U.S. patent application number 13/500597 was filed with the patent office on 2012-08-02 for capcna peptide therapeutics for cancer.
This patent application is currently assigned to Indiana University Research and Technology Corpora. Invention is credited to Robert J. Hickey, Linda H. Malkas.
Application Number | 20120195978 13/500597 |
Document ID | / |
Family ID | 43857153 |
Filed Date | 2012-08-02 |
United States Patent
Application |
20120195978 |
Kind Code |
A1 |
Hickey; Robert J. ; et
al. |
August 2, 2012 |
CAPCNA PEPTIDE THERAPEUTICS FOR CANCER
Abstract
Administration of compositions comprising cell-permeable
caPCNA-derived peptides and their variants reduces the
proliferation of cancer cells and also augments cytotoxic effects
of chemotherapeutics. The compositions are effective in cells
harboring mutations in DNA repair proteins.
Inventors: |
Hickey; Robert J.;
(Indianapolis, IN) ; Malkas; Linda H.;
(Indianapolis, IN) |
Assignee: |
Indiana University Research and
Technology Corpora
Indianapolis
IN
|
Family ID: |
43857153 |
Appl. No.: |
13/500597 |
Filed: |
October 7, 2010 |
PCT Filed: |
October 7, 2010 |
PCT NO: |
PCT/US10/51843 |
371 Date: |
April 5, 2012 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
61249528 |
Oct 7, 2009 |
|
|
|
Current U.S.
Class: |
424/649 ;
514/18.9; 514/19.3; 514/19.4 |
Current CPC
Class: |
A61K 9/0019 20130101;
A61K 38/1709 20130101; A61K 38/10 20130101; A61K 38/16 20130101;
A61K 45/06 20130101; A61K 38/08 20130101; A61P 35/00 20180101; A61K
33/24 20130101; C07K 14/4738 20130101; A61P 35/04 20180101; A61K
38/08 20130101; A61K 2300/00 20130101; A61K 38/10 20130101; A61K
2300/00 20130101; A61K 38/1709 20130101; A61K 2300/00 20130101 |
Class at
Publication: |
424/649 ;
514/18.9; 514/19.3; 514/19.4 |
International
Class: |
A61K 38/08 20060101
A61K038/08; A61K 33/24 20060101 A61K033/24; A61P 35/00 20060101
A61P035/00 |
Claims
1. A method of inducing cell death in a cancer cell or a
pre-malignant cell, the method comprising administering a
therapeutically effective amount of a composition comprising a
caPCNA peptide molecule, wherein the caPCNA peptide molecule
comprises an amino acid sequence selected from LGIPEQEY (SEQ ID NO:
1), LAIPEQEY (SEQ ID NO: 2), LGIAEQEY (SEQ ID NO: 3), LGIPAQEY (SEQ
ID NO: 4), LGIPEAEY (SEQ ID NO: 5), LGIPEQAY (SEQ ID NO: 6),
LGIAEAEY (SEQ ID NO: 7), LGIPEAAY (SEQ ID NO: 8), LGIAEQAY (SEQ ID
NO: 9), and LGIAEAAY (SEQ ID NO: 10), wherein the cell has a
mutation in a DNA repair protein.
2. A method of reducing cellular proliferation of a cancer cell or
a pre-malignant cell of an individual, the method comprising
administering a therapeutically effective amount of a composition
comprising a caPCNA peptide molecule, wherein the caPCNA peptide
molecule comprises an amino acid sequence selected from LGIPEQEY
(SEQ ID NO: 1), LAIPEQEY (SEQ ID NO: 2), LGIAEQEY (SEQ ID NO: 3),
LGIPAQEY (SEQ ID NO: 4), LGIPEAEY (SEQ ID NO: 5), LGIPEQAY (SEQ ID
NO: 6), LGIAEAEY (SEQ ID NO: 7), LGIPEAAY (SEQ ID NO: 8), LGIAEQAY
(SEQ ID NO: 9), and LGIAEAAY (SEQ ID NO: 10), wherein the
individual has one or more mutations in a DNA repair protein.
3. The method according to claim 1, wherein the DNA repair protein
participates in homologous recombination.
4. The method according to claim 1, wherein the protein is selected
from BRCA1, BRCA2, PALB2, RAD51, RAD52, XRCC3, MRE11, and/or
combinations thereof.
5. The method according to claim 4 wherein the protein is
BRCA1.
6. The method according to claim 1, wherein the caPCNA peptide
molecule comprises a cell penetrating factor.
7. The method according to claim 6 wherein the cell penetrating
factor is covalently attached or conjugated to the caPCNA peptide
molecule.
8. The method according to claim 6 wherein the cell penetrating
factor is recombinantly fused to the caPCNA peptide molecule.
9. The method according to claim 6, wherein the cell penetrating
factor is a peptide is selected from the amino acid sequences
RRRRRRR (SEQ ID NO: 11), RRRRRRRR (SEQ ID NO: 12), RRRRRRRRR (SEQ
ID NO: 13), RRRRRRRRRR (SEQ ID NO: 14), RRRRRRRRRRR (SEQ ID NO:
15), RQIKIWFQNRRMKWKK (SEQ ID NO: 16), GRKKRRQRRRPPQ (SEQ ID NO:
17), GWTLNSAGYLLGKINLKALAALAKKIL (SEQ ID NO: 18), and GRKKRRQRRR
(SEQ ID NO: 19).
10. The method according to claim 9, wherein the amino acid
sequence comprises one or more amino acid D-isomers.
11. The method according to claim 1, wherein the composition
further comprises a cell surface targeting factor.
12. The method according to claim 1, wherein the composition
further comprises a nuclear localization sequence.
13. The method according to claim 1, wherein the composition is
administered intravenously.
14. The method according to claim 1, wherein the composition is
delivered intratumorally.
15. The method according to claim 1, further comprising
administering a chemotherapeutic agent.
16. (canceled)
17. The method of claim 15, wherein the chemotherapeutic agent is
selected from doxorubicin, irinotecan, cyclophosphamide,
chlorambucil, melphalan, methotrexate, cytarabine, fludarabine,
6-mercaptopurine, 5-fluorouracil, capecytabine, cisplatin,
carboplatin, oxaliplatin, and any combination thereof.
18. A method of reducing the effective dose of a chemotherapeutic
agent required to treat cancer, the method comprising administering
a caPCNA peptide and a chemotherapeutic agent to an individual
diagnosed with a cancer associated with one or more mutations in a
DNA repair protein.
19. The method of claim 18, wherein the effective dose of the
chemotherapeutic agent is from about 25% to about 75% less than the
standard chemotherapeutic dose for the agent.
20. The method according to claim 18 wherein the cancer is breast
cancer.
21. (canceled)
22. (canceled)
23. (canceled)
24. (canceled)
25. (canceled)
26. The method of claim 18, wherein the chemotherapeutic agent is
selected from doxorubicin, irinotecan, cyclophosphamide,
chlorambucil, melphalan, methotrexate, cytarabine, fludarabine,
6-mercaptopurine, 5-fluorouracil, capecytabine, cisplatin,
carboplatin, oxaliplatin, and any combination thereof.
Description
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application claims priority under 35 USC .sctn.119(e)
to U.S. Provisional Application Ser. No. 61/249,528 filed on Oct.
7, 2009, the entire disclosure of which is incorporated herein by
reference.
INCORPORATION OF SEQUENCE LISTING
[0002] The sequence listing with file name 213944_ST25.txt, created
on Oct. 7, 2010 (21.8 KB) is expressly incorporated by reference in
its entirety.
TECHNICAL FIELD
[0003] This disclosure relates to peptide-based therapeutic
compositions and methods to inhibit cancer cell proliferation.
BACKGROUND
[0004] Proliferating cell nuclear antigen (PCNA) plays an important
role in the process of DNA replication, repair, chromosomal
recombination, cell cycle check-point control and other cellular
proliferative activities. In conjunction with an adaptor protein,
replication factor C(RFC), PCNA forms a moving clamp that is the
docking point for DNA polymerases delta and epsilon. Different
isoforms of proliferating cell nuclear antigen (PCNA) that display
both acidic and basic isoelectric points (pI) have been
demonstrated. Analysis of PCNA by two-dimensional polyacrylamide
gel electrophoresis (2D PAGE) from both malignant and non-malignant
breast cells (referred to as non-malignant PCNA or nmPCNA) and
tissues revealed the presence of an acidic form of PCNA only in
malignant cells (referred to as the cancer-specific PCNA or csPCNA
or caPCNA). This difference in isoelectric points between these two
forms of PCNA appears to result from an alteration in the ability
of the malignant cells to post-translationally modify the PCNA
polypeptide and is not due to a genetic change within the PCNA
gene.
[0005] Structural work examining the structure of the PCNA
polypeptide to define the structural differences between the caPCNA
and non-malignant cell isoform of PCNA revealed a region of the
caPCNA protein that is uniquely exposed only in the cancer cell. An
antibody was developed to a region of the cancer specific isoform
of PCNA that is highly selective for the PCNA isoform expressed
exclusively in cancer cells.
[0006] Proliferating cell nuclear antigen (PCNA) is a 29 kDa
nuclear protein and its expression in cells during the S and G2
phases of the cell cycle makes the protein a good cell
proliferation marker. It has also been shown to partner in many of
the molecular pathways responsible for the life and death of the
cell. Its periodic appearance in S phase nuclei suggested an
involvement in DNA replication. PCNA was later identified as a DNA
polymerase accessory factor in mammalian cells and an essential
factor for SV40 DNA replication in vitro. In addition to
functioning as a DNA sliding clamp protein and a DNA polymerase
accessory factor in mammalian cells, PCNA interacts with a number
of other proteins involved in transcription, cell cycle
checkpoints, chromatin remodeling, recombination, apoptosis, and
other forms of DNA repair. Besides being diverse in action, PCNA's
many binding partners are linked by their contributions to the
precise inheritance of cellular functions by each new generation of
cells. PCNA may act as a master molecule that coordinates
chromosome processing.
[0007] PCNA is also known to interact with other factors like
FEN-1, DNA ligase, and DNA methyl transferase. Additionally, PCNA
was also shown to be an essential player in multiple DNA repair
pathways. Interactions with proteins like the mismatch recognition
protein, Msh2, and the nucleotide excision repair endonuclease,
XPG, have implicated PCNA in processes distinct from DNA synthesis.
Interactions with multiple partners generally rely on mechanisms
that enable PCNA to selectively interact in an ordered and
energetically favorable way.
[0008] The use of short synthetic peptides for the generation of
polyclonal and monoclonal antibodies has been successful. Peptides
are known to serve as chemo-attractants, potent neurological and
respiratory toxins, and hormones. The peptides have also been used
as affinity targets and probes for biochemical studies, and have
provided a basis for understanding the characteristics and specific
nature of discrete protein-protein interactions. In addition,
peptide hormones exert potent physiological effects, and in some
cases the active hormone is either a peptide that is contained
within a larger protein or is processed and released from a
precursor protein prior to exerting its physiological effect.
[0009] Peptides have been used to disrupt protein-protein
interactions, by acting as highly specific competitors of these
interactions. Biochemical studies employing peptide reagents
advanced the use of peptides as therapeutic drugs capable of
disrupting cell functions that require protein-protein
interactions. Thus, specific cellular processes such as apoptosis
and cell cycle progression, which are dependent upon discrete
protein-protein interactions, can be inhibited if these
protein-protein interactions are selectively disrupted. The
replication of genomic DNA being dependent on protein-protein
interactions is also susceptible to peptide-induced inhibition of
these protein interactions.
[0010] In vivo DNA synthesis is a highly regulated process that
depends on a myriad of biochemical reactions mediated by a complex
series of protein-protein interactions. Cell division is dependent
on the DNA synthetic process, and cancer cell growth is
substantially sensitive to any agent that disrupts the regulation
and/or the activity of the DNA synthetic machinery responsible for
copying the cancer cell's genomic DNA. In addition, it was
demonstrated that one signature of cancer, for example, breast
cancer, is the induction of genomic instability, as transformed
cells develop a highly aggressive metastatic phenotype. Genomic
instability arises through a series of changes in the cellular DNA
synthetic machinery that alters the fidelity with which DNA is
synthesized.
[0011] Studies utilizing the carboxyl terminal 26 amino acids from
the p21cip protein, (which is known to interact with the PCNA
protein), demonstrated the ability of this peptide to disrupt the
cellular proliferative process. This peptide fragment of p21
potentially disrupts one or more cellular processes utilizing PCNA
and presumably interferes with protein-protein interactions that
participate in the DNA synthetic process as well as the regulation
of other cell cycle check-point controls and the induction of
apoptosis.
[0012] Studies utilizing this peptide fragment of p21 have
demonstrated the ability of the p21 peptide to activate a
non-caspase associated apoptotic pathway. Similarly, studies
involving a 39 amino acid peptide fragment of the p21 protein
partially inhibited DNA replication in vivo, and suggest that this
peptide fragment of p21 can stabilize the PCNA-p21 protein
interaction leading to the decrease in DNA synthetic activity
within the cell.
[0013] In addition, computational chemical methods are being used
to model specific regions of the PCNA molecule that may interact
with other cellular proteins involved in cell cycle check point
control and DNA synthesis. Regions of the cyclin-CDK complex may
serve as templates to identify target sites for disrupting key cell
cycle check-point control points that are essential for cell
proliferation.
[0014] Use of synthetic peptides to inhibit cell proliferation and
the process of selectively targeting cancer specific PCNA protein
to mediate the inhibition of cell proliferation is needed to treat
cancer. Peptidomimetic drugs that interact with an antigenic site
or target site on caPCNA to disrupt specific protein-caPCNA
interactions that are unique to the cancer cell are desired.
Peptides derived from caPCNA specific epitopes, described herein,
significantly augment the cytotoxic effects of standard
chemotherapeutic regimens and consequently kill cancer cells in a
highly selective manner.
[0015] Germ-line mutations in BRCA1 or BRCA2 alleles are associated
with a high risk of the development of a number of cancers,
including breast, ovarian, and prostate cancer. Cells lacking these
or other important DNA repair proteins have deficiencies in the
repair of DNA double stranded breaks by homologous recombination.
For example, loss of BRCA1 function often leads to aggressive
tumors, and the tumors are often resistant to chemotherapeutic DNA
damaging agents. Thus, novel therapeutics, such as caPCNA peptides,
that exploit the DNA repair defects in cancers harboring mutations
in homologous recombination pathways, are advantageous to standard
chemotherapeutics used alone.
SUMMARY
[0016] A method of inducing cell death in a cancer cell or a
pre-malignant cell includes administering a therapeutically
effective amount of a composition comprising a caPCNA peptide,
wherein the caPCNA peptide comprises an amino acid sequence
selected from LGIPEQEY (SEQ ID NO: 1), LAIPEQEY (SEQ ID NO: 2),
LGIAEQEY (SEQ ID NO: 3), LGIPAQEY (SEQ ID NO: 4), LGIPEAEY (SEQ ID
NO: 5), LGIPEQAY (SEQ ID NO: 6), LGIAEAEY (SEQ ID NO: 7), LGIPEAAY
(SEQ ID NO: 8), LGIAEQAY (SEQ ID NO: 9), and LGIAEAAY (SEQ ID NO:
10).
[0017] In an aspect, the cell harbors one or more mutations in a
DNA repair protein. In an aspect, the DNA repair protein
participates in homologous recombination. Illustrative examples of
homologous recombination repair proteins include, but are not
limited to BRCA1, BRCA2, or PALB2, RAD51, RAD52, XRCC3, MRE11, and
the like. Illustratively, the cancer cell or pre-malignant cell may
be a breast, ovarian, or prostate cell.
[0018] A method of reducing cellular proliferation of a cancer cell
or a pre-malignant cell of an individual having one or more
mutations in a DNA repair protein includes administering a
therapeutically effective amount of a composition comprising a
caPCNA peptide. Amino acid substitutions in one or more positions
of a caPCNA peptide improve the cytotoxic effects of caPCNA-derived
peptides. caPCNA-derived peptides, including amino acid substituted
peptides that have tags or domains that enhance cellular uptake,
increase the cytotoxic effects of the caPCNA peptides.
[0019] A method of reducing cellular proliferation of malignant
cells harboring a mutation of a DNA repair protein includes
administering a composition comprising a peptide molecule, the
peptide molecule having an amino acid sequence selected from
LGIPEQEY (SEQ ID NO: 1), LAIPEQEY (SEQ ID NO: 2), LGIAEQEY (SEQ ID
NO: 3), LGIPAQEY (SEQ ID NO: 4), LGIPEAEY (SEQ ID NO: 5), LGIPEQAY
(SEQ ID NO: 6), LGIAEAEY (SEQ ID NO: 7), LGIPEAAY (SEQ ID NO: 8),
LGIAEQAY (SEQ ID NO: 9), and LGIAEAAY (SEQ ID NO: 10). In an
embodiment, the peptide molecule is a synthetic molecule.
[0020] A method of reducing proliferation and/or inducing cell
death in a cancer cell harboring a mutation of a DNA repair protein
includes administering a composition comprising a peptide molecule,
the peptide molecule consisting essentially of an amino acid
sequence selected from LGIPEQEY (SEQ ID NO: 1), LAIPEQEY (SEQ ID
NO: 2), LGIAEQEY (SEQ ID NO: 3), LGIPAQEY (SEQ ID NO: 4), LGIPEAEY
(SEQ ID NO: 5), LGIPEQAY (SEQ ID NO: 6), LGIAEAEY (SEQ ID NO: 7),
LGIPEAAY (SEQ ID NO: 8), LGIAEQAY (SEQ ID NO: 9), and LGIAEAAY (SEQ
ID NO: 10).
[0021] In an embodiment, the caPCNA-derived peptide molecules
further include a cell permeable factor or a cell-uptake agent. For
example, the cell-permeable factor is a cell penetrating peptide
selected from amino acid sequences RRRRRRR (SEQ ID NO: 11),
RRRRRRRR (SEQ ID NO: 12), RRRRRRRRR (SEQ ID NO: 13), RRRRRRRRRR
(SEQ ID NO: 14), RRRRRRRRRRR (SEQ ID NO: 15), RQIKIWFQNRRMKWKK (SEQ
ID NO: 16), GRKKRRQRRRPPQ (SEQ ID NO: 17),
GWTLNSAGYLLGKINLKALAALAKKIL (SEQ ID NO: 18), GRKKRRQRRR (SEQ ID NO:
19) or a factor listed in Table 4. In some aspects, the cell
penetrating peptide includes one or more D-amino acids.
Illustratively, the cell penetrating peptide may comprise 1, 2, 3,
4, 5, 6, 7, 8, 9, 10, 11 or more D-Arg residues. In some aspects,
the cell penetrating peptide is covalently linked or conjugated to
the peptide molecules derived from caPCNA. In other aspects, the
cell penetrating peptide is recombinantly fused with the peptide
molecule.
[0022] In an embodiment, suitable cell surface targeting factors
may be used along with one or more of the compositions disclosed
herein. Illustrative examples of cell surface targeting factors
include HER2/neu, estrogen receptor, progesterone receptor,
epidermal growth factor receptor (EGFR), and the like.
[0023] In an embodiment, nuclear localization sequences (NLS) may
be used to transport the peptides and/or peptide variants disclosed
herein to their targets in tumor cells.
[0024] In an embodiment, the cell penetrating peptides may further
include a spacer sequence. The spacer sequence may be about 1-10 or
about 1-20 amino acids in length. Synthetic spacers are also
suitable as long as they do not interfere with the translocation of
the peptide across the cell membrane.
[0025] In an embodiment, the peptide is engineered to be protease
resistant compared to an unmodified native caPCNA-derived peptide.
In an embodiment, the peptides disclosed herein are generated as
retro-inverso isomers.
[0026] It is appreciated herein that the therapeutic compositions
may contain one or more caPCNA derived peptides and/or variants,
nuclear localization sequences, cell penetrating peptides, spacers,
or any combination thereof.
[0027] In an embodiment, the administration of a composition that
includes a caPCNA-derived translocatable peptide further includes
administration of a chemotherapeutic agent. Preferably, the
chemotherapeutic agent is a DNA damaging agent. Illustrative
examples of DNA damaging agents include doxorubicin, irinotecan,
cyclophosphamide, chlorambucil, melphalan, methotrexate,
cytarabine, fludarabine, 6-mercaptopurine, 5-fluorouracil,
capecytabine, cisplatin, carboplatin, oxaliplatin, and/or
combinations thereof. It is appreciated herein that
chemotherapeutic agent may be administered to a cancer patient
prior to, along with, or after the administration of the
composition that includes the caPCNA-derived peptides or variants
thereof. It is also appreciated that one or more chemotherapeutic
agents may be formulated together with one or more caPCNA peptides.
In an embodiment, the compositions that include the caPCNA peptides
may be delivered as a liposome. In an aspect, one or more
constituents of the pharmaceutical composition that includes
caPCNA-derived peptides may further include nanoparticles.
[0028] In an embodiment, a composition comprising caPCNA-derived
peptides is administered intravenously. It is appreciated herein
that any mode of administration, including direct delivery to
pre-malignant, cancer, or tumor cells or tissue is possible. In an
embodiment, radiotherapy may also be administered prior to or along
with or after the administration of the composition that includes
the caPCNA-derived peptides or variants thereof. Radio therapy
includes, for example, beam radiation therapy and radioisotope
therapy.
[0029] Rational drug design methodologies can also be implemented
to obtain specific inhibitors of caPCNA cellular interaction based
on the structural or sequence information of a caPCNA derived
peptide, e.g., a peptide that has an amino acid sequence LGIPEQEY
(SEQ ID NO: 1). In an embodiment, the agent is a peptide fragment
derived from an intracellular protein. In an embodiment, the
intracellular protein is known to interact with caPCNA.
[0030] A therapeutic composition for reducing in vivo cellular
proliferation of malignant cells that express a cancer specific
isoform of proliferating cell nuclear antigen (caPCNA), wherein the
cells harbor a mutation in a DNA repair protein is described. The
composition includes a peptide molecule that has an amino acid
sequence LGIPEQEY (SEQ ID NO: 1) with a cell-permeable peptide
sequence comprising a polyarginine sequence. In an embodiment, the
peptide domain that facilitates peptide uptake across cells is R9
(SEQ ID NO: 13) (nonarginine tag).
[0031] A method for reducing in vivo cellular proliferation of
malignant cells that express a cancer specific isoform of
proliferating cell nuclear antigen (caPCNA), wherein the cells
harbor a mutation of a DNA repair protein, comprises administering
a composition comprising a peptide molecule, the peptide molecule
comprising an amino acid sequence R9-LGIPEQEY (SEQ ID NO: 20) with
one or more amino acid substitutions or a functionally equivalent
structure thereof or a peptidomimetic thereof, wherein R9 is either
conjugated chemically or is part of a recombinant fusion
protein.
[0032] Other caPCNA-derived peptide inhibitors suitable for use in
the methods described herein include caPCNA peptides wherein one or
more amino acids are substituted include QLGIPEQEYSC (SEQ ID NO:
21), VEQLGIPEQEY (SEQ ID NO: 22), LGIPEQEYSCVVK (SEQ ID NO: 23),
LGIPEQEYSCVVKMPSG (SEQ ID NO: 24), EQLGIPEQEY (SEQ ID NO: 25),
QLGIPEQEY (SEQ ID NO: 26), LGIPEQEYSCVVKMPS (SEQ ID NO: 27),
LGIPEQEYSCVVKMP (SEQ ID NO: 28), LGIPEQEYSCVVKM (SEQ ID NO: 29),
LGIPEQEYSCVV (SEQ ID NO: 30), LGIPEQEYSCV (SEQ ID NO: 31),
LGIPEQEYSC (SEQ ID NO: 32), QLGIPEQEYSC (SEQ ID NO: 33), LGIPEQEYS
(SEQ ID NO: 34) that have one or more amino acid substitutions and
combinations of the additional NH.sub.2 and COOH termini amino
acids that flank LGIPEQEY (SEQ ID NO: 1) with one or more amino
acid substitutions and a cell-permeable sequence such as R9 (SEQ ID
NO: 13).
[0033] Replication defective viral expression vectors (e.g.,
lentivirus, adenovirus, adeno-associated virus, herpes virus, and
others) capable of expressing the peptides disclosed herein are
also suitable delivery systems.
BRIEF DESCRIPTION OF THE DRAWINGS
[0034] FIG. 1 illustrates a strategy behind the use of caPCNA
peptides to induce cell death in cancer cells. Mechanisms of caPCNA
peptide in inhibiting PCNA action in cells without a critical DNA
repair protein, BRCA1. caPCNA peptides are more effective in cells
lacking BRCA1. When mutated BRCA1 is present in tumors, they are
often resistant to treatment by DNA damaging agents like
chemotherapy. Loss of BRCA1 often leads to aggressive tumors;
however, the tumorcells are more sensitive to DNA damaging agents
because they lack this DNA repair protein.
[0035] FIG. 2 shows BRCA negative cells are more sensitive to the
cytotoxic action of caPCNA peptide.
[0036] FIG. 3 shows growth inhibition in HCC1937 cells lacking
BRCA1 (A) and HCC1937 cells+BRCA1 (B) after 24-hr treatment with
cisplatin or cisplatin plus R9-caPCNA peptide.
[0037] FIG. 4 shows R9-PCNA peptide lowers cisplatin dose needed
for growth inhibition in HCC1937 cells lacking BRCA1 (A) and
HCC1937 cells with BRCA1 (B) and is more effective in cells lacking
BRCA1 (A). In HCC1937 cells lacking BRCA1 (A), the IC.sub.50 value
for R9-PCNA peptide (60 .mu.M)+cisplatin is .about.20 .mu.M and the
IC.sub.50 value for cisplatin alone is .about.155 .mu.M. In HCC1937
cells with BRCA1 (B), the IC.sub.50 value for R9-PCNA peptide (60
.mu.M)+cisplatin is .about.100 .mu.M and the IC.sub.50 value for
cisplatin alone is >200 .mu.M.
[0038] FIG. 5 shows that HCC1937 cells are more sensitive to
cisplatin+caPCNA peptide combination treatment.
[0039] FIG. 6 shows summary of a 48-hr timepoint for EC50 values
involving caPCNA peptides and cisplatin for HCC+ and HCC-
cells.
DETAILED DESCRIPTION
[0040] Chemotherapeutic strategies are designed to exploit
differences between malignant versus nonmalignant cell biology with
the overall goal being selective inhibition of cancerous cells.
Since, in many cases, cancer cells rapidly proliferate in
comparison to nonmalignant cells, they also exhibit an increase in
(often erroneous) DNA repair processes. There are numerous examples
of drugs in the clinic that either induce DNA damage or inhibit DNA
damage repair processes in malignant cells.
[0041] Chemotherapeutic agents such irradiation, doxorubicin,
cisplatin, and the like can be nonspecific, resulting in
deleterious side effects in patients. Without being bound by
theory, it is believed herein that caPCNA peptides represent a
novel strategy aimed at targeting caPCNA, a cancer-associated
isoform on which malignant cells rely for DNA replication and
repair processes.
[0042] The approximate IC.sub.50s of the caPCNA peptide and its
alanine-substituted derivatives, P129A and Q131A, have been
determined in HCC1937 and HCC1937+wild-type BRCA1 breast cancer
cells. The ability of the caPCNA peptides to enhance the cytotoxic
effects of DNA damaging agents is described herein. A reduction of
the IC.sub.50 for cisplatin in the presence of caPCNA peptides is
discovered herein.
[0043] Lower doses of chemotherapeutic agents needed to kill cancer
cells (reduce toxicity to patients without compromising efficacy)
and increase sensitivity to chemotherapy in drug-resistant cells
are useful in treating various cancer types.
[0044] Methods and compositions disclosed herein relate to
caPCNA-peptide variants, peptidomimetics, functional analogs
thereof that selectively disrupt vital cellular functions in cancer
cells. There are at least two modes of actions of these peptides.
For example, caPCNA-derived peptide variants either compete with
caPCNA to bind to caPCNA-interacting proteins or alternatively bind
to a site on caPCNA-interacting protein that disrupts the
interaction.
[0045] Without being bound by theory, it is believed herein that
specific peptide variants derived from the caPCNA protein sequence
are able to block the binding of one or more cellular proteins that
participate in DNA replication, repair, cell cycle control,
apoptosis, transcription, or chromosomal recombination in cancer
cells. The binding of caPCNA to these cellular proteins is
disrupted when caPCNA derived peptides are allowed to compete with
these proteins for their naturally occurring binding site on PCNA.
By disrupting the naturally occurring interaction between PCNA and
the proteins that bind to or interact with PCNA, normal cellular
functions that recruit PCNA are disrupted. This disruption of vital
cellular machinery renders the caPCNA-derived peptide variants
cytotoxic by themselves or in combination with other molecules,
such as, for example cancer chemotherapeutic drugs. These peptides,
either alone or in combination with other cancer therapy agents,
are useful cancer chemotherapeutics or augmentors of the
pharmacodynamic effect of specific anti-cancer chemotherapeutics.
The peptide inhibitors disclosed herein sensitize tumor cells
towards chemotherapy agents that damage DNA and also render tumors
that are generally resistant to cancer drugs more responsive to
treatments.
[0046] The term "sensitize" as used herein, for therapeutic
purposes, generally refers to the ability of the peptides disclosed
herein to lower the amount of a growth inhibitory agent or a
cytotoxic agent (e.g., cisplatin, doxorubicin, and the like) needed
to kill 50% of a group of cancer cells (e.g., a tumor) within a
defined period of time (e.g., 24, 48, 72 hours).
[0047] The terms "pre-cancerous" or "pre-malignant" generally refer
to a condition which may or may not be recognizable as a
morphological change in tissue architecture that is known to be, or
thought to be, associated with the development of a cancer within
that tissue (organ). In addition, the initial molecular changes in
gene expression, (or expression of specific isoforms of proteins),
known to be associated with some percentage of cancer cells that
are found in tumor tissues, may precede readily discernable
morphological changes within the cells of these tissues undergoing
the cancer transformation process. Thus the initial changes in the
expression patterns of specific genes and/or proteins may be the
first events associated with the molecular transformation process
leading to the development of a cancer; may only be recognizable at
the molecular level, as they have not in themselves induced an
alteration in the morphology of the cells, and/or tissue, to the
extent that it can be recognized by a trained individual
(pathologist) at the light microscopic level.
[0048] The term "augment" or "augmenting" as used herein, for
therapeutic purposes, generally refers to an improvement in the
pharmacodynamic effect (referred to as the efficacy) of a
therapeutic agent. Thus, the term "augment" refers to the ability
of the peptide to raise the efficacy of a therapeutic agent (e.g.,
cisplatin, doxorubicin, and the like) leading to the killing of a
greater number of cancer cells over the same unit of time (e.g.,
24, 48, or 72 hour period) when the peptide is administered prior
to, along with, or after the therapeutic agent as compared to the
therapeutic agent alone.
[0049] Peptide variants derived from the protein Proliferating Cell
Nuclear Antigen (PCNA) are identified herein that have the ability
to act, in conjunction with DNA damaging agents (e.g., cisplatin,
doxorubicin, and the like), to enhance the therapeutic effects of
such agents to treat a variety of cancer cells. Without being bound
by theory, it is believed herein that the modes of action of
caPCNA-based peptide inhibitors and their roles in inhibiting
cancer proliferation in the presence of a DNA damaging agent is by
inhibiting the interaction between caPCNA and one or more DNA
repair proteins, thereby inhibiting the repair of damaged DNA. The
peptides are derived from the amino acid sequence within PCNA, for
example, encompassing amino acids 126-133 and include one or amino
acid mutations.
[0050] caPCNA-derived peptide variants and peptidomimetics
represent novel anti-cancer therapeutic agents and also augment or
sensitize tumor cells towards existing cancer therapies.
[0051] Without being bound by theory, it is believed that the
peptide sequences disclosed herein target a region of the caPCNA
protein that is likely to be uniquely unfolded in cancer cells.
Thus, the peptides disclosed herein are designed to selectively
target tumor cells by virtue of their ability to compete with
caPCNA for regulating the activity of specific proteins interacting
with the amino acid sequences within PCNA that are involved in at
least one of the following cellular processes: DNA replication,
repair, recombination, transcription, cell cycle checkpoint
control, and apoptosis.
[0052] The peptides disclosed herein may be synthesized using
standard peptide synthesis procedures and equipments or can be
obtained commercially (e.g., United Biochemical Research Co.,
Seattle Wash.). A caPCNA-derived peptide that includes amino acids
126-133 of the human PCNA molecule (LGIPEQEY (SEQ ID NO: 1)) having
at least one amino acid substitution, followed by a cell
penetrating peptide (CPP) sequence, e.g., a polyarginine sequence
to facilitate uptake of the peptide into cells selectively inhibits
cancer cells in vitro.
[0053] In certain embodiments involving in vitro methodologies,
uptake of caPCNA peptide variants were initiated by incubation of
this peptide with the cancer cells in the presence of dimethyl
sulfoxide (DMSO) in either phosphate buffered saline (PBS) or
culture media containing 0.2-2% DMSO, without serum for about 4-24
hours. Uptake of these peptides is also efficiently mediated by
encapsulation of the peptide in a liposome formulation and
subsequent incubation with the cancer cells at 37.degree. C. for
about 4-24 hours. These peptides also augment the cytotoxic effects
of chemotherapeutic agents such as doxorubicin, cisplatin, and the
like.
[0054] The term "agent" as used herein includes nucleic acids,
proteins, protein fragments, peptides, synthetic peptides,
peptidomimetics, analogs thereof, small molecules, inhibitors, and
any chemical, organic or bioorganic molecule capable of affecting
protein-protein interaction or a cellular process.
[0055] The terms "caPCNA peptide variants" or "peptide variants"
mean peptides whose sequences were derived from caPCNA and include
one or more mutations such as substitution mutations or deletion
mutations or amino acid analogs or a combination thereof. For
example, LGIPEQEY (SEQ ID NO: 1) representing amino acids 126-133
of PCNA is caPCNA derived sequence in which for example, amino
acids G, P, Q, and penultimate E can be substituted with an amino
acid such as alanine (A). Thus, LX.sub.1IX.sub.2EX.sub.3X.sub.4Y
(SEQ ID NO: 35) is a peptide variant wherein X.sub.1-4 can be
substituted either independently or collectively. In an embodiment,
X.sub.1 is A, X.sub.2 is P, X.sub.3 is Q, and X.sub.4 is E. In
another embodiment, X.sub.1 is G, X.sub.2 is A, X.sub.3 is Q, and
X.sub.4 is E. In another embodiment, X.sub.1 is G, X.sub.2 is P,
X.sub.3 is A, and X.sub.4 is E. In another embodiment, X.sub.1 is
G, X.sub.2 is P, X.sub.3 is Q, and X.sub.4 is A. In another
embodiment, X.sub.1 is G, X.sub.2 is A, X.sub.3 is A, and X.sub.4
is A. The "caPCNA peptide variants" or "peptide variants" can range
from about 5-10, 5-50, 7-50, 8-20, 8-25, 8-30, 8-40, 8-50 amino
acids in length. For example, the "caPCNA peptide variants" or
"peptide variants" may consist essentially of about 5, 6, 7, 8, 9,
10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, or
50 contiguous amino acids from caPCNA wherein one or more amino
acids are substituted. The "caPCNA peptide variants" or "peptide
variants" may further comprise peptide translocation domains or
sequences that enable the "caPCNA peptide variants" or "peptide
variants" to penetrate or translocate across cellular membranes.
The "caPCNA peptide variants" or "peptide variants" are also be
modified to affect their lipophilicity to enhance peptide delivery
into cancer cells. The peptides can be synthesized ("synthetic
peptides") or can also be produced through recombinant techniques
("recombinant peptides") or expressed in vivo using gene expression
techniques. These peptides can also be engineered to increase their
in vivo stability (e.g., increase peptide stability by rendering
them protease resistant) without significantly affecting their
efficacy in inhibiting caPCNA-protein interactions. Mutations
including insertions, deletions, substitutions, amino acid
modifications that substantially do not affect the inhibitory
activity of the peptides disclosed herein are within the scope.
Peptides that consist essentially of the 126-133 sequence LGIPEQEY
(SEQ ID NO: 1) having one or more mutations may include other
heterologous sequences that do not materially affect the inhibitory
function of the peptide variants disclosed herein.
[0056] The peptides disclosed herein show specificity for killing
malignant cells compared to non-cancerous cells. For example, the
peptides disclosed herein are substantially specific in which the
peptides preferentially kill malignant cancer cells more than 50%,
preferably more than 60% or 70% or 80% or 90% or 95% when compared
to non-malignant cells.
[0057] A "peptide variant" or "peptide derivative" also refers to a
molecule having an amino acid sequence of a region that is similar
to a portion of PCNA or of a PCNA homolog, but additionally having
at least one chemical modification of one or more of its amino acid
side groups, .alpha.-carbon atoms, terminal amino group, or
terminal carboxylic acid group. A chemical modification includes
additional chemical moieties, creation of new bonds, and/or removal
of chemical moieties. Modifications at amino acid side groups
include acylation of lysine, .epsilon.-amino groups, N-alkylation
of arginine, histidine, or lysine, alkylation of glutamic or
aspartic carboxylic acid groups, and deamidation of glutamine or
asparagine. Modifications of the terminal amino include the
des-amino, N-lower alkyl, N-di-lower alkyl, and N-acyl
modifications. Modifications of the terminal carboxy group include
the amide, lower alkyl amide, dialkyl amide, and lower alkyl ester
modifications. A lower alkyl is a C1-C4 alkyl. Furthermore, one or
more side groups, or terminal groups, may be protected by
protective groups known to the ordinarily-skilled protein chemist.
The .alpha.-carbon of an amino acid may be mono- or
di-methylated.
[0058] Those of skill in the art recognize that peptides may be
substantially similar to the peptides described above in that an
amino acid residue may be substituted with another amino acid
residue having a similar side chain without substantially affecting
the inhibitory functions of the peptide variants disclosed herein.
For example, a group of amino acids having aliphatic side chains is
glycine, alanine, valine, leucine, and isoleucine; a group of amino
acids having aliphatic-hydroxyl side chains is serine and
threonine; a group of amino acids having amide-containing side
chains is asparagine and glutamine; a group of amino acids having
aromatic side chains is phenylalanine, tyrosine, and tryptophan; a
group of amino acids having basic side chains is lysine, arginine,
and histidine; and a group of amino acids having sulfur-containing
side chains is cysteine and methionine. Preferred conservative
amino acid substitution groups include: valine-leucine-isoleucine,
phenylalanine-tyrosine, lysine-arginine, alanine-valine, and
asparagine-glutamine. Thus, the peptide inhibitors disclosed herein
may have one or more conservative amino acid substitutions without
substantially affecting the inhibitory functions of the
peptide.
[0059] Non-naturally occurring variants of the caPCNA-derived
peptides can readily be generated using recombinant techniques or
chemical synthesis. Such variants include, but are not limited to
deletions, additions and substitutions in the amino acid sequence
of the disclosed peptides. For example, one class of substitutions
is conserved amino acid substitution. Such substitutions are those
that substitute a given amino acid in the disclosed caPCNA-derived
peptides by another amino acid of like characteristics. Typically
accepted as conservative substitutions are the replacements, one
for another, among the aliphatic amino acids Ala, Val, Leu, and
Ile; interchange of the hydroxyl residues Ser and Thr; exchange of
the acidic residues Asp and Glu; substitution between the amide
residues Asn and Gln; exchange of the basic residues Lys and Arg;
and replacements among the aromatic residues Phe and Tyr. A list of
possible amino acid substitutions is provided in Table 5
herein.
[0060] The term "variant" refers to a peptide having an amino acid
sequence that differs to some extent from a native sequence
peptide, that is, an amino acid sequence that varies from the
native sequence by conservative amino acid substitutions, whereby
one or more amino acids are substituted by another with same
characteristics and conformational roles. The amino acid sequence
variants possess substitutions, deletions, and/or insertions at
certain positions within the amino acid sequence of the native
amino acid sequence.
[0061] The PCNA-derived peptide variants can also be fused or
otherwise linked to a ligand for a cell surface receptor that is
present in cancer cells. The ligand is optionally cleavable such
that the peptide variants (inhibitors) are targeted to a tumor
cells using a tumor-specific ligand but are cleaved by a protease
present in the tumor environment such that the peptide variants are
free to enter the tumor cells. For example, the human transferrin
receptor (hTfR), a marker for cellular proliferation is used as a
target for therapeutics and is expressed at least 100-fold more in
oral, liver, pancreatic, prostate, and other cancers (Lee et al.,
(2001) "Receptor mediated uptake of peptides that bind the human
transferrin receptor" Eur. J. Biochem., 268: 2004-2012). Peptides,
HAIYPRH (SEQ ID NO: 36) and THRPPMWSPVWP (SEQ ID NO: 37) bind
specifically hTfR and these peptides were able to target associated
macromolecule to the hTfR (Lee, supra). These peptides bind sites
that do not overlap with the native ligand, Tf, and are useful in
vivo for targeting macromolecules to the endocytic pathway in
hTfR-positive cells (Lee, supra). Such peptides can also be used to
target PCNA-derived peptides to enhance peptide delivery and also
to further enhance specific delivery.
[0062] The term "cell permeable factor" or "cell membrane carrier"
or "cell penetrating element" refers to any component, including
peptides, that enhance the ability of the peptide variants
disclosed herein to translocate the cell membrane as long as the
factor does not substantially affect the ability of the peptide
variants to inhibit caPCNA interaction. Optionally, the
cell-permeable factors operate through a non-endocytic and
non-degradative pathway in mammalian cells. These factors may
include cell penetrating peptides (CPP) or cell permeable peptides.
Illustrative examples of suitable cell-permeable peptides or
peptide domains to link or fuse caPCNA-derived peptides include
small polybasic peptides derived from the transduction domains of
certain proteins, such as polyarginine (R6-R21), the third-helix of
the Antennapedia (Antp) homeodomain, an RYIRS (SEQ ID NO: 38) tag
sequence, and those listed in Table 4 herein.
[0063] In an embodiment, the cell membrane permeable carrier is a
peptide, preferably an arginine rich peptide. (see e.g., Futaki S.
et al., (2001) "Arginine-rich peptides. An abundant source of
membrane-permeable peptides having potential as carriers for
intracellular protein delivery" J. Biol. Chem., 276, 5836). The
number of arginine residues in a cell membrane permeable carrier
peptide may contain more than 6 arginines, preferably 7, 8, 9, 10,
11, 12, 13, 14, or 15 arginine residues. The arginine residues in
an arginine rich peptide need not be contiguous. One or more of the
arginine residues may be a D-isomer of arginine. Those of skill in
the art know how to select an appropriate arginine rich peptide
with a suitable number of arginine residues.
[0064] A peptide hairpin can also be used to make use of the
increased number of extracellular proteases surrounding tumor
tissues (see U.S. patent application publication 20070041904,
incorporated herein by reference) to deliver the inhibitors
("cargo") disclosed herein. The construct includes a polyarginine
peptide covalently attached to a polyanionic segment, which would
only be substantially internalized upon proteolytic cleavage of the
anionic domain. Because the protease targeted is likely
overexpressed on cancerous cells, internalization is more likely
with the tumor cells compared to a normal cell. Cellular
association of cell-penetrating peptides (CPPs) (e.g., polyarginine
based) is blocked when they are fused to an inhibitory domain made
up of negatively charged residues. Such fusions termed as
activatable CPPs (ACPPs) because cleavage of the linker between the
polycationic and polyanionic domains, usually by a protease,
releases the CPP portion and its attached peptide of interest
("cargo") to bind to and enter cells such as tumor cells.
[0065] Pretreatment of the cell with a polycation, cationic polymer
and/or cationic peptide before transportation of the heterologous
compound into the cell is also useful (see e.g., 20060083737,
incorporated herein by reference).
[0066] Nuclear localization sequences (NLS) for example, VQRKRQKLMP
(SEQ ID NO: 39), SKKKKIKV (SEQ ID NO: 40), and GRKRKKRT (SEQ ID NO:
41) are also useful in transporting the peptide variants disclosed
herein into tumor cells. Other NLS can be obtained for example at
Nair et al., (2003), NLSdb: database of nuclear localization
signals, Nucl. Acids Res., 31:397-399 (see also
http://cubic.bioc.columbia.edu/db/NLSdb/).
[0067] In some embodiments, the peptide variants disclosed herein
are conjugated to the cell membrane permeable carrier, optionally
including a spacer. For example, a polyarginine peptide having 5-9
arginine residues may optionally include a non-arginine-based
spacer peptide or a spacer having non-standard amino acids or amino
acid analogs. The spacers generally provide additional length to
minimize for example steric hindrance to the function or transport
of the peptide variants disclosed herein. Spacers may include about
1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15 or more amino acids. Suitable
amino acids for use as spacers include, for example, glycine.
[0068] The caPCNA peptide variants and the cell-permeable peptides
are linked by chemical coupling in any suitable manner known in the
art as long as rendering the conjugated proteins are biologically
active. In an aspect, one way to increase coupling specificity is
to directly chemical couple to a functional group found only once
or a few times in one or both of the polypeptides to be
cross-linked. For example, in many proteins, cysteine, which is the
only protein amino acid containing a thiol group, occurs only a few
times. Also, for example, if a polypeptide contains no lysine
residues, a cross-linking reagent specific for primary amines will
be selective for the amino terminus of that polypeptide. Successful
utilization of this approach to increase coupling specificity
requires that the polypeptide have the suitably rare and reactive
residues in areas of the molecule that may be altered without loss
of the molecule's biological activity. Alternatively, synthetic
peptides with a modified residue can be synthesized such that
specificity of linking is enhanced.
[0069] Cysteine residues may be replaced when they occur in parts
of a polypeptide sequence where their participation in a
cross-linking reaction would otherwise likely interfere with
biological activity. When a cysteine residue is replaced, it is
typically desirable to minimize resulting changes in polypeptide
folding. Changes in polypeptide folding are minimized when the
replacement is chemically and sterically similar to cysteine. For
these reasons, serine is preferred as a replacement for cysteine.
When a cysteine residue is introduced, introduction at or near the
amino or carboxy terminus is preferred. Conventional methods are
available for such amino acid sequence modifications, whether the
polypeptide of interest is produced by chemical synthesis or
expression of recombinant DNA.
[0070] Coupling of the two constituents can be performed through a
coupling or conjugating agent. Suitable intermolecular
cross-linking reagents include for example, J-succinimidyl
3-(2-pyridyldithio) propionate (SPDP) or N,N'-(1,3-phenylene)
bismaleimide (both of which are highly specific for sulfhydryl
groups and form irreversible linkages);
N,N'-ethylene-bis-(iodoacetamide) or other such reagent having 6 to
11 carbon methylene bridges (which relatively specific for
sulfhydryl groups); and 1,5-difluoro-2,4-dinitrobenzene (which
forms irreversible linkages with amino and tyrosine groups). Other
cross-linking reagents include:
p,p'-difluoro-m,m'-dinitrodiphenylsulfon-e (which forms
irreversible cross-linkages with amino and phenolic groups);
dimethyl adipimidate (which is specific for amino groups);
phenol-1,4-disulfonylchloride (which reacts principally with amino
groups); hexamethylenediisocyanate or diisothiocyanate, or
azophenyl-p-diisocyanate (which reacts principally with amino
groups); glutaraldehyde (which reacts with several different side
chains) and disdiazobenzidine (which reacts primarily with tyrosine
and histidine).
[0071] Cross-linking reagents may be homobifunctional, i.e., two
functional groups that have the same reaction. A suitable
homobifunctional cross-linking reagent is bismaleimidohexane
("BMH"). Cross-linking reagents may also be heterobifunctional.
Heterobifunctional cross-linking agents have two different
functional groups, for example an amine-reactive group and a
thiol-reactive group, that will cross-link two proteins having free
amines and thiols, respectively. Examples of heterobifunctional
cross-linking agents are succinimidyl
4-(N-maleimidomethyl)cyclohexane-1-carboxylate ("SMCC"),
m-maleimidobenzoyl-N-hydroxysuccinimide ester ("MBS"), and
succinimide 4-(p-maleimidophenyl) butyrate ("SMPB"), an extended
chain analog of MBS. The succinimidyl group of these cross-linkers
reacts with a primary amine, and the thiol-reactive maleimide forms
a covalent bond with the thiol of a cysteine residue. A hydrophilic
moiety, such as a sulfonate group, may be added to the
cross-linking reagent to improve its water solubility. Sulfo-MBS
and sulfo-SMCC are examples of cross-linking reagents modified for
water solubility.
[0072] Many cross-linking reagents yield a conjugate that may be
non-cleavable under cellular conditions. However, some
cross-linking reagents contain a covalent bond, such as a
disulfide, that is cleavable under cellular conditions. For
example, Traut's reagent, dithiobis (succinimidylpropionate)
("DSP"), and N-succinimidyl 3-(2-pyridyldithio) propionate ("SPDP")
are well-known cleavable cross-linkers. The use of a cleavable
cross-linking reagent permits the cargo moiety to separate from the
transport polypeptide after delivery into the target cell. Direct
disulfide linkage may also be useful.
[0073] Numerous cross-linking reagents, including the ones
discussed above, are commercially available. Detailed instructions
for their use are readily available from the commercial suppliers.
A general reference on protein cross-linking and conjugate
preparation is: Wong, Chemistry of protein conjugation and
cross-linking, CRC Press (1991).
[0074] Chemical cross-linking may include the use of spacer arms.
Spacer arms provide intramolecular flexibility or adjust
intramolecular distances between conjugated moieties and thereby
may help preserve biological activity. A spacer arm may be in the
form of a polypeptide moiety that includes spacer amino acids, e.g.
proline. Alternatively, a spacer arm may be part of the
cross-linking reagent, such as in "long-chain SPDP" (Pierce Chem.
Co., Rockford, Ill., Cat. No. 21651 H).
[0075] Alternatively, the chimeric peptide can be produced as a
fusion peptide that includes the cell-permeable sequence and the
caPCNA peptide variant sequence that can be expressed in known
suitable host cells for large-scale production and purification.
Fusion peptides, as described herein, can be formed and used in
ways analogous to or readily adaptable from standard recombinant
DNA techniques, as described above.
[0076] Native peptides (in L-form) may be subject to degradation by
natural proteases, the peptides disclosed herein may be prepared to
include D-forms and/or "retro-inverso isomers" of the peptide. In
this case, retro-inverso isomers of short fragments and variants of
the peptide of caPCNA peptide variants disclosed herein are
prepared. The caPCNA peptide variants can have one or more L-amino
acids, D-amino acids, or combinations of both. For example, in
various embodiments, the peptides are D retro-inverso peptides. The
term "retro-inverso isomer" refers to an isomer of a linear peptide
in which the direction of the sequence is reversed and the
chirality of each amino acid residue is inverted. See, e.g.,
Jameson et al., Nature, 368, 744-746 (1994); Brady et al., Nature,
368, 692-693 (1994). The overall result of combining D-enantiomers
and reverse synthesis is that the positions of carbonyl and amino
groups in each amide bond are exchanged, while the position of the
side-chain groups at each alpha carbon is preserved. Unless
specifically stated otherwise, it is presumed that any given
L-amino acid sequence may be made into a D retro-inverso peptide by
synthesizing a reverse of the sequence for the corresponding native
L-amino acid sequence.
[0077] Suitable chemotherapy agents include for example,
cyclophosphamide (CYTOXAN.TM.), capecitabine (XELODA.TM.),
chlorambucil (LEUKERAN.TM.), melphalan (ALKERAN.TM.), methotrexate
(RHEUMATREX.TM.), cytarabine (CYTOSAR-U.TM.), fludarabine
(FLUDARA.TM.), 6-mercaptopurine (PURINETHOL.TM.), 5-fluorouracil
(ADRUCIL.TM.), paclitaxel (TAXOL.TM.), docetal, abraxane,
doxorubicin (ADRIAMYCIN.TM.), irinotecan (CAMPTOSAR.TM.), cisplatin
(PLATINOL.TM.), carboplatin (PARAPLATIN.TM.), oxaliplatin,
tamoxifen (NOLVADEX.TM.), bicalutamide (CASODEX.TM.), anastrozole
(ARIMIDEX.TM.), examestane, letrozole, imatinib (GLEEVEC.TM.),
rituximab (RITUXAN.TM.), trastuzumab (HERCEPTIN.TM.), gemtuzumab,
ozogamicin, interferon-alpha, tretinoin (RETIN-A.TM., AVITA.TM.,
RENOVA.TM.), arsenic trioxide, bevicizumab (AVASTIN.TM.),
bortezombi (VELCADE.TM.), cetuximab (ERBITUX.TM.), erlotinib
(TARCEVA.TM.), gefitinib (IRESSA.TM.), gemcitabine (GEMZAR.TM.),
lenalidomide (REVLIMID.TM.), Serafinib, Sunitinib (SUTENT.TM.),
panitumumab (VECTIBIX.TM.), pegaspargase (ONCASPAR.TM.), and
Tositumomab (BEXXAR.TM.) and prodrugs or precursors or combinations
thereof.
[0078] Examples of growth inhibitory agents include agents that
block cell cycle progression (at a place other than S phase), such
as agents that induce G1 arrest and M-phase arrest. Classical
M-phase blockers include the vincas (vincristine and vinblastine),
taxanes, and topoisomerase II inhibitors such as doxorubicin,
epirubicin, daunorubicin, etoposide, and bleomycin. Those agents
that arrest G1 also spill over into S-phase arrest, for example,
DNA alkylating agents such as tamoxifen, prednisone, dacarbazine,
mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and
ara-C.
[0079] In an embodiment, the dosage of chemotherapy agents, when
used in conjunction with the peptides of the disclosure, may be
lower than the dosage used for a monotherapy. For example,
doxorubicin, cisplatin, and the like, when coadministered (either
before or during or after) with caPCNA peptides described herein,
the dosage may be lowered by 25% or 35% or 50% or 60% or 75% or 80%
of the standard dose. Depending on other factors, dosage may range
from 300 mg/m.sup.2 to 500 mg/m.sup.2. Other suitable doses may be
lower e.g., 20 mg/m.sup.2, 50 mg/m.sup.2, 100 mg/m.sup.2, 150
mg/m.sup.2, or 200 m.sup.2 or higher 400 mg/m.sup.2, 450
mg/m.sup.2, 500 mg/m.sup.2, 550 mg/m.sup.2, or 600 mg/m.sup.2.
[0080] The peptides disclosed herein are also suitable for cancer
patients undergoing radiotherapy (including all forms of ionizing
radiations that are DNA damaging) and any other forms of cancer
therapy. The amount of radiation used in radiation therapy is
measured in gray (Gy), and may vary depending on the type and stage
of cancer being treated. For curative cases, a typical dose for a
solid epithelial tumor ranges from about 60 to 80 Gy, while
lymphoma tumors are treated with about 20 to 40 Gy. Preventative
(adjuvant) doses of radiation are typically around 45-60 Gy in
1.8-2 Gy fractions (e.g., for breast, head and neck cancers
respectively.) Many other factors are considered by radiation
oncologists when selecting a dose, including whether the patient is
receiving chemotherapy or any other therapy, whether radiation
therapy is being administered before or after surgery, and the
degree of success of surgery. A typical fractionation schedule for
adults is about 1.8 to 2 or to about 3 Gy per day. If the peptides
of the present invention are used in combination with radiotherapy,
then the radiation doses may reduced by, for example, 10%, 20%,
30%, 40%, 50%, 60%, and 75%. Modes of delivering radiotherapy
include for example, conventional external beam radiotherapy
(2DXRT), 3-dimensional conformal radiotherapy (3DCRT), stereotactic
radiotherapy, image-guided radiation therapy (IGRT), and
intensity-modulated radiation therapy (IMRT).
[0081] Particle therapy (Proton therapy) that uses energetic
ionizing particles (protons or carbon ions) is also suitable.
Radioisotope therapy (RIT) includes the use of radioisotopes to
target tumor tissues. Examples include At.sup.211, I.sup.131,
I.sup.125, Y.sup.90, Re.sup.186, Re.sup.188, Sm.sup.153,
Bi.sup.212, P.sup.32, Pb.sup.212 and radioactive isotopes of
Lu.
[0082] Radioimmunotherapy includes the use of biologicals such as
antibodies and a radioisotope. Ibritumomab tiuxetan (Zevalin.TM.)
is a monoclonal antibody anti-CD20 conjugated to a molecule of
Yttrium-90. Tositumomab Iodine-131 (Bexxar.TM.) is a molecule of
Iodine-131 linked to the monoclonal antibody anti-CD20.
[0083] The peptide inhibitors disclosed herein are suitable
augmenting agents that can be administered either prior to, during,
and after administering a particular cancer therapy, e.g.,
chemotherapy or radiotherapy.
[0084] A "small molecule" refers herein to have a molecular weight
below about 500 Daltons.
[0085] It is to be understood that cancers suitable for treatment
using the peptides disclosed herein include, but are not limited
to, malignancies such as various forms of glioblastoma, glioma,
astrocytoma, meningioma, neuroblastoma, retinoblastoma, melanoma,
colon carcinoma, lung carcinoma, adenocarcinoma, cervical
carcinoma, ovarian carcinoma, bladder carcinoma, lymphoblastoma,
leukemia, osteosarcoma, breast carcinoma, hepatoma, nephroma,
adrenal carcinoma, or prostate carcinoma, esophageal carcinoma. If
a malignant cell expresses a caPCNA isoform, the compositions
disclosed herein are capable of disrupting the interaction of
caPCNA isoform with one or more proteins. Metastases of cancers are
also treated by the peptide inhibitors disclosed herein. Any cell,
whether cancerous or premalignant or precancerous, if it expresses
cancer specific PCNA isoform, is suitable for reducing cellular
proliferation or chemoprevention.
[0086] Non-peptidic compounds that mimic peptide sequences are
known in the art (Meli et al. J. Med. Chem., 49:7721-7730 (2006),
that describes methods of identifying nonpeptide small molecule
mimics). Synthesis of non-peptide compounds that mimic peptide
sequences is also known in the art (see, e.g., Eldred et al. J.
Med. Chem., 37:3882, (1994); Ku et al. J. Med. Chem., 38:9, (1995);
Meli et al. J. Med. Chem., 49:7721-7730 (2006)). Such nonpeptide
compounds that mimic caPCNA-derived peptides or variants thereof
disclosed herein that bind caPCNA are contemplated by the present
invention.
[0087] The term "peptidomimetic" or "peptide mimetic" refers to a
chemical compound having small protein-like chain (peptide) that
includes non-peptidic elements such as non-natural amino acids.
Peptidomimetics are designed and synthesized with the purpose of
binding to target proteins in order to induce or effect a
particular change. Generally, a peptidomimetic functions by
mimicking or antagonizing key interactions of the parent peptide
structure that it was designed to mimic or antagonize. A
peptidomimetic normally does not have classical peptide
characteristics such as enzymatically cleavable peptidic bonds. For
a general review of the various techniques available for design and
synthesis peptide mimetics, see al-Obeidi et al., (1998), "Peptide
and peptidomimetic libraries. Molecular diversity and drug design"
Mol. Biotechnol.; 9(3):205-23; and Houben-Weyl: Synthesis of
Peptides and Peptidomemetics, Thieme Medical Publishers, 4.sup.th
edition (2003).
[0088] As used herein, the terms "peptide mimetic,"
"peptidomimetic," and "peptide analog" are used interchangeably and
refer to a synthetic chemical compound that has substantially the
same structural and/or functional characteristics of caPCNA
peptides or variants thereof disclosed herein. The mimetic can be
either entirely composed of synthetic, non-natural analogues of
amino acids, or, is a chimeric molecule of partly natural peptide
amino acids and partly non-natural analogs of amino acids. The
mimetic can also incorporate any amount of natural amino acid
conservative substitutions as long as such substitutions also do
not substantially alter the mimetic's structure and/or inhibitory
or binding activity. Routine experimentation will determine whether
a mimetic is within the scope of the disclosure, i.e., that its
structure and/or function is not substantially altered. Thus, a
mimetic composition is within the scope if it is capable of
specifically inhibiting caPCNA-mediated cellular proliferation or
cell death.
[0089] Polypeptide mimetic compositions can contain any combination
of nonnatural structural components, which are typically from three
structural groups: a) residue linkage groups other than the natural
amide bond ("peptide bond") linkages; b) non-natural residues in
place of naturally occurring amino acid residues; or c) residues
which induce secondary structural mimicry, i.e., to induce or
stabilize a secondary structure, e.g., a beta turn, gamma turn,
beta sheet, alpha helix conformation, and the like.
[0090] A polypeptide can be characterized as a mimetic when all or
some of its residues are joined by chemical means other than
natural peptide bonds. Individual peptidomimetic residues can be
joined by peptide bonds, other chemical bonds or coupling means,
such as, e.g., glutaraldehyde, N-hydroxysuccinimide esters,
bifunctional maleimides, N,N=dicyclohexylcarbodiimide (DCC) or
N,N=diisopropylcarbodiimide (DIC). Linking groups that can be an
alternative to the traditional amide bond ("peptide bond") linkages
include, e.g., ketomethylene (e.g., --C.dbd.O--CH.sub.2 for
--C.dbd.O--NH--), aminomethylene (CH.sub.2--NH), ethylene, olefin
(CH.dbd.CH), ether (--CH.sub.2--O), thioether (CH.sub.2--S),
tetrazole (CN.sub.4), thiazole, retroamide, thioamide, or ester
(see, e.g., Spatola (1983) in Chemistry and Biochemistry of Amino
Acids, Peptides and Proteins, Vol. 7, pp 267-357, A Peptide
Backbone Modifications, Marcell Dekker, NY).
[0091] A polypeptide can also be characterized as a mimetic by
containing all or some non-natural residues in place of naturally
occurring amino acid residues. Nonnatural residues are well
described in the scientific and patent literature; a few exemplary
nonnatural compositions useful as mimetics of natural amino acid
residues.
[0092] In another embodiment, peptides capable of disrupting caPCNA
interaction include peptides of amino acid sequences with one or
more amino acid substitutions that include about +3 contiguous or
non contiguous additional amino acids on the NH.sub.2 terminus of
LGIPEQEY (SEQ ID NO: 1) and about +9 contiguous or non contiguous
amino acids on the COOH terminus of LGIPEQEY (SEQ ID NO: 1). For
example, some of these peptides include amino acid sequences of
QLGIPEQEYSC (SEQ ID NO: 21) (+1--NH2 terminus, +2--COOH terminus),
VEQLGIPEQEY (SEQ ID NO: 22) (+3--NH2 terminus), LGIPEQEYSCVVK (SEQ
ID NO: 23) (+5--COOH terminus), LGIPEQEYSCVVKMPSG (SEQ ID NO: 24)
(+9--COOH terminus), EQLGIPEQEY (SEQ ID NO: 25) (+2--NH2 terminus),
QLGIPEQEY (SEQ ID NO: 26) (+1--NH2 terminus), LGIPEQEYSCVVKMPS (SEQ
ID NO: 27) (+8--COOH terminus), LGIPEQEYSCVVKMP (SEQ ID NO: 28)
(+7--COOH terminus), LGIPEQEYSCVVKM (SEQ ID NO: 29) (+6 COOH
terminus), LGIPEQEYSCVV (SEQ ID NO: 30) (+4--COOH terminus),
LGIPEQEYSCV (SEQ ID NO: 31) (+3--COOH terminus), LGIPEQEYSC (SEQ ID
NO: 32) (+2--COOH terminus), QLGIPEQEYSC (SEQ ID NO: 33) (+1--NH2
terminus, +2--COOH terminus), LGIPEQEYS (SEQ ID NO: 34) (+1--COOH
terminus) and combinations of the additional NH.sub.2 and COOH
termini amino acids that flank LGIPEQEY (SEQ ID NO: 1). Amino acid
mutations including substitutions that do not affect the
specificity of the peptides to generate csPCNA specific antibodies
are within the scope of this disclosure. One or more of the amino
acid residues in the peptides may be replaced with an amino acid
analog or an unnatural or non-standard amino acid.
[0093] Dosage of the caPCNA-derived peptide variants depend on the
efficacy of the peptides, stability of the peptides in vivo, mode
of administration, the nature of cancer being treated, body weight,
age of the patient and other factors that are commonly considered
by a skilled artisan. For example, dosage of caPCNA-derived peptide
variants drug can range from about 0.1-10.0 microgram (mcg)/kg body
weight or from about 0.2-1.0 mcg/kg body weight or from about
0.5-5.0 mcg/kg body weight or from about 10.0-50.0 mcg/kg body
weight. Depending on the toxicity effects and tumor killing
capability, the dosage can also range from about 1.0-10.0 mg/kg
body weight and from about 0.1-1.0 mg/kg body weight. The amount of
the inhibitor that is administered to the subject can and will vary
depending upon the type of inhibitor, the subject, and the
particular mode of administration. Those skilled in the art will
appreciate that dosages may also be determined with guidance from
Goodman & Goldman's The Pharmacological Basis of Therapeutics,
Ninth Edition (1996), Appendix II, pp. 1707-1711 and from Goodman
& Goldman's The Pharmacological Basis of Therapeutics, Tenth
Edition (2001), Appendix II, pp. 475-493.
[0094] Administration of the compositions disclosed herein may be
via any route known to be effective by the physician of ordinary
skill. Parenteral routes include intravenous, intramuscular,
subcutaneous, and intraperitoneal routes of administration.
Intravenous, intramuscular, and subcutaneous routes of
administration of the compositions disclosed herein are suitable.
For parenteral administration, the peptides disclosed herein can be
combined with phosphate buffered saline (PBS) or any suitable
pyrogen-free pharmaceutical grade buffer that meets FDA standard
for human subject administration. As used herein, "pharmaceutically
acceptable carrier" includes any and all solvents, diluents, or
other liquid vehicle, dispersion or suspension aids, surface active
agents, isotonic agents, thickening or emulsifying agents,
preservatives and the like, as suited to the particular dosage form
desired. Remington's Pharmaceutical Sciences, 20.sup.th Edition,
A.R. Gennaro (Williams and Wilkins, Baltimore, Md., 2000) discloses
various carriers used in formulating pharmaceutical compositions
and known techniques for the preparation thereof. Solutions or
suspensions of the compositions described herein can also include a
sterile diluent, such as water for injection, saline solution,
fixed oils, polyethylene glycols, glycerine, propyleneglycol or
other synthetic solvents; chelating agents, such as EDTA; buffers,
such as acetates, citrates or phosphates; and agents for the
adjustment of tonicity, such as sodium chloride or dextrose. A
parenteral preparation of the compositions can be enclosed in
ampoules, disposable syringes or multiple dose vials made of glass
or plastic, in accordance with standard practice in the field. The
compositions disclosed herein can be stored as a lyophilized
sterile powder in vials containing for reconstitution and the
unreconstituted product may be stored at -20.degree. C.
[0095] Agents administered parenterally, i.e., intravenously,
intramuscularly, etc., may include a sterile diluent such as water,
saline solution, a pharmaceutically acceptable polyol such as
glycerol, propylene glycol, polyethylene glycols, or other
synthetic solvents; an antibacterial and/or antifungal agent such
as benzyl alcohol, methyl paraben, chlorobutanol, phenol,
thimerosal, and the like; an antioxidant such as ascorbic acid or
sodium bisulfate; a chelating agent such as
etheylenediaminetetraacetic acid; a buffer such as acetate,
citrate, or phosphate; and/or an agent for the adjustment of
tonicity such as sodium chloride, dextrose, or a polyalcohol such
as mannitol or sorbitol. The pH of the solution may be adjusted
with acids or bases such as hydrochloric acid or sodium hydroxide.
Preparations for oral administration generally include an inert
diluent or an edible carrier. They may be include a
pharmaceutically compatible binding agent such as microcrystalline
cellulose, gum tragacanth or gelatin; an excipient such as starch
or lactose; a disintegrating agent such as alginic acid, Primogel,
or corn starch; a lubricant such as magnesium stearate or sterotes;
a glidant such as colloidal silicon dioxide; a sweetening agent
such as sucrose or saccharin; and/or a flavoring agent such as
peppermint, methyl salicylate, or citrus flavoring. Oral
preparations may be enclosed in gelatin capsules, compressed into
tablets, or prepared as a fluid carrier. For administration by
inhalation, the agent is generally delivered in the form of an
aerosol spray from a pressurized container or dispenser that
contains a suitable propellant, e.g., a gas such as carbon dioxide,
or a nebulizer. For topical (e.g., transdermal or transmucosal)
administration, penetrants appropriate to the barrier to be
permeated are generally included in the preparation. Transmucosal
administration may be accomplished through the use of nasal sprays
or suppositories, and transdermal administration may be via
ointments, salves, gels, patches, or creams as generally known in
the art.
[0096] Peptides and other compositions disclosed herein can be
administered via any suitable means. For example, the peptide
compositions may be diluted in saline or any suitable buffer and
administered directly intravenously. For example, the peptide
compositions can be encapsulated in liposomes and administered
intravenously of by any suitable method. For example, the peptide
compositions can be delivered by an extended release drug delivery
system known to one of ordinary skill in the art. Other modes of
targeting tumors are also suitable. For example, U.S. patent
application publication US20050008572 (Prokop et al.,) discloses
methods and compositions relating to nanoparticular tumor targeting
and therapy, the disclosure of which is hereby incorporated by
reference. U.S. patent application publication US20030212031 (Huang
et al.) discloses stable lipid-comprising drug delivery complexes
and methods for their production, the disclosure of which is hereby
incorporated by reference.
[0097] Replication defective viral expression vectors (e.g.,
lentivirus; adenovirus, adeno-associated virus, herpes virus, and
others) capable of expressing the peptides disclosed herein are
also suitable delivery systems. Other nucleic acid delivery systems
such as retroviral vectors, adenovirus vectors, adeno-associated
virus vectors, alphavirus vectors, Semliki Forest virus-based
vectors, Sindbis virus-based vectors are also useful, See,
Schlesinger and Dubensky (1999) Curr. Opin. Biotechnol. 5:434-439
and Ying et al. (1999) Nat. Med. 5(7):823-827.
[0098] caPCNA-derived peptides disclosed herein are expressed from
a suitable viral vector. cDNA sequence of PCNA gene is found for
example, in Travali et al., (1989), J. Biol. Chem. 264 (13),
7466-7472, incorporated by reference and also in several GenBank
entries such as for example, NM.sub.--002592 and NM.sub.--182649.
Standard cloning methods based on PCR and site-directed mutagenesis
techniques are used to engineer one or more Ala substitutions or
other conserved mutations in the coding region of caPCNA regions
for expressing the variant peptides in a cancer cell.
[0099] In addition, the term "pharmaceutically effective amount" or
"therapeutically effective amount" refers to an amount (dose)
effective in treating a patient, having, for example, breast
cancer. For example, in vitro test conditions, a suitable dose
would kill at least 50% of cancer cells. It is also to be
understood herein that a "pharmaceutically effective amount" may be
interpreted as an amount giving a desired therapeutic effect,
either taken in one dose or in any dosage or route, taken alone or
in combination with other therapeutic agents. In the case of the
present disclosure, a "pharmaceutically effective amount" may be
understood as an amount of caPCNA-derived peptide variants which
may for example, suppress (e.g., totally or partially) the
interaction of caPCNA and one or more of its interacting partners,
or reduce tumor growth, or reduce cancer cell proliferation.
[0100] Administration of caPCNA peptides induces cell death in
cancerous cells and augments the beneficial effects of
chemotherapeutics. caPCNA peptides are particularly effective in
cells harboring mutations in DNA repair proteins, for example, BRCA
1.
[0101] While the invention is susceptible to various modifications
and alternative forms, specific embodiments will herein be
described in detail. It should be understood, however, that there
is no intent to limit the invention to the particular forms
described, but on the contrary, the intention is to cover all
modifications, equivalents, and alternatives falling within the
spirit and scope of the invention.
EXAMPLES
Example
[0102] The cytotoxic effects of cell-permeable caPCNA-derived
peptide variants on breast cancer cells harboring BRCA1 mutations
were examined. caPCNA peptides are discovered herein to be
effective in cancer cells harboring mutations in DNA repair
proteins. Inhibiting DNA repair proteins represents a viable target
for anti-cancer therapy. For example, inhibitors of a DNA repair
protein Poly (ADP-ribose) polymerase family, member I, (PARP1) are
used as anti-cancer therapeutic agents. caPCNA peptides that
selectively interact with caPCNA isoform in malignant or
pre-malignant cells are useful either as a monotherapy or a
combination therapy with one or more chemotherapy agents such as
cisplatin.
[0103] Breast cancer cells were obtained from a patient harboring a
hereditary mutation in BRCA1, a major component of DNA double
strand break repair (HCC1937 cells). HCC1937 is a near-tetraploid
cell line from mammary gland whose cells are homozygous for a
frameshift mutation in BRCA1. The cell line is available at
ATCC.
[0104] As a genetically matched control, wild-type BRCA1 has been
transduced into HCC1937 cells (referred to as HCC1937+wild-type
BRCA1). HCC1937+wild-type BRCA1 cells were selected for maintenance
of the vector using 1 .mu.g/mL puromycin. All cells in these assays
were used at passage numbers <25.
[0105] MTT [3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium
bromide] assays were conducted with caPCNA peptides at a variety of
time points both alone and in combination with a DNA damaging agent
e.g., cisplatin in HCC1937 and HCC1937+wild-type BRCA1 cells. The
MTT assay is based on the ability of a mitochondrial dehydrogenase
enzyme from viable cells to cleave the tetrazolium rings of the
pale yellow MTT dye and form dark blue formazan crystals. These
formazan crystals are largely impermeable to cell membranes and
thus accumulate within healthy cells. Solubilization of the cells
by the addition of a detergent results in the liberation and
solubilization of the crystals. The number of proliferating cells
is directly proportional to the level of formazan product created.
The color can then be quantified using a simple colorimetric assay.
The results are read on a multiwall scanning spectrophotometer
(ELISA reader). The peptides used in these experiments including
caPCNA peptide, Q131A (LGIPEAEY (SEQ ID NO: 5)), and P129A
(LGIAEQEY (SEQ ID NO: 3)) were ordered and obtained from Anaspec
(Fremont, Calif.). ca PCNA peptide was dissolved in sterile
1.times.PBS solution to create a 1.5 mM stock concentration. caPCNA
peptides with alanine substitutions (e.g., P129A (SEQ ID NO: 3) and
Q131A (SEQ ID NO: 5)) were dissolved in sterile 1.times.PBS
solution to create 1.0 mM stock solutions.
[0106] Cisplatin powder was dissolved in sterile 1.times.PBS to
create a 3.3 mM stock solution. The stock peptide and cisplatin
solutions were sterile filtered using a 0.2 .mu.M filter,
aliquoted, and stored at -20.degree. C. until use in the MTT
experiments.
[0107] MTT assays: The efficacy of caPCNA peptides (caPeptides)
were tested using the MTT assays: HCC1937 and HCC137+wildtype BRCA1
cells were grown in DMEM 1.times. (supplemented with 10% fetal
bovine serum and 5% penicillin/streptomycin) and were plated at a
densities of 5.5.times.10.sup.3 or 7.times.10.sup.3, respectively,
in 96 well plates (100 .mu.L total volume per well) and allowed to
attach overnight in a 37.degree. C. incubator (5% CO.sub.2). Then,
caPCNA peptide stock solution was diluted to final working
concentrations in DMEM 1.times. (10% fetal bovine serum and 5%
penicillin/streptomycin) of 150 .mu.M, 100 .mu.M, 75 .mu.M, 50 and
25 .mu.M. Media was removed from cells and replaced with media
containing caPCNA peptide at various concentrations (200 .mu.L
total volume per well). Cells were cultured with caPCNA
peptide-containing media for 24, 48 or 72 hours. At the appropriate
treatment timepoint, 20 .mu.L MTT (5 mg/mL in PBS) reagent was
added to each well and plates were incubated for an additional 4
hours. Media/dye solution was then aspirated and 200 .mu.L DMSO was
added to each well. Plates were rocked at room temperature for five
minutes to dissolve crystals and transferred to an ELISA plate
reader. Absorbance was measured at 550 nm. The extent to which
caPeptides inhibited cell proliferation was calculated as a
percentage of the absorbance in each well containing caPCNA peptide
relative to wells containing no caPCNA peptide (negative control)
for both HCC1937 and HCC1937+wild-type BRCA1 cells.
[0108] The negative control wells were assigned a value of 100%.
The data were derived from a total of 3 experiments done at 24 and
48 hour timepoints and two experiments done at the 72 hour
timepoint. The data shown here are representative of results
obtained in each cell line at these timepoints.
[0109] Efficacy of P129A (SEQ ID NO: 3) and Q131A (SEQ ID NO: 5)
caPCNA peptides: Cells were cultured and plated in 96 well plates
as described herein. P129A (SEQ ID NO: 3) or Q131A (SEQ ID NO: 5)
stock solution was diluted to final working concentrations in DMEM
1.times. (10% fetal bovine serum and 5% penicillin/streptomycin) of
100 .mu.M, 75 .mu.M, 50 .mu.M, 25 .mu.M, and 12.5 .mu.M. Media was
removed from cells and replaced with media containing P129A (SEQ ID
NO: 3) or Q131A (SEQ ID NO: 5) caPCNA peptides at various
concentrations (200 .mu.L total volume per well) and cells were
cultured with peptide-containing media for 24 hours. After 24
hours, the MTT assay was completed and data analysis was performed
as described herein.
[0110] Results: HCC1937 cells show a trend of increased sensitivity
to caPCNA peptides at 24, 48, and 72 hour treatment timepoints in
comparison to HCC1937+wild-type BRCA1 cells (FIGS. 2A-B).
caPeptides with alanine substitutions at particular amino acid
residues (P129A (SEQ ID NO: 3) and Q131A (SEQ ID NO: 5)) show
enhanced efficacy in comparison to wild-type peptides, and Q131A
appears to be more effective of these peptides tested.
[0111] CaPCNA peptide treatment inhibits colony formation in both
HCC1937 and HCCI937+wild-type BRCA1 cells. This effect is more
pronounced in HCC1937 cells lacking the wildtype BRCA1. These data
suggest that peptides derived against a cancer-associated epitope
of PCNA have anticancer uses, and are particularly effective in
treatment of cancers harboring mutations in DNA repair proteins. In
addition, these peptides are capable of acting synergistically
(i.e., synergistic inhibition of tumor cells) with DNA damaging
chemotherapeutics, for example, cisplatin and the like, to reduce
the IC50 of these chemotherapeutic agents. caPCNA peptides
therefore may reduce toxicity to patients without compromising
treatment efficacy.
Example
[0112] The efficacy of caPCNA peptides used in combination with
cisplatin on breast cancer cells harboring BRCA1 mutations was
examined. The purpose of these experiments was to determine whether
caPCNA peptides at a fixed concentration could lower the IC50 of
cisplatin in HCC1937 and HCC1937+wild-type BRCA1 cells. Cells were
cultured and plated in 96 well plates as described herein. Then,
cisplatin stock solution was diluted to final working
concentrations in DMEM 1.times. (10% fetal bovine serum and 5%
penicillin/streptomycin) of 200 .mu.M, 100 .mu.M, 75 .mu.M, 50
.mu.M, 25 .mu.M, and 12.5 .mu.M. caPCNA peptide stock solution was
diluted to final working concentrations in DMEM 1.times. (10% fetal
bovine serum and 5% penicillin/streptomycin) of 60 .mu.M or 25 uM.
Media was removed from cells and replaced with media containing
cisplatin alone, cisplatin and 60 .mu.M caPCNA peptide added
simultaneously, or 25 .mu.M caPCNA peptide (pretreatment) followed
by addition of cisplatin into the media at increasing
concentrations after 3 or 6 hours. Cells treated with cisplatin
alone or cisplatin plus 60 .mu.M caPCNA peptide treatment were
incubated with peptide and/or cisplatin containing media for both
24 and 48 hour timepoints. Cells treated with 25 .mu.M caPCNA
peptide pretreatment plus cisplatin were incubated with media
containing caPCNA peptide and cisplatin for 24 hours. At the
appropriate treatment timepoint, the MTT assay was completed and
data analysis was performed as described herein. The data detailing
the effects of cisplatin on these cell lines were derived from
multiple experiments. The data showing the effects of cisplatin in
combination with 60 .mu.M of caPCNA peptide and cisplatin and 25
.mu.M caPCNA peptide pretreatment was experimentally verified.
[0113] Clonogeizic survival assay: Clonogenic survival after caPCNA
peptide treatment: The purpose of this experiment was to determine
the effects of high caPCNA peptide treatment (100 .mu.M caPCNA
peptide for 48 hours) on ability of cells plated at low density to
proliferate and form colonies. HCC1937 and HCC1937+wild-type BRCA1
cells were plated in 6-well plates and allowed to attach overnight
at 37.degree. C.
[0114] Then, media was removed and replaced with 100 .mu.M caPCNA
peptide in DMEM 1.times. (10% fetal bovine serum and 5%
penicillin/streptomycin). Untreated cells were used as a negative
control. Plates were incubated with media containing peptide for 48
hours. Live cells were then collected, counted, plated at low
density (1.times.10 cells in 10 cm2 dishes) and allowed to grow in
DMEM 1.times. (20% fetal bovine serum, 5% penicillin/streptomycin)
for 13 days. After 13-day incubation, media was removed and plates
were washed twice with 1.times.PBS. Cells were fixed with 70% EtOH
for 10 minutes, dried, and stained for 1 hour with 20% Giemsa
diluted in MilliQ water. Dye was removed; plates were rinsed, dried
overnight and photographed. Images shown are representative of
results obtained for treated and untreated HCC1937 and
HCC1937+wild-type BRCA1 cells.
[0115] HCC1937 and HCC1937+wild-type BRCA1 cells are relatively
resistant to the effects of cisplatin (FIG. 3A, 3B). 60 .mu.M
caPCNA peptide added simultaneously with cisplatin treatment
lowered the IC50 of cisplatin and this effect was more pronounced
in HCC1937 cells lacking wild-type BRCA1 (FIGS. 4A-B)
[0116] Therefore, the caPCNA-derived peptides or the variants
disclosed herein present a viable chemopreventative option to
reduce the overall occurrence of cancer in tissue types that are
likely to express caPCNA isoform at an early stage. A practitioner
or a clinician can readily determine if the individual or a tissue
biopsy expresses caPCNA by using a caPCNA-specific detection method
e.g., caPCNA-specific antibodies disclosed in international patent
application publication WO2006/116631 or based on caPCNA isoform
post-translational modifications disclosed in international patent
application publication WO 2007/002574, the contents of both the
publications are herein incorporated by reference in their
entirety.
TABLE-US-00001 TABLE 1 Exemplary caPCNA peptide domains containing
the amino acid 126- 133 region. PCNA Sequence 111-125 (SEQ ID NO:
42) LVFEAPNQEK VSDYEMKLMD LDVEQLGIPEQEYSCVVKMP SGEFARICRD
LSHIGDAVVI SCAKDGVKFS ASGELGNGNI KLSQTSNVDK EEEAVTIEMN (SEQ ID NO:
43) PCNA Sequence 118-135 (SEQ ID NO: 44) LVFEAPNQEK VSDYEMKLMD
LDVEQLGIPEQEYSCVVKMP SGEFARICRD LSHIGDAVVI SCAKDGVKFS ASGELGNGNI
KLSQTSNVDK EEEAVTIEMN (SEQ ID NO: 43) PCNA Sequence 121-133 (SEQ ID
NO: 45) LVFEAPNQEK VSDYEMKLMD LDVEQLGIPEQEYSCVVKMP SGEFARICRD
LSHIGDAVVI SCAKDGVKFS ASGELGNGNI KLSQTSNVDK EEEAVTIEMN (SEQ ID NO:
43) PCNA Sequence 126-133 (SEQ ID NO: 1) LVFEAPNQEK VSDYEMKLMD
LDVEQLGIPEQEYSCVVKMP SGEFARICRD LSHIGDAVVI SCAKDGVKFS ASGELGNGNI
KLSQTSNVDK EEEAVTIEMN (SEQ ID NO: 43) PCNA Sequence 126-143 (SEQ ID
NO: 46) LVFEAPNQEK VSDYEMKLMD LDVEQLGIPEQEYSCVVKMP SGEFARICRD
LSHIGDAVVI SCAKDGVKFS ASGELGNGNI KLSQTSNVDK EEEAVTIEMN (SEQ ID NO:
43) PCNA Sequence 126-153 (SEQ ID NO: 47) LVFEAPNQEK VSDYEMKLMD
LDVEQLGIPEQEYSCVVKMP SGEFARICRD LSHIGDAVVI SCAKDGVKFS ASGELGNGNI
KLSQTSNVDK EEEAVTIEMN (SEQ ID NO: 43) PCNA Sequence 126-163 (SEQ ID
NO: 48) LVFEAPNQEK VSDYEMKLMD LDVEQLGIPEQEYSCVVKMP SGEFARICRD
LSHIGDAVVI SCAKDGVKFS ASGELGNGNI KLSQTSNVDK EEEAVTIEMN (SEQ ID NO:
43) The regions containing the 126-133 sequence are shown as
underlined.
TABLE-US-00002 TABLE 2 Amino acid sequences of R9-lined
caPCNA-derived peptides. Name Sequence R9 Alone RRRRRRRRR (SEQ ID
NO: 13) caPeptide LGIPEQEY (SEQ ID NO: 1) R9-caPep
RRRRRRRRRCCLGIPEQEY (SEQ ID NO: 49) R9-L126A RRRRRRRRRCCAGIPEQEY
(SEQ ID NO: 50) R9-L127A RRRRRRRRRCCLAIPEQEY (SEQ ID NO: 51)
R9-L128A RRRRRRRRRCCLGAPEQEY (SEQ ID NO: 52) R9-L129A
RRRRRRRRRCCLGIAEQEY (SEQ ID NO: 53) R9-L130A RRRRRRRRRCCLGIPAQEY
(SEQ ID NO: 54) R9-L131A RRRRRRRRRCCLGIPEAEY (SEQ ID NO: 55)
R9-L132A RRRRRRRRRCCLGIPEQAY (SEQ ID NO: 56) R9-L133A
RRRRRRRRRCCLGIPEQEA (SEQ ID NO: 57) FITC-R9-
FITC-RRRRRRRRRCCLGIPEQEY (SEQ ID NO: 49) caPep
TABLE-US-00003 TABLE 3 Cytotoxic effects of R9-linked caPCNA
peptides. Arginine-linked caPCNA peptide and the Peptide
designation respective alanine substitutions % cancer 126-133
peptide 126- L G I P E Q E Y -133 cell death Unsub. Peptide R9- 1 2
3 4 5 6 7 8 43 .+-. 10 (SEQ ID NO: 58) A1-sub. Peptide R9- A 2 3 4
5 6 7 8 8 .+-. 9 (SEQ ID NO: 59) A2-sub. Peptide R9- 1 A 3 4 5 6 7
8 47 .+-. 13 (SEQ ID NO: 60) A3-sub. Peptide R9- 1 2 A 4 5 6 7 8 21
.+-. 12 (SEQ ID NO: 61) A4-sub. Peptide R9- 1 2 3 A 5 6 7 8 80 .+-.
7 (SEQ ID NO: 62) A5-sub. Peptide R9- 1 2 3 4 A 6 7 8 45 .+-. 14
(SEQ ID NO: 63) A6-sub. Peptide R9- 1 2 3 4 5 A 7 8 93 .+-. 7 (SEQ
ID NO: 64) A7-sub. Peptide R9- 1 2 3 4 5 6 A 8 88 .+-. 4 (SEQ ID
NO: 65) A8-sub. Peptide R9- 1 2 3 4 5 6 7 A 7 .+-. 6 (SEQ ID NO:
66) Negative control Scrambled peptide 5 .+-. 4
R9 refers to a cell penetrating peptide that includes a
polyarginine sequence e.g., nine contiguous arginine residues.
Alanine substitutions in the caPCNA peptide affect its cytotoxic
action. U937 cells were treated with each alanine substituted
peptide and the scrambled peptide and % cell death evaluated by
flow cytometry. The scrambled peptide and alanine substitutions at
positions aa126 or aa133 show reduced cytotoxic activity.
Substitutions at aa129, aa131, or aa132 cause an increase in
cytotoxicity of the peptide. Substitutions that result in a neutral
change include aa127 and aa130. Substitution at aa128 results in a
decrease in cytotoxic action but not to the levels of aa126 or
aa133.
TABLE-US-00004 TABLE 4 Cell permeable or cell-penetrating peptides
References (each is incorporated by reference Name Peptide sequence
in its entirety) R9 RRRRRRRRR (SEQ ID NO: 13) Penetratin .TM.
RQIKIWFQNRRMKWKK (SEQ ID NO: 16) U.S. Pat. No. 5,888,762 Tat
GRKKRRQRRRPPQ (SEQ ID NO: 17) U.S. Pat. Nos. 5,804,604 and
5,674,980 TAT (47-57) YGRKKRRQRRR (SEQ ID NO: 67) Wender, PA. et
al. Proc. Natl. Acad. Sci. USA 97, 13003 (2000) Tat (48-57)
GRKKRRQRRR (SEQ ID NO: 19) Hottiger, M. and G. Nabel, J. Virol. 72,
8252 (1998). Tat (Npys) YGRKKRRQRRRGGG-C(Npys)-NH2 (SEQ ID NO: 68)
Transportan .TM. GWTLNSAGYLLGKINLKALAALAKKIL (SEQ ID NO: 18) VP22
DAATATRGRSAASRPTERPRAPARSASRPRRPVD WO 97/05265 (SEQ ID NO: 69) MAP
KLALKLALKALKAALKLA (SEQ ID NO: 70) KALA
WEAKLAKALAKALAKHLAKALAKALKACEA (SEQ ID NO: 71) ppTG20
GLFRALLRLLRSLWRLLLRA (SEQ ID NO: 72) Trimer VRLPPP (SEQ ID NO: 73)
P1 MGLGLHLLVLAAALQGAWSQPKKKRKV (SEQ ID NO: 74) MPG
GALFLGFLGAAGSTMGAWSQPKKKRKV (SEQ ID NO: 75) Pep-1
KETWWETWWTEWSQPKKKRKV (SEQ ID NO: Fischer, R. et 76) al. Chem. Bio.
Chem. 6, 2126 (2005). hCT LGTYTQDFNKFHTFPQTAIGVGAP (SEQ ID NO: 77)
C105Y CSIPPEVKFNKPFVYLI (SEQ ID NO: 78) Rhee and Davis, (2006) J.
Biol. Chem. 281, 1233 105Y SIPPEVKFNKPFVYLI (SEQ ID NO: 79) Boland,
K. et al. J. Biol. Chem. 270, 28022 (1995) Lipid KKAAAVLLPVLLAAP
(SEQ ID NO: 80) and its D- Membrane isomer Translocating Peptide
Nuclear PKKKRKV (SEQ ID NO: 81) localization RVG
YTIWMPENPRPGTPCDIFTNSRGKRASNGGGG Kumar, P. et (SEQ ID NO: 82) al.
Nature 448, 39 (2007). Transdermal ACSSSPSKHCG (SEQ ID NO: 83)
Chen, Y. et al. Peptide Nat. Biotechnol. 24, 455 (2006).
Antennapedia KKWKMRRNQFWVKVQRG (SEQ ID NO: 84) Kanovsky, M. Leader
et al. Proc. Peptide (CT) Natl. Acad. Sci. 98, 12438 (2001).
Antennapedia RQIKIWFQNRRMKWKK (SEQ ID NO: 85) Jain, M. et al.
Peptide Cancer Res. 65, 7840 (2005). SynB1 RGGRLSYSRRRFSTSTGRA (SEQ
ID NO: 86) The peptides listed above can be synthesized or are
commercially available (e.g., AnaSpec, San Jose, CA) with an
NH.sub.2 moiety for coupling with the peptide variants disclosed
herein.
TABLE-US-00005 TABLE 5 List of exemplary amino acid conserved
substitutions Amino Acid Code Conserved Substitutions Alanine A
D-Ala, Gly, beta-Ala, L-Cys, D-Cys Arginine R D-Arg, Lys, D-Lys,
homo-Arg, D-homo-Arg, Met, Ile, D-Met, D-Ile, Orn, D-Orn Asparagine
N D-Asn, Asp, D-Asp, Glu, D-Glu, Gln, D-Gln Aspartic Acid D D-Asp,
D-Asn, Asn, Glu, D-Glu, Gln, D-Gln Cysteine C D-Cys, S--Me-Cys,
Met, D-Met, Thr, D-Thr Glutamine Q D-Gln, Asn, D-Asn, Glu, D-Glu,
Asp, D-Asp Glutamic Acid E D-Glu, D-Asp, Asp, Asn, D-Asn, Gln,
D-Gln Glycine G Ala, D-Ala, Pro, D-Pro, .beta.-Ala, Acp Isoleucine
I D-Ille, Val, D-Val, Leu, D-Leu, Met, D-Met Leucine L D-Leu, Val,
D-Val, Met, D-Met Lysine K D-Lys, Arg, D-Arg, homo-Arg, D-homo-Arg,
Met, D-Met, Ile, D-Ile, Orn, D-Orn Methionine M D-Met, S--Me-Cys,
Ile, D-Ile, Leu, D-Leu, Val, D-Val Phenylalanine F D-Phe, Tyr,
D-Thr, L-Dopa, His, D-His, Trp, D-Trp, Trans-3,4, or
5-phenylproline, cis-3,4 or 5-phenylproline Proline P D-Pro,
L-1-thioazolidine-4-carboxylic acid, D- or
L-1-oxazolidine-4-carboxylic acid Serine S De-Ser, Thr, D-Thr,
allo-Thr, Met, D-Met, Met(O), D-Met(O), L-Cys, D-Cys Threonine T
D-Thr, Ser, D-Ser, allo-Thr, Met, D-Met, Met(O), D-Met(O), Val,
D-Val Tyrosine Y D-Tyr, Phe, D-Phe, L-Dopa, His, D-His Valine V
D-Val, Leu, D-Leu, Lle, D-Lle, Met, D-Met
TABLE-US-00006 TABLE 6 Preferential killing of cancer cells by
R9-caPeptide Cell line % Dead Cells MCF 10A (non-malignant) 18.2
MCF 7 (breast cancer) 91.5
Sequence CWU 1
1
8618PRTArtificial SequenceSynthetic Peptide 1Leu Gly Ile Pro Glu
Gln Glu Tyr1 528PRTArtificial SequenceSynthetic Peptide 2Leu Ala
Ile Pro Glu Gln Glu Tyr1 538PRTArtificial SequenceSynthetic Peptide
3Leu Gly Ile Ala Glu Gln Glu Tyr1 548PRTArtificial
SequenceSynthetic Peptide 4Leu Gly Ile Pro Ala Gln Glu Tyr1
558PRTArtificial SequenceSynthetic Peptide 5Leu Gly Ile Pro Glu Ala
Glu Tyr1 568PRTArtificial SequenceSynthetic Peptide 6Leu Gly Ile
Pro Glu Gln Ala Tyr1 578PRTArtificial SequenceSynthetic Peptide
7Leu Gly Ile Ala Glu Ala Glu Tyr1 588PRTArtificial
SequenceSynthetic Peptide 8Leu Gly Ile Pro Glu Ala Ala Tyr1
598PRTArtificial SequenceSynthetic Peptide 9Leu Gly Ile Ala Glu Gln
Ala Tyr1 5108PRTArtificial SequenceSynthetic Peptide 10Leu Gly Ile
Ala Glu Ala Ala Tyr1 5117PRTArtificial SequenceSynthetic Peptide
11Arg Arg Arg Arg Arg Arg Arg1 5128PRTArtificial SequenceSynthetic
Peptide 12Arg Arg Arg Arg Arg Arg Arg Arg1 5139PRTArtificial
SequenceSynthetic Peptide 13Arg Arg Arg Arg Arg Arg Arg Arg Arg1
51410PRTArtificial SequenceSynthetic Peptide 14Arg Arg Arg Arg Arg
Arg Arg Arg Arg Arg1 5 101511PRTArtificial SequenceSynthetic
Peptide 15Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg1 5
101616PRTArtificial SequenceSynthetic Peptide 16Arg Gln Ile Lys Ile
Trp Phe Gln Asn Arg Arg Met Lys Trp Lys Lys1 5 10
151713PRTArtificial SequenceSynthetic Peptide 17Gly Arg Lys Lys Arg
Arg Gln Arg Arg Arg Pro Pro Gln1 5 101827PRTArtificial
SequenceSynthetic Peptide 18Gly Trp Thr Leu Asn Ser Ala Gly Tyr Leu
Leu Gly Lys Ile Asn Leu1 5 10 15Lys Ala Leu Ala Ala Leu Ala Lys Lys
Ile Leu 20 251910PRTArtificial SequenceSynthetic Peptide 19Gly Arg
Lys Lys Arg Arg Gln Arg Arg Arg1 5 102017PRTArtificial
SequenceSynthetic Peptide 20Arg Arg Arg Arg Arg Arg Arg Arg Arg Leu
Gly Ile Pro Glu Gln Glu1 5 10 15Tyr2111PRTArtificial
SequenceSynthetic Peptide 21Gln Leu Gly Ile Pro Glu Gln Glu Tyr Ser
Cys1 5 102211PRTArtificial SequenceSynthetic Peptide 22Val Glu Gln
Leu Gly Ile Pro Glu Gln Glu Tyr1 5 102313PRTArtificial
SequenceSynthetic Peptide 23Leu Gly Ile Pro Glu Gln Glu Tyr Ser Cys
Val Val Lys1 5 102417PRTArtificial SequenceSynthetic Peptide 24Leu
Gly Ile Pro Glu Gln Glu Tyr Ser Cys Val Val Lys Met Pro Ser1 5 10
15Gly2510PRTArtificial SequenceSynthetic Peptide 25Glu Gln Leu Gly
Ile Pro Glu Gln Glu Tyr1 5 10269PRTArtificial SequenceSynthetic
Peptide 26Gln Leu Gly Ile Pro Glu Gln Glu Tyr1 52716PRTArtificial
SequenceSynthetic Peptide 27Leu Gly Ile Pro Glu Gln Glu Tyr Ser Cys
Val Val Lys Met Pro Ser1 5 10 152815PRTArtificial SequenceSynthetic
Peptide 28Leu Gly Ile Pro Glu Gln Glu Tyr Ser Cys Val Val Lys Met
Pro1 5 10 152914PRTArtificial SequenceSynthetic Peptide 29Leu Gly
Ile Pro Glu Gln Glu Tyr Ser Cys Val Val Lys Met1 5
103012PRTArtificial SequenceSynthetic Peptide 30Leu Gly Ile Pro Glu
Gln Glu Tyr Ser Cys Val Val1 5 103111PRTArtificial
SequenceSynthetic Peptide 31Leu Gly Ile Pro Glu Gln Glu Tyr Ser Cys
Val1 5 103210PRTArtificial SequenceSynthetic Peptide 32Leu Gly Ile
Pro Glu Gln Glu Tyr Ser Cys1 5 103311PRTArtificial
SequenceSynthetic Peptide 33Gln Leu Gly Ile Pro Glu Gln Glu Tyr Ser
Cys1 5 10349PRTArtificial SequenceSynthetic Peptide 34Leu Gly Ile
Pro Glu Gln Glu Tyr Ser1 5358PRTArtificial SequenceSynthetic
peptide 35Leu Xaa Ile Xaa Glu Xaa Xaa Tyr1 5367PRTArtificial
SequenceSynthetic Peptide 36His Ala Ile Tyr Pro Arg His1
53712PRTArtificial SequenceSynthetic Peptide 37Thr His Arg Pro Pro
Met Trp Ser Pro Val Trp Pro1 5 10385PRTArtificial SequenceSynthetic
Peptide 38Arg Tyr Ile Arg Ser1 53910PRTArtificial SequenceSynthetic
Peptide 39Val Gln Arg Lys Arg Gln Lys Leu Met Pro1 5
10408PRTArtificial SequenceSynthetic Peptide 40Ser Lys Lys Lys Lys
Ile Lys Val1 5418PRTArtificial SequenceSynthetic Peptide 41Gly Arg
Lys Arg Lys Lys Arg Thr1 54215PRTArtificial SequenceSynthetic
Peptide 42Val Ser Asp Tyr Glu Met Lys Leu Met Asp Leu Asp Val Glu
Gln1 5 10 1543100PRTArtificial SequenceSynthetic Peptide 43Leu Val
Phe Glu Ala Pro Asn Gln Glu Lys Val Ser Asp Tyr Glu Met1 5 10 15Lys
Leu Met Asp Leu Asp Val Glu Gln Leu Gly Ile Pro Glu Gln Glu 20 25
30Tyr Ser Cys Val Val Lys Met Pro Ser Gly Glu Phe Ala Arg Ile Cys
35 40 45Arg Asp Leu Ser His Ile Gly Asp Ala Val Val Ile Ser Cys Ala
Lys 50 55 60Asp Gly Val Lys Phe Ser Ala Ser Gly Glu Leu Gly Asn Gly
Asn Ile65 70 75 80Lys Leu Ser Gln Thr Ser Asn Val Asp Lys Glu Glu
Glu Ala Val Thr 85 90 95Ile Glu Met Asn 1004418PRTArtificial
SequenceSynthetic Peptide 44Leu Met Asp Leu Asp Val Glu Gln Leu Gly
Ile Pro Glu Gln Glu Tyr1 5 10 15Ser Cys4512PRTArtificial
SequenceSynthetic Peptide 45Asp Val Glu Gln Leu Gly Ile Pro Glu Gln
Glu Tyr1 5 104618PRTArtificial SequenceSynthetic Peptide 46Leu Gly
Ile Pro Glu Gln Glu Tyr Ser Cys Val Val Lys Met Pro Ser1 5 10 15Gly
Glu4728PRTArtificial SequenceSynthetic Peptide 47Leu Gly Ile Pro
Glu Gln Glu Tyr Ser Cys Val Val Lys Met Pro Ser1 5 10 15Gly Glu Phe
Ala Arg Ile Cys Arg Asp Leu Ser His 20 254838PRTArtificial
SequenceSynthetic Peptide 48Leu Gly Ile Pro Glu Gln Glu Tyr Ser Cys
Val Val Lys Met Pro Ser1 5 10 15Gly Glu Phe Ala Arg Ile Cys Arg Asp
Leu Ser His Ile Gly Asp Ala 20 25 30Val Val Ile Ser Cys Ala
354919PRTArtificial SequenceSynthetic Peptide 49Arg Arg Arg Arg Arg
Arg Arg Arg Arg Cys Cys Leu Gly Ile Pro Glu1 5 10 15Gln Glu
Tyr5019PRTArtificial SequenceSynthetic Peptide 50Arg Arg Arg Arg
Arg Arg Arg Arg Arg Cys Cys Ala Gly Ile Pro Glu1 5 10 15Gln Glu
Tyr5119PRTArtificial SequenceSynthetic Peptide 51Arg Arg Arg Arg
Arg Arg Arg Arg Arg Cys Cys Leu Ala Ile Pro Glu1 5 10 15Gln Glu
Tyr5219PRTArtificial SequenceSynthetic Peptide 52Arg Arg Arg Arg
Arg Arg Arg Arg Arg Cys Cys Leu Gly Ala Pro Glu1 5 10 15Gln Glu
Tyr5319PRTArtificial SequenceSynthetic Peptide 53Arg Arg Arg Arg
Arg Arg Arg Arg Arg Cys Cys Leu Gly Ile Ala Glu1 5 10 15Gln Glu
Tyr5419PRTArtificial SequenceSynthetic Peptide 54Arg Arg Arg Arg
Arg Arg Arg Arg Arg Cys Cys Leu Gly Ile Pro Ala1 5 10 15Gln Glu
Tyr5519PRTArtificial SequenceSynthetic Peptide 55Arg Arg Arg Arg
Arg Arg Arg Arg Arg Cys Cys Leu Gly Ile Pro Glu1 5 10 15Ala Glu
Tyr5619PRTArtificial SequenceSynthetic Peptide 56Arg Arg Arg Arg
Arg Arg Arg Arg Arg Cys Cys Leu Gly Ile Pro Glu1 5 10 15Gln Ala
Tyr5719PRTArtificial SequenceSynthetic Peptide 57Arg Arg Arg Arg
Arg Arg Arg Arg Arg Cys Cys Leu Gly Ile Pro Glu1 5 10 15Gln Glu
Ala5817PRTArtificial SequenceSynthetic Peptide 58Arg Arg Arg Arg
Arg Arg Arg Arg Arg Leu Gly Ile Pro Glu Gln Glu1 5 10
15Tyr5917PRTArtificial SequenceSynthetic Peptide 59Arg Arg Arg Arg
Arg Arg Arg Arg Arg Ala Gly Ile Pro Glu Gln Glu1 5 10
15Tyr6017PRTArtificial SequenceSynthetic Peptide 60Arg Arg Arg Arg
Arg Arg Arg Arg Arg Leu Ala Ile Pro Glu Gln Glu1 5 10
15Tyr6117PRTArtificial SequenceSynthetic Peptide 61Arg Arg Arg Arg
Arg Arg Arg Arg Arg Leu Gly Ala Pro Glu Gln Glu1 5 10
15Tyr6217PRTArtificial SequenceSynthetic Peptide 62Arg Arg Arg Arg
Arg Arg Arg Arg Arg Leu Gly Ile Ala Glu Gln Glu1 5 10
15Tyr6317PRTArtificial SequenceSynthetic Peptide 63Arg Arg Arg Arg
Arg Arg Arg Arg Arg Leu Gly Ile Pro Ala Gln Glu1 5 10
15Tyr6417PRTArtificial SequenceSynthetic Peptide 64Arg Arg Arg Arg
Arg Arg Arg Arg Arg Leu Gly Ile Pro Glu Ala Glu1 5 10
15Tyr6517PRTArtificial SequenceSynthetic Peptide 65Arg Arg Arg Arg
Arg Arg Arg Arg Arg Leu Gly Ile Pro Glu Gln Ala1 5 10
15Tyr6617PRTArtificial SequenceSynthetic Peptide 66Arg Arg Arg Arg
Arg Arg Arg Arg Arg Leu Gly Ile Pro Glu Gln Glu1 5 10
15Ala6711PRTArtificial SequenceSynthetic Peptide 67Tyr Gly Arg Lys
Lys Arg Arg Gln Arg Arg Arg1 5 106815PRTArtificial
SequenceSynthetic Peptide 68Tyr Gly Arg Lys Lys Arg Arg Gln Arg Arg
Arg Gly Gly Gly Cys1 5 10 156934PRTArtificial SequenceSynthetic
Peptide 69Asp Ala Ala Thr Ala Thr Arg Gly Arg Ser Ala Ala Ser Arg
Pro Thr1 5 10 15Glu Arg Pro Arg Ala Pro Ala Arg Ser Ala Ser Arg Pro
Arg Arg Pro 20 25 30Val Asp7018PRTArtificial SequenceSynthetic
Peptide 70Lys Leu Ala Leu Lys Leu Ala Leu Lys Ala Leu Lys Ala Ala
Leu Lys1 5 10 15Leu Ala7130PRTArtificial SequenceSynthetic Peptide
71Trp Glu Ala Lys Leu Ala Lys Ala Leu Ala Lys Ala Leu Ala Lys His1
5 10 15Leu Ala Lys Ala Leu Ala Lys Ala Leu Lys Ala Cys Glu Ala 20
25 307220PRTArtificial SequenceSynthetic Peptide 72Gly Leu Phe Arg
Ala Leu Leu Arg Leu Leu Arg Ser Leu Trp Arg Leu1 5 10 15Leu Leu Arg
Ala 20736PRTArtificial SequenceSynthetic Peptide 73Val Arg Leu Pro
Pro Pro1 57427PRTArtificial SequenceSynthetic Peptide 74Met Gly Leu
Gly Leu His Leu Leu Val Leu Ala Ala Ala Leu Gln Gly1 5 10 15Ala Trp
Ser Gln Pro Lys Lys Lys Arg Lys Val 20 257527PRTArtificial
SequenceSynthetic Peptide 75Gly Ala Leu Phe Leu Gly Phe Leu Gly Ala
Ala Gly Ser Thr Met Gly1 5 10 15Ala Trp Ser Gln Pro Lys Lys Lys Arg
Lys Val 20 257621PRTArtificial SequenceSynthetic Peptide 76Lys Glu
Thr Trp Trp Glu Thr Trp Trp Thr Glu Trp Ser Gln Pro Lys1 5 10 15Lys
Lys Arg Lys Val 207724PRTArtificial SequenceSynthetic Peptide 77Leu
Gly Thr Tyr Thr Gln Asp Phe Asn Lys Phe His Thr Phe Pro Gln1 5 10
15Thr Ala Ile Gly Val Gly Ala Pro 207817PRTArtificial
SequenceSynthetic Peptide 78Cys Ser Ile Pro Pro Glu Val Lys Phe Asn
Lys Pro Phe Val Tyr Leu1 5 10 15Ile7916PRTArtificial
SequenceSynthetic Peptide 79Ser Ile Pro Pro Glu Val Lys Phe Asn Lys
Pro Phe Val Tyr Leu Ile1 5 10 158015PRTArtificial SequenceSynthetic
Peptide 80Lys Lys Ala Ala Ala Val Leu Leu Pro Val Leu Leu Ala Ala
Pro1 5 10 15817PRTArtificial SequenceSynthetic Peptide 81Pro Lys
Lys Lys Arg Lys Val1 58232PRTArtificial SequenceSynthetic Peptide
82Tyr Thr Ile Trp Met Pro Glu Asn Pro Arg Pro Gly Thr Pro Cys Asp1
5 10 15Ile Phe Thr Asn Ser Arg Gly Lys Arg Ala Ser Asn Gly Gly Gly
Gly 20 25 308311PRTArtificial SequenceSynthetic Peptide 83Ala Cys
Ser Ser Ser Pro Ser Lys His Cys Gly1 5 108417PRTArtificial
SequenceSynthetic Peptide 84Lys Lys Trp Lys Met Arg Arg Asn Gln Phe
Trp Val Lys Val Gln Arg1 5 10 15Gly8516PRTArtificial
SequenceSynthetic Peptide 85Arg Gln Ile Lys Ile Trp Phe Gln Asn Arg
Arg Met Lys Trp Lys Lys1 5 10 158619PRTArtificial SequenceSynthetic
Peptide 86Arg Gly Gly Arg Leu Ser Tyr Ser Arg Arg Arg Phe Ser Thr
Ser Thr1 5 10 15Gly Arg Ala
* * * * *
References