ser Thr
Ser Gly Met Gly Val Ser1 5 101713PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 17Gly Tyr Ala Ser Leu Ser
Thr Ser Gly Met Gly Val Ser1 5 101813PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 18Tyr
Gly Ala Ser Leu Ser Thr Ser Gly Met Gly Val Ser1 5
10196PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 19Met Glu Glu Phe Leu Leu1 5206PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 20Leu
Leu Leu Phe Gly Leu1 5216PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 21Asn Ser Asp Tyr Tyr Lys1
52216PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 22His Ile Tyr Trp Asp Asp Asp Lys Arg Tyr Asn Pro
Ser Leu Lys Ser1 5 10 152313PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 23Asp Tyr Val Gln Glu Asp Ile
Ser Lys Asp Thr Ser Arg1 5 102413PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 24Phe Met Val Gln Glu Asp
Ile Ser Lys Asp Thr Ser Arg1 5 102513PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 25Asp
Tyr Asn Leu Glu Asp Ile Ser Lys Asp Thr Ser Arg1 5
10269PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 26Leu Phe Phe Val Pro His Ile Ser Lys1
5279PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 27Arg His Asn Val Pro His Ile Ser Lys1
5289PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 28Ala Ala Leu Gln Glu Leu Ile Ser Lys1
52911PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 29Phe Lys Thr Val Asp Arg Thr Ile Ser Lys Asp1 5
103011PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 30Gly Tyr Arg Val Asp Arg Thr Ile Ser Lys Asp1 5
103110PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 31Val Glu Ala Phe Gln Thr Thr Ile Ser Lys1 5
103210PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 32Asn Asn Ala Phe Lys Thr Thr Ile Ser Lys1 5
103310PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 33Asp Ile Ala Phe Gln Thr Thr Ile Ser Lys1 5
103410PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 34Tyr Pro Glu Ala Trp Glu Thr Ile Ser Lys1 5
103510PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 35Thr Tyr Tyr Cys Ala Arg Thr Thr Gly Tyr1 5
103610PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 36Thr Tyr Tyr Cys Ala Arg Ser Asp Gly Tyr1 5
103713PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 37Asp Tyr Trp Gly Gln Gly Thr Ser Val Thr Val Ser
Ser1 5 10384PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 38Ala Asn Asn Ala1394PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 39Asn
Ala Asn Ala1404PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 40Ala Asn Ala Asn1414PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 41Asn
Ala Ala Asn1424PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 42Asn Asn Ala Ala1434PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 43Ala
Ala Asn Asn1
* * * * *
References