Anti-jam-a Antibodies

Abstract

The present invention relates to novel isolated antibodies, derived compounds, and functional isolated antibody fragments, capable of inhibiting the proliferation of tumor cells in vitro and/or in vivo and obtained by functional screening. More particularly, the present invention relates to the 6F4 antibody, specific to the JAM-A protein, as well as its use for the treatment of cancer. Pharmaceutical compositions composed of these antibodies are also covered.

Description

CROSS-REFERENCE TO RELATED APPLICATIONS

[0001] This application is a Divisional Application of U.S. patent application Ser. No. 12/125,726, filed on May 22, 2008, now U.S. Pat. No. 8,071,730, which is a nonprovisional application under 35 U.S.C. .sctn.111(a) of International Patent Application PCT/EP2007/062760, filed on Nov. 23, 2007, and published as WO 2008/062063 on May 29, 2008, which claims priority to French Patent Application FR 06/10329, filed on Nov. 24, 2006, all of which are incorporated herein by reference in their entireties for all purposes.

BACKGROUND OF THE INVENTION

Technical Field of the Invention

[0002] The present invention relates to novel antibodies, in particular murine monoclonal antibodies, chimeric and humanized, able to inhibit tumor growth, as well as the amino and nucleic acid sequences coding for such antibodies. From one aspect, the invention relates to novel antibodies, derived compounds or functional fragments, able to inhibit the proliferation of tumor cells. The invention also comprises the use of such antibodies as a drug for the preventive and/or therapeutic treatment of cancers, as well as in the procedures or kits related to cancer diagnosis. Finally, the invention comprises compositions comprising such antibodies in combination with other anticancer compounds, such as antibodies, or conjugated with toxins, and the use of same for the prevention and/or treatment of certain cancers.

[0003] Generally, the criterion selected for the production of monoclonal antibodies is the recognition of the immunogen identified as a potential target of a treatment. In practice, mice are immunized with a recombinant protein that corresponds to the immunogen and, after the monoclonal antibodies produced by the mouse are recovered, they are first screened for their capacity to recognize the immunogen in a specific manner. In a second stage, the antibodies thus selected are tested in vivo and in vitro in order to determine their activity as well as their properties and/or mechanisms of action.

[0004] This "traditional" approach, even if it makes it possible to know the working target from the beginning, often generates a large number of antibodies which are certainly capable of specifically recognizing a given target but which in vivo do not exhibit significant biological activity. In the field of cancer, it is indeed known that, even if an antibody produces good results in vitro, that does not inevitably mean that such an antibody will later show genuine anti-tumor activity in vivo.

[0005] The present invention differs from this manner of proceeding, and goes even against the aforementioned, since it is based on a "functional" approach, and more particularly on primary screening based on the function sought for the antibody and not on the recognized antigen.

[0006] More particularly, the inventors have selected a given function, namely inhibition of basal proliferation, not induced, of the cell, as an antibody selection parameter.

[0007] The production method used will be described in more detail in the examples below.

[0008] In a surprising way, by this functional approach, the inventors have produced and selected an antibody capable of inhibiting in vitro and/or in vivo, in a significant manner, the proliferation of tumor cells.

[0009] According to a first aspect, the invention relates to an isolated antibody, or a derived compound or functional fragment of same, capable of inhibiting the proliferation of tumor cells in vitro and/or in vivo; said antibody, or a derived compound or functional fragment of same, comprising at least one CDR selected among the complementarity-determining regions (CDRs) of sequences SEQ ID No. 1, 2, 3, 4, 5 or 6 or at least one CDR whose sequence has at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequences SEQ ID No. 1, 2, 3, 4, 5 or 6.

[0010] A "functional fragment" of an antibody means in particular an antibody fragment, such as fragments Fv, scFv (sc=simple chain), Fab, F(ab').sub.2, Fab', scFv-Fc or diabodies, or any fragment whose half-life has been increased. Such functional fragments will be described in detail later in the present description.

[0011] A "derived compound" of an antibody means in particular a binding protein composed of a peptide scaffold and at least one of the CDRs of the original antibody in order to preserve its ability to be recognized. Such derived compounds, well-known to a person skilled in the art, will be described in more detail later in the present description.

[0012] More preferably, the invention comprises the antibodies, their derived compounds or their functional fragments, according to the present invention, notably chimeric or humanized, obtained by genetic recombination or chemical synthesis.

[0013] According to a preferred embodiment, the antibody according to the invention, or its derived compounds or functional fragments, is characterized in that it consists of a monoclonal antibody.

[0014] "Monoclonal antibody" is understood to mean an antibody arising from a nearly homogeneous antibody population. More particularly, the individual antibodies of a population are identical except for a few possible naturally-occurring mutations which can be found in minimal proportions. In other words, a monoclonal antibody consists of a homogeneous antibody arising from the growth of a single cell clone (for example a hybridoma, a eukaryotic host cell transfected with a DNA molecule coding for the homogeneous antibody, a prokaryotic host cell transfected with a DNA molecule coding for the homogeneous antibody, etc.) and is generally characterized by heavy chains of one and only one class and subclass, and light chains of only one type. Monoclonal antibodies are highly specific and are directed against a single antigen. In addition, in contrast with preparations of polyclonal antibodies which typically include various antibodies directed against various determinants, or epitopes, each monoclonal antibody is directed against a single epitope of the antigen.

[0015] It must be understood here that the invention does not relate to antibodies in natural form, i.e., they are not taken from their natural environment but are isolated or obtained by purification from natural sources or obtained by genetic recombination or chemical synthesis and thus they can carry unnatural amino acids as will be described below.

[0016] More particularly, according to a preferred embodiment of the invention, the antibody, or its derived compounds or functional fragments, is characterized in that it comprises a light chain comprising at least one CDR selected among the CDRs of amino acid sequences SEQ ID No. 1, 3 or 5, or at least one CDR whose sequence has at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequences SEQ ID No. 1, 3 or 5; or it comprises a heavy chain comprising at least one CDR selected among the CDRs of amino acid sequences SEQ ID No. 2, 4 or 6, or at least one CDR whose sequence has at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequences SEQ ID No. 2, 4 or 6.

[0017] More particularly, the antibodies of the invention, or one of their derived compounds or functional fragments, are characterized in that they comprise a heavy chain comprising at least one of the three CDRs of the sequences SEQ ID Nos. 2, 4 and 6, or at least one sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequences SEQ ID Nos. 2,4 or 6.

[0018] Even more preferably, the antibodies of the invention, or one of their derived compounds or functional fragments, are characterized in that they comprise a heavy chain comprising the following three CDRs, respectively CDR-H1, CDR-H2 and CDR-H3, wherein:

[0019] CDR-H1 comprises the sequence SEQ ID No. 2, 7 or 9, or a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 2, 7 or 9;

[0020] CDR-H2 comprises the sequences SEQ ID No. 4 or 11, or a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 4 or 11; and

[0021] CDR-H3 comprises the sequences SEQ ID No. 6 or 12, or a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 6 or 12.

[0022] According to a particular embodiment, antibodies, or one of their derived compounds or functional fragments, are characterized in that they comprise a heavy chain comprising the CDR-H1 of the sequence SEQ ID No. 7, the CDR-H2 of the sequence SEQ ID No. 4 and the CDR-H3 of the sequence SEQ ID No. 12.

[0023] According to another particular embodiment, antibodies, or one of their derived compounds or functional fragments, are characterized in that they comprise a heavy chain comprising the CDR-H1 of the sequence SEQ ID No. 9, the CDR-H2 of the sequence SEQ ID No. 11 and the CDR-H3 of the sequence SEQ ID No. 6.

[0024] According to another embodiment, the antibodies of the invention, or one of their derived compounds or functional fragments, are characterized in that they comprise a light chain comprising at least one of the three CDRs of the sequences SEQ ID Nos. 1, 3 and 5, or at least one sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequences SEQ ID Nos. 1, 3 or 5.

[0025] In a preferred manner, the antibodies of the invention, or one of their derived compounds or functional fragments, are characterized in that they comprise a light chain comprising the following three CDRs, respectively CDR-L1, CDR-L2 and CDR-L3, wherein:

[0026] CDR-L1 comprises the sequence SEQ ID No. 1 or 8, or a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 1 or 8;

[0027] CDR-L2 comprises the sequences SEQ ID No. 3 or 10, or a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 3 or 10; and

[0028] CDR-L3 comprises the sequence SEQ ID No. 5, or a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 5.

[0029] According to a particular embodiment, antibodies, or one of their derived compounds or functional fragments, are characterized in that they comprise a light chain comprising the CDR-L1 of the sequence SEQ ID No. 1, the CDR-L2 of the sequence SEQ ID No. 3 and the CDR-L3 of the sequence SEQ ID No. 5.

[0030] According to another particular embodiment, antibodies, or one of their derived compounds or functional fragments, are characterized in that they comprise a light chain comprising the CDR-L1 of the sequence SEQ ID No. 8, the CDR-L2 of the sequence SEQ ID No. 10 and the CDR-L3 of the sequence SEQ ID No. 5.

[0031] In the present description, the terms "polypeptides", "polypeptide sequences", "peptides" and "proteins attached to antibody compounds or to their sequences" are interchangeable.

[0032] It must be understood here that the invention does not relate to antibodies in natural form, i.e., they are not taken from their natural environment but are isolated or obtained by purification from natural sources or obtained by genetic recombination or chemical synthesis and thus they can carry unnatural amino acids as will be described below.

[0033] In a first embodiment, complementarity-determining region, or CDR, means the hypervariable regions of the heavy and light chains of immunoglobulins as defined by Kabat et al. (Kabat et al., Sequences of proteins of immunological interest, 5.sup.th Ed., U.S. Department of Health and Human Services, NIH, 1991, and later editions). There are three heavy-chain CDRs and three light-chain CDRs. Here, the terms "CDR" and "CDRs" are used to indicate, depending on the case, one or more, or even all, of the regions containing the majority of the amino acid residues responsible for the antibody's binding affinity for the antigen or epitope it recognizes.

[0034] In a second embodiment, by CDR regions or CDR(s), it is intended to indicate the hypervariable regions of the heavy and light chains of the immunoglobulins as defined by IMGT.

[0035] The IMGT unique numbering has been defined to compare the variable domains whatever the antigen receptor, the chain type, or the species [Lefranc M.-P., Immunology Today 18, 509 (1997)/Lefranc M.-P., The Immunologist, 7, 132-136 (1999)/Lefranc, M.-P., Pommie, C., Ruiz, M., Giudicelli, V., Foulquier, E., Truong, L., Thouvenin-Contet, V. and Lefranc, Dev. Comp. Immunol., 27, 55-77 (2003)]. In the IMGT unique numbering, the conserved amino acids always have the same position, for instance cystein 23 (1st-CYS), tryptophan 41 (CONSERVED-TRP), hydrophobic amino acid 89, cystein 104 (2nd-CYS), phenylalanine or tryptophan 118 (J-PHE or J-TRP). The IMGT unique numbering provides a standardized delimitation of the framework regions (FR1-IMGT: positions 1 to 26, FR2-IMGT: 39 to 55, FR3-IMGT: 66 to 104 and FR4-IMGT: 118 to 128) and of the complementarity determining regions: CDR1-IMGT: 27 to 38, CDR2-IMGT: 56 to 65 and CDR3-IMGT: 105 to 117. As gaps represent unoccupied positions, the CDR-IMGT lengths (shown from brackets and separated by dots, e.g. [8.8.13]) become crucial information. The IMGT unique numbering is used in 2D graphical representations, designated as IMGT Colliers de Perles [Ruiz, M. and Lefranc, M.-P., Immunogenetics, 53, 857-883 (2002)/Kaas, Q. and Lefranc, M.-P., Current Bioinformatics, 2, 21-30 (2007)], and in 3D structures in IMGT/3D structure-DB [Kaas, Q., Ruiz, M. and Lefranc, M.-P., T cell receptor and MHC structural data. Nucl. Acids. Res., 32, D208-D210 (2004)].

[0036] Three heavy chain CDRs and 3 light chain CDRs exist. The term CDR or CDRs is used here in order to indicate, according to the case, one of these regions or several, or even the whole, of these regions which contain the majority of the amino acid residues responsible for the binding by affinity of the antibody for the antigen or the epitope which it recognizes.

[0037] For more clarity, it must be understood that in the following description, and more particularly in table 2 and 3, the CDRs will be defined by IMGT numbering, kabat numbering and by common numbering.

[0038] Common numbering regroups the residues part of each CDR which are common to the CDRs as defined by the IMGT and the Kabat numbering systems.

[0039] IMGT numbering system defines the CDRs according to the IMGT system as above defined whereas kabat numbering system defines the CDRs according to the kabat system as above defined.

[0040] More particularly, CDR-L1 consist of SEQ ID No. 1 (QDINNY) in the common and IMGT numbering systems and of SEQ ID No. 8 (KASQDINNYIA) in the kabat numbering system.

[0041] Concerning the CDR-L2, it consists of SEQ ID No. 3 (YTS) in the common and IMGT numbering systems and of SEQ ID No. 10 (YTSTLQA) in the kabat numbering system.

[0042] The CDR-L3 consists of SEQ ID No. 5 (LQYDNLWT) for each of the three numbering systems.

[0043] For the heavy chain, the CDR-H1 consists of the SEQ ID No. 2 (TDYS) in the common numbering system, of SEQ ID No. 7 (GYSFTDYS) in the IMGT numbering system and of SEQ ID No. 9 (TDYSMY) in the kabat numbering system.

[0044] The CDR-H2 consists of SEQ ID No. 4 (IDPYNGGT) in the common and IMGT numbering systems and of SEQ ID No. 11 (YIDPYNGGTRYNQKFKG) in the kabat numbering system.

[0045] At last, the CDR-H3 consists in the SEQ ID No. 6 (QTDYFDY) in the common and kabat numbering systems whereas it consists of SEQ ID No. 12 (ARQTDYFDY) in the IMGT numbering system.

[0046] In the sense of the present invention, the "percentage identity" from two sequences of nucleic acids or amino acids means the percentage of identical nucleotides or amino acid residues from the two sequences to be compared, obtained after optimal alignment, this percentage being purely statistical and the differences from the two sequences being distributed randomly along their length. The comparison of two nucleic acid or amino acid sequences is traditionally carried out by comparing the sequences after having optimally aligned them, said comparison being able to be conducted by segment or by using an "alignment window". Optimal alignment of the sequences for comparison can be carried out, in addition to comparison by hand, by means of the local homology algorithm of Smith and Waterman (1981) [Ad. App. Math. 2:482], by means of the local homology algorithm of Neddleman and Wunsch (1970) [J. Mol. Biol. 48:443], by means of the similarity search method of Pearson and Lipman (1988) [Proc. Natl. Acad. Sci. USA 85:2444] or by means of computer software using these algorithms (GAP, BESTFIT, FASTA and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis., or by the comparison software BLAST NR or BLAST P).

[0047] The percentage identity from two nucleic acid or amino acid sequences is determined by comparing the two optimally-aligned sequences in which the nucleic acid or amino acid sequence to compare can have additions or deletions compared to the reference sequence for optimal alignment from the two sequences. Percentage identity is calculated by determining the number of positions at which the amino acid nucleotide or residue is identical from the two sequences, dividing the number of identical positions by the total number of positions in the alignment window and multiplying the result by 100 to obtain the percentage identity from the two sequences.

[0048] For example, the BLAST program, "BLAST 2 sequences" (Tatusova et al., "Blast 2 sequences--a new tool for comparing protein and nucleotide sequences", FEMS Microbial., 1999, Lett. 174:247-250) can be used with the default parameters (notably for the parameters "open gap penalty": 5, and "extension gap penalty": 2; the selected matrix being for example the "BLOSUM 62" matrix proposed by the program); the percentage identity from the two sequences to compare is calculated directly by the program.

[0049] For the amino acid sequence exhibiting at least 80%, preferably 85%, 90%, 95% and 98% identity with a reference amino acid sequence, preferred examples include those containing the reference sequence, certain modifications, notably a deletion, addition or substitution of at least one amino acid, truncation or extension. In the case of substitution of one or more consecutive or non-consecutive amino acids, substitutions are preferred in which the substituted amino acids are replaced by "equivalent" amino acids. Here, the expression "equivalent amino acids" is meant to indicate any amino acids likely to be substituted for one of the structural amino acids without however modifying the biological activities of the corresponding antibodies and of those specific examples defined below.

[0050] Equivalent amino acids can be determined either on their structural homology with the amino acids for which they are substituted or on the results of comparative tests of biological activity from the various antibodies likely to be generated.

[0051] As a non-limiting example, table 1 below summarizes the possible substitutions likely to be carried out without resulting in a significant modification of the biological activity of the corresponding modified antibody; inverse substitutions are naturally possible under the same conditions.

TABLE-US-00001 TABLE 1 Original residue Substitution(s) Ala (A) Val, Gly, Pro Arg (R) Lys, His Asn (N) Gln Asp (D) Glu Cys (C) Ser Gln (Q) Asn Glu (G) Asp Gly (G) Ala His (H) Arg Ile (I) Leu Leu (L) Ile, Val, Met Lys (K) Arg Met (M) Leu Phe (F) Tyr Pro (P) Ala Ser (S) Thr, Cys Thr (T) Ser Trp (W) Tyr Tyr (Y) Phe, Trp Val (V) Leu, Ala

[0052] It is known by those skilled in the art that in the current state of the art the greatest variability (length and composition) from the six CDRs is found at the three heavy-chain CDRs and, more particularly, at CDR-H3 of this heavy chain. Consequently, it will be evident that the preferred characteristic CDRs of the antibodies of the invention, or of one of their derived compounds or functional fragments, will be the three CDRs of the heavy chain, i.e., the CDRs coded by sequences SEQ ID Nos. 2, 4 and 6, respectively, and even more preferentially, the CDR corresponding to the CDR-H3 coded by sequence SEQ ID No. 6.

[0053] In a specific embodiment, the present invention relates to a murine antibody, or derived compounds or functional fragments of same.

[0054] Another embodiment of the invention discloses an antibody, or its derived compounds or functional fragments, comprising a light chain comprising the following three CDRs: [0055] CDR-L1 of the sequence SEQ ID No. 1 or of a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 1; [0056] CDR-L2 of the sequence SEQ ID No. 3 or of a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 3; and [0057] CDR-L3 of the sequence SEQ ID No. 5 or of a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 5, and a heavy chain comprising the following three CDRs: [0058] CDR-H1 of the sequence SEQ ID No. 7 or of a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 7; [0059] CDR-H2 of the sequence SEQ ID No. 4 or of a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 4; and [0060] CDR-H3 of the sequence SEQ ID No. 12 or of a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 12.

[0061] Still another embodiment of the invention discloses an antibody, or a derived compound or functional fragment of same, comprising a light chain comprising the following three CDRs:

[0062] CDR-L1 of the sequence SEQ ID No. 8 or of a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 8;

[0063] CDR-L2 of the sequence SEQ ID No. 10 or of a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 10; and

[0064] CDR-L3 of the sequence SEQ ID No. 5 or of a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 5, and

a heavy chain comprising the following three CDRs:

[0065] CDR-H1 of the sequence SEQ ID No. 9 or of a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 9;

[0066] CDR-H2 of the sequence SEQ ID No. 11 or of a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 11; and

[0067] CDR-H3 of the sequence SEQ ID No. 6 or of a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 6.

[0068] According to still another embodiment, the antibody of the invention, or its derived compounds or functional fragments, is characterized in that it comprises a light-chain sequence comprising the amino acid sequence SEQ ID No. 13 or a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 13; and in that it comprises a heavy-chain sequence comprising the amino acid sequence SEQ ID No. 14 or a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 14.

[0069] It is also disclosed a humanized antibody, or a derived compound or functional fragment of same, which is characterized in that it comprises a light chain sequence comprising the amino acid sequence SEQ ID No. 17 or a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 17, and in that it comprises a heavy chain sequence comprising the amino acid sequence SEQ ID No. 18 or 19 or a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 18 or 19.

[0070] As seen above, the invention also relates to any compound derived from an antibody as described in the invention.

[0071] More particularly, the antibody of the invention, or its derived compounds or functional fragments, is characterized in that said derived compound consists of a binding protein comprising a peptide scaffold on which is grafted at least one CDR in such a way as to preserve all or part of the paratope recognition properties of the initial antibody.

[0072] One or more sequences among the six CDR sequences described in the present invention can also be present on the various immunoglobulin protein scaffolding. In this case, the protein sequence makes it possible to recreate a peptide skeleton favorable to the folding of the grafted CDRs, enabling them to preserve their paratope antigen-recognition properties.

[0073] Generally, a person skilled in the art knows how to determine the type of protein scaffold on which to graft at least one of the CDRs arising from the original antibody. More particularly, it is known that to be selected such scaffolds must meet the greatest number of criteria as follows (Skerra A., J. Mol. Recogn., 2000, 13:167-187): [0074] good phylogenetic conservation; [0075] known three-dimensional structure (as, for example, by crystallography, NMR spectroscopy or any other technique known to a person skilled in the art); [0076] small size; [0077] few or no post-transcriptional modifications; and/or [0078] easy to produce, express and purify.

[0079] The origin of such protein scaffolds can be, but is not limited to, the structures selected among: fibronectin and preferentially fibronectin type III domain 10, lipocalin, anticalin (Skerra A., J. Biotechnol., 2001, 74(4):257-75), protein Z arising from domain B of protein A of Staphylococcus aureus, thioredoxin A or proteins with a repeated motif such as the "ankyrin repeat" (Kohl et al., PNAS, 2003, vol. 100, No. 4, 1700-1705), the "armadillo repeat", the "leucine-rich repeat" and the "tetratricopeptide repeat".

[0080] Scaffolds derived from toxins such as, for example, toxins from scorpions, insects, plants, mollusks, etc., and the protein inhibiters of neuronal NO synthase (PIN) should also be mentioned.

[0081] An example, in no way limiting, of such hybrid constructions, is the insertion of the CDR-H1 (heavy chain) of an anti-CD4 antibody, namely 13B8.2, in one of the loops in the PIN, the new binding protein thus obtained preserving the same binding properties as the original antibody (Bes et al., Biochem. Biophys. Res. Commun., 2006, 343(1), 334-344). On a purely illustrative basis, grafting the CDR-H3 (heavy chain) of an anti-lysozyme VHH antibody on one of the loops of neocarzinostatin (Nicaise et al., Protein Science, 2004, 13(7):1882-1891) can also be mentioned.

[0082] Lastly, as described above, such peptide scaffolds can comprise from one to six CDRs arising from the original antibody. Preferably, but not being a requirement, a person skilled in the art will select at least one CDR from the heavy chain, the latter being known to be primarily responsible for the specificity of the antibody. The selection of one or more relevant CDRs is obvious to a person skilled in the art, who will then choose suitable known techniques (Bes et al., FEBS letters 508, 2001, 67-74).

[0083] A specific aspect of the present invention relates to a method for selecting a compound derived from an antibody according to the invention, said derived compound being capable of inhibiting in vitro and/or in vivo the growth of tumor cells and said derived compound comprising a peptide scaffold on which is grafted at least one antibody CDR, characterized in that it comprises the following steps: [0084] a) the placing in contact in vitro of a compound composed of a peptide scaffold on which is grafted at least one antibody CDR with a biological sample containing tumor cells able to grow and under conditions allowing these cells to grow; and [0085] b) selection of said compound if said compound is capable of inhibiting the growth of these tumor cells, and characterized in that said at least one grafted CDR is selected among the following CDRs: [0086] the CDR of sequence SEQ ID No. 1, 8 or a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 1, 8; [0087] the CDR of sequence SEQ ID No. 3, 10 or a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 3, 10; [0088] the CDR of sequence SEQ ID No. 5 or a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 5; [0089] the CDR of sequence SEQ ID No. 2, 7, 9 or a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 2, 7, 9; [0090] the CDR of sequence SEQ ID No. 4, 11 or a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 4, 11; and [0091] the CDR of sequence SEQ ID No. 6, 12 or a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 6, 12.

[0092] According to a preferred mode, the method can include in step a) the placing in contact in vitro of a compound comprising a peptide scaffold on which is grafted at least two or three antibody CDRs.

[0093] According to an even more preferred mode of this method, the peptide scaffold is selected among the scaffolds or binding proteins whose structures were mentioned above.

[0094] Obviously, these examples are in no way limiting, and any other structure known or obvious to a person skilled in the art should be considered as being covered by the protection conferred by the present patent application.

[0095] The present invention thus relates to an antibody, or its derived compounds or functional fragments, characterized in that the peptide scaffold is selected among proteins that are a) phylogenetically well preserved, b) of robust architecture, c) with a well-known 3-D molecular organization, d) of small size and/or e) comprising regions that can be modified by deletion and/or insertion without modifying stability properties.

[0096] According to a preferred embodiment, the antibody of the invention, or its derived compounds or functional fragments, is characterized in that said peptide scaffold is selected among i) scaffolds arising from fibronectin, preferentially fibronectin type 3 domain 10, lipocalin, anticalin, protein Z arising from domain B of protein A of Staphylococcus aureus, thioredoxin A or proteins with a repeated motif such as the "ankyrin repeat" (Kohl et al., PNAS, 2003, vol. 100, No. 4, 1700-1705), the "armadillo repeat", the "leucine-rich repeat" and the "tetratricopeptide repeat" or iii) protein inhibiters of neuronal NO synthase (PIN).

[0097] Another aspect of the invention relates to the functional fragments of the antibody described above.

[0098] More particularly, the invention targets an antibody, or its derived compounds or functional fragments, characterized in that said functional fragment is selected among the fragments Fv, Fab, (Fab').sub.2, Fab', scFv, scFv-Fc and diabodies, or any fragment whose half-life has been increased such as PEGylated fragments.

[0099] Such functional fragments of the antibody according to the invention consist, for example, of the fragments Fv, scFv (sc=simple chain), Fab, F(ab').sub.2, Fab', scFv-Fc or diabodies, or any fragment whose half-life has been increased by chemical modification, such as the addition of polyalkylene glycol such as polyethylene glycol (PEGylation) (PEGylated fragments are referred to as Fv-PEG, scFv-PEG, Fab-PEG, F(ab').sub.2-PEG and Fab'-PEG), or by incorporation in a liposome, microspheres or PLGA, said fragments possessing at least one of the characteristic CDRs of the invention which is notably capable of exerting in a general manner activity, even partial, of the antibody from which it arises.

[0100] Preferably, said functional fragments will comprise or include a partial sequence of the variable heavy or light chain of the antibody from which they are derived, said partial sequence being sufficient to retain the same binding specificity as the antibody from which it arises and sufficient affinity, preferably at least equal to 1/100, more preferably at least 1/10 of that of the antibody from which it arises.

[0101] Such a functional fragment will contain at least five amino acids, preferably 6, 7, 8, 10, 15, 25, 50 or 100 consecutive amino acids of the sequence of the antibody from which it arises.

[0102] Preferably, these functional fragments will be of the types Fv, scFv, Fab, F(ab').sub.2, F(ab'), scFv-Fc or diabodies, which generally have the same binding specificity as the antibody from which they result. According to the present invention, fragments of the antibody of the invention can be obtained from the antibodies described above by methods such as enzyme digestion, including pepsin or papain, and/or by cleavage of the disulfide bridges by chemical reduction. The antibody fragments can be also obtained by recombinant genetics techniques also known to a person skilled in the art or by peptide synthesis by means, for example, of automatic peptide synthesizers such as those marketed by Applied BioSystems, etc.

[0103] The invention also targets the original murine antibody, namely an antibody according to the invention, or its derived compounds or functional fragments, characterized in that said antibody is a murine antibody and in that it comprises a light-chain of amino acid sequence SEQ ID No. 15, or a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 15, and a heavy-chain of amino acid sequence SEQ ID No. 16, or a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 16.

[0104] For more clarity, table 2 below summarizes the various amino acid sequences corresponding to the antibody of the invention.

TABLE-US-00002 TABLE 2 (wherein Mu. = murine and Hu. = humanized): CDR SEQ ID Antibody numbering Heavy chain Light chain NO. 6F4 Common CDR-L1 1 CDR-L2 3 CDR-L3 5 CDR-H1 2 CDR-H2 4 CDR-H3 6 IMGT CDR-L1 1 CDR-L2 3 CDR-L3 5 CDR-H1 7 CDR-H2 4 CDR-H3 12 Kabat CDR-L1 8 CDR-L2 10 CDR-L3 5 CDR-H1 9 CDR-H2 11 CDR-H3 6 Mu. variable 13 domain Mu. variable 14 domain Mu. entire 15 Mu. entire 16 Hu. variable 17 domain Hu. variable 18 domain (V1) Hu. variable 19 domain (V2)

[0105] Another specific aspect of the present invention relates to a chimeric antibody, or its derived compounds or functional fragments, characterized in that said antibody also comprises light-chain and heavy-chain constant regions derived from an antibody of a species heterologous with the mouse, notably man.

[0106] Yet another specific aspect of the present invention relates to a humanized antibody, or its derived compounds or functional fragments, characterized in that the constant regions of the light-chain and the heavy-chain derived from human antibody are, respectively, the lambda or kappa region and the gamma-1, gamma-2 or gamma-4 region.

[0107] According to another aspect, the invention relates to a murine hybridoma capable of secreting a monoclonal antibody according to the invention, notably the hybridoma of murine origin filed with the French center for microorganism cultures (CNCM, Pasteur Institute, Paris, France) on Jul. 6, 2006, under number 1-3646. Said hybridoma was obtained by the fusion of Balb/C immunized mice splenocytes and cells of the myeloma Sp 2/O-Ag 14 lines.

[0108] The monoclonal antibody, here referred to as 6F4, or its derived compounds or functional fragments, characterized in that said antibody is secreted by the hybridoma filed with the CNCM on Jul. 4, 2006, under number I-3646, obviously forms part of the present invention.

[0109] The antibody of the invention also comprises chimeric or humanized antibodies.

[0110] A chimeric antibody is one containing a natural variable region (light chain and heavy chain) derived from an antibody of a given species in combination with constant regions of the light chain and the heavy chain of an antibody of a species heterologous to said given species.

[0111] The antibodies, or chimeric fragments of same, can be prepared by using the techniques of recombinant genetics. For example, the chimeric antibody could be produced by cloning recombinant DNA containing a promoter and a sequence coding for the variable region of a nonhuman monoclonal antibody of the invention, notably murine, and a sequence coding for the human antibody constant region. A chimeric antibody according to the invention coded by one such recombinant gene could be, for example, a mouse-human chimera, the specificity of this antibody being determined by the variable region derived from the murine DNA and its isotype determined by the constant region derived from human DNA. Refer to Verhoeyn et al. (BioEssays, 8:74, 1988) for methods for preparing chimeric antibodies.

[0112] "Humanized antibodies" means an antibody that contains CDR regions derived from an antibody of nonhuman origin, the other parts of the antibody molecule being derived from one (or several) human antibodies. In addition, some of the skeleton segment residues (called FR) can be modified to preserve binding affinity (Jones et al., Nature, 321:522-525, 1986; Verhoeyen et al., Science, 239:1534-1536, 1988; Riechmann et al., Nature, 332:323-327, 1988).

[0113] The humanized antibodies of the invention or fragments of same can be prepared by techniques known to a person skilled in the art (such as, for example, those described in the documents Singer et al., J. Immun., 150:2844-2857, 1992; Mountain et al., Biotechnol. Genet. Eng. Rev., 10:1-142, 1992; and Bebbington et al., Bio/Technology, 10:169-175, 1992). Such humanized antibodies are preferred for their use in methods involving in vitro diagnoses or preventive and/or therapeutic treatment in vivo. Other humanization techniques, also known to a person skilled in the art, such as, for example, the "CDR grafting" technique described by PDL in patents EP 0 451 261, EP 0 682 040, EP 0 939 127, EP 0 566 647 or US 5,530,101, US 6,180,370, US 5,585,089 and US 5,693,761. U.S. Pat. Nos. 5,639,641 or 6,054,297, 5,886,152 and 5,877,293 can also be cited.

[0114] In addition, the invention also relates to humanized antibodies arising from the murine antibodies described above.

[0115] More particularly, the humanization method for the 6F4 antibody is described in detail in examples 2 and 3 for the light and heavy chains, respectively.

[0116] In a preferred manner, constant regions of the light-chain and the heavy-chain derived from human antibody are, respectively, the lambda or kappa and the gamma-1, gamma-2 or gamma-4 region.

[0117] In the embodiment corresponding to IgG1 isotype IgG1, an additional characteristic of the antibody is to exhibit effector functions, such as antibody-dependant cellular cytotoxicity (ADCC) and/or complement-dependant cytotoxicity (CDC).

[0118] In the field of the present invention, several backup humanized antibodies have been developed. More particularly, the invention concerns two variants heavy chains and two variants light chains, both derived from the 6F4 antibody.

[0119] In a first aspect, the invention relates to a humanized antibody, or a derived compound or functional fragment thereof, said antibody being characterized in that it comprises a heavy chain variable domain, called BU-H1, comprising the amino acid sequence SEQ ID No. 65.

TABLE-US-00003 SEQ ID No. 65: (X01)VQL(X02)QSGAEVKKPGASVKVSCKASGYSFTDYSMHWVRQAPG Q(X03)LEWMG(X04)IDPYNGGT(X05)YSQKFQGR(X06)T(X07)T (X08) DTSASTAYM(X09)LSSLRSEDTAVYYCARQTDYFDYWGQGTLV TVSS

wherein bolded residues correspond to CDR-IMGT, [0120] and X01 is E or Q; X02 is V or Q; X03 is S or R; X04 is Y or W; X05 is R or K; X06 is A or V; X07 is L or I; X08 is V or R and X09 is H or E.

[0121] In a second aspect, the invention relates to a humanized antibody, or a derived compound or functional fragment thereof, said antibody being characterized in that it comprises a heavy chain variable domain, called BU-H2, comprising the amino acid sequence SEQ ID No. 66.

TABLE-US-00004 SEQ ID No. 66: (X01)VQL(X02)QSGAEVKKPGASVKVSCKASGYSFTDYSMHVVVRQAP GQ(X03)LEWMG(X04)IDPYNGGT(X05)YAQKFQGR(X06)T(X07)T (X08)DTSTSTVYM(X09)LSSLRSEDTAVYYCARQTDYFDYWGQGTLVT VSS

wherein bolded residues correspond to CDR-IMGT, [0122] and X01 is E or Q; X02 is V or Q; X03 is S or G; X04 is Y or I; X05 is R or S; X06 is A or V; X07 is L or M; X08 is V or R and X09 is H or E.

[0123] In a third aspect, the invention relates to a humanized antibody, or a derived compound or functional fragment thereof, said antibody being characterized in that it comprises a light chain variable domain, called BU-L1, comprising the amino acid sequence SEQ ID No. 67.

TABLE-US-00005 SEQ ID No. 67: DIQMTQSPSSLSASVGDRVTITC(X01)ASQDINNY(X02)AWYQQKPGK VPKLLI(X03)YTSTLQSGVPSRFSGSGSGTD(X04)TLTISSLQPEDVA TYYCLQYDNLWTFGQGTKVEIK

wherein bolded residues correspond to CDR-IMGT, [0124] and X01 is K or R; X02 is L or I; X03 is H or Y and X04 is Y or F.

[0125] In a fourth aspect, the invention relates to a humanized antibody, or a derived compound or functional fragment thereof, said antibody being characterized in that it comprises a light chain variable domain, called BU-L2, comprising the amino acid sequence SEQ ID No. 68.

TABLE-US-00006 SEQ ID No. 68: (X01)I(X02)MTQSPFSLSASVGDRVTITC(X03)ASQDINNY(X04)A WYQQKPAKAPKLFI(X05)YTS(X06)LQSGVPSRFSGSGSGTDYTLTIS SLQPEDFATYYCLQYDNLWTFGQGTKVEIK

wherein bolded residues correspond to CDR-IMGT, [0126] and X01 is D or A; X02 is R or Q; X03 is K or W; X04 is L or I; X05 is H or Y and X06 is S or T.

[0127] In a preferred embodiment, the invention relates to a humanized antibody, or a derived compound or functional fragment thereof, characterized in that it comprises a heavy chain variable domain comprising the amino acid sequences SEQ ID No. 65 and a light chain variable domain comprising the amino acid sequence SEQ ID No. 67.

[0128] In another preferred embodiment, the invention relates to a humanized antibody, or a derived compound or functional fragment thereof, characterized in that it comprises a heavy chain variable domain comprising the amino acid sequences SEQ ID No. 65 and a light chain variable domain comprising the amino acid SEQ ID No. 68.

[0129] In yet another preferred embodiment, the invention relates to a humanized antibody, or a derived compound or functional fragment thereof, characterized in that it comprises a heavy chain variable domain comprising the amino acid sequences SEQ ID No. 66 and a light chain variable domain comprising the amino acid sequence SEQ ID No. 67.

[0130] Still in another preferred embodiment, the invention relates to a humanized antibody, or a derived compound or functional fragment thereof, characterized in that it comprises a heavy chain variable domain comprising the amino acid sequences SEQ ID No. 66 and a light chain variable domain comprising the amino acid sequence SEQ ID No. 68.

[0131] For more clarity, table 3 below summarizes the various amino acid sequences corresponding to the back-up antibodies.

TABLE-US-00007 TABLE 3 (wherein Mu. = murine and Hu. = humanized): CDR SEQ ID Antibody numbering Heavy chain Light chain NO. 6F4 BU Hu. variable 65 domain (H1) Hu. variable 66 domain (H2) Hu. variable 67 domain (L1) Hu. variable 68 domain (L2)

[0132] In another aspect of the invention, the applicant has also identified the antigen recognized by the antibody according to the invention.

[0133] The method used to accomplish this is described in detail in example 4 below.

[0134] JAM-A is a membrane protein belonging to the immunoglobulin superfamily (IgSF), in which it belongs to the junctional adhesion molecule (JAM) family. In man, the JAM family comprises several members, including the JAM-A, JAM-B, JAM-C, A33 and A34 proteins. Among the members of the JAM family, JAM-A has the highest homology with JAM-B and JAM-C, approximately 35% sequence identity in amino acids and 45% similarity with these two proteins. JAM-A protein is also called JAM A, F11R, F11 receptor, JAM-1, JAM 1, PAM-1 or CD321.

[0135] Two isoforms of the JAM-A precursor differing by the length of the extracellular region were identified: [0136] isoform a: 299 amino acids (SEQ ID No. 61) [0137] isoform b: 259 amino acids (SEQ ID No. 63).

[0138] The nucleotide sequences of the two isoforms are represented with SEQ ID No. 62 for isoform a and SEQ ID No. 64 for isoform b.

[0139] The protein expressed on the surface of the human cells has a single polypeptide chain with an intracellular C-terminal domain, a single transmembrane domain (21 amino acids) and an N-terminal extracellular region containing two "Ig-like" domains.

[0140] JAM-A has an N-glycosylation site, an Asn residue in position 185 for isoform a and 145 for isoform b, and two disulfide bridges, one from Cys residues 50 and 109 in the Ig N-terminal domain and one from residues Cys 153 and 212 in the second Ig domain.

[0141] The presence of the two extracellular Ig-like domains was confirmed by crystallography (Kostrewa et al., 2001, EMBO J. 16:4391-4398; Prota et al., 2003, Proc. Natl. Acad. Sci. USA, 100:5366-5371). These two domains are connected by a tripeptide linker (sequence VLV [127-129], isoform A). These structural studies also confirmed the implication of JAM-A in homophilic interactions on the cell surface involving the extracellular region; this region, produced in recombinant form and capable of forming homodimers in solution (Bazzoni et al., 2000, J. Biol. Chem. 275:30970-30976) also made it possible to identify the amino acids involved in these interactions: Arg 59, Glu 61, Lys 63, Leu 72, Tyr 75, Met 110, Glu 114, Tyr 119 and Glu 121. The tripeptide RVE [59-61] is relatively conserved within the JAM family (RLE for JAM-B, RIE for JAM-C) and constitutes the minimal motif for homodimer formation (Kostrewa et al., 2001, EMBO J. 16:4391-4398).

[0142] In epithelial and endothelial cells, JAM-A is mainly found in the tight junctions (Liu et al., 2000, J. Cell Sci., 113:2363-2374). The cytoplasmic region contains a type II PDZ domain in the C-terminal position (sequence FLV [298-300], isoform a, which is responsible for the interaction of JAM-A with various cytosolic proteins associated with the tight junction, also containing a PDZ domain, such as ZO-1, AF-6, MUPP-1 and PAR-3 (Ebnet et al., 2000, J. Biol. Chem., 275:27979-27988; Itoh et al., 2001, J. Cell Biol., 154:491-498; Hamazaki et al., 2002, J. Biol. Chem., 277:455-461). Murine antibodies directed against the region [111-123] involved in dimer formation, so-called J3F.1 and J10.4 antibodies, are capable of inhibiting the homodimerization of JAM-A and the reconstruction of the epithelial barrier in vitro (Mandell et al., 2004, J. Biol. Chem., 279:16254-16262).

[0143] JAM-A interacts with integrin .alpha..sub.V.beta..sub.3 and is involved in the migration of endothelial cells on vitronectin, ligand of integrin .alpha..sub.V.beta..sub.3 (Naik and Naik, 2005, J. Cell Sci. 119:490-499). AntiJAM-A antibody J3F.1, in the same manner as an anti-.alpha..sub.V.beta..sub.3 antibody, inhibits the migration of endothelial cells and the angiogenesis induced by bFGF in vitro (Naik et al., 2003, Blood, 102:2108-2114). Various signaling pathways were demonstrated in endothelial cells: MAP kinases, PI3-kinase and PKC (Naik et Naik, 2005, J. Cell Sci., 119:490-499; Naik et al., 2003, Blood, 102:2108-2114; Naik et al., 2003, Artherioscler. Thromb. Vasc. Biol., 23:2165-2171).

[0144] JAM-A is also expressed in monocytes, lymphocytes, neutrophils and platelets (Williams et al., 1999, Mol. Immunol., 36:1175-1188). JAM-A protein was however initially identified as a receptor of the F11 antibody, an antibody capable of activating platelets and inducing their aggregation (Naik et al., 1995, Biochem. J., 310:155-162; Sobocka et al., 2000, Blood, 95:2600-2609). Peptides [28-60] and [97-109] belong to the F11 antibody epitope and are involved in platelet activation and aggregation phenomena and in homodimerization (Babinska et al., 2002, Thromb. Haemost., 87:712-721).

[0145] Rat antibody BV11, directed against the murine form of JAM-A, inhibits the trans-endothelial migration of monocytes in vitro and in vivo (Del Maschio et al., 1999, J. Exp. Med., 190:1351-1356). Ostermann and colleagues (2002, Nature Immunol., 3:151-158) showed that JAM-A was a ligand of .alpha..sub.L.beta..sub.2 or LFA-1 (lymphocyte function-associated antigen 1) integrin, which is overexpressed in response to certain chemokines during the development of an anti-inflammatory response and is required for the diapedesis or migration of leukocytes to the site of inflammation. JAM-A, via the second Ig-like domain, contributes to the adhesion and trans-endothelial migration of T lymphocytes and neutrophils (Ostermann et al., 2002, Nature Immunol., 3:151-158), and thus plays an important role in the recruitment of leukocytes to the site of inflammation.

[0146] JAM-A protein is also implicated in viral infection phenomena. JAM-A is indeed a receptor of reovirus, viruses responsible for certain types of encephalitis by means of interacting with attachment protein .sigma.1 (Barton et al., 2001, Cell 104:441-451). AntiJAM-A antibody J10.4 inhibits the binding of reovirus to JAM-A (Forrest et al., 2003, J. Biol. Chem., 278:48434-48444).

[0147] To date, none of the antibodies mentioned above directed against the human form of JAM-A exhibit activity in vivo, much less anti-tumor activity. Such antibodies are used only as research tools. Thus, in the former art, there is a genuine lack of an anti-tumor antibody active in vitro and in vivo.

[0148] According to a specific aspect, the antibody of the invention, or its derived compounds or functional fragments, is characterized in that it is capable of specifically binding to JAM-A protein (according to the English nomenclature "Junctional Adhesion Molecules").

[0149] According to still another aspect, the antibody of the invention, or its derived compounds or functional fragments, is characterized in that it exhibits a K.sub.D for JAM-A from roughly 1 nM and roughly 1 pM. More preferably, said K.sub.D for JAM-A is from roughly 10 pM and roughly 40 pM.

[0150] The expression "K.sub.D" refers to the dissociation constant of a given antibody-antigen complex. K.sub.D=K.sub.off/K.sub.on with K.sub.off consisting of the "off rate" constant for the dissociation of the antibody from the antibody-antigen complex and K.sub.on consisting of the level at which the antibody binds the antigen (Chen Y. et al., 1999, J. Mol. Biol., 293:865-881).

[0151] A novel aspect of the present invention relates to an isolated nucleic acid characterized in that it is selected among the following nucleic acids (including any degenerate genetic code):

[0152] a) a nucleic acid, DNA or RNA, coding for an antibody according to the invention, or one of its derived compounds or functional fragments;

[0153] b) a nucleic acid complementary to a nucleic acid as defined in a);

[0154] c) a nucleic acid of at least 18 nucleotides capable of hybridizing under highly stringent conditions with at least one of the CDRs of nucleic acid sequences SEQ ID Nos. 20 to 31 or with a sequence with at least 80%, preferably 85%, 90%, 95% and 98%, identity after optimal alignment with sequence SEQ ID Nos. 20 to 31; and

[0155] d) a nucleic acid of at least 18 nucleotides capable of hybridizing under highly stringent conditions with at least the light chain of nucleic acid sequence SEQ ID No. 32 or 36 and/or the heavy chain of nucleic acid sequence SEQ ID No. 33, 37 or 38, or with a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 32 or 36 and/or 33, 37 or 38.

[0156] Table 4 below summarizes the various nucleotide sequences concerning the antibody of the invention.

TABLE-US-00008 TABLE 4 CDR SEQ ID Antibody numbering Heavy chain Light chain NO. 6F4 Common CDR-L1 20 CDR-L2 22 CDR-L3 24 CDR-H1 21 CDR-H2 23 CDR-H3 25 IMGT CDR-L1 20 CDR-L2 22 CDR-L3 24 CDR-H1 26 CDR-H2 23 CDR-H3 27 Kabat CDR-L1 28 CDR-L2 29 CDR-L3 24 CDR-H1 30 CDR-H2 31 CDR-H3 25 Mu. variable 32 domain Mu. variable 33 domain Mu. entire 34 Mu. entire 35 Hu. variable 36 domain Hu. variable 37 domain (V1) Hu. variable 38 domain (V2)

[0157] The terms "nucleic acid", "nucleic sequence", "nucleic acid sequence", "polynucleotide", "oligonucleotide", "polynucleotide sequence" and "nucleotide sequence", used interchangeably in the present description, mean a precise sequence of nucleotides, modified or not, defining a fragment or a region of a nucleic acid, containing unnatural nucleotides or not, and being either a double-strand DNA, a single-strand DNA or transcription products of said DNAs.

[0158] It should also be included here that the present invention does not relate to nucleotide sequences in their natural chromosomal environment, i.e., in a natural state. The sequences of the present invention have been isolated and/or purified, i.e., they were sampled directly or indirectly, for example by a copy, their environment having been at least partially modified. Isolated nucleic acids obtained by recombinant genetics, by means, for example, of host cells, or obtained by chemical synthesis should also be mentioned here.

[0159] "Nucleic sequences exhibiting a percentage identity of at least 80%, preferably 85%, 90%, 95% and 98%, after optimal alignment with a preferred sequence" means nucleic sequences exhibiting, with respect to the reference nucleic sequence, certain modifications such as, in particular, a deletion, a truncation, an extension, a chimeric fusion and/or a substitution, notably punctual. Preferably, these are sequences which code for the same amino acid sequences as the reference sequence, this being related to the degeneration of the genetic code, or complementarity sequences that are likely to hybridize specifically with the reference sequences, preferably under highly stringent conditions, notably those defined below.

[0160] Hybridization under highly stringent conditions means that conditions related to temperature and ionic strength are selected in such a way that they allow hybridization to be maintained from two complementarity DNA fragments. On a purely illustrative basis, the highly stringent conditions of the hybridization step for the purpose of defining the polynucleotide fragments described above are advantageously as follows.

[0161] DNA-DNA or DNA-RNA hybridization is carried out in two steps: (1) prehybridization at 42.degree. C. for three hours in phosphate buffer (20 mM, pH 7.5) containing 5.times.SSC (1.times.SSC corresponds to a solution of 0.15 M NaCl+0.015 M sodium citrate), 50% formamide, 7% sodium dodecyl sulfate (SDS), 10.times. Denhardt's, 5% dextran sulfate and 1% salmon sperm DNA; (2) primary hybridization for 20 hours at a temperature depending on the length of the probe (i.e.: 42.degree. C. for a probe>100 nucleotides in length) followed by two 20-minute washings at 20.degree. C. in 2.times.SSC+2% SDS, one 20-minute washing at 20.degree. C. in 0.1.times.SSC+0.1% SDS. The last washing is carried out in 0.1.times.SSC+0.1% SDS for 30 minutes at 60.degree. C. for a probe>100 nucleotides in length. The highly stringent hybridization conditions described above for a polynucleotide of defined size can be adapted by a person skilled in the art for longer or shorter oligonucleotides, according to the procedures described in Sambrook, et al. (Molecular cloning: a laboratory manual, Cold Spring Harbor Laboratory; 3rd edition, 2001).

[0162] The invention also relates to a vector comprising a nucleic acid as described in the invention.

[0163] The invention notably targets cloning and/or expression vectors that contain such a nucleotide sequence.

[0164] The vectors of the invention preferably contain elements which allow the expression and/or the secretion of nucleotide sequences in a given host cell. The vector thus must contain a promoter, translation initiation and termination signals, as well as suitable transcription regulation regions. It must be able to be maintained in a stable manner in the host cell and may optionally have specific signals which specify secretion of the translated protein. These various elements are selected and optimized by a person skilled in the art according to the host cell used. For this purpose, the nucleotide sequences can be inserted in self-replicating vectors within the selected host or be integrative vectors of the selected host.

[0165] Such vectors are prepared by methods typically used by a person skilled in the art and the resulting clones can be introduced into a suitable host by standard methods such as lipofection, electroporation, heat shock or chemical methods.

[0166] The vectors are, for example, vectors of plasmid or viral origin. They are used to transform host cells in order to clone or express the nucleotide sequences of the invention.

[0167] The invention also comprises host cells transformed by or comprising a vector as described in the present invention.

[0168] The host cell can be selected among prokaryotic or eukaryotic systems such as bacterial cells, for example, but also yeast cells or animal cells, notably mammal cells. Insect or plant cells can also be used.

[0169] The invention also relates to animals, other than man, that have a transformed cell according to the invention.

[0170] Another aspect of the invention relates to a method for the production of an antibody according to the invention, or one of its functional fragments, characterized in that said method comprises the following steps:

[0171] a) the culture in a medium of and the suitable culture conditions for a host cell according to the invention; and

[0172] b) the recovery of said antibody, or one of its functional fragments, thus produced from the culture medium or from said cultured cells.

[0173] The transformed cells according to the invention are of use in methods for the preparation of recombinant polypeptides according to the invention. Methods for the preparation of polypeptide according to the invention in recombinant form, characterized in that said methods use a vector and/or a cell transformed by a vector according to the invention, are also comprised in the present invention. Preferably, a cell transformed by an vector according to the invention is cultured under conditions that allow the expression of the aforesaid polypeptide and recovery of said recombinant peptide.

[0174] As already mentioned, the host cell can be selected among prokaryotic or eukaryotic systems. In particular, it is possible to identify the nucleotide sequences of the invention that facilitate secretion in such a prokaryotic or eukaryotic system. An vector according to the invention carrying such a sequence can thus be used advantageously for the production of recombinant proteins to be secreted. Indeed, the purification of these recombinant proteins of interest will be facilitated by the fact that they are present in the supernatant of the cellular culture rather than inside host cells.

[0175] The polypeptides of the invention can also be prepared by chemical synthesis. One such method of preparation is also an object of the invention. A person skilled in the art knows methods for chemical synthesis, such as solid-phase techniques (see notably Steward et al., 1984, Solid phase peptides synthesis, Pierce Chem. Company, Rockford, 111, 2nd ed.) or partial solid-phase techniques, by condensation of fragments or by conventional synthesis in solution. Polypeptides obtained by chemical synthesis and capable of containing corresponding unnatural amino acids are also comprised in the invention.

[0176] The antibodies, or the derived compounds or functional fragments of same, likely to be obtained by the method of the invention are also comprised in the present invention.

[0177] According to still another aspect, the present invention relates to an antibody as described above, characterized in that it is, in addition, capable of specifically binding to a human tyrosine kinase family receptor and/or capable of specifically inhibiting the tyrosine kinase activity of such a receptor.

[0178] According to a novel embodiment, the invention relates to an antibody, or its derived compounds or functional fragments, consisting of an antibody that is bispecific in the sense that it comprises a second motif capable of interacting with any receptor implicated in the development of tumors, such as, for example, VEGFR, VEGF, EGFR, IGF-1R, HER2neu, HGF, cMET, FGF, tetraspanins, integrins, CXCR4 or CXCR2.

[0179] According to a first embodiment, one such antibody consists of a bispecific antibody and comprises a second motif that specifically inhibits the binding of EGF with human epidermal growth factor receptor (EGFR) and/or specifically inhibiting the tyrosine kinase activity of said EGFR. According to an even more preferred aspect of the invention, said second anti-EGFR motif arises from the monoclonal antibody cetuximab (C225 or erbitux), matuzumab, huR3, HuMax-EGFR or panitumab.

[0180] According to a second embodiment, the antibody according to the invention consists of a bispecific antibody and comprises a second motif specifically inhibiting the activity modulated by the HER2/neu receptor and/or specifically inhibiting the tyrosine kinase activity of said HER2/neu receptor. More particularly, said second antiHER2/neu motif arises from the mouse monoclonal antibody 4D5 or 2C4 or from the humanized antibody trastuzumab or pertuzumab.

[0181] According to a third embodiment, the antibody according to the invention consists of a bispecific antibody and comprises a second motif specifically inhibiting the binding of hepatocyte growth factor (HGF) with the cMET receptor and/or specifically inhibiting the tyrosine kinase activity of said cMET receptor.

[0182] According to a fourth embodiment, the antibody according to the invention consists of a bispecific antibody and comprises a second motif specifically inhibiting the activity modulated by the IGF-1R receptor and/or specifically inhibiting the tyrosine kinase activity of said IGF-1R receptor. More particularly, said second antiIGF-1R motif arises from mouse monoclonal antibody 7C10, from corresponding humanized antibody h7C10 (Goetsch et al., international patent application WO 03/059951), from hEM164 antibodies (Maloney et al., Cancer Res., 2003, 63 (16):5073-5083), from the antiIGF-1R antibodies developed by Abgenix (see US patent application 2005/281812) or from Mab 39, 1H7 (Li et al., Cancer Immunol. Immunother., 2000, 49(4-5):243-252) or 4G11 (Jackson-Booth et al., Horm. Metab. Res., 2003, 35(11-12):850-856).

[0183] Lastly, according to a final embodiment, the antibody of the invention consists in a bispecific antibody and comprises a second motif capable of interacting with any type of receptor implicated in tumor development, such as, as non-limiting examples, VEGFR, VEGF, FGF (fibroblast growth factor) or any member of the CXCR (chemokine receptor) family, such as CXCR2 or CXCR4.

[0184] Also suitable for mention are antiCD20 antibodies such as a rituximab, ibritumomab or tositumomab; antiCD33 antibodies such as gemtuzumab or lintuzumab; antiCD22 antibodies such as epratuzumab; antiCD52 antibodies such as alemtuzumab; antiEpCAM antibodies such as edrecolomab, Ch 17-1A or IGN-101; antiCTP21 or 16 antibodies such as Xactin; antiDNA-Ag antibodies such as .sup.131I-Cotara TNT-1; antiMUC1 antibodies such as pemtumomab or R1150; antiMUC18 antibodies such as ABX-MA1; antiGD3 antibodies such as mitumomab; antiECA antibodies such as CeaVac or labetuzumab; antiCA125 antibodies such as OvaRex; antiHLA-DR antibodies such as apolizumab; antiCTLA4 antibodies such as MDX-010; antiPSMA antibodies such as MDX-070, .sup.111In & .sup.90Y-J591, .sup.177Lu J591, J591-DM1; antiLewis Y antibodies such as IGN311; antiangiogenesis antibodies such as AS1405 and 90YmuBC1; antiTrail-R1 antibodies such as TRAIL R1mAb or TRAIL R2mAb.

[0185] The bispecific or bifunctional antibodies constitute a second generation of monoclonal antibodies in which two different variable regions are combined in the same molecule (Hollinger and Bohlen, 1999, Cancer and metastasis, rev. 18:411-419). Their utility was demonstrated in both diagnostic and therapeutic domains relative to their capacity to recruit new effector functions or to target several molecules on the surface of tumor cells; such antibodies can be obtained by chemical methods (Glennie M J et al., 1987, J. Immunol. 139, 2367-2375; Repp R. et al., 1995, J. Hemat., 377-382) or somatic methods (Staerz U. D. and Bevan M. J., 1986, PNAS 83, 1453-1457; Suresh M. R. et al., 1986, Method Enzymol., 121:210-228) but also, preferentially, by genetic engineering techniques that make it possible to force heterodimerization and thus facilitate the purification of the antibody sought (Merchand et al., 1998, Nature Biotech., 16:677-681).

[0186] These bispecific antibodies can be constructed as whole IgG, bispecific Fab'2, Fab'PEG, diabodies or bispecific scFv, but also as a tetravalent bispecific antibody in which two binding sites are present for each antigen targeted (Park et al., 2000, Mol. Immunol., 37(18):1123-30) or the fragments of same as described above.

[0187] In addition to an economic advantage given that the production and administration of a bispecific antibody are cheaper than the production of two specific antibodies, the use of such bispecific antibodies has the advantage of reducing the treatment's toxicity. Indeed, the use of a bispecific antibody makes it possible to decrease the overall quantity of circulating antibodies and, consequently, possible toxicity.

[0188] In a preferred embodiment of the invention, the bispecific antibody is a bivalent or tetravalent antibody.

[0189] Lastly, the present invention relates to the antibody described above, or its derived compounds or functional fragments, for use as a drug.

[0190] The invention also relates to a pharmaceutical composition comprising as an active ingredient a compound consisting of an antibody of the invention, or one of its derived compounds or functional fragments. Preferably, said antibody is supplemented by an excipient and/or a pharmaceutically acceptable carrier.

[0191] According to still another embodiment, the present invention also relates to a pharmaceutical composition as described above that comprises at least a second anti-tumor compound selected among the compounds capable of specifically inhibiting the tyrosine kinase activity of receptors such as IGF-IR, EGFR, HER2/neu, cMET, VEGFR or VEGF, or any other anti-tumor compound known to a person skilled in the art. In a second preferred aspect of the invention, said second compound can be selected among the antibodies antiEGFR, antiIGF-IR, antiHER2/neu, anticMET, VEGFR, VEGF, etc., isolated, or their functional fragments and derived compounds, capable of inhibiting the proliferative and/or anti-apoptotic and/or angiogenic and/or inductive activity of metastatic dissemination promoted by said receptors.

[0192] According to still another embodiment of the invention, the composition comprises, in addition, as a combination product for use in a simultaneous, separated or extended fashion, at least one inhibiter of the tyrosine kinase activity of receptors such as IGF-IR, EGFR, HER2/neu, cMET and VEGFR.

[0193] In another preferred embodiment, said inhibiter of the tyrosine kinase activity of these receptors is selected from the group comprising derived natural agents, dianilinophthalimides, pyrazolo- or pyrrolo-pyridopyrimidines or quinazolines. Such inhibiting agents, well-known to a person skilled in the art, are described in the literature (Ciardiello F., Drugs 2000, Suppl. 1, 25-32).

[0194] Another embodiment complementary to the invention consists of a composition as described above comprised of, in addition, as a combination product for simultaneous, separated or extended use, a cytotoxic/cytostatic agent.

[0195] "Simultaneous use" means the administration of both compounds of the composition comprised in a single dosage form.

[0196] "Separated use" means administration, at the same time, of both compounds of the composition, comprised in distinct dosage forms.

[0197] "Extended use" means the successive administration of both compounds of the composition, each comprised in a distinct dosage form.

[0198] Generally, the composition according to the invention considerably increases cancer treatment effectiveness. In other words, the therapeutic effect of the antibody of the invention is enhanced in an unexpected way by the administration of a cytotoxic agent. Another major subsequent advantage produced by a composition of the invention relates to the possibility of using lower effective doses of the active ingredient, thus making it possible to avoid or reduce the risks of the appearance of side effects, in particular the effect of the cytotoxic agent. Moreover, this composition makes it possible to achieve the expected therapeutic effect more quickly.

[0199] "Therapeutic anticancer agent" or "cytotoxic agent" means a substance which, when it is administered to a patient, treats or prevents the development of cancer in the patient. Non-limiting examples of such agents include "alkylating" agents, antimetabolites, antitumor antibiotics, mitotic inhibitors, inhibitors of chromatin functioning, antiangiogenics, antiestrogens, antiandrogens and immunomodulators.

[0200] Such agents, for example, are cited in VIDAL, on the page devoted to compounds related to oncology and hematology under the heading "Cytotoxic"; the cytotoxic compounds cited by reference to this document are cited herein as preferred cytotoxic agents.

[0201] "Alkylating agent" refers to any substance that can bind covalently with or can alkylate any molecule, preferentially a nucleic acid (e.g., DNA), within a cell. Examples of such alkylating agents include nitrogen mustards such as mechlorethamine, chlorambucil, melphalan, chlorhydrate, pipobroman, prednimustine, disodium phosphate or estramustine; oxazaphosphorines such as cyclophosphamide, altretamine, trofosfamide, sulfofosfamide or ifosfamide; aziridines or ethylene-imines such as thiotepa, triethyleneamine or altetramine; nitrosoureas such as carmustine, streptozocine, fotemustine or lomustine; alkyl sulfonates such as busulfan, treosulfan or improsulfan; triazenes such as dacarbazine; or platinum complexes such as cisplatine, oxaliplatine or carboplatine.

[0202] "Antimetabolite" refers to a substance that blocks growth and/or cellular metabolism by interfering with certain activities, generally DNA synthesis. Examples of antimetabolites include methotrexate, 5-fluorouracile, floxuridine, 5-fluorodeoxyuridine, capecitabine, cytarabine, fludarabine, cytosine arabinoside, 6-mercaptopurine (6-MP), 6-thioguanine (6-TG), chlorodesoxyadenosine, 5-azacytidine, gemcitabine, cladribine, deoxycoformycin and pentostatin.

[0203] "Antitumor antibiotic" refers to a compound that can prevent or inhibit the synthesis of DNA, RNA and/or proteins. Examples of such antitumor antibiotics include doxorubicin, daunorubicin, idarubicin valrubicin, mitoxantrone, dactinomycin, mithramycin, plicamycin, mitomycin C, bleomycin and procarbazine.

[0204] "Mitotic inhibiters" prevent the normal progression of the cell cycle and mitosis. In general, microtubule inhibiters or "taxoids" such as paclitaxel and docetaxel are capable of inhibiting mitosis. The vinca alkaloids, such as vinblastine, vincristine, vindesine and vinorelbine, are also capable of inhibiting mitosis.

[0205] "Chromatin inhibiters" or "topoisomerase inhibiters" are substances that inhibit the normal functioning of proteins that shape chromatin, such as topoisomerases I and II. Examples of such inhibiters include, for topoisomerase I, camptothecine and its derivatives, such as irinotecan or topotecan; for topoisomerase II, etoposide, etiposide phosphate and teniposide.

[0206] An "antiangiogenic" is any drug, compound, substance or agent that inhibits the growth of the blood vessels. Examples of antiangiogenics include, without being limiting, razoxin, marimastat, batimastat, prinomastat, tanomastat, ilomastat, CGS-27023A, halofuginone, COL-3, neovastat, BMS-275291, thalidomide, CDC 501, DMXAA, L-651582, squalamine, endostatine, SU5416, SU6668, interferon-alpha, EMD121974, interleukin-12, IM862, angiostatin and vitaxin.

[0207] "Antiestrogen" or "estrogen antagonist" refers to any substance that decreases, antagonizes or inhibits estrogen action. Examples of such agents are tamoxifene, toremifene, raloxifene, droloxifene, iodoxyfene, anastrozole, letrozole and exemestane.

[0208] "Antiandrogen" or "androgen antagonist" refers to any substance that reduces, antagonizes or inhibits androgen action. Examples of antiandrogens include flutamide, nilutamide, bicalutamide, sprironolactone, cyproterone acetate, finasteride and cimitidine.

[0209] Immunomodulators are substances that stimulate the immune system. Examples of immunomodulators include interferon, interleukins such as aldesleukin, OCT-43, denileukin diftitox or interleukine-2, tumor necrosis factors such as tasonermine, or other types of immunomodulators such as lentinan, sizofiran, roquinimex, pidotimod, pegademase, thymopentine, poly I:C or levamisole in combination with 5-fluorouracil.

[0210] For further details, a person skilled in the art can refer to the manual published by the French Association of Therapeutic Chemistry Teachers titled "Therapeutic chemistry, vol. 6, Antitumor drugs and perspectives in the treatment of cancer, TEC and DOC edition, 2003 [in French]".

[0211] In a particularly preferred embodiment, said composition of the invention as a combination product is characterized in that said cytotoxic agent is bound chemically to said antibody for use simultaneously.

[0212] In a particularly preferred embodiment, said composition is characterized in that said cytotoxic/cytostatic agent is selected among the spindle inhibitors or stabilizers, preferably vinorelbine and/or vinflunine and/or vincristine.

[0213] In order to facilitate binding from said cytotoxic agent and the antibody according to the invention, spacer molecules can be introduced from the two compounds to bind, such as the poly(alkylene)glycol polyethyleneglycol or the amino acids; or, in another embodiment, said cytotoxic agents' active derivatives, into which have been introduced functions capable of reacting with said antibody, can be used. These binding techniques are well-known to a person skilled in the art and will not be discussed in more detail in the present description.

[0214] Other EGFR inhibiters include, without being limiting, monoclonal antibodies C225 and antiEGFR 22Mab (ImClone Systems Incorporated), ABX-EGF (Abgenix/Cell Genesys), EMD-7200 (Merck KgaA) or compounds ZD-1834, ZD-1838 and ZD-1839 (AstraZeneca), PKI-166 (Novartis), PKI-166/CGP-75166 (Novartis), PTK 787 (Novartis), CP 701 (Cephalon), flunomide (Pharmacia/Sugen), CI-1033 (Warner Lambert Parke Davis), CI-1033/PD 183, 805 (Warner Lambert Parke Davis), CL-387, 785 (Wyeth-Ayerst), BBR-1611 (Boehringer Mannheim GMBH/Roche), Naamidine A (Bristol-board Myers Squibb), RC-3940-II (Pharmacia), BIBX-1382 (Boehringer Ingelheim), OLX-103 (Merck & Co), VRCTC-310 (Ventech Research), EGF fusion toxin (Seragen Inc.), DAB-389 (Seragen/Lilgand), ZM-252808 (Imperial Cancer Research Fund), RG-50864 (INSERM), LFM-A12 (Parker Hughes Center Cancer), WHI-P97 (Parker Hughes Center Cancer), GW-282974 (Glaxo), KT-8391 (Kyowa Hakko) or the "EGFR vaccine" (York Medical/Centro of Immunologia Molecular).

[0215] Another aspect of the invention relates to a composition characterized in that at least one of said antibodies, or of the derived compounds or functional fragments of same, is conjugated with a cellular toxin and/or a radioisotope.

[0216] Preferably, said toxin or said radioisotope is capable of preventing the growth or proliferation of the tumor cell, notably of completely inactivating said tumor cell.

[0217] Also preferably, said toxin is an enterobacteria toxin, notably Pseudomonas exotoxin A.

[0218] The radioisotopes preferentially combined with therapeutic antibodies are radioisotopes that emit gamma rays, preferentially iodine.sup.131, yttrium.sup.90, gold.sup.199, palladium.sup.100, copper.sup.67, bismuth.sup.217 and antimony.sup.211. Radioisotopes that emit alpha and beta rays can also be used in therapy.

[0219] "Toxin or radioisotope combined with at least one antibody of the invention, or a functional fragment of same" refers to any means that makes it possible to bind said toxin or said radioisotope to that at least one antibody, notably by covalent binding from the two compounds, with or without the introduction of the binding molecule.

[0220] Examples of agents that allow chemical (covalent), electrostatic, or non-covalent bonding of all or part of the conjugate's elements include, in particular, benzoquinone, carbodiimide and more particularly EDC (1-ethyl-3-[3-dimethyl-aminopropyl]-carbodiimide-hydrochloride), dimaleimide, dithiobis-nitrobenzoic (DTNB) acid, N-succinimidyl S-acetyl thio-acetate (SATA), bridging agents with one or more groups, with one or more phenylaside groups, reacting with ultraviolet (UV) rays, most preferentially N-[-4(azidosalicylamino)butyl]-3'-(2'-pyridyldithio)-propionamide (APDP), N-succinimid-yl 3(2-pyridyldithio)propionate (SPDP) and 6-hydrazino-nicotinamide (HYNIC).

[0221] Another form of binding, notably for radioisotopes, can consist of the use of bifunctional ion chelating agents.

[0222] Examples of such chelators include the chelators derived from EDTA (ethylenediaminetetraacetic acid) or DTPA (d iethylenetriaminepentaacetic acid) which were developed to bind metals, particularly radioactive metals, with immunoglobulins. Thus, DTPA and its derivatives can be substituted on the carbon chain by various groups in such a way as to increase the stability and the rigidity of the ligand-metal complex (Krejcarek et al., 1977; Brechbiel et al., 1991; Gansow, 1991; U.S. Pat. No. 4,831,175).

[0223] For example, DTPA (diethylenetriaminepentaacetic acid) and its derivatives, which long have been widely used in drug and biology either in its free form or in a complex with a metal ion, exhibit the remarkable characteristic of forming stable chelates with metal ions which can be coupled with proteins of therapeutic or diagnostic interest, such as antibodies, for the development of radio-immuno conjugates for cancer therapy (Meases et al., 1984; Gansow et al., 1990).

[0224] Also preferably, said at least one antibody of the invention forming said conjugate is selected among its functional fragments, notably fragments that have lost their Fc component, such as scFv fragments.

[0225] The present invention also comprises the use of the composition for the preparation of a drug intended for the prevention or the treatment of cancer.

[0226] The present invention also relates to the use of an antibody, or a derived compound or functional fragment of same, preferably humanized, and/or of a composition according to the invention for the preparation of a drug for inhibiting the growth of tumor cells. Generally, the present invention relates to the use of an antibody, or a derived compound or functional fragment of same, preferably humanized, and/or of a composition, for the preparation of a drug for cancer prevention or treatment.

[0227] Preferred cancers that can be prevented and/or treated include prostate cancer, osteosarcoma, lung cancer, breast cancer, endometrial cancer, colon cancer, multiple myeloma, ovarian cancer, pancreatic cancer or any other cancer.

[0228] In a preferred manner, said cancer is a cancer selected among estrogen-related breast cancer, non-small cell lung cancer, colon cancer and/or pancreatic cancer.

[0229] Another aspect of the present invention relates to the use of the antibody as described in a diagnostic method, preferably in vitro, of diseases related to JAM-A expression level. Preferably, said JAM-A protein related diseases in said diagnostic method will be cancers.

[0230] Thus, the antibodies of the invention, or the derived compounds or functional fragments of same, can be employed in a method for the detection and/or quantification of JAM-A protein in a biological sample in vitro, notably for the diagnosis of diseases associated with an abnormal expression with this protein, such as cancers, wherein said method comprises the following steps:

[0231] a) placing the biological sample in contact with an antibody according to the invention, or a derived compound or functional fragment of same;

[0232] b) demonstrating the antigen-antibody complex possibly formed.

[0233] Thus, the present invention also comprises the kits or accessories for the implementation of a method as described (for detecting the expression of a gene from Legionella pneumophila Paris or from an associated organism, or for detecting and/or identifying Legionella pneumophila Paris bacteria or associated microorganisms), comprising the following elements:

[0234] a) a polyclonal or monoclonal antibody of the invention;

[0235] b) optionally, reagents for constituting the medium favorable to immunological reactions;

[0236] c) optionally, reagents that reveal the antigen-antibodies complexes produced by the immunological reaction.

[0237] Advantageously, the antibodies or functional fragments of same can be immobilized on a support, notably a protein chip. One such protein chip is an object of the invention.

[0238] Advantageously, the protein chips can be used in the kits or accessories required for detecting and/or quantifying JAM-A protein in a biological sample.

[0239] It must be stated that the term "biological sample" relates herein to samples taken from a living organism (notably blood, tissue, organ or other samples taken from a mammal, notably man) or any sample likely to contain one such JAM-A protein (such as a sample of cells, transformed if needed).

[0240] Said antibody, or a functional fragment of same, can be in the form of an immunoconjugate or of a labeled antibody in order to obtain a detectable and/or quantifiable signal.

[0241] The labeled antibodies of the invention, or the functional or fragments of same, include, for example, antibody conjugates (immunoconjugates), which can be combined, for example, with enzymes such as peroxidase, alkaline phosphatase, .alpha.-D-galactosidase, glucose oxidase, glucose amylase, carbonic anhydrase, acetyl-cholinesterase, lysozyme, malate dehydrogenase or glucose-6 phosphate dehydrogenase or by a molecule such as biotin, digoxigenin or 5-bromo-desoxyuridine. Fluorescent labels can be also combined with the antibodies of the invention or functional fragments of same, including notably fluorescein and its derivatives, fluorochrome, rhodamine and its derivatives, green fluorescent protein (GFP), dansyl, umbelliferone, etc. In such conjugates, the antibodies of the invention or functional fragments of same can be prepared by methods known to a person skilled in the art. They can be bound with enzymes or fluorescent labels directly; via a spacer group or a linkage group such as polyaldehyde, glutaraldehyde, ethylenediaminetetraacetic acid (EDTA) or diethylenetriaminepentaacetic acid (DPTA); or in the presence of binding agents such as those mentioned above for therapeutic conjugates. Conjugates carrying fluorescein labels can be prepared by reaction with an isothiocyanate.

[0242] Others conjugates can also include chemiluminescent labels such as luminol and dioxetane, bioluminescent labels such as luciferase and luciferin, or radioactive labels such as iodine.sup.123, iodine.sup.125, iodine.sup.126, iodine.sup.133, bromine.sup.77, technetium99m, indium.sup.111, indium.sup.113m, gallium.sup.67, gallium.sup.68, ruthenium.sup.95, ruthenium.sup.97, ruthenium.sup.103, ruthenium.sup.105, mercury.sup.107, mercury.sup.203, rhenium.sup.99m, rhenium.sup.101, rhenium.sup.105, scandium.sup.47, tellurium.sup.121m, tellurium.sup.122m, tellurium.sup.125m, thulium.sup.165, thulium.sup.187, thulium.sup.168, fluorine.sup.18, yttrium.sup.199 and iodine.sup.131. Existing methods known to a person skilled in the art for binding radioisotopes with antibodies, either directly or via a chelating agent such as the EDTA or DTPA mentioned above, can be used for as diagnostic radioisotopes. Thus should be mentioned labeling with [I.sup.125]Na by the chloramine-T technique [Hunter W. M. and Greenwood F. C. (1962) Nature 194:495]; labeling with technetium.sup.99m as described by Crockford et al. (U.S. Pat. No. 4,424,200) or bound via DTPA as described by Hnatowich (U.S. Pat. No. 4,479,930).

[0243] The invention also relates to the use of an antibody according to the invention for the preparation of a drug for the specific targeting of a compound that is biologically active toward cells expressing or overexpressing JAM-A protein.

[0244] In the sense of the present description, a "biologically active compound" is any compound capable of modulating, notably inhibiting, cellular activity, notably growth, proliferation, transcription and gene translation.

[0245] The invention also relates to an in vivo diagnostic reagent composed of an antibody according to the invention, or a functional fragment of same, preferably labeled, notably radiolabeled, and its use in medical imaging, notably for the detection of cancer related to the cellular expression or overexpression of JAM-A protein.

[0246] The invention also relates to a composition as a combination product or to an anti-JAM-A/toxin conjugate or radioisotope, according to the invention, used as drug.

[0247] Preferably, said composition as a combination product or said conjugate will be supplemented by an excipient and/or a pharmaceutical vehicle.

[0248] In the present description, "pharmaceutical vehicle" means a compound, or a combination of compounds, entering a pharmaceutical composition that does not cause secondary reactions and that, for example, facilitates administration of the active compounds, increases its lifespan and/or effectiveness in the organism, increases its solubility in solution or improves its storage. Such pharmaceutical carriers are well-known and will be adapted by a person skilled in the art according to the nature and the administration route of the active compounds selected.

[0249] Preferably, such compounds will be administered by systemic route, notably by intravenous, intramuscular, intradermal, intraperitoneal, subcutaneous or oral route. More preferably, the composition composed of the antibody according to the invention will be administered in several doses spaced equally over time.

[0250] Their administration routes, dosing schedules and optimal galenic forms can be determined according to the criteria generally taken into account when establishing a treatment suited to a patient such as, for example, the patient's age or body weight, the seriousness of his general state, his tolerance for the treatment and the side effects experienced.

[0251] Thus, the invention relates to the use of an antibody, or one of its functional fragments, for the preparation of a drug for the specific targeting of a compound that is biologically active toward cells expressing or overexpressing JAM-A.

[0252] Other characteristics and advantages of the invention appear further in the description with the examples and figures whose legends are presented below.

BRIEF DESCRIPTION OF THE FIGURES

[0253] FIG. 1 shows the respective sequences of the heavy (DNA sequence disclosed as SEQ ID NO: 33; protein sequence disclosed as SEQ ID NO: 14) and light (DNA sequence disclosed as SEQ ID NO: 32; protein sequence disclosed as SEQ ID NO: 13) chains of the murine 6F4 antibody. CDRs are underlined and in bold (according to the Kabat numbering).

[0254] FIGS. 2A and 2B represent the respective alignments of the V (FIG. 2A) and J (FIG. 2B) regions of murine 6F4 antibody and the murine cell lines selected, namely IGKV19-93*01 (SEQ ID No. 39) for the V region and IGKJ1*01 (SEQ ID No. 40) for the J region. FIG. 2A discloses SEQ ID NOS 13 and 69-70, respectively, in order of appearance. FIG. 2B discloses SEQ ID NOS 40, 71 and 71, respectively, in order of appearance.

[0255] FIGS. 3A and 3B represent the respective alignments of the V (FIG. 3A) and J (FIG. 3B) regions of murine 6F4 antibody and the human cell lines selected, namely IGKV1-33*01 (SEQ ID No. 41) for the V region and IGKJ1*01 (SEQ ID No. 42) for the J region. FIG. 3A discloses SEQ ID NOS 72-75, respectively, in order of appearance. FIG. 3B discloses SEQ ID NOS 76, 40 and 77-78, respectively, in order of appearance.

[0256] FIG. 4 is the protein sequence of the light chain of the 6F4 antibody (SEQ ID NO: 13) with reference to the respective KABAT and IMGT numbering systems.

[0257] FIGS. 5A, 5B and 5C represent the respective alignments of the V (FIG. 5A), D (FIG. 5B) and J (FIG. 5C) regions of the murine 6F4 antibody and the murine cell lines selected, namely IGHV1S135*01 (SEQ ID No. 43) for the V region, IgHD-ST4*01 (SEQ ID No. 44) for the D region and IgHJ2*01 (SEQ ID No. 45) for the J region. FIG. 5A discloses SEQ ID NOS 14, 79 and 54, respectively, in order of appearance. FIG. 5B discloses SEQ ID NOS 80-81, respectively, in order of appearance. FIG. 5C discloses SEQ ID NOS 82-84, respectively, in order of appearance.

[0258] FIGS. 6A, 6B and 6C represent the respective alignments of the V (FIG. 6A), D (FIG. 6B) and J (FIG. 6C) regions of the murine 6F4 antibody and the human cell lines selected, namely IGHV1-f*01 (SEQ ID No. 46) for the V region, IGHD1-1*01 (SEQ ID No. 47) for the D region and IGHJ4*01 (SEQ ID No. 48) for the J region. FIG. 6A discloses SEQ ID NOS 85-86, 57 and 46, respectively, in order of appearance. FIG. 6B discloses SEQ ID NOS 87-88, respectively, in order of appearance. FIG. 6C discloses SEQ ID NOS 89, 45, 90 and 48, respectively, in order of appearance.

[0259] FIG. 7 is the protein sequence of the heavy chain of the 6F4 antibody (SEQ ID NO: 14) with reference to the respective KABAT and IMGT numbering systems.

[0260] FIGS. 8A and 8B represent the 6F4-sepharose immunopurification of 6F4 antigen from HT-29 cell membranes. Analyses of fractions collected by SDS-PAGE electrophoresis (FIG. 8A) and western blot (FIG. 8B) are presented as well.

[0261] FIGS. 9A and 9B present an analysis by SDS-PAGE electrophoresis (FIG. 9A) and western blot (FIG. 9B) of immunopurified protein. Two purifications (#1 and #2) were performed and analyzed under reducing and in non-reducing conditions.

[0262] FIG. 10 presents an analysis by MALDI-TOF mass spectrometry of the mixture of peptides extracted after tryptic hydrolysis.

[0263] FIGS. 11A and 11B consist of the confirmation of a protein identified by western blot (non-reducing conditions): revealed using 6F4 antibody (FIG. 11A) and anti-human JAM-A polyclonal antibody (FIG. 11B).

[0264] FIG. 12 shows the specificity of the 6F4 antibody for human JAM-A protein. The quantities deposited for each protein are 250 ng, 25 ng and 10 ng.

[0265] FIG. 13 is sensorgrams obtained after 2 minutes of injection (double arrow) of the 6F4 antibody at 100 nm in HBS-EP buffer on murine JAM1 Fc protein (Flow cell #1, bottom graph) and on murine JAM1 Fc protein (Flow cell #2, top graph) with a dissociation time at 25.degree. C. of 5 minutes and a flow rate of 30 .mu.l/min (CM4: m-JAM1-Fc 501.6 RU (Fc1) and 511.5 RU (Fc2)).

[0266] FIG. 14 is sensorgrams obtained with a double reference, (Fc2-Fc1)6F4(Fc2-Fc1)HBS-EP. The curve is fitted using a Langmuir A+B binding model. The calculated kinetic parameters (black curve) are as follows: ka=(1.38.+-.0.001)*.sup.10.sup.5 M.sup.-1s.sup.-1; kd=(0.25.+-.1.58)10.sup.-6 s.sup.-1; Rmax (global fitting)=371 RU; .quadrature..sup.2=0.853.

[0267] FIG. 15 illustrates the antitumor activity of the 6F4 antibody in a xenograft model of MCF-7 cells in the Swiss nude mouse. The 6F4 antibody was tested by IP route in unpurified form (peritoneal cavity fluid), at the theoretical dose of 250 .mu.g/mouse, twice per week. The 9G4 antibody is an antibody of the same isotype (IgG1), non-relevant with respect to the activity measured.

[0268] FIG. 16 illustrates JAM-A protein expression recognized by Mab 6F4 on the surface of various tumor lines.

[0269] FIG. 17 is the sequence of the humanized 6F4 VL domain (SEQ ID NO: 91) wherein: * correspond to amino acids changed de facto to their human counterparts, 1 correspond to amino acids analyzed for their abilities to be humanized, the human residue being indicated below the sign, and 2 correspond to amino acids that remain murin in the humanized 6F4 VL domain.

[0270] FIG. 18 is the sequence of the humanized 6F4 VH domain (SEQ ID NO: 92) wherein: * correspond to amino acids changed de facto to their human counterparts, 1 correspond to amino acids analysed for their abilities to be humanized, the human residue being indicated below the sign, and 2 correspond to amino acids that remain murin in the humanized 6F4 VH domain.

[0271] FIG. 19 illustrates the in vitro JAM-A down-regulation induced by the 6F4 MAb.

[0272] FIG. 20 illustrates the in vivo inhibition of tumor cell proliferation induced by the 6F4 MAb.

[0273] FIG. 21 is the in vivo down-regulation of JAM-A by the 6F4 Mab.

[0274] FIG. 22 is curves of the Comparison of 6F4 and its F(ab').sub.2 fragment on the MCF-7 in vivo model.

[0275] FIG. 23 illustrates the comparison of normal versus tumoral expression of JAM-A on thyroid tissues.

[0276] FIG. 24 illustrates the comparison of normal versus tumoral expression of JAM-A on lung tissues.

[0277] FIG. 25 illustrates the comparison of normal versus tumoral expression of JAM-A on Breast tissues.

[0278] FIG. 26 is curves illustrating the in vivo activity of 6F4 on A431 epidermoid carcinoma xenograft in nude mice.

[0279] FIG. 27 illustrates the effect of the 6F4 antibody on A. non specific lyphoproliferation induced with PHA and B. antigen presentation process. First experiment with 2 independent donors.

[0280] FIG. 28 illustrates the effect of the 6F4 antibody on A. non specific lyphoproliferation induced with PHA and B. antigen presentation process. Second experiment with 2 independent donors.

[0281] FIG. 29 illustrates the platelet aggregation on 10 human normal donors. Results are expected as mean+/-sd.

[0282] FIG. 30 is the serotonine release on 10 human normal donors. Results are expected as mean+/-sd.

[0283] FIG. 31 is the alignment of the 6F4 VH domain and IGHV1-03*01 germline gene (SEQ ID No. 49). Figure discloses SEQ ID NOS 93-95, respectively, in order of appearance.

[0284] FIG. 32 is the IGKV1-27*01 based humanized version of 6F4 VL with mentioned mutations (BU-L1). Figure discloses SEQ ID NOS 13 and 96-97, respectively, in order of appearance.

[0285] FIG. 33 is the IGKV1D-43*01 based humanized version of 6F4 VL with mentioned mutations (BU-L2). Figure discloses SEQ ID NOS 13 and 98-99, respectively, in order of appearance.

[0286] FIG. 34 is the IGHV1-3*01 based humanized version of 6F4 VH with mentioned mutations (BU-H1). Figure discloses SEQ ID NOS 14 and 100-101, respectively, in order of appearance.

[0287] FIG. 35 is the IGHV1-46*01 based humanized version of 6F4 VH with mentioned mutations (BU-H2). Figure discloses SEQ ID NOS 14, 102 and 101, respectively, in order of appearance.

[0288] In order to further illustrate the present invention and the advantages thereof, the following specific examples are given, it being understood that same are intended only as illustrative and in nowise limitative.

EXAMPLES

Example 1

Generation of the 6F4 Antibody

[0289] To generate the murine monoclonal antibody (Mab), BALB/C mice were immunized using 5.times.10.sup.6 MCF-7 cells from ATCC. After a final booster injection of 10.sup.7 MCF-7 cells, cells from lymph nods of mice are fused with Sp2/O-Ag14 myeloma cells using the techniques classically described by Kohler and Milstein. The supernatants of the hybridomas arising from the fusion were then screened for functional activity, namely the inhibition of the proliferation of MCF-7 cells in vitro.

[0290] For this screening, MCF-7 cells are cultured in 96-well culture dishes at 5.times.10.sup.3 cells/well in 100 .mu.l of hybridoma medium without fetal calf serum. The plates are incubated for 24 hours at 37.degree. C. under an atmosphere of 5% CO.sub.2. After 24 hours, 50 .mu.l of the supernatant of the hybridomas to be screened are added to each well. The last line on the plate is reserved for the controls: [0291] three wells are supplemented by 50 .mu.l of a hybridoma supernatant that is non-relevant with respect to the activity sought and that is cultured in the same culture medium as that used for the fused cells. These wells will be used to calibrate the impact of inactive supernatant on the incorporation of tritiated thymidine; [0292] three wells will receive 50 .mu.l of hybridoma culture medium.

[0293] After roughly 52 hours of culture, each well is supplemented by 0.25 .mu.Ci of [.sup.3H]thymidine and incubated again for 20 hours at 37.degree. C. The incorporation of [.sup.3H]thymidine in the DNA, indicating cell proliferation, is quantified by measuring liquid scintillation. Background noise and thresholds are determined for each plate as a function of the control wells containing the medium alone and the non-relevant hybridoma supernatant.

[0294] By this method, 43 hybridomas secreting antibodies inhibiting the growth of MCF-7 cells were selected after a first screening. Eleven of these 43 hybridomas had weak or non-existent growth and were abandoned. During proliferation tests performed following the expansion and cloning of the hybridomas, only the hybridomas whose supernatant had a .gtoreq.20% inhibiting activity on the proliferation of MCF-7 cells were selected. At the end of the cloning/selection process, only one clone proved to have the required properties, the 6F4 clone.

Example 2

Process of Humanization by CDR-Grafting of the Variable Region of the Light Chain of the 6F4 Antibody (6F4 VL)

[0295] a) Comparison of the 6F4 VL Nucleotide Sequence with all Known Murine Cell Line Sequences

[0296] As a preliminary step in humanization by CDR-grafting, the 6F4 VL nucleotide sequence initially was compared with all of the murine cell line sequences present in the IMGT data bank.

[0297] Regions V and J of mouse cell lines having a sequence identity of 98.56% for the V region and 100% for the J region were identified, respectively IGKV19-93*01 (SEQ ID No. 39, EMBL nomenclature: AJ235935) and IGKJ1*01 (SEQ ID No. 40, EMBL nomenclature: V00777).

[0298] Considering these identity percentages, it was decided to use the 6F4 VL sequence directly.

[0299] These alignments are represented in FIG. 2A for the V region and in FIG. 2B for the J region.

[0300] b) Comparison of the Nucleotide Sequence of 6F4 VL with all Known Human Cell Line Sequences

[0301] In order to identify the best human candidate for CDR-grafting, the human-origin germline having the greatest possible identity with 6F4 VL was sought. For this purpose, the nucleotide sequence of mouse 6F4 VL was compared with all of the human cell line sequences present in the IMGT data base.

[0302] Regions V and J of human-origin cell lines were identified with a sequence identity of 81.36% for the V region, namely IGKV1-33*01 (SEQ ID No. 41, EMBL nomenclature: M64856) and 86.84% for the J region, namely IGKJ1*01 (SEQ ID No. 42, EMBL nomenclature: J00242).

[0303] Cell lines IGKV1-33*01 for the V region and IGKJ1*01 for the J region were thus selected as human receptor sequences for mouse 6F4 VL CDRs.

[0304] These alignments are presented in FIG. 3A for the V region and in FIG. 3B for the J region.

[0305] c) Humanized Versions of 6F4 VL

[0306] The following step in the humanization process consists of joining together the IGKV1-33*01 and IGKJ1*01 cell line sequences and then joining the mouse 6F4 VL CDRs to the scaffold regions of these same germlines.

[0307] This stage of the process the molecular model of the mouse 6F4 Fv regions will be particularly useful in the choice of the mouse residues to preserve because they may play a role either in maintaining the molecule's three-dimensional structure (canonical structure of CDRs, VH/VL interfaces, etc.) or in binding the antigen. In the scaffold regions, each difference from mouse (6F4 VL) and human (IGKV1-33*01/IGKJ1*01) nucleotides will be examined very carefully.

[0308] For more clarity in the following, FIG. 4 presents the 6F4VL sequence with reference to KABAT and IMGT classifications.

[0309] Three murine residues were identified which must be preserved.

[0310] Residue 33 (Ile) takes part in CDR1 anchoring according to IMGT and is part of CDR1 according to Kabat.

[0311] Residue 49 (His) takes part in CDR2 anchoring according to IMGT, takes part in the VH/VL interface and belongs to the Vernier zone.

[0312] Residue 53 (Thr) takes part in CDR2 anchoring according to IMGT and is part of CDR2 according to Kabat.

[0313] Initially, three changes in the scaffold regions of IGKV1-33*01 and IGKJ1*01 will be studied. These changes relate to residues 24, 69 and 71 (IMGT nomenclature). It should be understood, of course, that these three changes will be studied independently of each other and also in various combinations. The aim is to have available all possible mutants in order to test them and to select the mutant that has preserved the best binding properties. ELISA/Biacore binding tests will thus be performed on each mutant.

[0314] Residue 24 (Lys/Gln) is near CDR1 and could as a result be critical for maintaining a conformation that enables proper CDR1 presentation. More particularly, this residue is likely to interact with residues 69-70 within the Vernier zone. Lys is only slightly represented in human VLs but is part of CDR1 according to Kabat.

[0315] Although residue 69 (Arg/Thr) is in the Vernier zone and thus directly takes part in CDR1's canonical structure, this residue is always Thr in the human VL.

[0316] Although residue 71 (Tyr/Phe) directly takes part in CDR1's canonical structure, it is systematically Phe in the human VL.

[0317] Secondly, a modification of residue 56 (Ala) into Thr can be considered. This residue, although outside of CDRs according to IMGT, belongs to CDR2 according to Kabat.

[0318] Third and last, two additional changes could be made at residues 34 and 55 (IMGT nomenclature). The two residues, outside of the CDRs defined IMGT, are included in the CDRs defined by Kabat.

[0319] Residue 34 (Ala/Asn) belongs to CDR1 according to Kabat and takes part in the VH/VL interface. Such a mutation remains relevant in spite of the strong representation of Ala in man.

[0320] Residue 55 (Gln/Glu) is part of CDR2 according to Kabat and also takes part in the VH/VL interface. Such a mutation also remains relevant in spite of the strong representation of Gln in man.

[0321] As was described above, these three mutations could be tested independently or in various combinations.

Example 3

Process of Humanization by CDR-Grafting of the Variable Region of the Heavy Chain of the 6F4 Antibody (6F4 VH)

[0322] a) Comparison of the 6F4 VH Nucleotide Sequence with all Known Murine Cell Line Sequences

[0323] As a preliminary step in humanization by CDR-grafting, the 6F4 VH nucleotide sequence initially was compared with all of the murine cell line sequences present in the IMGT data bank.

[0324] Regions V, D and J of murine cell lines having a sequence identity of 99.30% for the V region (IGHV1S135*01; SEQ ID No. 43; EMBL nomenclature: AF304556), of 80% for the D region (IgHD-ST4*01; SEQ ID No. 44; EMBL nomenclature: M23243) and of 100% for the J region (IgHJ2*01; SEQ ID No. 45; EMBL nomenclature: V00770).

[0325] These alignments are represented in FIG. 5A for the V region, FIG. 5B for the D region and FIG. 5C for the J region.

[0326] Considering these identity percentages, it was decided to use the 6F4 VH sequence directly, as was the case for 6F4 VL.

[0327] b) Comparison of the Nucleotide Sequence of 6F4 VH with all Known Human Cell Line Sequences

[0328] In order to identify the best human candidate for CDR-grafting, the human-origin germline having the greatest possible identity with each of the three regions V, D and J of 6F4 VH was sought. For this purpose, the nucleotide sequence of mouse 6F4 VH was compared with all of the human cell line sequences present in the IMGT data base.

[0329] Human-origin germlines were identified having an sequence identity of 75.34% for the V region (IGHV1-f*01; SEQ ID No. 46; EMBL nomenclature: Z12305), of 71.42% for the D region (IGHD1-1*01; SEQ ID No. 47; EMBL nomenclature: X97051) and of 87.51% for the J region (IGHJ4*01; SEQ ID No. 48, EMBL nomenclature: J00256).

[0330] For each of the regions V, D and J, the germinal lines above were selected and rearranged from them.

[0331] These alignments are presented in FIG. 6A for the V region, FIG. 6B for the D region and FIG. 6C for the J region.

[0332] c) Humanized Versions of 6F4 VH

[0333] The following step in the humanization process consists of joining together the IGHV1-f*01, IGHD1-1*01 and IGHJ4*01 cell line sequences and then joining the mouse 6F4 VH CDRs to the scaffold regions of these same germlines.

[0334] This stage of the process the molecular model of the mouse 6F4 Fv regions will be particularly useful in the choice of the mouse residues to preserve because they may play a role either in maintaining the molecule's three-dimensional structure (canonical structure of CDRs, VH/VL interfaces, etc.) or in binding the antigen. In the scaffold regions, each difference from mouse (6F4 VH) and human (IGHV1-f*01, IGHD1-1*01 and IGHJ4*01) nucleotides will be examined very carefully.

[0335] For more clarity in the following, FIG. 7 presents the 6F4VH sequence with reference to KABAT and IMGT classifications.

[0336] As was the case with the light chain, four residues that must remain unchanged were identified.

[0337] Residue 2 (Ile) is part of Vernier zone and takes part in CDR3 structuring.

[0338] Residue 35 (Tyr) takes part in CDR1 anchoring according to IMGT, is part of CDR1 according to Kabat, and also takes part in the VH/VL interface and interacts with CDR3.

[0339] Residue 50 (Tyr) takes part in CDR2 anchoring according to IMGT, is part of CDR2 according to Kabat, is also part of the Vernier zone and also takes part in the VH/VL interface.

[0340] Residue 59 (Arg) takes part in CDR2 anchoring according to IMGT, is part of CDR2 according to Kabat and takes part in the VH/VL interface.

[0341] A first humanized version will be able to include three mutations at residues 61, 62 and 65, respectively (IMGT classification).

[0342] These three residues are located in CDR2 according to Kabat and take part in the VH/VL interface.

[0343] Residue 61 (Asn/Ala) is not directly implicated in antigen recognition. Its mutation can thus be considered.

[0344] Residue 62 (Gln/Glu) and residue 65 (Lys/Gln).

[0345] Secondly, two additional changes will be evaluated. The two changes relate to residues 48 and 74 (IMGT nomenclature).

[0346] Residue 48 (Ile/Met), belonging to the scaffold region, takes part in the VH/VL interface.

[0347] Residue 74 (Lys/Thr) is part of the Vernier zone and may be implicated in CDR2 structuring.

[0348] Third and last, a third series of mutations could be considered, namely a change of residues 9 (Pro/Ala) and 41 (His/Pro). The aim is thus, in a way similar to the mutations planned for 6F4 VL, to approach the human germline as closely as possible without modifying CDR anchoring.

[0349] For summary purpose only, tables 5 and 6 below list the cell lines used as well as, respectively, their amino acid and nucleotide sequence numbers.

TABLE-US-00009 TABLE 5 GERMLINES (EMBL ref.) SEQ ID No. IGKV19-93*01 (AJ235935) 39 IGKJ1*01 (V00777) 40 IGKV1-33*01 (M64856) 41 IGKJ1*01 (J00242) 42 IGHV1S135*01 (AF304556) 43 IGHD-ST4*01 (M23243) 44 IGHJ2*01 (V00770) 45 IGHV1-f*01 (Z12305) 46 IGHD1-1*01 (X97051) 47 IGHJ4*01 (J00256) 48 IGHV1-03*01 (X62109) 49

TABLE-US-00010 TABLE 6 GERMLINES (EMBL ref.) SEQ ID No. IGKV19-93*01 (AJ235935) 50 IGKJ1*01 (V00777) 51 IGKV1-33*01 (M64856) 52 IGKJ1*01 (J00242) 53 IGHV1S135*01 (AF304556) 54 IGHD-ST4*01 (M23243) 55 IGHJ2*01 (V00770) 56 IGHV1-f*01 (Z12305) 57 IGHD1-1*01 (X97051) 58 IGHJ4*01 (J00256) 59 IGHV1-03*01 (X62109) 60

Example 4

Purification and Identification of the 6F4 Antibody Antigen Target

Purification by Immunoaffinity:

[0350] The antigen target of the 6F4 antibody is purified from a membrane fraction enriched by HT-29 cells. After solubilization in a 50 mM Tris/HCl buffer, pH 7.4, containing 150 mM NaCl, Triton X-100 and IGEPAL, membrane proteins are incubated in the presence of the 6F4 antibody immobilized on sepharose beads overnight at +4.degree. C. under gentle mixing. The 6F4-Ag complex formed on the beads is then washed with various solutions containing detergents in order to eliminate proteins adsorbed nonspecifically. The 6F4 antigen target is eluted from the 6F4-sepharose support using a 0.1 M Gly/HCl buffer, pH 2.7. The fractions collected are analyzed by SDS-PAGE electrophoresis (10% gel, non-reducing conditions) and western blot after transfer to nitrocellulose membrane (primary 6F4 antibody used at 0.5 .mu.g/ml, detection by chemiluminescence) in order to select the fractions enriched in the antigen of interest (FIGS. 8A and 8B). The analysis by western blot confirms the absence of the protein of interest in the un-selected fractions and washings, and a specific elution of the latter at acid pH.

[0351] The enriched fractions arising from two purifications were then analyzed by SDS-PAGE electrophoresis (10% gel) and western blot under the conditions described previously. The antigen recognized by the 6F4 antibody in the western blot had an apparent molecular weight of 35 kDa after analysis in reducing conditions (FIGS. 9A and 9B). A difference in apparent molecular weight can be noted when electrophoresis is performed in non-reducing conditions: under these conditions, the apparent molecular weight is indeed slightly lower than that observed in reducing conditions.

Identification of the Antigen Target:

[0352] After SDS-PAGE electrophoresis (10% gel), the proteins are stained with colloidal blue using a method compatible with mass spectrometry analysis (FIG. 10). The band of interest corresponding to the protein detected by western blot is cut out using a scalpel and then de-stained by incubation in a 25 mM ammonium bicarbonate solution. After reduction (DTT)/alkylation (iodoacetamide) and "in gel" hydrolysis (overnight at 37.degree. C.) of the protein by trypsin (Promega), a proteolytic enzyme that hydrolyzes proteins at the Lysine and Arginine residues and thus releases peptides having a Lysine or Arginine residue in the C-terminal position, the peptides generated are extracted using an acetonitrile/water mixture (70/30, v/v) in the presence of formic acid. These are then deposited on the MALDI target in a mixture with a matrix (alpha-cyano-4-hydroxycinnamic acid, Bruker Daltonics) and in the presence of ATFA, and then analyzed by MALDI-TOF mass spectrometry (Autoflex, Bruker Daltonics). The mass spectrum obtained is presented in FIG. 10. The list of the peptides deduced from this analysis is used to identify the protein by searching data banks using the Mascot search engine (Matrix Sciences).

[0353] The NCBInr data bank search results, restricted to proteins of human origin, indicate that three proteins have a significant score (score>64):

[0354] 1. Crystal structure of human junctional adhesion molecule type 1 [0355] Score=116 [0356] This protein corresponds to the extracellular domain of the F11R/JAM-A protein used for structural studies.

[0357] 2. F11 receptor (Homo sapiens) [0358] Score=116 [0359] This protein corresponds to the precursor of protein F11R/isoform a.

[0360] 3. F11 receptor isoform b (Homo sapiens) [0361] Score=65

[0362] This is the precursor of the isoform b of protein F11R, with two deletions of 20 amino acids with respect to isoform a.

[0363] The identified protein, by this approach, is thus called F11R or F11 receptor. This is in fact the official designation of the protein adopted when it was first described as a receptor of a so-called F11 antibody (Naik et al., 1995, Biochem. J., 310, 155-162). This protein is better known today under the name of JAM-A or "junctional adhesion molecule A", and is also called JAM1, PAM-1, CD321 or antigen 106.

[0364] Among the peptides released by tryptic hydrolysis and analyzed by mass spectrometry, nine peptides have an experimental molecular weight corresponding, within 0.1 Da, to that of peptides arising from the theoretical hydrolysis of the human form of JAM-A/isoform a. These nine peptides cover 37% of the protein's primary sequence. Moreover, the theoretical molecular weight of the JAM-A precursor (.about.32.9 kDa) is in agreement with the apparent molecular weight determined experimentally by SDS-PAGE.

Confirmation of the Target Identified by Western Blot:

[0365] The identification of JAM-A by a proteomic approach was then confirmed by western blot (10% SDS-PAGE gel in non-reducing conditions, 6F4 antibody at 0.5 .mu.g/ml, detection by chemiluminescence).

[0366] As shown in FIG. 11A, the 6F4 antibody recognizes natural JAM-A protein in the HT-29 membrane extract and in the fraction enriched by immunopurification (apparent MW=35 kDa), as well as the dimeric recombinant protein JAM-A/Fc (R&D Systems ref. 1103-JM, apparent MW .about.120 kDa). This recognition is equivalent to that of a commercial anti-human JAM-A goat polyclonal antibody (R&D Systems, ref. AF1103) diluted to 1/1000 (FIG. 11B).

Example 5

Specificity of the 6F4 Antibody for Human JAM-A

[0367] The specificity of the 6F4 antibody was determined by western blot under the conditions described above.

[0368] FIG. 12 shows that the 6F4 antibody is specific for the human form of JAM-A since it recognizes the recombinant protein hJAM-A/Fc (R&D Systems ref. 1103-JM), but recognizes neither the human forms of JAM-B and JAM-C (recombinant proteins hJAM-B/Fc and hJAM-C/Fc, R&D Systems ref. 1074-VJ and 1189-J3) nor the murine form of JAM-A (recombinant protein mJAM-A/Fc, R&D Systems ref. 1077-JM).

Example 6

Measurement of the Affinity of the 6F4 Antibody by BIAcore (Surface Plasmon Resonance):

Principle:

[0369] Using BIAcore, the affinity constant K.sub.D (M) of the 6F4 antibody for the soluble protein JAM-1-Fc (extracellular domain fused with a Fc fragment of the antibody and produced in recombinant form in NSO cells) can be calculated from the determination of the association kinetics (k.sub.a) (1/m.s) and the dissociation kinetics (k.sub.d) (1/s) according to the formula K.sub.D=k.sub.d/k.sub.a (Rich and Myszka, J. Mol. Recog., 2005, 18, 431).

Materials and Methods:

[0370] Instrument used: BIAcore X and BIAevaluation 3.1.times. software (Uppsala, SW) [0371] Reagents: [0372] Murine monoclonal 6F4 antibody: 1.3 mg/ml [0373] Human JAM-1-Fc (ref. 1103-JM R&D Systems): 50 .mu.g carrier-free) [0374] Mouse JAM-1-Fc (ref. 1077-JM R&D Systems): 50 .mu.g carrier-free [0375] Running buffer: HBS-EP (BIAcore) [0376] Binding kit: "Amine" (BIAcore) [0377] Binding buffer: Acetate pH 5.0 (BIAcore) [0378] Capturing antibody: goat IgG Fc anti-human (=GAH, goat anti-human) (Bioscience) [0379] Regeneration buffer: Glycine, HCl pH 1.5 for 30 seconds (BIAcore).

Discussion and Conclusions:

[0380] The data in FIG. 13 show that the murine 6F4 antibody is bound to the extracellular part of the human JAM-1 protein but not to the extracellular part of the murine JAM-1 protein.

[0381] The data in FIG. 14 make it possible to calculate a K.sub.D of 22 pM of the 6F4 antibody for the human JAM-1 protein under these experimental conditions.

[0382] The slow dissociation kinetics indicates the involvement of a phenomenon of antibody avidity for the antigen (divalent analytical model).

Example 7

In vivo Activity of the 6F4 Antibody in the MCF-7 Xenograft Model

[0383] A test of the 6F4 antibody, unpurified and injected by IP route at a dose of 250 .mu.g/mouse, demonstrates that this antibody significantly inhibits the growth of MCF-7 cells in vivo with inhibition percentages reaching 56% compared to mice injected with PBS (FIG. 15). The non-relevant 9G4 antibody used as an IgG1 control isotype is, as expected, without antitumor activity.

Example 8

Study of the Distribution of the Antigen Recognized by 6F4 on a Panel of Tumor Cells

[0384] In order to determine the potential indications for the 6F4 antibody, four types of tumors were studied by flow cytometry in terms of a membrane expression profile. The selected cell lines are MCF-7 (estrogen-related breast cancer), A549 (non-small cell lung cancer), HT29 and Colo 205 (colon cancer) and BxPC3 (pancreatic cancer). For labeling cells, a range of doses (10 .mu.g/ml, 5 .mu.g/ml, 1 .mu.g/ml, 0.5 .mu.g/ml, 0.25 .mu.g/ml and 0.125 .mu.g/ml) was tested.

[0385] The results presented in FIG. 16 show that the 6F4 antibody recognizes an antigen significantly expressed on the surface of all cells tested. The labeling obtained is saturable, which attests to its specificity. Saturation of the sites is obtained from a concentration of 1 .mu.g/ml of antibody, which is evidence that the 6F4 antibody's affinity for the JAM-A antigen is high.

Example 9

Humanization by CDR-Grafting of the Variable Region of the Light Chain of the 6F4 Antibody (6F4 VL)

[0386] Summary of the Immunogenetic Analysis:

TABLE-US-00011 Result Productive IGK rearranged sequence summary: (no stop codon and in frame junction) V-GENE and IGKV1-33*01 score = identity = 81, 36% allele 922 (227/279 nt) J-GENE and IGKJ1*01 score = identity = 86, 49% allele 140 (32/37 nt) CDR-IMGT [6, 3, 8] CLQYDNLWTF (SEQ ID NO: 103) lengths and AA JUNCTION

Detailed Data for Closest Human V-Gene Identification:

[0387] Closest V-REGIONs (evaluated from the V-REGION first nucleotide to the 2nd-CYS codon plus 15 nt of the CDR3-IMGT)

TABLE-US-00012 [0387] Score Identity M64856 IGKV1-33*01 922 81.36% (227/279 nt) M64855 IGKV1D-33*01 922 81.36% (227/279 nt) X63398 IGKV1-27*01 868 79.21% (221/279 nt) Y14865 IGKV1-NL1*01 841 78.14% (218/279 nt) X72817 IGKV1D-43*01 841 78.14% (218/279 nt)

Detailed Data for Closest Human J-Gene Identification:

[0388] Closest J-REGIONs:

TABLE-US-00013 [0388] Score Identity J00242 IGKJ1*01 140 86.49% (32/37 nt) AF103571 IGKJ4*02 122 81.08% (30/37 nt) J00242 IGKJ4*01 113 78.38% (29/37 nt) Z70260 IGKJ2*02 104 75.68% (28/37 nt) Z46620 IGKJ2*04 95 72.97% (27/37 nt)

Identification of Critical Residues:

[0389] Several criteria are involved in the definition and ranking of outside CDR critical residues. These include at least, known participation of the residue in VH/VL interface, in antigen binding or in CDR structure, the amino acid class changes from murine and human residues, localization of the residue in the 3D structure of a variable domain etc.

[0390] 21 amino acids are found different from 6F4 VL domain and the closest IGKV1-33*01 human germline V gene, all of them being outside CDR residues. Out of these 21 residues, analysis of the above cited parameters lead to the identification of 9 most potentially contributing residues. These murine residues are K24, I39, A40, H55, T66, Q68, A69, R85 and Y87. Out of these 9 residues, 3 of them are supposed to be even more important so that they will keep their murine origin in the humanized form. These are residues I39 and H55 and T66, located at the CDR1 and CDR2 anchors, respectively. Finally, 6 amino acids will be analysed individually and/or in combination to determine whether they can be humanized or if they have to keep their murine origin.

[0391] Looking to the non-involvement of the J-region in antigen binding and structuration of the V-region, it was decided to use the native human IGKJ1*01 germline gene.

[0392] In the designed sequence of the humanized 6F4 VL domain depicted in FIG. 17:

[0393] *, correspond to amino acids changed de facto to their human counterparts

[0394] 1, correspond to amino acids analysed for their abilities to be humanized, the human residue being indicated below the sign

[0395] 2, correspond to amino acids that remain murin in the humanized 6F4 VH domain

Example 10

First Version of Humanization by CDR-Grafting of the Variable Region of the Heavy Chain of the 6F4 Antibody (6F4 VH)

Summary of the Immunogenetic Analysis:

TABLE-US-00014 [0396] Result Productive IGH rearranged sequence summary: (no stop codon and in frame junction) V-GENE and IGHV1-f*01 score = identity = 75, 35% allele 796 (217/288 nt) J-GENE and IGHJ4*01 score = identity = 87, 23% allele 181 (41/47 nt) CDR-IMGT [8, 8, 9] CARQTDYFDYW (SEQ ID NO 104) lengths and AA JUNCTION

[0397] D-gene strictly belongs to the CDR3 region in the VH domain. The humanization process is based on a <<CDR-grafting>> approach. Analysis of the closest human D-genes is not useful in this strategy.

Detailed Data for Closest Human V-Gene Identification:

[0398] Closest V-REGIONs (evaluated from the V-REGION first nucleotide to the 2nd-CYS codon)

TABLE-US-00015 [0398] Score Identity Z12305 IGHV1-f*01 796 75.35% (217/288 nt) X62106 IGHV1-2*02 787 75.00% (216/288 nt) X92208 IGHV1-2*03 782 74.65% (215/288 nt) Z12310 IGHV1-2*04 778 74.65% (215/288 nt) M99642 IGHV1-24*01 760 73.96% (213/288 nt)

Detailed Data for Closest Human J-Gene Identification:

[0399] Closest J-REGIONs:

TABLE-US-00016 [0399] Score Identity J00256 IGHJ4*01 181 87.23% (41/47 nt) X86355 IGHJ4*02 172 85.11% (40/47 nt) M25625 IGHJ4*03 172 85.11% (40/47 nt) J00256 IGHJ1*01 138 74.51% (38/51 nt) J00256 IGHJ5*01 133 74.00% (37/50 nt)

Identification of Critical Residues:

[0400] Several criteria are involved in the definition and ranking of outside CDR critical residues. These include at least, known participation of the residue in VH/VL interface, in antigen binding or in CDR structure, the amino acid class changes from murine and human residues, localization of the residue in the 3D structure of a variable domain etc.

[0401] 31 amino acids are found different from 6F4 VH domain and the closest IGHV1-f*01 human germline V gene, all of them being outside CDR residues. Out of these 31 residues, analysis of the above cited parameters lead to the identification of 9 most potentially contributing residues. These murine residues are I2, Y40, I53, Y55, R66, N68, Q69, K72 and K82. Out of these 9 residues, 2 of them are supposed to be even more important so that they will keep their murine origin in the humanized form. These are residues Y55 and R66, located at the CDR2 anchors. Finally, 7 amino acids will be analysed individually and/or in combination to determine whether they can be humanized or if they have to keep their murine origin.

[0402] Looking to the non-involvement of the J-region in antigen binding and structuration of the V-region, it was decided to use the native human IGHJ4*01 germline gene.

[0403] In the designed sequence of the humanized 6F4 VH domain depicted in FIG. 18:

[0404] *, correspond to amino acids changed de facto to their human counterparts

[0405] 1, correspond to amino acids analysed for their abilities to be humanized, the human residue being indicated below the sign

[0406] 2, correspond to amino acids that remain murin in the humanized 6F4 VH domain

Example 11

Second Version of Humanization by CDR-Grafting of the Variable Region of the Heavy Chain of the 6F4 Antibody (6F4 VH)

[0407] An other way to identify human V-gene candidates for CDR-grafting was to look for human homologies at the amino acid level using IMGT/DomainGapAlign tool.

Results of the IMGT/DomainGapAlign Immunogenetic Analysis are Summarized Hereinafter:

TABLE-US-00017 [0408] Smith- Waterman Identity Allele Species Domain Score percentage Overlap IGHV1-3*01 Homo sapiens 1 451 64.3 98

[0409] Identification of critical residues in IGHV1-03*01 germline gene (SEQ ID No. 49, EMBL nomenclature: X62109).

[0410] The alignment of 6F4 VH domain and IGHV1-3*01 proteic sequences is represented in FIG. 31.

[0411] The selection and ranking of those residues is based on differential criteria based on the relative importance of each single position according to their structural relevance, their known structure-function relationship, the relevance of the amino acid class change if it happen and it also take advantage of the results obtained during the first humanization process.

[0412] In a first intention, all the different "out-side CDRs" amino acids have been changes for their human counterparts, except residues Y55 and R66 which both are strongly supposed to be involved in binding as CDR2-anchors assigned residues. Humanizability of those two residues will be explored at the end of the process, when all the other analyses described after will be performed. Indeed, recovery of the fully activity of the parental antibody, the 6F4 Hz2 re-humanized VH domain would have to be improved as follow; a "de-humanization" process would consist in back mutating, if necessary, these amino acids in their murine counterpart:

[0413] The first group residues, namely E1Q, K43R and K75R present a strong combination of criteria and correspond to the first positions that "de-humanization" will be assessed if looking for a benefit.

[0414] Then, residues from group 2, namely K48Q, S49R, F88Y and H90R, are chemically relevant mutations but structurally a little less supposed key residues and will be tested in a second round of experiment.

[0415] The six residues from the third group, are presumably more involved in an overall and/or core-oriented residues and thus supposed to be less involved in binding and thus be explored in a third round of improving, whenever necessary.

[0416] Residues from the group 4, are supposed to be the less structurally and/or amino acid class change relevant and for who "de-humanization" would be explored lately.

[0417] Finally, the following six residues, I2V, Y40H, I53M, N68S, K72Q and K82T, correspond to amino acids that humanization did not, at least in this initial combination, alter binding activity of the firstly humanized VH domain. "De-humanization" of these residues will be performed in a last round of improving.

[0418] D-gene strictly belongs to the CDR3 region in the VH domain. The humanization process is based on a <<CDR-grafting>> approach. Analysis of the closest human D-genes is not useful in this strategy.

[0419] Looking to the non-involvement of the J-region in antigen binding and structuration of the V-region, it was decided to use the native human IGHJ4*01 germline gene.

Experimental Data Obtained for the Re-Humanized 6F4 Antibody:

[0420] In the following experiments, the re-humanization only concern the heavy chain, the light chain always corresponding to the QTY/AET humanized 6F4 VL domain as exemplified in example 9 this finally selected humanized VL domain exhibits an anti-JAM-a binding activity similar to that of the recombinant chimeric 6F4 antibody. Similarly, the re-humanized version improvement assays were performed with reference to recombinant chimeric 6F4 antibody anti-JAM-a binding activity as defined by an ELISA assay (data not showed).

Example 12

In vitro Down-Regulation of JAM-A Expression by the 6F4 MAb

[0421] MCF-7, HT29 and A549 cell lines were selected to determine the effect of the 6F4 MAb on JAMA expression. Briefly cells were plated in 75 cm.sup.2 flasks and incubated at 37.degree. C., in 5% CO.sub.2 atmosphere, for 24 hours, in medium supplemented with 10% Fecal Calf Serum (FCS). Then cells were washed 3 times with PBS and incubated for an additional day in serum-free medium. After this second incubation, the serum-free medium was removed and replaced by fresh serum-free medium alone or fresh serum-free medium containing either 6F4 or an IgG1 isotype control described as 9G4. After either 5 or 16 hours of incubation, cold lysis buffer (10 mM Tris HCl buffer, pH 7.5, 15% NaCl 1 M (Sigma Chemical Co.), 10% detergent mix (10 mM Tris-HCl, 10% Igepal lysis buffer) (Sigma Chemical Co.), 5% sodium deoxycholate (Sigma Chemical Co.), 1 protease inhibitor cocktail complete TM tablet (Roche) and 1% phosphatase inhibitor Cocktail Set II (Calbiochem), pH 7.5) was added and cells were scrapped on ice. The lysates were clarified by centrifugation at 4.degree. C. Protein was quantified by BCA protein assay and 25pg of protein were loaded in each lane of a Biorad 4-12% Bis-Tris gel. Samples were heated for 5 minutes at 100.degree. C. and kept at -20.degree. C. or loaded directly on 4-12% SDS-PAGE gels and transferred to nitrocellulose membrane. Blots were first blocked with 5% BSA for all antibodies. Incubation of specific anti-JAMA primary antibody was performed for 2 hours at room temperature. Filters were washed in TBST and incubated with appropriate HRP-linked secondary antibodies for 1 hour at room temperature. Membranes were washed in TBST prior visualization of proteins with ECL (Amersham).

[0422] As shown in FIG. 19, a significant down-regulation of JAM-A was observed for the 3 cell lines treated with the 6F4 MAb. MCF-7 seemed to be the most sensitive one with a complete and stable down-regulation observed as early as 5 hours post 6F4 incubation. For HT29 cells a partial but sustained down-regulation of JAM-A was also noticed. The kinetic of down-regulation was different for A549 cells as no significant effect was observed at the early incubation time while a complete inhibition occurred after 16 hours of incubation with the 6F4 MAb. As expected no significant differences were observed from untreated cells and cells incubated with the 9G4 isotype control.

Example 13

Effect of a Single Injection of 6F4 on in vivo Tumor Proliferation

[0423] To determine the in vivo mechanism of action of the 6F4 MAb, 7 weeks old female mice bearing estrogen pellets have been injected with MCF-7 cells. When tumors reached a volume of 80 to 100 mm.sup.3, 3 groups of mice with comparable tumors were generated. Before any injection, tumors were removed from one of these groups to check the basal proliferation of tumor cells within an untreated tumor. Mice from the 2 other groups were injected either with 1 mg of 6F4 or with the same dose of an IgG1 isotype control described as 9G4.

[0424] Six hours post injection, tumors were removed, fixed in formalin, paraffin embedded, cut into 5 .mu.m sections and stained with an anti-Ki67 antibody to determine the level of proliferation in treated versus control tumors.

[0425] As shown in FIG. 20 no difference was observed from tumors removed before injection (described as T0 for time 0) and tumors treated with the isotype control 9G4. On the other hand, a significant inhibition of tumor cell proliferation was observed after a single injection, 6F4.

Example 14

Effect of a Single Injection of 6F4 on in vivo JAM-A Expression

[0426] For this study the in vivo protocol is the same as the one described in in vivo proliferation experiments except that removed tumors were quickly frozen in liquid nitrogen for Western blot analysis. The Western blot was performed as described in the Example 13 above.

[0427] FIG. 21 demonstrate that no difference in JAM-A expression was observed from untreated mice (described as T0 for Time 0) and mice injected once with the 9G4 isotype control. A significant down-regulation was noticed when mice were treated with the 6F4 MAb indicating that a potential mechanism of action involved in the in vivo antitumor activity of this antibody could be the down-regulation of the receptor. These results were in agreement with the one observed in vitro and described below in example 13.

Example 15

Comparison of the Anti-Tumoral Activity of 6F4 and its F(ab').sub.2 Fragment

[0428] As JAM-A is highly expressed by MCF-7 cells and despite the fact that 6F4 is an IgG1 (isotype known to be poorly involved in effector functions in mice), an in vivo comparison from 6F4 and its F(ab')2 fragment has been set up in the MCF-7 model to determine a potential involvement of effector functions in the in vivo activity.

[0429] For that purpose, Five millions MCF7 cells were engrafted into 7 weeks old mice female bearing estrogens pellet. Five days after cells implantation, mice were treated either with 300 .mu.g of 6F4 or with 200 .mu.g of 6F4 F(ab').sub.2 three times per week. For the first injection, 600 .mu.g of antibody and 400 .mu.g of 6F4 F(ab').sub.2 were injected. Tumor volume was measured twice a week for 4 weeks.

[0430] FIG. 22 showed that tumor growth in mice treated with 6F4 and 6F4 F(ab').sub.2 was significantly different from tumor growth of control mice from D3 to D27 (p.ltoreq.0.03 for 6F4 and p.ltoreq.0.015 for 6F4 F(ab').sub.2). No difference was observed from 6F4 and 6F4 F(ab').sub.2 groups of mice showing that effector functions are not involved in the 6F4 activity.

Example 16

Evaluation of the Expression of JAM-A on Human Tissue

[0431] A comparison of JAM-A expression on tumoral versus normal patient tissues has been performed to select tumor types overexpressing JAMA. Pairs of normal versus tumoral tissues from the same patient were selected for this study. In these patients normal tissues was taken near to the tumor. JAM-A expression was determined by ImmunoHistoChemistry (IHC) using tissue arrays from Superships. Briefly, Slides were dewaxed and antigen retrieval was performed using the Dakocytomation solution S1699, at 98.degree. C. for 20 minutes. After quenching endogenous peroxidase (0.3% H.sub.2O.sub.2 solution for 5 minutes) and blocking non specific sites (Ultra-V-Block; Labvision, ref. TA-125-UB), the primary antibody (anti-hJAM-A, AF1103 from R&Dsytem or goat IgG isotype control from Zymed) was incubated for 1 hour at room temperature. After washes in TBS-tween, the binding of the anti-hJAM-A was revealed using the LSAB+ kit from dakocytomation. Visualization of the complex primary Ab and LSAB+ was performed by the chromogenic reaction HRP-DAB. Slides were then counterstained by hematoxylin.

[0432] Samples of thyroid, lung and breast cancer were analysed. For thyroid samples (FIG. 23), no expression was observed on normal thyroid tissue while JAM-A appeared to be strongly expressed in tumoral sections (membrane staining) from the same patient. In lung normal tissue JAM-A was expressed by pneumocytes. However, a strong membrane expression was observed in all tumoral samples (FIG. 24). For breast cancer, a weak JAM-A expression, located on lobular ducts, was observed on normal breast tissue. In cancer sections, the 3 examples of carcinoma shown in FIG. 25 (infiltrating duct, atypically medullary and infiltrating papillary) demonstrate that JAM-A is over expresses on breast cancer tissues.

[0433] These data suggested that thyroid, breast and lung cancers could be good targets for a JAMA therapy.

Example 17

In vivo Activity of 6F4 on A431 Epidermoid Carcinoma Xenograft in Nude Mice

[0434] A-431 cells were routinely cultured in DMEM (Lonza) supplemented with 10% heat inactivated Fetal Calf Serum (Sigma). Cells were split two days before engraftment so that they were in exponential phase of growth. Ten million A-431 cells were engrafted on 7 weeks old Athymic Nude mice. Five days after engraftment (D5) mice were randomized and treated i.p. with the following schemes: The control group received twice a week injections of PBS and the 6F4 treated group was injected i.p. with a loading dose of 2 mg followed by twice a week injections of 1 mg dose of antibody. Tumor were measured twice a week and tumor volumes were calculated using the formula: .quadrature./6.length.width.height. Statistical analysis were performed for each time point using a Mann-Whitney Test and SigmaStat software. FIG. 26 showed that the 6F4 MAb is capable of significantly inhibiting the in vivo growth of A431 cell line (p<0.009 from day 38 to day 56).

Example 18

Evaluation of 6F4 Activity on Antigen Presentation by Antigen Presenting Cells (APC)

[0435] JAM proteins are expressed in a variety of tissues throughout the human body as well as on the surface of platelets, leukocytes, and erythrocytes [Naik 1995; Malergue 1998; Korneki 1990; Williams 1999; Gupta 2000]. JAM-A appears to be expressed in platelets, neutrophils, monocytes, lymphocytes, and erythrocytes [For review see Mandell 2005].

[0436] To determine whether a treatment with 6F4 could impair antigen presentation in patients an evaluation of a potential interference with Antigen Presenting Cells (APC) including macrophages and dendritic cells has been performed. In the presentation process, APC internalize antigens and degrade them to generate peptides which are associated within the cytoplasm with CMH class II molecules. Then the complex is expressed on APC membranes and presented to specific T lymphocytes responding to that stimulation by proliferation.

[0437] In the study presented below, the potential effect of 6F4 on Tetanus Toxoid presentation by human PBMC was evaluated. For that purpose, PBMC were isolated by Ficoll gradient centrifugation from blood. Cells were washed in PBS, counted and suspended in RPMI 1640 medium supplemented with 10% heat-inactivated foetal calf serum (FCS), glutamine and antibiotics at the concentration of 0.25.10.sup.6 cells/ml. 100 .mu.l of PBMC were seeded in each well of a 96 well plate previously filled with the antigen and the antibody to be tested 10 .mu.g/ml final concentration). The 9G4 Mab was used as an IgG1 isotype control and phytohemagglutinin PHA (2.5 .mu.g/ml final concentration), a polyclonal activator of lymphocytes, was introduced as a positive control.

[0438] Specific antigen activator Tetanus Toxoid (TT) was selected and added to PBMC at a final concentration of 100 .mu.g/ml. Plates were then incubated at 37.degree. C. in an atmosphere containing 5% CO.sub.2 for 96 h. Then, 0.25 .mu.Ci of [.sup.3H]-Thymidine is added to the wells and incubated for 24 h. After incubation the cells were harvested, the filter membrane was dried and the amount of radioactivity was counted in a scintillation counter.

[0439] Regarding to FIGS. 27A and 28A that display the values of two independent experiments, the polyclonal activator, PHA used as a positive control of PBMC preparation is a potent inducer of lymphoproliferation, with indexes ranging from 30 and 70 depending on the donors and the experiment. In these conditions, the lymphoproliferation index was not modified whatever the antibody incubated, and 6F4 did not display any significant agonist or antagonist activity. FIGS. 27B and 28B that display the values of two independent experiments, showed that significant variations could occur from donors towards TT activation of lymphoproliferation. In these experiments, indexes ranged from 2 and 5 depending on the donors and the experiment. However, no interference on the antigen presentation was observed in presence of 6F4.

[0440] In conclusion, despite the significant expression of JAM-A on APC and lymphocyte, the use of an antibody directed against this target does not impair neither the non specific proliferation of lymphocyte nor the antigen presentation process.

Example 19

Evaluation of Platelet Aggregation and Activation After 6F4 Incubation

[0441] In order to investigate whether 6F4, which binds to human platelets, could have any biological function, two parameters were measured: platelet aggregation and serotonine release.

[0442] For this purpose, human platelets from 10 normal donors were incubated with 5 .mu.g/ml of several antibodies to be tested.

[0443] PM6/248 (an anti-.quadrature..sub.IIb.quadrature..sub.3) have been reported to induce platelet aggregation. 9G4 was used as negative isotype control.

[0444] As expected when tested on human platelets, thrombine and ADP induced aggregation. PM6/248 also induced platelet aggregation.

[0445] No platelet aggregation was measured after incubation with 6F4. The effect was comparable to the one observed with 9G4, used as positive control (FIG. 29).

[0446] In a similar way, 6F4 was not able to induce serotonine release (FIG. 30) whereas thrombine induced, as expected, 5-HT release.

[0447] All together, these results indicate that whereas JAM-A is expressed, no biological function is triggered on human platelet after 6F4 activation.

Example 20

Humanization by CDR-Grafting of the Variable Region of the Light Chain of the 6F4-Back Up Antibody (6F4-BU)

Detailed Data for Closest Human Gene Identification:

[0448] In order to identify alternative human candidates for the CDR grafting, human germline genes displaying the best identity with the 6F4 VL have been searched. To this end, the nucleotidic sequence of 6F4 VL has been aligned with the human germline genes sequences part of the IMGT database. For optimization of the selection, alignments from the proteic sequences were also made to search for better homologies.

[0449] For the J region, the best homology score was obtained with the human IGKJ1*01 showing a nucleotidic sequence identity of 86,49%. Thus the IGKJ1*01 germline gene was selected as receiving human J region for the murine 6F4 VL CDRs. [0450] IGKV1-27*01 and IGKV1D-43*01 human V genes were selected for further use as human framework sequence for CDR-grafting.

TABLE-US-00018 [0450] % Identity IGKV1-27*01 79.21% (221/279 nt) IGKV1D-43*01 78.14% (218/279 nt)

Humanization of the 6F4 VL Domain by CDR-Grafting:

[0451] Given the possibility of two receiving human V regions for the murine 6F4 VL CDRs, 2 humanized versions of the 6F4 VL domain will be described.

a) IGKV1-27*01 Based Humanized Version of 6F4 VL (BU-L1)

[0452] The following steps in the humanization process consist in linking the selected germline genes sequences IGKV1-27*01 and IGKJ1*01 and also the CDRs of the murine 6F4 VL to the frameworks of these germline genes sequences.

[0453] As depicted in FIG. 32, the bolded residues in the 6F4 VL sequence corresponds to the twenty-one amino acids that were found different from 6F4 VL domain and the selected human frameworks (Human FR, i.e. IGKV1-27*01 and IGKJ1*01).

[0454] FIG. 32 is the implemented IGKV1-27*01 based humanized 6F4 VL with the described mutations clearly identified. The number under each proposed mutation corresponds to the rank at which said mutation will be done.

[0455] The numbering of amino acids and subsequent mutations correspond to the IMGT numbering system in FIG. 32. For example, residue 33 in the sequence listing (linear numbering) corresponds to residue 39 in the FIG. 32 (IMGT numbering).

[0456] Regarding to several criteria such as their known participation in VH/VL interface, in antigen binding or in CDR structure, the amino acid class changes from murine and human residues, localization of the residue in the 3D structure of the variable domain, four out of the twenty-one different residues have been identified to be eventually mutated. These four most important defined residues and mutations into their human counterparts being murine K24 into human R, I39 into L, H54 into Y and Y87 into F. These ranked one residues are shown in FIG. 32 as bolded residues in the 6F4 BU-L1 humanized VL sequence where they remained murine.

[0457] Of course, the above mentioned residues to be tested are not limited but must be considered as preferential mutations.

[0458] With the help of a molecular model, other mutations could be identified. Can be mentioned the following ranked two residues, i.e. residues 17 (G/D), 44 (H/Q), 69 (A/S), 85 (R/T), 89 (F/L), 93 (N/S) and 115 (G/Q) on which mutations could also be envisaged in another preferred embodiment.

[0459] The above mentioned residues to be eventually tested are not limited but must be considered as preferential mutations. In another preferred embodiment, all the ten others ranked three residues among the twenty-one different amino acids could be reconsidered.

[0460] All the above mentioned mutations will be tested individually or according various combinations.

b) IGKV1D-43*01 Based Humanized Version of 224G11 VL (BU-L2)

[0461] The following steps in the humanization process consist in linking the selected germline genes sequences IGKV1D-43*01 and IGKJ1*01 and also the CDRs of the murine 6F4 VL to the frameworks of these germline genes sequences.

[0462] As depicted in FIG. 33, the bolded residues in the 6F4 VL sequence correspond to the twenty-seven amino acids that were found different from 6F4 VL domain and the selected human frameworks (Human FR, i.e. IGKV1D-43*01 and IGKJ1*01). FIG. 33 is the implemented IGKV1D-43*01 based humanized 6F4 VL with the described mutations clearly identified. The number under each proposed mutation corresponds to the rank at which said mutation will be done.

[0463] The numbering of amino acids and subsequent mutations correspond to the IMGT numbering system in FIG. 33. For example, residue 33 in the sequence listing (linear numbering) corresponds to residue 39 in the FIG. 33 (IMGT numbering).

[0464] Regarding to several criteria such as their known participation in VH/VL interface, in antigen binding or in CDR structure, the amino acid class changes from murine and human residues, localization of the residue in the 3D structure of the variable domain, six out of the twenty-seven different residues have been identified to be eventually mutated. These six most important defined residues and mutations into their human counterparts being murine D1 into human A, Q3 into R, K24 into W, I39 into L, H55 into Y and T66 into S. These ranked one residues are shown in FIG. 33 as bolded residues in the 6F4 BU-L2 humanized VL sequence where they remained murine. Of course, the above mentioned residues to be tested are not limited but must be considered as preferential mutations.

[0465] With the help of a molecular model, other mutations could be identified. Can be mentioned the following ranked two residues, i.e. residues 9 (S/F), 17 (G/D), 44 (H/Q), 53 (L/F), 69 (A/S), 85 (R/T), 89 (F/L), 93 (N/S) and 115 (G/Q) on which mutations could also be envisaged in another preferred embodiment.

[0466] The above mentioned residues to be eventually tested are not limited but must be considered as preferential mutations. In another preferred embodiment, all the twelve others ranked three residues among the twenty-seven different amino acids could be reconsidered.

[0467] All the above mentioned mutations will be tested individually or according various combinations.

Example 21

Humanization by CDR-Grafting of the Variable Region of the Heavy Chain of the 6F4-Back Up Antibody (6F4-BU)

Detailed Data for Closest Human Gene Identification:

[0468] In order to identify alternative human candidates for the CDR grafting, human germline genes displaying the best identity with the 6F4 VH have been searched. To this end, the nucleotidic sequence of 6F4 VH has been aligned with the human germline genes sequences part of the IMGT database. For optimization of the selection, alignments from the proteic sequences were also made to search for better homologies.

[0469] For the J region, the best homology score was obtained with the human IGHJ4*01 showing a nucleotidic sequence identity of 87.23%. Thus the IGHJ4*01 germline gene was selected as receiving human J region for the murine 6F4 VH CDRs. IGHV1-3*01 and IGHV1-46*01 human V genes were selected for further use as human framework sequence for CDR-grafting.

TABLE-US-00019 % Identity IGHV1-46*01 73.61% (212/288 nt) IGHV1-3*01 64.30% (63/98 aa)

Humanization of the 6F4 VH Domain by CDR-Grafting:

[0470] Given the possibility of two receiving human V regions for the murine 6F4 VH CDRs, 2 humanized versions of the 6F4 VH domain will be described.

a) IGHV1-3*01 Based Humanized Version of 6F4 VH (BU-H1)

[0471] The following steps in the humanization process consist in linking the selected germline genes sequences IGHV1-3*01 and IGHJ4*01 and also the CDRs of the murine 6F4 VH to the frameworks of these germline genes sequences.

[0472] As depicted in FIG. 34, the bolded residues in the 6F4 VH sequence corresponds to the thirty amino acids that were found different from 6F4 VH domain and the selected human frameworks (Human FR, i.e. IGHV1-3*01 and IGHJ4*01). FIG. 34 is the implemented IGHV1-3*01 based humanized 6F4 VL with the described mutations clearly identified. The number under each proposed mutation corresponds to the rank at which said mutation will be done.

[0473] The numbering of amino acids and subsequent mutations correspond to the IMGT numbering system in FIG. 34. For example, residue 44 in the sequence listing (linear numbering) corresponds to residue 49 in the FIG. 34 (IMGT numbering).

[0474] Regarding to several criteria such as their known participation in VH/VL interface, in antigen binding or in CDR structure, the amino acid class changes from murine and human residues, localization of the residue in the 3D structure of the variable domain, nine out of the thirty different residues have been identified to be eventually mutated. These nine most important defined residues and mutations into their human counterparts being murine E1 into human Q, Q5 into V, S49 into R, Y55 into W, R66 into K, A76 into V, L78 into I, V80 into R and H90 into R. These ranked one residues are shown in FIG. 34 as bolded residues in the 6F4 BU-H1 humanized VH sequence where they remained murine. It must be noted that the above mentioned residues to be tested are not limited but must be considered as preferential mutations.

[0475] With the help of a molecular model, other mutations could be identified. Can be mentioned the following ranked two residues, i.e. residues 2 (I/V), 9 (A/P), 40 (Y/H), 46 (H/P), 53 (I/M) and 84 (S/A) on which mutations could also be envisaged in another preferred embodiment.

[0476] Of course, the above mentioned residues to be eventually tested are not limited but must be considered as preferential mutations. In another preferred embodiment, all the fifteen others ranked three residues among the thirty different amino acids could be reconsidered.

[0477] All the above mentioned mutations will be tested individually or according various combinations.

b) IGHV1-46*01 Based Humanized Version of 6F4 VH (BU-H2)

[0478] The following steps in the humanization process consist in linking the selected germline genes sequences IGHV1-46*01 and IGHJ4*01 and also the CDRs of the murine 6F4 VH to the frameworks of these germline genes sequences.

[0479] As depicted in FIG. 35, the bolded residues in the 6F4 VH sequence correspond to the thirty-one amino acids that were found different from 6F4 VH domain and the selected human frameworks (Human FR, i.e. IGHV1-46*01 and IGHJ4*01). FIG. 35 is the implemented IGHV1-46*01 based humanized 6F4 VL with the described mutations clearly identified. The number under each proposed mutation corresponds to the rank at which said mutation will be done.

[0480] The numbering of amino acids and subsequent mutations correspond to the IMGT numbering system in FIG. 35. For example, residue 44 in the sequence listing (linear numbering) corresponds to residue 49 in the FIG. 35 (IMGT numbering).

[0481] Regarding to several such as their known participation in VH/VL interface, in antigen binding or in CDR structure, the amino acid class changes from murine and human residues, localization of the residue in the 3D structure of the variable domain, nine out of the thirty different residues have been identified to be eventually mutated. These nine most important defined residues and mutations into their human counterparts being murine El into human Q, Q5 into V, S49 into G, Y55 into I, R66 into S, A76 into V, L78 into M, V80 into R and H90 into E. These ranked one residues are shown in FIG. 35 as bolded residues in the 6F4 BU-H2 humanized VH sequence where they remained murine. Of course, the above mentioned residues to be tested are not limited but must be considered as preferential mutations.

[0482] With the help of a molecular model, other mutations could be identified. Can be mentioned the following ranked two residues, i.e. residues 2 (IN), 9 (A/P), 40 (Y/H), 46 (H/P) and 53 (I/M) on which mutations could also be envisaged in another preferred embodiment. It must be notice that the above mentioned residues to be eventually tested are not limited but must be considered as preferential mutations. In another preferred embodiment, all the sixteen others ranked three residues among the thirty-one different amino acids could be reconsidered.

[0483] All the above mentioned mutations will be tested individually or according various combinations.

[0484] Each patent, patent application, publication, text and literature article/report cited or indicated herein is hereby expressly incorporated by reference in its entirety.

[0485] While the invention has been described in terms of various specific and preferred embodiments, the skilled artisan will appreciate that various modifications, substitutions, omissions, and changes may be made without departing from the spirit thereof. Accordingly, it is intended that the scope of the present invention be limited solely by the scope of the following claims, including equivalents thereof.

Sequence CWU 1

1

10416PRTMus musculus 1Gln Asp Ile Asn Asn Tyr1 524PRTMus musculus 2Thr Asp Tyr Ser133PRTMus musculus 3Tyr Thr Ser148PRTMus musculus 4Ile Asp Pro Tyr Asn Gly Gly Thr1 558PRTMus musculus 5Leu Gln Tyr Asp Asn Leu Trp Thr1 567PRTMus musculus 6Gln Thr Asp Tyr Phe Asp Tyr1 578PRTMus musculus 7Gly Tyr Ser Phe Thr Asp Tyr Ser1 5811PRTMus musculus 8Lys Ala Ser Gln Asp Ile Asn Asn Tyr Ile Ala1 5 1096PRTMus musculus 9Thr Asp Tyr Ser Met Tyr1 5107PRTMus musculus 10Tyr Thr Ser Thr Leu Gln Ala1 51117PRTMus musculus 11Tyr Ile Asp Pro Tyr Asn Gly Gly Thr Arg Tyr Asn Gln Lys Phe Lys1 5 10 15Gly129PRTMus musculus 12Ala Arg Gln Thr Asp Tyr Phe Asp Tyr1 513106PRTMus musculus 13Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Leu Gly1 5 10 15Gly Lys Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asn Asn Tyr 20 25 30Ile Ala Trp Tyr Gln His Lys Pro Gly Lys Gly Pro Arg Leu Leu Ile 35 40 45His Tyr Thr Ser Thr Leu Gln Ala Gly Ile Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Arg Asp Tyr Ser Phe Ser Ile Ser Asn Leu Glu Pro65 70 75 80Glu Asp Ile Gly Thr Tyr Tyr Cys Leu Gln Tyr Asp Asn Leu Trp Thr 85 90 95Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 100 10514116PRTMus musculus 14Glu Ile Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30Ser Met Tyr Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Trp Ile 35 40 45Gly Tyr Ile Asp Pro Tyr Asn Gly Gly Thr Arg Tyr Asn Gln Lys Phe 50 55 60Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Phe65 70 75 80Met His Leu Asn Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95Ala Arg Gln Thr Asp Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Thr Leu 100 105 110Thr Val Ser Ser 11515215PRTMus musculus 15Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Leu Gly1 5 10 15Gly Lys Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asn Asn Tyr 20 25 30Ile Ala Trp Tyr Gln His Lys Pro Gly Lys Gly Pro Arg Leu Leu Ile 35 40 45His Tyr Thr Ser Thr Leu Gln Ala Gly Ile Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Arg Asp Tyr Ser Phe Ser Ile Ser Asn Leu Glu Pro65 70 75 80Glu Asp Ile Gly Thr Tyr Tyr Cys Leu Gln Tyr Asp Asn Leu Trp Thr 85 90 95Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro 100 105 110Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly 115 120 125Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn 130 135 140Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn145 150 155 160Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser 165 170 175Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr 180 185 190Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe 195 200 205Asn Arg Asn Glu Cys Asn His 210 21516440PRTMus musculus 16Glu Ile Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30Ser Met Tyr Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Trp Ile 35 40 45Gly Tyr Ile Asp Pro Tyr Asn Gly Gly Thr Arg Tyr Asn Gln Lys Phe 50 55 60Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Phe65 70 75 80Met His Leu Asn Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95Ala Arg Gln Thr Asp Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Thr Leu 100 105 110Thr Val Ser Ser Ala Lys Thr Thr Pro Pro Ser Val Tyr Pro Leu Ala 115 120 125Pro Gly Ser Ala Ala Gln Thr Asn Ser Met Val Thr Leu Gly Cys Leu 130 135 140Val Lys Gly Tyr Phe Pro Glu Pro Val Thr Val Thr Trp Asn Ser Gly145 150 155 160Ser Leu Ser Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Asp 165 170 175Leu Tyr Thr Leu Ser Ser Ser Val Thr Val Pro Ser Ser Thr Trp Pro 180 185 190Ser Glu Thr Val Thr Cys Asn Val Ala His Pro Ala Ser Ser Thr Lys 195 200 205Val Asp Lys Lys Ile Val Pro Arg Asp Cys Gly Cys Lys Pro Cys Ile 210 215 220Cys Thr Val Pro Glu Val Ser Ser Val Phe Ile Phe Pro Pro Lys Pro225 230 235 240Lys Asp Val Leu Thr Ile Thr Leu Thr Pro Lys Val Thr Cys Val Val 245 250 255Val Asp Ile Ser Lys Asp Asp Pro Glu Val Gln Phe Ser Trp Phe Val 260 265 270Asp Asp Val Glu Val His Thr Ala Gln Thr Gln Pro Arg Glu Glu Gln 275 280 285Phe Asn Ser Thr Phe Arg Ser Val Ser Glu Leu Pro Ile Met His Gln 290 295 300Asp Trp Leu Asn Gly Lys Glu Phe Lys Cys Arg Val Asn Ser Ala Ala305 310 315 320Phe Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly Arg Pro 325 330 335Lys Ala Pro Gln Val Tyr Thr Ile Pro Pro Pro Lys Glu Gln Met Ala 340 345 350Lys Asp Lys Val Ser Leu Thr Cys Met Ile Thr Asp Phe Phe Pro Glu 355 360 365Asp Ile Thr Val Glu Trp Gln Trp Asn Gly Gln Pro Ala Glu Asn Tyr 370 375 380Lys Asn Thr Gln Pro Ile Met Asp Thr Asp Gly Ser Tyr Phe Val Tyr385 390 395 400Ser Lys Leu Asn Val Gln Lys Ser Asn Trp Glu Ala Gly Asn Thr Phe 405 410 415Thr Cys Ser Val Leu His Glu Gly Leu His Asn His His Thr Glu Lys 420 425 430Ser Leu Ser His Ser Pro Gly Lys 435 44017106PRTMus musculus 17Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Gln Ala Ser Gln Asp Ile Asn Asn Tyr 20 25 30Ile Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45His Tyr Thr Ser Thr Leu Glu Thr Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Tyr Thr Phe Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Ile Ala Thr Tyr Tyr Cys Leu Gln Tyr Asp Asn Leu Trp Thr 85 90 95Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 100 10518116PRTMus musculus 18Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Thr Val Lys Ile Ser Cys Lys Val Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30Ser Met His Trp Val Gln Gln Ala Pro Gly Lys Gly Leu Glu Trp Met 35 40 45Gly Tyr Ile Asp Pro Tyr Asn Gly Gly Thr Arg Tyr Ala Glu Lys Phe 50 55 60Gln Gly Arg Val Thr Ile Thr Ala Asp Thr Ser Thr Asp Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Gln Thr Asp Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110Thr Val Ser Ser 11519116PRTMus musculus 19Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30Ser Met His Trp Val Arg Gln Ala Pro Gly Gln Arg Leu Glu Trp Met 35 40 45Gly Tyr Ile Asp Pro Tyr Asn Gly Gly Thr Arg Tyr Ser Gln Lys Phe 50 55 60Gln Gly Arg Val Thr Ile Thr Ala Asp Thr Ser Thr Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Gln Thr Asp Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110Thr Val Ser Ser 1152018DNAMus musculus 20caagacatta acaattat 182112DNAMus musculus 21actgactaca gc 12229DNAMus musculus 22tacacatct 92324DNAMus musculus 23attgatcctt acaatggtgg tact 242424DNAMus musculus 24ctacagtatg ataatctgtg gacg 242521DNAMus musculus 25cagacggact actttgacta c 212624DNAMus musculus 26ggttactcat tcactgacta cagc 242727DNAMus musculus 27gcaagacaga cggactactt tgactac 272833DNAMus musculus 28aaggcaagcc aagacattaa caattatata gct 332921DNAMus musculus 29tacacatcta cattacaagc a 213018DNAMus musculus 30actgactaca gcatgtac 183151DNAMus musculus 31tatattgatc cttacaatgg tggtactagg tacaaccaga agttcaaggg c 5132318DNAMus musculus 32gacatccaga tgacacagtc tccatcctca ctgtctgcat ctctgggagg caaagtcacc 60atcacttgca aggcaagcca agacattaac aattatatag cttggtacca acacaagcct 120ggaaaaggtc ctaggctgct catacattac acatctacat tacaagcagg catcccatca 180aggttcagtg gaagtgggtc tgggagagat tattccttca gcatcagcaa cctggagcct 240gaagatattg gaacttatta ttgtctacag tatgataatc tgtggacgtt cggtggaggc 300accaagctgg aaatcaaa 31833348DNAMus musculus 33gagatccagc tgcagcagtc tggacctgag ctggtgaagc ctggggcttc agtgaaggta 60tcctgcaagg cttctggtta ctcattcact gactacagca tgtactgggt gaagcagagc 120catggaaaga gccttgagtg gattggatat attgatcctt acaatggtgg tactaggtac 180aaccagaagt tcaagggcaa ggccacattg actgttgaca agtcctccag cacagccttc 240atgcatctca acagcctgac atctgaggac tctgcagtct attactgtgc aagacagacg 300gactactttg actactgggg ccaaggcacc actctcacag tctcctca 34834639DNAMus musculus 34gacatccaga tgacacagtc tccatcctca ctgtctgcat ctctgggagg caaagtcacc 60atcacttgca aggcaagcca agacattaac aattatatag cttggtacca acacaagcct 120ggaaaaggtc ctaggctgct catacattac acatctacat tacaagcagg catcccatca 180aggttcagtg gaagtgggtc tgggagagat tattccttca gcatcagcaa cctggagcct 240gaagatattg gaacttatta ttgtctacag tatgataatc tgtggacgtt cggtggaggc 300accaagctgg aaatcaaacg ggctgatgct gcaccaactg tatccatctt cccaccatcc 360agtgagcagt taacatctgg aggtgcctca gtcgtgtgct tcttgaacaa cttctacccc 420aaagacatca atgtcaagtg gaagattgat ggcagtgaac gacaaaatgg cgtcctgaac 480agttggactg atcaggacag caaagacagc acctacagca tgagcagcac cctcacgttg 540accaaggacg agtatgaacg acataacagc tatacctgtg aggccactca caagacatca 600acttcaccca ttgtcaagag cttcaacagg aatgagtgt 639351320DNAMus musculus 35gagatccagc tgcagcagtc tggacctgag ctggtgaagc ctggggcttc agtgaaggta 60tcctgcaagg cttctggtta ctcattcact gactacagca tgtactgggt gaagcagagc 120catggaaaga gccttgagtg gattggatat attgatcctt acaatggtgg tactaggtac 180aaccagaagt tcaagggcaa ggccacattg actgttgaca agtcctccag cacagccttc 240atgcatctca acagcctgac atctgaggac tctgcagtct attactgtgc aagacagacg 300gactactttg actactgggg ccaaggcacc actctcacag tctcctcagc caaaacaaca 360gccccatcgg tctatccact ggcccctgga tctgctgccc aaactaactc catggtgacc 420ctgggatgcc tggtcaaggg ctatttccct gagccagtga cagtgacctg gaactctgga 480tccctgtcca gcggtgtgca caccttccca gctgtcctgc agtctgacct ctacactctg 540agcagctcag tgactgtccc ctccagcacc tggcccagcg agaccgtcac ctgcaacgtt 600gcccacccgg ccagcagcac caaggtggac aagaaaattg tgcccaggga ttgtggttgt 660aagccttgca tatgtacagt cccagaagta tcatctgtct tcatcttccc cccaaagccc 720aaggatgtgc tcaccattac tctgactcct aaggtcacgt gtgttgtggt agacatcagc 780aaggatgatc ccgaggtcca gttcagctgg tttgtagatg atgtggaggt gcacacagct 840cagacgcaac cccgggagga gcagttcaac agcactttcc gctcagtcag tgaacttccc 900atcatgcacc aggactggct caatggcaag gagttcaaat gcagggtcaa cagtgcagct 960ttccctgccc ccatcgagaa aaccatctcc aaaaccaaag gcagaccgaa ggctccacag 1020gtgtacacca ttccacctcc caaggagcag atggccaagg ataaagtcag tctgacctgc 1080atgataacag acttcttccc tgaagacatt actgtggagt ggcagtggaa tgggcagcca 1140gcggagaact acaagaacac tcagcccatc atggacacag atggctctta cttcgtctac 1200agcaagctca atgtgcagaa gagcaactgg gaggcaggaa atactttcac ctgctctgtg 1260ttacatgagg gcctgcacaa ccaccatact gagaagagcc tctcccactc tcctggtaaa 132036318DNAMus musculus 36gacatacaga tgactcagag cccatcatca ttgagcgcgt ctgtcggcga tcgggttacc 60attacctgcc aggcaagtca agatatcaac aactatattg cttggtatca acagaagccc 120ggtaaagccc caaagctgct gatacactac acctccaccc tggagaccgg cgtgccttct 180agattttctg gaagcgggtc cggaaccgat tatacgttca caatctccag ccttcagccc 240gaagacatcg ccacatacta ctgtctgcaa tacgacaatc tgtggacatt tggccagggg 300actaaggtgg agatcaaa 31837345DNAMus musculus 37gaagtgcagc tggttcagag cggcgccgag gtaaaaccag gggcgacggt gaagataagc 60tgcaaggtga gtgggtactc attcaccgac tattcaatgc actgggtcca acaggcccct 120ggtaaaggac tggagtggat gggatacatc gatccctaca atggaggcac taggtacgcc 180gagaagttcc aggggagagt cactattacc gcagatactt ctaccgatac tgcctacatg 240gaactcagca gtctgcggtc cgaggacaca gcagtctact attgtgctcg ccaaacagac 300tattttgact attggggcca gggaaccttg gtgacagtgt cctct 34538348DNAMus musculus 38caggtgcaat tggtacagtc aggcgcggag gtgaagaagc ctggggctag tgttaaagtc 60tcctgtaaag cctccggata ttccttcact gactactcta tgcattgggt tcgccaggca 120ccagggcagc ggctggaatg gatggggtac attgatccct acaacggagg cacgcgatat 180agtcagaagt tccagggtcg ggtgacaatc acagccgata cgtccaccag caccgcctac 240atggagttga gcagtctcag gtcagaagac acagccgtgt actattgcgc aagacagacc 300gattatttcg actactgggg ccaaggcact ctcgtgaccg tctctagc 34839115PRTMus musculus 39Met Arg Pro Ser Ile Gln Phe Leu Gly Leu Leu Leu Phe Trp Leu His1 5 10 15Gly Ala Gln Cys Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser 20 25 30Ala Ser Leu Gly Gly Lys Val Thr Ile Thr Cys Lys Ala Ser Gln Asp 35 40 45Ile Asn Lys Tyr Ile Ala Trp Tyr Gln His Lys Pro Gly Lys Gly Pro 50 55 60Arg Leu Leu Ile His Tyr Thr Ser Thr Leu Gln Pro Gly Ile Pro Ser65 70 75 80Arg Phe Ser Gly Ser Gly Ser Gly Arg Asp Tyr Ser Phe Ser Ile Ser 85 90 95Asn Leu Glu Pro Glu Asp Ile Ala Thr Tyr Tyr Cys Leu Gln Tyr Asp 100 105 110Asn Leu Leu 1154012PRTMus musculus 40Trp Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys1 5 1041117PRTHomo sapiens 41Met Asp Met Arg Val Pro Ala Gln Leu Leu Gly Leu Leu Gln Leu Trp1 5 10 15Leu Ser Gly Ala Arg Cys Asp Ile Gln Met Thr Gln Ser Pro Ser Ser 20 25 30Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Gln Ala Ser 35 40 45Gln Asp Ile Ser Asn Tyr Leu Asn Trp Tyr Gln Gln Lys Pro Gly Lys 50 55 60Ala Pro Lys Leu Leu Ile Tyr Asp Ala Ser Asn Leu Glu Thr Gly Val65 70 75 80Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Phe Thr 85 90 95Ile Ser Ser Leu Gln Pro Glu Asp Ile Ala Thr Tyr Tyr Cys Gln Gln 100 105 110Tyr Asp Asn Leu Pro 1154212PRTHomo sapiens 42Trp Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys1 5 104398PRTMus musculus 43Glu Ile Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30Asn Met Tyr Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Trp Ile 35 40 45Gly Tyr Ile Asp Pro Tyr Asn Gly Gly Thr Ser Tyr Asn Gln Lys

Phe 50 55 60Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Phe65 70 75 80Met His Leu Asn Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95Ala Arg442PRTMus musculus 44Gln Thr14516PRTMus musculus 45Asp Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Thr Leu Thr Val Ser Ser1 5 10 154698PRTHomo sapiens 46Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Thr Val Lys Ile Ser Cys Lys Val Ser Gly Tyr Thr Phe Thr Asp Tyr 20 25 30Tyr Met His Trp Val Gln Gln Ala Pro Gly Lys Gly Leu Glu Trp Met 35 40 45Gly Leu Val Asp Pro Glu Asp Gly Glu Thr Ile Tyr Ala Glu Lys Phe 50 55 60Gln Gly Arg Val Thr Ile Thr Ala Asp Thr Ser Thr Asp Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Thr47121PRTHomo sapiens 47Met Ser Val Ser Phe Leu Ile Phe Leu Pro Val Leu Gly Leu Pro Trp1 5 10 15Gly Val Leu Ser Gln Val Gln Leu Gln Gln Ser Gly Pro Gly Leu Val 20 25 30Lys Pro Ser Gln Thr Leu Ser Leu Thr Cys Ala Ile Ser Gly Asp Ser 35 40 45Val Ser Ser Asn Ser Ala Ala Trp Asn Trp Ile Arg Gln Ser Pro Ser 50 55 60Arg Gly Leu Glu Trp Leu Gly Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr65 70 75 80Asn Asp Tyr Ala Val Ser Val Lys Ser Arg Ile Thr Ile Asn Pro Asp 85 90 95Thr Ser Lys Asn Gln Phe Ser Leu Gln Leu Asn Ser Val Thr Pro Glu 100 105 110Asp Thr Ala Val Tyr Tyr Cys Ala Arg 115 1204815PRTHomo sapiens 48Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser1 5 10 154997PRTHomo sapiens 49Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25 30Ala Met His Trp Val Arg Gln Ala Pro Gly Gln Arg Leu Glu Trp Met 35 40 45Gly Trp Ile Asn Ala Gly Asn Gly Asn Thr Lys Tyr Ser Gln Lys Phe 50 55 60Gln Gly Arg Val Thr Ile Thr Arg Asp Thr Ser Ala Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala50643DNAMus musculus 50cagatgaagc tgatttgcat gtgctgagat catattctac tgccccagag atttaataat 60ctgatcatac acactccaac agtcattctt ggtcaggaga cgttgtagaa atgagaccgt 120ctattcagtt cctggggctc ttgttgttct ggcttcatgg taaggagttt aacattgaat 180atgctaaaaa gagtatgtga tcaggaattt ctggtccttc agaaaaatct tctttgaata 240taattaattt catagggatt tgtgttcttt ttaattatag gtgctcagtg tgacatccag 300atgacacagt ctccatcctc actgtctgca tctctgggag gcaaagtcac catcacttgc 360aaggcaagcc aagacattaa caagtatata gcttggtacc aacacaagcc tggaaaaggt 420cctaggctgc tcatacatta cacatctaca ttacagccag gcatcccatc aaggttcagt 480ggaagtgggt ctgggagaga ttattccttc agcatcagca acctggagcc tgaagatatt 540gcaacttatt attgtctaca gtatgataat cttctaccca cagtgataca aatcataaca 600aaaaccaccc agggaagcag aagtgagagg ctaggttgcc cac 6435139DNAMus musculus 51tggacgttcg gtggaggcac caagctggaa atcaaacgt 3952667DNAHomo sapiens 52ctgcagctgt gcccagcctg ccctatcccc tgctgatttg catgttcgca gagcacagcc 60ccctgccctg aagacttatt aataggctgg tcgcaccctg tgcaggagtc agtcccaacc 120aggacacagc atggacatga gggtccctgc tcagctcctg gggctcctgc agctctggct 180ctcaggtaag gaaggataac actaggaatt ttctcagcca gtgtgctcag tacagcctgg 240ctcttgatgg aagccttcct ataatatgac taatagtatg aatatttgtg tttatgtttc 300taatcgcagg tgccagatgt gacatccaga tgacccagtc tccatcctcc ctgtctgcat 360ctgtaggaga cagagtcacc atcacttgcc aggcgagtca ggacattagc aactatttaa 420attggtatca gcagaaacca gggaaagccc ctaagctcct gatctacgat gcatccaatt 480tggaaacagg ggtcccatca aggttcagtg gaagtggatc tgggacagat tttactttca 540ccatcagcag cctgcagcct gaagatattg caacatatta ctgtcaacag tatgataatc 600tccctcccac agtgtaacaa gtcataacat aaatcaccca ggggagcaga tgcgtgaggc 660tcagctg 6675337DNAHomo sapiens 53tggacgttcg gccaagggac caaggtggaa atcaaac 3754294DNAMus musculus 54gagatccagc tgcagcagtc tggacctgag ctggtgaagc ctggggcttc agtgaaggta 60tcctgcaagg cttctggtta ctcattcact gactacaaca tgtactgggt gaagcagagc 120catggaaaga gccttgagtg gattggatat attgatcctt acaatggtgg tactagctac 180aaccagaagt tcaagggcaa ggccacattg actgttgaca agtcctccag cacagccttc 240atgcatctca acagcctgac atctgaggac tctgcagtct attactgtgc aaga 29455163DNAMus musculus 55aagcttgccc aggaaccact agtgctcaca cagctctgcc cacaggggaa acctaaccat 60gcctgccccc tactcagcag gaaggctctg aagctctgag aggattttga acaagttact 120gtcacagtga gacagctcgg gctaccatgt aagaaaagct caa 1635645DNAMus musculus 56tactttgact actggggcca aggcaccact ctcacagtct cctca 4557294DNAHomo sapiensCDS(1)..(294) 57gag gtc cag ctg gta cag tct ggg gct gag gtg aag aag cct ggg gct 48Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15aca gtg aaa atc tcc tgc aag gtt tct gga tac acc ttc acc gac tac 96Thr Val Lys Ile Ser Cys Lys Val Ser Gly Tyr Thr Phe Thr Asp Tyr 20 25 30tac atg cac tgg gtg caa cag gcc cct gga aaa ggg ctt gag tgg atg 144Tyr Met His Trp Val Gln Gln Ala Pro Gly Lys Gly Leu Glu Trp Met 35 40 45gga ctt gtt gat cct gaa gat ggt gaa aca ata tac gca gag aag ttc 192Gly Leu Val Asp Pro Glu Asp Gly Glu Thr Ile Tyr Ala Glu Lys Phe 50 55 60cag ggc aga gtc acc ata acc gcg gac acg tct aca gac aca gcc tac 240Gln Gly Arg Val Thr Ile Thr Ala Asp Thr Ser Thr Asp Thr Ala Tyr65 70 75 80atg gag ctg agc agc ctg aga tct gag gac acg gcc gtg tat tac tgt 288Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95gca aca 294Ala Thr5817DNAHomo sapiens 58ggtacaactg gaacgac 175946DNAHomo sapiens 59tactttgact actggggcca aggaaccctg gtcaccgtct cctcag 4660291DNAHomo sapiens 60ggggcctcag tgaaggtttc ctgcaaggct tctggataca ccttccaggt ccagcttgtg 60cagtctgggg ctgaggtgaa gaagcctact agctatgcta tgcattgggt gcgccaggcc 120cccggacaaa ggcttgagtg gatgggatgg atcaacgctg gcaatggtaa cacaaaatat 180tcacagaagt tccagggcag agtcaccatt accagggaca catccgcgag cacagcctac 240atggagctga gcagcctgag atctgaagac acggctgtgt attactgtgc g 29161299PRTHomo sapiens 61Met Gly Thr Lys Ala Gln Val Glu Arg Lys Leu Leu Cys Leu Phe Ile1 5 10 15Leu Ala Ile Leu Leu Cys Ser Leu Ala Leu Gly Ser Val Thr Val His 20 25 30Ser Ser Glu Pro Glu Val Arg Ile Pro Glu Asn Asn Pro Val Lys Leu 35 40 45Ser Cys Ala Tyr Ser Gly Phe Ser Ser Pro Arg Val Glu Trp Lys Phe 50 55 60Asp Gln Gly Asp Thr Thr Arg Leu Val Cys Tyr Asn Asn Lys Ile Thr65 70 75 80Ala Ser Tyr Glu Asp Arg Val Thr Phe Leu Pro Thr Gly Ile Thr Phe 85 90 95Lys Ser Val Thr Arg Glu Asp Thr Gly Thr Tyr Thr Cys Met Val Ser 100 105 110Glu Glu Gly Gly Asn Ser Tyr Gly Glu Val Lys Val Lys Leu Ile Val 115 120 125Leu Val Pro Pro Ser Lys Pro Thr Val Asn Ile Pro Ser Ser Ala Thr 130 135 140Ile Gly Asn Arg Ala Val Leu Thr Cys Ser Glu Gln Asp Gly Ser Pro145 150 155 160Pro Ser Glu Tyr Thr Trp Phe Lys Asp Gly Ile Val Met Pro Thr Asn 165 170 175Pro Lys Ser Thr Arg Ala Phe Ser Asn Ser Ser Tyr Val Leu Asn Pro 180 185 190Thr Thr Gly Glu Leu Val Phe Asp Pro Leu Ser Ala Ser Asp Thr Gly 195 200 205Glu Tyr Ser Cys Glu Ala Arg Asn Gly Tyr Gly Thr Pro Met Thr Ser 210 215 220Asn Ala Val Arg Met Glu Ala Val Glu Arg Asn Val Gly Val Ile Val225 230 235 240Ala Ala Val Leu Val Thr Leu Ile Leu Leu Gly Ile Leu Val Phe Gly 245 250 255Ile Trp Phe Ala Tyr Ser Arg Gly His Phe Asp Arg Thr Lys Lys Gly 260 265 270Thr Ser Ser Lys Lys Val Ile Tyr Ser Gln Pro Ser Ala Arg Ser Glu 275 280 285Gly Glu Phe Lys Gln Thr Ser Ser Phe Leu Val 290 29562897DNAHomo sapiens 62atggggacaa aggcgcaagt cgagaggaaa ctgttgtgcc tcttcatatt ggcgatcctg 60ttgtgctccc tggcattggg cagtgttaca gtgcactctt ctgaacctga agtcagaatt 120cctgagaata atcctgtgaa gttgtcctgt gcctactcgg gcttttcttc tccccgtgtg 180gagtggaagt ttgaccaagg agacaccacc agactcgttt gctataataa caagatcaca 240gcttcctatg aggaccgggt gaccttcttg ccaactggta tcaccttcaa gtccgtgaca 300cgggaagaca ctgggacata cacttgtatg gtctctgagg aaggcggcaa cagctatggg 360gaggtcaagg tcaagctcat cgtgcttgtg cctccatcca agcctacagt taacatcccc 420tcctctgcca ccattgggaa ccgggcagtg ctgacatgct cagaacaaga tggttcccca 480ccttctgaat acacctggtt caaagatggg atagtgatgc ctacgaatcc caaaagcacc 540cgtgccttca gcaactcttc ctatgtcctg aatcccacaa caggagagct ggtctttgat 600cccctgtcag cctctgatac tggagaatac agctgtgagg cacggaatgg gtatgggaca 660cccatgactt caaatgctgt gcgcatggaa gctgtggagc ggaatgtggg ggtcatcgtg 720gcagccgtcc ttgtaaccct gattctcctg ggaatcttgg tttttggcat ctggtttgcc 780tatagccgag gccactttga cagaacaaag aaagggactt cgagtaagaa ggtgatttac 840agccagccta gtgcccgaag tgaaggagaa ttcaaacaga cctcgtcatt cctggtg 89763259PRTHomo sapiens 63Met Gly Thr Lys Ala Gln Val Glu Arg Lys Leu Leu Cys Leu Phe Ile1 5 10 15Leu Ala Ile Leu Pro Glu Asn Asn Pro Val Lys Leu Ser Cys Ala Tyr 20 25 30Ser Gly Phe Ser Ser Pro Arg Ala Ala Ser Tyr Glu Asp Arg Val Thr 35 40 45Phe Leu Pro Thr Gly Ile Thr Phe Lys Ser Val Thr Arg Glu Asp Thr 50 55 60Gly Thr Tyr Thr Cys Met Val Ser Glu Glu Gly Gly Asn Ser Tyr Gly65 70 75 80Glu Val Lys Val Lys Leu Ile Val Leu Val Pro Pro Ser Lys Pro Thr 85 90 95Val Asn Ile Pro Ser Ser Ala Thr Ile Gly Asn Arg Ala Val Leu Thr 100 105 110Cys Ser Glu Gln Asp Gly Ser Pro Pro Ser Glu Tyr Thr Trp Phe Lys 115 120 125Asp Gly Ile Val Met Pro Thr Asn Pro Lys Ser Thr Arg Ala Phe Ser 130 135 140Asn Ser Ser Tyr Val Leu Asn Pro Thr Thr Gly Glu Leu Val Phe Asp145 150 155 160Pro Leu Ser Ala Ser Asp Thr Gly Glu Tyr Ser Cys Glu Ala Arg Asn 165 170 175Gly Tyr Gly Thr Pro Met Thr Ser Asn Ala Val Arg Met Glu Ala Val 180 185 190Glu Arg Asn Val Gly Val Ile Val Ala Ala Val Leu Val Thr Leu Ile 195 200 205Leu Leu Gly Ile Leu Val Phe Gly Ile Trp Phe Ala Tyr Ser Arg Gly 210 215 220His Phe Asp Arg Thr Lys Lys Gly Thr Ser Ser Lys Lys Val Ile Tyr225 230 235 240Ser Gln Pro Ser Ala Arg Ser Glu Gly Glu Phe Lys Gln Thr Ser Ser 245 250 255Phe Leu Val64777DNAHomo sapiens 64atggggacaa aggcgcaagt cgagaggaaa ctgttgtgcc tcttcatatt ggcgatcctt 60cctgagaata atcctgtgaa gttgtcctgt gcctactcgg gcttttcttc tccccgtgca 120gcttcctatg aggaccgggt gaccttcttg ccaactggta tcaccttcaa gtccgtgaca 180cgggaagaca ctgggacata cacttgtatg gtctctgagg aaggcggcaa cagctatggg 240gaggtcaagg tcaagctcat cgtgcttgtg cctccatcca agcctacagt taacatcccc 300tcctctgcca ccattgggaa ccgggcagtg ctgacatgct cagaacaaga tggttcccca 360ccttctgaat acacctggtt caaagatggg atagtgatgc ctacgaatcc caaaagcacc 420cgtgccttca gcaactcttc ctatgtcctg aatcccacaa caggagagct ggtctttgat 480cccctgtcag cctctgatac tggagaatac agctgtgagg cacggaatgg gtatgggaca 540cccatgactt caaatgctgt gcgcatggaa gctgtggagc ggaatgtggg ggtcatcgtg 600gcagccgtcc ttgtaaccct gattctcctg ggaatcttgg tttttggcat ctggtttgcc 660tatagccgag gccactttga cagaacaaag aaagggactt cgagtaagaa ggtgatttac 720agccagccta gtgcccgaag tgaaggagaa ttcaaacaga cctcgtcatt cctggtg 77765116PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 65Xaa Val Gln Leu Xaa Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30Ser Met His Trp Val Arg Gln Ala Pro Gly Gln Xaa Leu Glu Trp Met 35 40 45Gly Xaa Ile Asp Pro Tyr Asn Gly Gly Thr Xaa Tyr Ser Gln Lys Phe 50 55 60Gln Gly Arg Xaa Thr Xaa Thr Xaa Asp Thr Ser Ala Ser Thr Ala Tyr65 70 75 80Met Xaa Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Gln Thr Asp Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110Thr Val Ser Ser 11566116PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 66Xaa Val Gln Leu Xaa Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30Ser Met His Trp Val Arg Gln Ala Pro Gly Gln Xaa Leu Glu Trp Met 35 40 45Gly Xaa Ile Asp Pro Tyr Asn Gly Gly Thr Xaa Tyr Ala Gln Lys Phe 50 55 60Gln Gly Arg Xaa Thr Xaa Thr Xaa Asp Thr Ser Thr Ser Thr Val Tyr65 70 75 80Met Xaa Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Gln Thr Asp Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110Thr Val Ser Ser 11567106PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 67Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Xaa Ala Ser Gln Asp Ile Asn Asn Tyr 20 25 30Xaa Ala Trp Tyr Gln Gln Lys Pro Gly Lys Val Pro Lys Leu Leu Ile 35 40 45Xaa Tyr Thr Ser Thr Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Xaa Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Val Ala Thr Tyr Tyr Cys Leu Gln Tyr Asp Asn Leu Trp Thr 85 90 95Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 100 10568106PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 68Xaa Ile Xaa Met Thr Gln Ser Pro Phe Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Xaa Ala Ser Gln Asp Ile Asn Asn Tyr 20 25 30Xaa Ala Trp Tyr Gln Gln Lys Pro Ala Lys Ala Pro Lys Leu Phe Ile 35 40 45Xaa Tyr Thr Ser Xaa Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Tyr Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Leu Gln Tyr Asp Asn Leu Trp Thr 85 90 95Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 100 10569319DNAMus musculusCDS(1)..(318) 69gac atc cag atg aca cag tct cca tcc tca ctg tct gca tct ctg gga 48Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Leu Gly1 5 10 15ggc aaa gtc acc atc act tgc aag gca agc caa gac att aac aat tat 96Gly Lys Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asn Asn Tyr 20 25 30ata gct tgg tac caa cac aag cct gga aaa ggt cct agg ctg ctc ata 144Ile Ala Trp Tyr Gln His Lys Pro Gly Lys Gly Pro Arg Leu Leu Ile 35 40 45cat tac aca tct aca tta caa gca ggc atc cca tca agg ttc agt gga 192His Tyr Thr Ser Thr Leu Gln Ala Gly Ile Pro Ser Arg Phe Ser Gly 50 55 60agt ggg tct ggg aga gat tat tcc ttc agc atc agc aac ctg gag cct 240Ser Gly Ser Gly Arg Asp Tyr Ser Phe Ser Ile Ser Asn Leu

Glu Pro65 70 75 80gaa gat att gga act tat tat tgt cta cag tat gat aat ctg tgg acg 288Glu Asp Ile Gly Thr Tyr Tyr Cys Leu Gln Tyr Asp Asn Leu Trp Thr 85 90 95ttc ggt gga ggc acc aag ctg gaa atc aaa c 319Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 100 10570287DNAMus musculus 70gacatccaga tgacacagtc tccatcctca ctgtctgcat ctctgggagg caaagtcacc 60atcacttgca aggcaagcca agacattaac aagtatatag cttggtacca acacaagcct 120ggaaaaggtc ctaggctgct catacattac acatctacat tacagccagg catcccatca 180aggttcagtg gaagtgggtc tgggagagat tattccttca gcatcagcaa cctggagcct 240gaagatattg caacttatta ttgtctacag tatgataatc ttctacc 2877138DNAMus musculusCDS(2)..(37) 71g tgg acg ttc ggt gga ggc acc aag ctg gaa atc aaa c 38 Trp Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 1 5 1072312DNAMus musculusCDS(1)..(312) 72gac atc cag atg aca cag tct cca tcc tca ctg tct gca tct ctg gga 48Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Leu Gly1 5 10 15ggc aaa gtc acc atc act tgc aag gca agc caa gac att aac aat tat 96Gly Lys Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asn Asn Tyr 20 25 30ata gct tgg tac caa cac aag cct gga aaa ggt cct agg ctg ctc ata 144Ile Ala Trp Tyr Gln His Lys Pro Gly Lys Gly Pro Arg Leu Leu Ile 35 40 45cat tac aca tct aca tta caa gca ggc atc cca tca agg ttc agt gga 192His Tyr Thr Ser Thr Leu Gln Ala Gly Ile Pro Ser Arg Phe Ser Gly 50 55 60agt ggg tct ggg aga gat tat tcc ttc agc atc agc aac ctg gag cct 240Ser Gly Ser Gly Arg Asp Tyr Ser Phe Ser Ile Ser Asn Leu Glu Pro65 70 75 80gaa gat att gga act tat tat tgt cta cag tat gat aat ctg tgg acg 288Glu Asp Ile Gly Thr Tyr Tyr Cys Leu Gln Tyr Asp Asn Leu Trp Thr 85 90 95ttc ggt gga ggc acc aag ctg gaa 312Phe Gly Gly Gly Thr Lys Leu Glu 10073104PRTMus musculus 73Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Leu Gly1 5 10 15Gly Lys Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asn Asn Tyr 20 25 30Ile Ala Trp Tyr Gln His Lys Pro Gly Lys Gly Pro Arg Leu Leu Ile 35 40 45His Tyr Thr Ser Thr Leu Gln Ala Gly Ile Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Arg Asp Tyr Ser Phe Ser Ile Ser Asn Leu Glu Pro65 70 75 80Glu Asp Ile Gly Thr Tyr Tyr Cys Leu Gln Tyr Asp Asn Leu Trp Thr 85 90 95Phe Gly Gly Gly Thr Lys Leu Glu 10074287DNAHomo sapiensCDS(1)..(285) 74gac atc cag atg acc cag tct cca tcc tcc ctg tct gca tct gta gga 48Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15gac aga gtc acc atc act tgc cag gcg agt cag gac att agc aac tat 96Asp Arg Val Thr Ile Thr Cys Gln Ala Ser Gln Asp Ile Ser Asn Tyr 20 25 30tta aat tgg tat cag cag aaa cca ggg aaa gcc cct aag ctc ctg atc 144Leu Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45tac gat gca tcc aat ttg gaa aca ggg gtc cca tca agg ttc agt gga 192Tyr Asp Ala Ser Asn Leu Glu Thr Gly Val Pro Ser Arg Phe Ser Gly 50 55 60agt gga tct ggg aca gat ttt act ttc acc atc agc agc ctg cag cct 240Ser Gly Ser Gly Thr Asp Phe Thr Phe Thr Ile Ser Ser Leu Gln Pro65 70 75 80gaa gat att gca aca tat tac tgt caa cag tat gat aat ctc cct cc 287Glu Asp Ile Ala Thr Tyr Tyr Cys Gln Gln Tyr Asp Asn Leu Pro 85 90 957595PRTHomo sapiens 75Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Gln Ala Ser Gln Asp Ile Ser Asn Tyr 20 25 30Leu Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Asp Ala Ser Asn Leu Glu Thr Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Phe Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Ile Ala Thr Tyr Tyr Cys Gln Gln Tyr Asp Asn Leu Pro 85 90 957637DNAMus musculusCDS(2)..(37) 76g tgg acg ttc ggt gga ggc acc aag ctg gaa atc aaa 37 Trp Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 1 5 107737DNAHomo sapiensCDS(2)..(37) 77g tgg acg ttc ggc caa ggg acc aag gtg gaa atc aaa 37 Trp Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 1 5 107812PRTHomo sapiens 78Trp Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys1 5 1079349DNAMus musculusCDS(1)..(348) 79gag atc cag ctg cag cag tct gga cct gag ctg gtg aag cct ggg gct 48Glu Ile Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala1 5 10 15tca gtg aag gta tcc tgc aag gct tct ggt tac tca ttc act gac tac 96Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30agc atg tac tgg gtg aag cag agc cat gga aag agc ctt gag tgg att 144Ser Met Tyr Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Trp Ile 35 40 45gga tat att gat cct tac aat ggt ggt act agg tac aac cag aag ttc 192Gly Tyr Ile Asp Pro Tyr Asn Gly Gly Thr Arg Tyr Asn Gln Lys Phe 50 55 60aag ggc aag gcc aca ttg act gtt gac aag tcc tcc agc aca gcc ttc 240Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Phe65 70 75 80atg cat ctc aac agc ctg aca tct gag gac tct gca gtc tat tac tgt 288Met His Leu Asn Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95gca aga cag acg gac tac ttt gac tac tgg ggc caa ggc acc act ctc 336Ala Arg Gln Thr Asp Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Thr Leu 100 105 110aca gtc tcc tca g 349Thr Val Ser Ser 115806PRTMus musculus 80Ala Arg Gln Thr Asp Tyr1 58116DNAMus musculus 81agacagctc gggctac 168218PRTMus musculus 82Gln Thr Asp Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Thr Leu Thr Val1 5 10 15Ser Ser8354DNAMus musculusCDS(1)..(54) 83cag acg gac tac ttt gac tac tgg ggc caa ggc acc act ctc aca gtc 48Gln Thr Asp Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Thr Leu Thr Val1 5 10 15tcc tca 54Ser Ser8447DNAMus musculus 84actactttga ctactggggc caaggcacca ctctcacagt ctcctca 4785336DNAMus musculusCDS(1)..(336) 85gag atc cag ctg cag cag tct gga cct gag ctg gtg aag cct ggg gct 48Glu Ile Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala1 5 10 15tca gtg aag gta tcc tgc aag gct tct ggt tac tca ttc act gac tac 96Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30agc atg tac tgg gtg aag cag agc cat gga aag agc ctt gag tgg att 144Ser Met Tyr Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Trp Ile 35 40 45gga tat att gat cct tac aat ggt ggt act agg tac aac cag aag ttc 192Gly Tyr Ile Asp Pro Tyr Asn Gly Gly Thr Arg Tyr Asn Gln Lys Phe 50 55 60aag ggc aag gcc aca ttg act gtt gac aag tcc tcc agc aca gcc ttc 240Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Phe65 70 75 80atg cat ctc aac agc ctg aca tct gag gac tct gca gtc tat tac tgt 288Met His Leu Asn Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95gca aga cag acg gac tac ttt gac tac tgg ggc caa ggc acc act ctc 336Ala Arg Gln Thr Asp Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Thr Leu 100 105 11086112PRTMus musculus 86Glu Ile Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30Ser Met Tyr Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Trp Ile 35 40 45Gly Tyr Ile Asp Pro Tyr Asn Gly Gly Thr Arg Tyr Asn Gln Lys Phe 50 55 60Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Phe65 70 75 80Met His Leu Asn Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95Ala Arg Gln Thr Asp Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Thr Leu 100 105 1108715DNAMus musculusCDS(1)..(15) 87cag acg gac tac ttt 15Gln Thr Asp Tyr Phe1 5885PRTMus musculus 88Gln Thr Asp Tyr Phe1 58956DNAMus musculusCDS(9)..(56) 89gacagacg gac tac ttt gac tac tgg ggc caa ggc acc act ctc aca gtc 50 Asp Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Thr Leu Thr Val 1 5 10tcc tca 56Ser Ser159047DNAHomo sapiensCDS(3)..(47) 90ac tac ttt gac tac tgg ggc caa gga acc ctg gtc acc gtc tcc tca 47 Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 1 5 10 1591106PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 91Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asn Asn Tyr 20 25 30Ile Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45His Tyr Thr Ser Thr Leu Gln Ala Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Arg Asp Tyr Thr Phe Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Ile Ala Thr Tyr Tyr Cys Leu Gln Tyr Asp Asn Leu Trp Thr 85 90 95Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 100 10592116PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 92Glu Ile Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Thr Val Lys Ile Ser Cys Lys Val Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30Ser Met Tyr Trp Val Gln Gln Ala Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45Gly Tyr Ile Asp Pro Tyr Asn Gly Gly Thr Arg Tyr Asn Gln Lys Phe 50 55 60Lys Gly Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Asp Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Gln Thr Asp Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110Thr Val Ser Ser 1159397PRTMus musculus 93Glu Ile Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30Ser Met Tyr Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Trp Ile 35 40 45Gly Tyr Ile Asp Pro Tyr Asn Gly Gly Thr Arg Tyr Asn Gln Lys Phe 50 55 60Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Phe65 70 75 80Met His Leu Asn Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95Ala9497PRTMus musculus 94Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30Ser Met His Trp Val Arg Gln Ala Pro Gly Gln Arg Leu Glu Trp Met 35 40 45Gly Trp Ile Asp Pro Tyr Asn Gly Gly Thr Lys Tyr Ser Gln Lys Phe 50 55 60Gln Gly Arg Val Thr Ile Thr Arg Asp Thr Ser Ala Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala9597PRTMus musculus 95Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30Ser Met His Trp Val Arg Gln Ala Pro Gly Gln Arg Leu Glu Trp Met 35 40 45Gly Tyr Ile Asp Pro Tyr Asn Gly Gly Thr Arg Tyr Ser Gln Lys Phe 50 55 60Gln Gly Arg Val Thr Ile Thr Ala Asp Thr Ser Thr Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala96106PRTHomo sapiens 96Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Asp Ile Asn Asn Tyr 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Val Pro Lys Leu Leu Ile 35 40 45Tyr Tyr Thr Ser Thr Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Val Gly Thr Tyr Tyr Cys Leu Gln Tyr Asp Asn Leu Trp Thr 85 90 95Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 100 10597106PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 97Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asn Asn Tyr 20 25 30Ile Ala Trp Tyr Gln Gln Lys Pro Gly Lys Val Pro Lys Leu Leu Ile 35 40 45His Tyr Thr Ser Thr Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Tyr Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Val Gly Thr Tyr Tyr Cys Leu Gln Tyr Asp Asn Leu Trp Thr 85 90 95Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 100 10598106PRTHomo sapiens 98Ala Ile Arg Met Thr Gln Ser Pro Phe Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Trp Ala Ser Gln Asp Ile Asn Asn Tyr 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro Ala Lys Ala Pro Lys Leu Phe Ile 35 40 45Tyr Tyr Thr Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Tyr Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Leu Gln Tyr Asp Asn Leu Trp Thr 85 90 95Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 100 10599106PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 99Asp Ile Gln Met Thr Gln Ser Pro Phe Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asn Asn Tyr 20 25 30Ile Ala Trp Tyr Gln Gln Lys Pro Ala Lys Ala Pro Lys Leu Phe Ile 35 40 45His Tyr Thr Ser Thr Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Tyr Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Leu Gln Tyr Asp Asn Leu Trp Thr 85 90 95Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 100 105100116PRTHomo sapiens 100Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30Ser Met His Trp Val Arg Gln Ala Pro Gly Gln Arg Leu Glu Trp Met

35 40 45Gly Trp Ile Asp Pro Tyr Asn Gly Gly Thr Lys Tyr Ser Gln Lys Phe 50 55 60Gln Gly Arg Val Thr Ile Thr Arg Asp Thr Ser Ala Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Gln Thr Asp Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110Thr Val Ser Ser 115101116PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 101Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30Ser Met His Trp Val Arg Gln Ala Pro Gly Gln Ser Leu Glu Trp Met 35 40 45Gly Tyr Ile Asp Pro Tyr Asn Gly Gly Thr Arg Tyr Ser Gln Lys Phe 50 55 60Gln Gly Arg Ala Thr Leu Thr Val Asp Thr Ser Ala Ser Thr Ala Tyr65 70 75 80Met His Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Gln Thr Asp Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110Thr Val Ser Ser 115102116PRTHomo sapiens 102Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30Ser Met His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45Gly Ile Ile Asp Pro Tyr Asn Gly Gly Thr Ser Tyr Ala Gln Lys Phe 50 55 60Gln Gly Arg Val Thr Met Thr Arg Asp Thr Ser Thr Ser Thr Val Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Gln Thr Asp Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110Thr Val Ser Ser 11510310PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 103Cys Leu Gln Tyr Asp Asn Leu Trp Thr Phe1 5 1010411PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 104Cys Ala Arg Gln Thr Asp Tyr Phe Asp Tyr Trp1 5 10

Claims

1. A method for preventing or treating a disease related to tumor cell proliferation in a mammal comprising administering to said mammal an antibody or a derived compound or functional fragment of said antibody, wherein said antibody, derived compound, or functional fragment comprises at least one complementarity-determining region ("CDR") and wherein said at least one CDR comprises SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, or a combination thereof.

2. The method according to claim 1, wherein said disease related to tumor cells proliferation is cancer.

3. The method according to claim 2, wherein said cancer is a cancer selected from the group consisting of prostate cancer, osteosarcoma, lung cancer, breast cancer, endometrial cancer, multiple myeloma, ovarian cancer, pancreatic cancer, and colon cancer.

4. The method according to claim 3, wherein said cancer is a cancer selected from the group consisting of estrogen-related breast cancer, non-small cell lung cancer, colon cancer, and pancreatic cancer.