U.S. patent application number 13/375357 was filed with the patent office on 2012-05-24 for monovalent, bivalent and trivalent anti human respiratory syncytial virus (hrsv) nanobody constructs for the prevention and/or treatment of respiratory tract infections.
This patent application is currently assigned to Ablynx N.V.. Invention is credited to Erik Depla, Stephanie Staelens, Catelijne Stortelers.
Application Number | 20120128669 13/375357 |
Document ID | / |
Family ID | 42333502 |
Filed Date | 2012-05-24 |
United States Patent
Application |
20120128669 |
Kind Code |
A1 |
Depla; Erik ; et
al. |
May 24, 2012 |
MONOVALENT, BIVALENT AND TRIVALENT ANTI HUMAN RESPIRATORY SYNCYTIAL
VIRUS (HRSV) NANOBODY CONSTRUCTS FOR THE PREVENTION AND/OR
TREATMENT OF RESPIRATORY TRACT INFECTIONS
Abstract
Amino acid sequences are provided that are directed against
and/or that can specifically bind protein F of hRSV, as well as to
compounds or constructs, and in particular proteins and
polypeptides, that comprise or essentially consist of one or more
such amino acid sequences. The amino acid sequences, polypeptides
and therapeutic compounds and compositions provided by the
invention show an improved stability, less immunogenicity and/or
improved affinity and/or avidity for protein F of hRSV. The
invention also relates to the uses of such amino acid sequences,
polypeptides, compounds or constructs for prophylactic and/or
therapeutic purposes.
Inventors: |
Depla; Erik; (Destelbergen,
BE) ; Stortelers; Catelijne; (Gent, BE) ;
Staelens; Stephanie; (Wevelgen, BE) |
Assignee: |
Ablynx N.V.
Zwijnaarde
BE
|
Family ID: |
42333502 |
Appl. No.: |
13/375357 |
Filed: |
June 7, 2010 |
PCT Filed: |
June 7, 2010 |
PCT NO: |
PCT/EP10/57921 |
371 Date: |
January 25, 2012 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
61184396 |
Jun 5, 2009 |
|
|
|
61265014 |
Nov 30, 2009 |
|
|
|
Current U.S.
Class: |
424/133.1 ;
435/252.3; 435/252.31; 435/252.33; 435/252.34; 435/252.35;
435/254.11; 435/254.2; 435/254.21; 435/254.23; 435/254.3;
435/254.4; 435/254.6; 435/320.1; 435/328; 435/419; 435/69.6;
530/387.3; 536/23.53; 800/317.3 |
Current CPC
Class: |
C07K 2317/92 20130101;
C07K 16/1027 20130101; C07K 2317/567 20130101; A61P 11/06 20180101;
A61M 15/0065 20130101; A61M 2202/064 20130101; C07K 2317/569
20130101; A61P 29/00 20180101; C07K 2317/34 20130101; C07K 2317/35
20130101; C07K 2317/22 20130101; C07K 2317/76 20130101; A61M 11/00
20130101; A61P 31/14 20180101; A61K 2039/505 20130101; C07K
2317/626 20130101; C07K 2317/565 20130101; A61P 11/00 20180101;
A61P 11/04 20180101; C07K 2317/56 20130101; A61P 11/14
20180101 |
Class at
Publication: |
424/133.1 ;
530/387.3; 536/23.53; 435/320.1; 435/69.6; 435/252.33; 435/252.3;
435/252.34; 435/252.31; 435/252.35; 435/254.6; 435/254.4;
435/254.11; 435/254.3; 435/254.21; 435/254.23; 435/254.2; 435/328;
435/419; 800/317.3 |
International
Class: |
A61K 39/42 20060101
A61K039/42; C12N 15/13 20060101 C12N015/13; C12N 15/63 20060101
C12N015/63; C12P 21/02 20060101 C12P021/02; C07K 1/107 20060101
C07K001/107; C12N 1/21 20060101 C12N001/21; C12N 1/15 20060101
C12N001/15; C12N 1/19 20060101 C12N001/19; C12N 5/10 20060101
C12N005/10; A01H 5/00 20060101 A01H005/00; A61P 31/14 20060101
A61P031/14; A61P 11/00 20060101 A61P011/00; A61P 29/00 20060101
A61P029/00; A61P 11/06 20060101 A61P011/06; C07K 16/10 20060101
C07K016/10 |
Claims
1.-30. (canceled)
31. Polypeptide that comprises or essentially consists of at least
one amino acid sequence and/or one or more Nanobody.RTM. that is
directed against and/or specifically binds protein F of hRSV, and
optionally further comprises one or more other amino acid binding
units, optionally linked via one or more peptidic linkers, wherein
the at least one amino acid sequence and/or one or more
Nanobody.RTM. is chosen from the following: a) SEQ ID NO's: 138-141
and 154-157; b) amino acid sequences that have no more than 3, no
more than 2, or no more than 1 amino acid difference with one of
SEQ ID NO's: 138-141 and 154-157, provided that: i) the amino acid
sequence has an Aspartic acid (Asp, D) at position 1 (said position
determined according to Kabat numbering); and ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference.
32. Polypeptide according to claim 31, wherein the at least one
amino acid sequence and/or one or more Nanobody.RTM. is chosen from
the following: a) SEQ ID NO's: 140-141 and 154-157; b) amino acid
sequences that have no more than 3, no more than 2, or no more than
1 amino acid difference with one of SEQ ID NO's: 140-141 and
154-157, provided that: i) the amino acid sequence has a Proline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and Leucine (Leu, L) at position 108 (said
positions determined according to Kabat numbering); and ii) the
amino acid sequence binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence without the 3, 2 or 1 amino
acid difference.
33. Polypeptide according to claim 31, wherein the at least one
amino acid sequence and/or one or more Nanobody.RTM. is chosen from
the following: a) SEQ ID NO's: 140-141 and 154-157; b) amino acid
sequences that have no more than 3, no more than 2, or no more than
1 amino acid difference with one of SEQ ID NO's: 140-141 and
154-157, provided that: i) the amino acid sequence has a Proline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and Leucine (Leu, L) at position 108; and
in addition Arginine (Arg, R) at position 83, Glutamic acid (Glu,
E) at position 85 and/or Glutamine (Gln, Q) at position 105 (said
positions determined according to Kabat numbering); and ii) the
amino acid sequence binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence without the 3, 2 or 1 amino
acid difference.
34. Polypeptide according to claim 31, wherein the polypeptide
comprises or essentially consists of at least one amino acid
sequence and/or Nanobody.RTM. with SEQ ID NO: 5, in which one or
more amino acid residues have been mutated selected from the
following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54 Asp,
and wherein the Glutamic acid at position 1 has been changed into
Aspartic acid.
35. Polypeptide according to claim 31, wherein the polypeptide
comprises or essentially consists of at least one amino acid
sequence and/or Nanobody.RTM. with SEQ ID NO: 5, wherein following
amino acid residues have been mutated: Glu1Asp; Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu and Gln108Leu; Glu1Asp, Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Ala83Arg; Glu1Asp, Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Asp85Glu; Glu1Asp, Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Arg105Gln; Glu1Asp, Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg and Asp85Glu; Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln; Glu1Asp,
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and Arg105Gln; or
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg,
Asp85Glu and Arg105Gln.
36. Polypeptide according to claim 31, wherein the polypeptide is a
multivalent polypeptide.
37. Multivalent polypeptide according to claim 36, wherein the
multivalent polypeptide is a bivalent or trivalent polypeptide.
38. Trivalent polypeptide according to claim 37, wherein the
trivalent polypeptide is directed against and/or specifically binds
protein F of hRSV, chosen from the following polypeptides: a) SEQ
ID NO's: 142-145 and 162-165; b) polypeptides that have no more
than 3, no more than 2, or no more than 1 amino acid difference
with one of SEQ ID NO's: 142-145 and 162-165, provided that: i) the
first amino acid sequence or Nanobody.RTM. encompassed in said
polypeptide has an Aspartic acid (Asp, D) at position 1; and ii)
the polypeptide binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the polypeptide has the same, about the
same, or a higher potency (as defined herein) compared to the
polypeptide without the 3, 2 or 1 amino acid difference.
39. Trivalent polypeptide according to claim 37, wherein the
trivalent polypeptide is directed against and/or specifically binds
protein F of hRSV, chosen from the following polypeptides: a) SEQ
ID NO's: 144-145 and 162-165; b) polypeptides that have no more
than 3, no more than 2, or no more than 1 amino acid difference
with one of SEQ ID NO's: 144-145 and 162-165, provided that: i) the
amino acid sequence or Nanobody.RTM. encompassed in said
polypeptide has a Proline (Pro, P) at position 14, Arginine (Arg,
R) at position 19, Leucine (Leu, L) at position 20 and Leucine
(Leu, L) at position 108 (said positions determined according to
Kabat numbering); and ii) the polypeptide binds protein F of hRSV
with the same, about the same, or a higher affinity (said affinity
as measured by surface plasmon resonance) and/or the polypeptide
has the same, about the same, or a higher potency (as defined
herein) compared to the amino acid sequence without the 3, 2 or 1
amino acid difference.
40. Trivalent polypeptide according to claim 37, wherein the
trivalent polypeptide is directed against and/or specifically binds
protein F of hRSV, chosen from the following polypeptides: a) SEQ
ID NO's: 144-145 and 162-165; b) polypeptides that have no more
than 3, no more than 2, or no more than 1 amino acid difference
with one of SEQ ID NO's: 144-145 and 162-165, provided that: i) the
amino acid sequence or Nanobody.RTM. encompassed in said
polypeptide has a Proline (Pro, P) at position 14, Arginine (Arg,
R) at position 19, Leucine (Leu, L) at position 20 and Leucine
(Leu, L) at position 108; and in addition Arginine (Arg, R) at
position 83, Glutamic acid (Glu, E) at position 85 and/or Glutamine
(Gln, Q) at position 105 (said positions determined according to
Kabat numbering); and ii) the polypeptide binds protein F of hRSV
with the same, about the same, or a higher affinity (said affinity
as measured by surface plasmon resonance) and/or the polypeptide
has the same, about the same, or a higher potency (as defined
herein) compared to the polypeptide without the 3, 2 or 1 amino
acid difference.
41. Trivalent polypeptide according to claim 37, comprising or
essentially consisting of SEQ ID NO: 53, wherein the first Glutamic
acid has been changed into Aspartic acid, and in which optionally
in at least one, at least two, or in all three
Nanobody.RTM./Nanobodies.RTM. that form(s) part of SEQ ID NO: 53,
one or more (such as two, three, four, five, six, seven, eight or
nine, ten, eleven or twelve) amino acid residues have been mutated
selected from the following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu,
Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp.
42. Trivalent polypeptide according to claim 37, comprising or
essentially consisting of SEQ ID NO: 53, in which in at least one
Nanobody.RTM. that forms part of SEQ ID NO: 53 the following amino
acid residue(s) have been mutated: Glu1Asp; Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu and Gln108Leu; Glu1Asp, Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Ala83Arg; Glu1Asp, Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Asp85Glu; Glu1Asp, Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Arg105Gln; Glu1Asp, Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg and Asp85Glu; Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln; Glu1Asp,
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and Arg105Gln; or
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg,
Asp85Glu and Arg105Gln.
43. Trivalent polypeptide according to claim 37, comprising or
essentially consisting of one of SEQ ID NO's: 142-145 and
162-165.
44. Amino acid sequence and/or Nanobody.RTM. that is directed
against and/or specifically binds protein F of hRSV, wherein the
amino acid sequence and/or Nanobody.RTM. is chosen from the
following: a) SEQ ID NO's: 138-141 and 154-157; b) amino acid
sequences that have no more than 3, no more than 2, or no more than
1 amino acid difference with one of SEQ ID NO's: 138-141 and
154-157, provided that: i) the amino acid sequence has an Aspartic
acid (Asp, D) at position 1 (said position determined according to
Kabat numbering); and ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference.
45. Monovalent construct, comprising or essentially consisting of
one amino acid sequence and/or one Nanobody.RTM. according to claim
44.
46. A multivalent polypeptide comprising multiple monovalent
constructs of claim 45.
47. Nucleic acid or nucleotide sequence that encodes a polypeptide
according to claim 31.
48. A genetic construct comprising the nucleic acid or nucleotide
sequence of claim 47.
49. Host or host cell that comprises a nucleic acid or nucleotide
sequence according to claim 47.
50. Composition, comprising a polypeptide according to claim
31.
51. Composition according to claim 50, which is a pharmaceutical
composition.
52. Pharmaceutical composition comprising a polypeptide according
to claim 31 and a carrier suitable for pulmonary delivery.
53. Method for producing a polypeptide, said method at least
comprising the steps of: a) expressing, in a suitable host cell or
host organism or in another suitable expression system, a nucleic
acid or nucleotide sequence according to claim 47, optionally
followed by: b) isolating and/or purifying the polypeptide, thus
obtained.
54. Method for preparing a bivalent or trivalent polypeptide, said
method comprising at least the steps of linking two or more
monovalent amino acid sequences or monovalent construct according
to claim 45 and, for example, one or more linkers.
55. Method for the prevention and/or treatment of hRSV infection,
said method comprising administering to a subject in need thereof,
a pharmaceutically active amount of a polypeptide according to
claim 31.
56. Method for the prevention and/or treatment of at least one of
respiratory illness, upper respiratory tract infection, lower
respiratory tract infection, bronchiolitis (inflammation of the
small airways in the lung), pneumonia, dyspnea, cough, (recurrent)
wheezing and asthma, said method comprising administering to a
subject in need thereof a pharmaceutically active amount of a
polypeptide according to claim 31.
57. Pharmaceutical device suitable for the pulmonary delivery of a
polypeptide according to claim 31.
58. Pharmaceutical device according to claim 57 that is an inhaler
for liquids (e.g. a suspension of fine solid particles or
droplets), an aerosol or a dry powder inhaler.
Description
FIELD OF THE INVENTION
[0001] The present invention relates to amino acid sequences that
are directed against/and or that can specifically bind (as defined
herein) protein F of hRSV, as well as to compounds or constructs,
and in particular proteins and polypeptides, that comprise or
essentially consist of one or more such amino acid sequences (also
referred to herein as "amino acid sequence(s) of the invention",
"compound(s) of the invention", "construct(s) of the invention" and
"polypeptide(s) of the invention", respectively).
[0002] The invention also relates to nucleic acids encoding such
amino acid sequences and polypeptides (also referred to herein as
"nucleic acid(s) of the invention" or "nucleotide sequence(s) of
the invention"); to methods for preparing such amino acid sequences
and polypeptides; to host cells expressing or capable of expressing
such amino acid sequences or polypeptides; to compositions, and in
particular to pharmaceutical compositions, that comprise such amino
acid sequences, polypeptides, compounds or constructs, nucleic
acids and/or host cells; and to uses of such amino acid sequences,
polypeptides, compounds or constructs, nucleic acids, host cells
and/or compositions, in particular for prophylactic and/or
therapeutic purposes, such as the prophylactic and/or therapeutic
purposes mentioned herein.
[0003] Other aspects, embodiments, advantages and applications of
the invention will become clear from the further description
herein.
BACKGROUND ART
[0004] Human respiratory syncytial virus (hRSV) is a member of the
Paramyxoviridae family and is an enveloped virus with two main
surface glycoproteins that make the spikes of the virus particle.
One of these glycoproteins (protein G) is the attachment protein
that mediates binding of the virus to the cell surface. The other
glycoprotein (protein F or fusion) mediates fusion of the viral and
cell membranes, allowing the entry of the viral nucleocapsid into
the cell cytoplasm. Inhibition of the steps mediated by either G or
F glycoproteins blocks the initial stages of the infectious cycle
and neutralizes virus infectivity. Therefore, antibodies directed
against either G or F, and which inhibit their respective
activities, may neutralize virus infectivity and may protect
against a hRSV infection. The F protein is highly conserved and
forms trimeric spikes that undergo conformational changes upon
activation.
[0005] hRSV is the leading cause of severe lower respiratory tract
infections (bronchiolitis and pneumonia) in infants and very young
children and causes annual epidemics during the winter months. The
virus also causes a substantial disease burden among the elderly
and adults with underlying cardiopulmonary disorders and/or
immunosuppressive conditions are also at risk of severe hRSV
disease. The immune response does not prevent re-infections.
[0006] There is no vaccine available to prevent hRSV infections.
The only drug product available in the market is a humanized
monoclonal antibody (Synagis.RTM.) directed against one of the
viral glycoproteins (protein F) which is used prophylactically in
children that are at a very high risk of suffering a severe hRSV
infection. The restricted use of Synagis.RTM. is due, at least in
part, to the high cost of this product. There is clearly a need for
improved and/or cheaper prophylactic and/or therapeutic agents for
the prevention and or treatment of infections by hRSV.
SUMMARY OF THE INVENTION
[0007] The present invention provides amino acid sequences (also
referred to as "amino acid sequence(s) of the invention"),
polypeptides (also referred to as "polypeptide(s) of the
invention") and therapeutic compounds and compositions that are
directed against protein F of hRSV and that have improved
prophylactic, therapeutic and/or pharmacological properties, in
addition to other advantageous properties (such as, for example,
improved ease of preparation and/or reduced costs of goods),
compared to the prior art amino acid sequences and antibodies.
These improved and advantageous properties will become clear from
the further description herein. Without being limiting, the amino
acid sequences, polypeptides and therapeutic compounds and
compositions provided by the invention may show an improved
stability, less immunogenicity, improved binding to protein F of
hRSV, improved affinity and/or avidity for protein F of hRSV,
improved efficacy and/or potency for neutralizing hRSV (as defined
herein), an increased selectivity for protein F of hRSV and/or they
may be capable of partially or preferably totally blocking the
interaction of protein F of hRSV with the target host cell and/or
its membrane. They may be capable of neutralizing hRSV by
modulating, inhibiting and/or preventing hRSV infectivity, by
modulating, inhibiting and/or preventing hRSV fusion with (the cell
membrane of) the target host cell, and/or by modulating, inhibiting
and/or prevent hRSV entry in the target host cell (as defined
herein). They may be cross reactive with and/or capable of
neutralizing different strains of hRSV and/or different hRSV escape
mutants.
[0008] In a first aspect, the present invention provides a number
of stretches of amino acid residues (as defined herein) that are
particularly suited for binding to a specific epitope on protein F
of hRSV. These stretches of amino acid residues may be present in,
and/or may be incorporated into, an amino acid sequence of the
invention, in particular in such a way that they form (part of) the
antigen binding site of the amino acid sequence of the invention.
The resulting amino acid sequences will be capable of binding a
specific epitope on protein F of hRSV that lies in, forms part of,
or overlaps with (i.e. in the primary or tertiary structure) or is
in close proximity to (i.e. in the primary or tertiary structure)
antigenic site II on protein F of hRSV (i.e. amino acid residues
250-275 of protein F of hRSV).
[0009] Accordingly, in one aspect, the present invention provides
amino acid sequences that comprise at least a stretch of amino acid
residues chosen from the following: [0010] a) SEQ ID NO: 102;
[0011] b) a stretch of amino acid residues that has no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with SEQ ID NO: 102, provided that: [0012] i) said
stretch of amino acid residues has an Aspartic acid (Asp, D) at
position 6 (position 54 determined according to Kabat numbering);
and [0013] ii) the amino acid sequence comprising said stretch of
amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference.
[0014] In a preferred aspect, the present invention provides amino
acid sequences that comprise two or more stretches of amino acid
residues in which one stretch is chosen from the following: [0015]
a) SEQ ID NO: 102; [0016] b) a stretch of amino acid residues that
has no more than 3, preferably no more than 2, more preferably no
more than 1 amino acid difference with SEQ ID NO: 102, provided
that: [0017] i) said stretch of amino acid residues has an Aspartic
acid (Asp, D) at position 6 (position 54 determined according to
Kabat numbering); and [0018] ii) the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference;
and at least one stretch is chosen from: [0019] c) SEQ ID NO: 98;
[0020] d) a stretch of amino acid residues that has no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with SEQ ID NO: 98, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [0021] e) SEQ ID NO: 121; and [0022] f) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 121, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference.
[0023] such that the stretch of amino acid residues that
corresponds to one of a), and b) should always be present in the
amino acid sequence of the invention and such that the second
stretch of amino acid residues is chosen from one of c), d), e) and
f).
[0024] Even more preferably, the amino acid sequences of the
invention comprise three or more stretches of amino acid residues,
in which the first stretch of amino acid residues is chosen from
the group consisting of: [0025] a) SEQ ID NO: 98; [0026] b) a
stretch of amino acid residues that has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with SEQ ID NO: 98, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; or the second stretch of amino acid residues is chosen
from the group consisting of: [0027] c) SEQ ID NO: 102; [0028] d) a
stretch of amino acid residues that has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with SEQ ID NO: 102, provided that: [0029] i) said
stretch of amino acid residues has an Aspartic acid (Asp, D) at
position 6 (position 54 determined according to Kabat numbering);
and [0030] ii) the amino acid sequence comprising said stretch of
amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference; and the third stretch
of amino acid residues is chosen from the group consisting of:
[0031] e) SEQ ID NO: 121; [0032] f) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
121, provided that the amino acid sequence comprising said stretch
of amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference.
[0033] Amino acid sequences comprising one or more of these
specific stretches of amino acid residues have shown improved
properties such as e.g. improved binding characteristics (suitably
measured and/or expressed as a K.sub.D-value (actual or apparent),
a K.sub.A-value (actual or apparent), a k.sub.on-rate and/or a
k.sub.off-rate, or alternatively as an IC.sub.50 value, as further
described herein), improved affinity and/or improved avidity for
protein F of hRSV and/or improved efficacy and/or potency for
neutralizing hRSV.
[0034] The amino acid sequence of the invention may in particular
be a domain antibody (or an amino acid sequence that is suitable
for use as a domain antibody), a single domain antibody (or an
amino acid sequence that is suitable for use as a single domain
antibody), a "dAb" (or an amino acid sequence that is suitable for
use as a dAb) or a Nanobody.RTM. (as defined herein, and including
but not limited to a V.sub.HH sequence); other single variable
domains, or any suitable fragment of any one thereof.
[0035] In this respect, the amino acid sequences of the invention
may essentially consist of 4 framework regions (FR1 to FR4,
respectively) and 3 complementarity determining regions (CDR1 to
CDR3, respectively), in which CDR2 is chosen from: [0036] a) SEQ ID
NO: 102; [0037] b) a stretch of amino acid residues that has no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with SEQ ID NO: 102, provided that:
[0038] i) said stretch of amino acid residues has an Aspartic acid
(Asp, D) at position 6 (position 54 determined according to Kabat
numbering); and [0039] ii) the amino acid sequence comprising said
stretch of amino acid residues binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid
difference.
[0040] These preferred complementarity determining regions (CDR2
sequences) are also referred to as "CDR2(s) of the invention".
[0041] Preferably, the amino acid sequences of the invention may
essentially consist of 4 framework regions (FR1 to FR4,
respectively) and 3 complementarity determining regions (CDR1 to
CDR3, respectively), in which CDR2 is chosen from the group
consisting of: [0042] a) SEQ ID NO: 102; or [0043] b) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 102, provided that: [0044] i) said stretch of amino acid
residues has an Aspartic acid (Asp, D) at position 6 (position 54
determined according to Kabat numbering); and [0045] ii) the amino
acid sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [0046] and at least one of CDR1 or CDR3 is chosen from:
[0047] CDR1 chosen from the group consisting of: [0048] c) SEQ ID
NO: 98; [0049] d) a stretch of amino acid residues that has no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with SEQ ID NO: 98, provided that the amino
acid sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; or [0050] and/or [0051] CDR3 chosen from the group
consisting of: [0052] e) SEQ ID NO: 121; or [0053] f) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 121, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid
difference.
[0054] Even more preferably, the amino acid sequences of the
invention may essentially consist of 4 framework regions (FR1 to
FR4, respectively) and 3 complementarity determining regions (CDR1
to CDR3, respectively), in which: CDR1 is chosen from the group
consisting of: [0055] a) SEQ ID NO: 98; [0056] b) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 98, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference;
[0057] and [0058] CDR2 is chosen from the group consisting of:
[0059] c) SEQ ID NO: 102; or [0060] d) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
102, provided that: [0061] i) said stretch of amino acid residues
has an Aspartic acid (Asp, D) at position 6 (position 54 determined
according to Kabat numbering); and [0062] ii) the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [0063] and [0064] CDR3 is chosen from the group
consisting of: [0065] e) SEQ ID NO: 121; [0066] f) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 121, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid
difference.
[0067] In a specific aspect, the amino acid sequence or
Nanobody.RTM. of the invention comprises at least SEQ ID NO: 102.
Preferably, the amino acid sequence or Nanobody.RTM. of the
invention comprises SEQ ID NO: 98, SEQ ID NO: 102 and SEQ ID NO:
121.
[0068] The present invention also provides a number humanized amino
acid sequences that are particularly suited for binding protein F
of hRSV. The amino acid sequences of the present invention show
reduced immunogenicity upon administration to a human subject. In
addition, the amino acid sequences of the present invention show
other improved properties such as e.g. improved binding
characteristics (suitably measured and/or expressed as a
K.sub.D-value (actual or apparent), a K.sub.A-value (actual or
apparent), a k.sub.on-rate and/or a k.sub.off-rate, or
alternatively as an IC.sub.50 value, as further described herein)
for protein F of hRSV, improved affinity and/or improved avidity
for protein F of hRSV and/or improved efficacy and/or potency for
neutralizing hRSV compared to their corresponding wild type amino
acid sequences (as described in PCT application PCT/EP2009/056975
entitled "Amino acid sequences directed against envelope proteins
of a virus and polypeptides comprising the same for the treatment
of viral diseases" filed by Ablynx N.V on 5 Jun. 2009).
[0069] Accordingly, in another aspect, the present invention
provides amino acid sequences chosen from the following: [0070] a)
SEQ ID NO's: 60-76; [0071] b) amino acid sequences that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 60-76,
provided that: [0072] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105 (said position determined according to
Kabat numbering); and [0073] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference.
[0074] In a preferred aspect, the amino acid sequence of the
invention comprises or essentially consists of SEQ ID NO:
60-76.
[0075] In another aspect, the present invention provides amino acid
sequences chosen from the following: [0076] a) SEQ ID NO's: 62, 65,
67, 68, 75 and 76; [0077] b) amino acid sequences that have no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with one of SEQ ID NO's: 62, 65, 67, 68, 75
and 76, provided that: [0078] i) the amino acid sequence has a
Glutamine (Gln, Q) at position 105, a Leucine (Leu, L) at position
78 and/or an Arginine (Arg, R) at position 83 (said positions
determined according to Kabat numbering); and [0079] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference.
[0080] Preferred amino acid sequences of the invention comprise or
essentially consists of one of SEQ ID NO's: 62, 65, 67, 68, 75 and
76.
[0081] In yet another aspect, the present invention provides amino
acid sequences chosen from the following: [0082] a) SEQ ID NO's: 65
and 76; [0083] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 65 and 76, provided that:
[0084] i) the amino acid sequence has an Aspartic acid (Asp, D) at
position 54, a Glutamine (Gln, Q) at position 105, a Leucine (Leu,
L) at position 78 and/or an Arginine (Arg, R) at position 83 (said
positions determined according to Kabat numbering); and [0085] ii)
the amino acid sequence binds protein F of hRSV with the same,
about the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence without the 3, 2 or 1 amino
acid difference.
[0086] In a preferred aspect, the amino acid sequence of the
invention comprises or essentially consists of SEQ ID NO: 65. In
another preferred aspect, the amino acid sequence of the invention
comprises or essentially consists of SEQ ID NO: 76.
[0087] In another aspect, the present invention provides amino acid
sequences chosen from the following: [0088] a) SEQ ID NO's:
146-153; [0089] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 146-453, provided that:
[0090] i) the amino acid sequence has a Proline (Pro, P) at
position 14, Arginine (Arg, R) at position 19, Leucine (Leu, L) at
position 20 and Leucine (Leu, L) at position 108 (said positions
determined according to Kabat numbering); and [0091] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference.
[0092] In a preferred aspect, the amino acid sequence of the
invention comprises or essentially consists of SEQ ID NO:
146-153.
[0093] In another aspect, the present invention provides amino acid
sequences chosen from the following: [0094] a) SEQ ID NO's: 146-149
and 151-153; [0095] b) amino acid sequences that have no more than
3, preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 146-149 and 151-153,
provided that: [0096] i) the amino acid sequence has a Proline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and Leucine (Leu, L) at position 108 and in
addition Arginine (Arg, R) at position 83, Glutamic acid (Glu, E)
at position 85 and/or Glutamine (Gln, Q) at position 105 so that
when the amino acid sequence has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with:
[0097] SEQ ID NO: 146, the amino acid sequence preferably has
Glutamine (Gln, Q) at position 105; [0098] SEQ ID NO: 147, the
amino acid sequence preferably has Arginine (Arg, R) at position 83
and Glutamine (Gln, Q) at position 105; [0099] SEQ ID NO: 148, the
amino acid sequence preferably has Glutamic acid (Glu, E) at
position 85 and Glutamine (Gln, Q) at position 105; [0100] SEQ ID
NO: 149, the amino acid sequence preferably has Arginine (Arg, R)
at position 83, Glutamic acid (Glu, E) at position 85 and Glutamine
(Gln, Q) at position 105; [0101] SEQ ID NO: 151, the amino acid
sequence preferably has Arginine (Arg, R) at position 83; [0102]
SEQ ID NO: 152, the amino acid sequence preferably has Glutamic
acid (Glu, E) at position 85; [0103] SEQ ID NO: 153, the amino acid
sequence preferably has Arginine (Arg, R) at position 83 and
Glutamic acid (Glu, E) at position 85; [0104] (said positions
determined according to Kabat numbering); and [0105] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference.
[0106] Preferred amino acid sequences of the invention comprise or
essentially consist of one of SEQ ID NO's: 146-149 and 151-153.
[0107] The present invention provides a number of sequence
optimized amino acid sequences and/or Nanobodies.RTM. that show
increased stability upon storage during stability studies and that
are particularly suited for binding protein F of hRSV. The amino
add sequences of the present invention show reduced pyroglutamate
post-translational modification of the N-terminus and hence have
increased product stability. In addition, the amino acid sequences
of the present invention show other improved properties such as
e.g. less immunogenicity, improved binding characteristics
(suitably measured and/or expressed as a K.sub.D-value (actual or
apparent), a K.sub.A-value (actual or apparent), a k.sub.on-rate
and/or a k.sub.off-rate, or alternatively as an IC.sub.50 value, as
further described herein) for protein F of hRSV, improved affinity
and/or improved avidity for protein F of hRSV and/or improved
efficacy and/or potency for neutralizing hRSV compared to their
corresponding parental amino acid sequences (as described in PCT
application PCT/EP2009/056975 entitled "Amino acid sequences
directed against envelope proteins of a virus and polypeptides
comprising the same for the treatment of viral diseases" filed by
Ablynx N.V on 5 Jun. 2009).
[0108] Accordingly, in one aspect of the present invention, amino
acid sequences and/or Nanobodies.RTM. are provided chosen from the
following: [0109] a) SEQ ID NO's: 138-141 and 154-157; [0110] b)
amino acid sequences that have no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
one of SEQ ID NO's: 138-141 and 154-157, provided that: [0111] i)
the amino acid sequence has a Aspartic acid (Asp, D) at position 1
(said position determined according to Kabat numbering); and [0112]
ii) the amino acid sequence binds protein F of hRSV with the same,
about the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence without the 3, 2 or 1 amino
acid difference.
[0113] In a preferred aspect, the amino acid sequence and/or
Nanobody.RTM. of the invention comprises or essentially consists of
one of SEQ ID NO's: 138-141 and 154-157.
[0114] The amino acid sequences and Nanobodies.RTM. provided by the
invention are preferably in essentially isolated form (as defined
herein), or form part of a protein or polypeptide of the invention
(also referred to as "polypeptide of the invention" or "protein of
the invention"), which may comprise or essentially consist of one
or more amino acid sequences or Nanobodies.RTM. of the invention
and which may optionally further comprise one or more further amino
acid sequences or Nanobodies.RTM. (all optionally linked via one or
more suitable linkers).
[0115] Accordingly, in another aspect, the invention also relates
to a protein or polypeptide (also referred to herein as a
"polypeptide of the invention", respectively) that comprises or
essentially consists of one or more amino acid sequences and/or
Nanobodies.RTM. of the invention (or suitable fragments
thereof)
[0116] For example, and without limitation, the one or more amino
acid sequences and/or Nanobodies.RTM. of the invention may be used
as a binding unit in such a protein or polypeptide, so as to
provide a monovalent, multivalent or multiparatopic polypeptide of
the invention, respectively, all as described herein. The present
invention thus also relates to a polypeptide which is a monovalent
construct comprising or essentially consisting of an amino acid
sequence or a Nanobody.RTM. of the invention. The present invention
thus also relates to a polypeptide which is a multivalent
polypeptide, such as e.g. a bivalent or trivalent polypeptide. The
present invention also relates to a polypeptide which is a
multiparatopic polypeptide, such as e.g. a bisparatopic or
triparatopic polypeptide.
[0117] In a preferred aspect, the invention provides a multivalent,
preferably a bivalent or trivalent polypeptide comprising or
essentially consisting of at least two amino acid sequences and/or
Nanobodies.RTM. of the invention (as described above).
[0118] In one aspect, the invention provides a multivalent,
preferably a bivalent or trivalent polypeptide comprising or
essentially consisting of at least two (preferably identical) or at
least three (preferably identical) amino acid sequences or
Nanobodies.RTM. chosen from amino acid sequences that comprise at
least a stretch of amino acid residues chosen from the following:
[0119] a) SEQ ID NO: 102; [0120] b) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
102, provided that: [0121] i) said stretch of amino acid residues
has an Aspartic acid (Asp, D) at position 6 (position 54 determined
according to Kabat numbering); and [0122] ii) the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference.
[0123] In another aspect, the invention provides a multivalent,
preferably a bivalent or trivalent polypeptide comprising or
essentially consisting of at least two (preferably identical) or at
least three (preferably identical) amino acid sequences or
Nanobodies.RTM. chosen from amino acid sequences that comprise two
or more stretches of amino acid residues in which one stretch is
chosen from the following: [0124] a) SEQ ID NO: 102; [0125] b) a
stretch of amino acid residues that has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with SEQ ID NO: 102, provided that: [0126] i) said
stretch of amino acid residues has an Aspartic acid (Asp, D) at
position 6 (position 54 determined according to Kabat numbering);
and [0127] ii) the amino acid sequence comprising said stretch of
amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino add sequence comprising said stretch of amino add residues
without the 3, 2 or 1 amino acid difference; [0128] and at least
one stretch is chosen from: [0129] c) SEQ ID NO: 98; [0130] d) a
stretch of amino acid residues that has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with SEQ ID NO: 98, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [0131] e) SEQ ID NO: 121; and [0132] f) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 121, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference.
[0133] such that the stretch of amino acid residues that
corresponds to one of a), and b) should always be present in the
amino acid sequence that forms part of the multivalent polypeptide
and such that the second stretch of amino acid residues is chosen
from one of c), d), e) and f).
[0134] Preferred multivalent (such as bivalent or trivalent)
polypeptides may comprise or essentially consist of at least two
(preferably identical) or at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. chosen from amino acid
sequences that comprise three or more stretches of amino acid
residues, in which the first stretch of amino acid residues is
chosen from the group consisting of: [0135] a) SEQ ID NO: 98;
[0136] b) a stretch of amino add residues that has no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with SEQ ID NO: 98, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; or the second stretch of amino acid residues is chosen
from the group consisting of: [0137] c) SEQ ID NO: 102; [0138] d) a
stretch of amino acid residues that has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with SEQ ID NO: 102, provided that: [0139] i) said
stretch of amino acid residues has an Aspartic acid (Asp, D) at
position 6 (position 54 determined according to Kabat numbering);
and [0140] ii) the amino acid sequence comprising said stretch of
amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference; and the third stretch
of amino acid residues is chosen from the group consisting of:
[0141] e) SEQ ID NO: 121; [0142] f) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
121, provided that the amino acid sequence comprising said stretch
of amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference.
[0143] Multivalent (such as bivalent or trivalent) polypeptides may
comprise or essentially consist of at least two (preferably
identical) or at least three (preferably identical) amino acid
sequences or Nanobodies.RTM. that essentially consist of 4
framework regions (FR1 to FR4, respectively) and 3 complementarity
determining regions (CDR1 to CDR3, respectively), in which CDR2 is
chosen from: [0144] a) SEQ ID NO: 102; [0145] b) a stretch of amino
acid residues that has no more than 3, preferably no more than 2,
more preferably no more than 1 amino acid difference with SEQ ID
NO: 102, provided that: [0146] i) said stretch of amino acid
residues has an Aspartic acid (Asp, D) at position 6 (position 54
determined according to Kabat numbering); and [0147] ii) the amino
acid sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference.
[0148] Multivalent (such as bivalent or trivalent) polypeptides may
comprise or essentially consist of at least two (preferably
identical) or at least three (preferably identical) amino acid
sequences or Nanobodies.RTM. that essentially consist of 4
framework regions (FR1 to FR4, respectively) and 3 complementarity
determining regions (CDR1 to CDR3, respectively), in which CDR2 is
chosen from the group consisting of: [0149] a) SEQ ID NO: 102; or
[0150] b) a stretch of amino acid residues that has no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with SEQ ID NO: 102, provided that: [0151] i) said
stretch of amino acid residues has an Aspartic acid (Asp, D) at
position 6 (position 54 determined according to Kabat numbering);
and [0152] ii) the amino acid sequence comprising said stretch of
amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference; [0153] and at least
one of CDR1 or CDR3 is chosen from: [0154] CDR1 chosen from the
group consisting of: [0155] c) SEQ ID NO: 98; [0156] d) a stretch
of amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 98, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference; or
[0157] and/or [0158] CDR3 chosen from the group consisting of:
[0159] e) SEQ ID NO: 121; or [0160] f) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
121, provided that the amino acid sequence comprising said stretch
of amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference.
[0161] Preferably, multivalent (such as bivalent or trivalent)
polypeptides may comprise or essentially consist of at least two
(preferably identical) or at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. that essentially consist of
4 framework regions (FR1 to FR4, respectively) and 3
complementarity determining regions (CDR1 to CDR3, respectively),
in which: CDR1 is chosen from the group consisting of: [0162] a)
SEQ ID NO: 98; [0163] b) a stretch of amino acid residues that has
no more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with SEQ ID NO: 98, provided that the
amino acid sequence comprising said stretch of amino acid residues
binds protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [0164] and [0165] CDR2 is chosen from the group
consisting of: [0166] c) SEQ ID NO: 102; or [0167] d) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 102, provided that: [0168] i) said stretch of amino acid
residues has an Aspartic acid (Asp, D) at position 6 (position 54
determined according to Kabat numbering); and [0169] ii) the amino
acid sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [0170] and [0171] CDR3 is chosen from the group
consisting of: [0172] e) SEQ ID NO: 121; [0173] f) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 121, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid
difference.
[0174] In a specific aspect, the multivalent (such as bivalent or
trivalent) polypeptides may comprise or essentially consist of at
least two (preferably identical) or at least three (preferably
identical) amino acid sequences or Nanobodies.RTM. that comprise at
least SEQ ID NO: 102, preferably that comprise SEQ ID NO: 98, SEQ
ID NO: 102 and SEQ ID NO: 121.
[0175] In another aspect, the invention provides a multivalent,
preferably a bivalent or trivalent polypeptide comprising or
essentially consisting of at least two (preferably identical) amino
acid sequences or Nanobodies.RTM. chosen from the following: [0176]
a) SEQ ID NO's: 60-76; [0177] b) amino acid sequences that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 60-76,
provided that: [0178] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105 (said position determined according to
Kabat numbering); and [0179] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference.
[0180] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least two
identical amino acid sequences or Nanobodies.RTM. chosen from the
group consisting of SEQ ID NO's: 60-76.
[0181] In another aspect, the invention provides a multivalent,
preferably a bivalent or trivalent polypeptide comprising or
essentially consisting of at least two (preferably identical) amino
acid sequences or Nanobodies.RTM. chosen from the following: [0182]
a) SEQ ID NO's: 62, 65, 67, 68, 75 and 76; [0183] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 62, 65, 67, 68, 75 and 76, provided that: [0184] i) the amino
acid sequence has a Glutamine (Gln, Q) at position 105, a Leucine
(Leu, L) at position 78 and/or an Arginine (Arg, R) at position 83
(said positions determined according to Kabat numbering); and
[0185] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference.
[0186] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least two
identical amino acid sequences or Nanobodies.RTM. chosen from the
group consisting of SEQ ID NO's: 62, 65, 67, 68, 75 and 76.
[0187] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least two (preferably
identical) amino acid sequences or Nanobodies.RTM. chosen from the
following: [0188] a) SEQ ID NO's: 65 and 76; [0189] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 65 and 76, provided that: [0190] i) the amino acid sequence
has an Aspartic acid (Asp, D) at position 54, a Glutamine (Gln, Q)
at position 105, a Leucine (Leu, at position 78 and/or an Arginine
(Arg, R) at position 83 (said positions determined according to
Kabat numbering); and [0191] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference.
[0192] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least two
identical amino acid sequences or Nanobodies.RTM. chosen from the
group consisting of SEQ ID NO's: 65 and 76.
[0193] In another preferred aspect, the invention provides a
multivalent, preferably a trivalent polypeptide comprising or
essentially consisting of at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. chosen from the following:
[0194] a) SEQ ID NO's: 60-76; [0195] b) amino acid sequences that
have no more than 3, preferably no more than 2, more preferably no
more than 1 amino acid difference with one of SEQ ID NO's: 60-76,
provided that: [0196] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105 (said position determined according to
Kabat numbering); and [0197] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference.
[0198] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least three
identical amino acid sequences or Nanobodies.RTM. chosen from the
group consisting of SEQ ID NO's: 60-76.
[0199] In another preferred aspect, the invention provides a
multivalent, preferably a trivalent polypeptide comprising or
essentially consisting of at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. chosen from the following:
[0200] a) SEQ ID NO's: 62, 65, 67, 68, 75 and 76; [0201] b) amino
acid sequences that have no more than 3, preferably no more than 2,
more preferably no more than 1 amino acid difference with one of
SEQ ID NO's: 62, 65, 67, 68, 75 and 76, provided that: [0202] i)
the amino acid sequence has a Glutamine (Gln, Q) at position 105, a
Leucine (Leu, L) at position 78 and/or an Arginine (Arg, R) at
position 83 (said positions determined according to Kabat
numbering); and [0203] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference.
[0204] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least three
identical amino acid sequences or Nanobodies.RTM. chosen from the
group consisting of SEQ ID NO's: 62, 65, 67, 68, 75 and 76.
[0205] In another preferred aspect, the invention provides a
multivalent, preferably a trivalent polypeptide comprising or
essentially consisting of at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. chosen from the following:
[0206] a) SEQ ID NO's: 65 and 76; [0207] b) amino acid sequences
that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 65 and 76, provided that: [0208] i) the amino acid sequence
has an Aspartic acid (Asp, D) at position 54, a Glutamine (Gln, Q)
at position 105, a Leucine (Leu, L) at position 78 and/or an
Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [0209] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference.
[0210] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least three
identical amino acid sequences or Nanobodies.RTM. chosen from the
group consisting of SEQ ID NO's: 65 and 76.
[0211] A preferred multivalent polypeptide of the invention
comprises or essentially consists of three amino acid sequences or
Nanobodies.RTM. with SEQ ID NO: 62. Another preferred multivalent
polypeptide of the invention comprises or essentially consists of
three amino acid sequences or Nanobodies.RTM. with SEQ ID NO: 65.
Another preferred multivalent polypeptide of the invention
comprises or essentially consists of three amino acid sequences or
Nanobodies.RTM. with SEQ ID NO: 76.
[0212] In another aspect, the invention provides a multivalent,
preferably a bivalent or trivalent polypeptide comprising or
essentially consisting of at least two (preferably identical) amino
acid sequences or Nanobodies.RTM. chosen from the following: [0213]
a) SEQ ID NO's: 146-153; [0214] b) amino acid sequences that have
no more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 146-153,
provided that: [0215] i) the amino acid sequence has a Proline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and Leucine (Leu, L) at position 108 (said
positions determined according to Kabat numbering); and [0216] ii)
the amino acid sequence binds protein F of hRSV with the same,
about the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence without the 3, 2 or 1 amino
acid difference.
[0217] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least two
identical amino acid sequences or Nanobodies.RTM. chosen from the
group consisting of SEQ ID NO's: 146-153.
[0218] In another aspect, the invention provides a multivalent,
preferably a bivalent or trivalent polypeptide comprising or
essentially consisting of at least two (preferably identical) amino
acid sequences or Nanobodies.RTM. chosen from the following: [0219]
a) SEQ ID NO's: 146-149 and 151-153; [0220] b) amino acid sequences
that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 146-149 and 151-153, provided that: [0221] i) the amino acid
sequence has a Proline (Pro, P) at position 14, Arginine (Arg, R)
at position 19, Leucine (Leu, L) at position 20 and Leucine (Leu,
L) at position 108 and in addition Arginine (Arg, R) at position
83, Glutamic acid (Glu, E) at position 85 and/or Glutamine (Gln, Q)
at position 105 so that when the amino acid sequence has no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with: [0222] SEQ ID NO: 146, the amino acid
sequence preferably has Glutamine (Gln, Q) at position 105; [0223]
SEQ ID NO: 147, the amino acid sequence preferably has Arginine
(Arg, R) at position 83 and Glutamine (Gln, Q) at position 105;
[0224] SEQ ID NO: 148, the amino acid sequence preferably has
Glutamic acid (Glu, E) at position 85 and Glutamine (Gln, Q) at
position 105; [0225] SEQ ID NO: 149, the amino acid sequence
preferably has Arginine (Arg, R) at position 83, Glutamic acid
(Glu, E) at position 85 and Glutamine (Gln, Q) at position 105;
[0226] SEQ ID NO: 151, the amino acid sequence preferably has
Arginine (Arg, R) at position 83; [0227] SEQ ID NO: 152, the amino
acid sequence preferably has Glutamic acid (Glu, E) at position 85;
[0228] SEQ ID NO: 153, the amino acid sequence preferably has
Arginine (Arg, R) at position 83 and Glutamic acid (Glu, E) at
position 85; [0229] (said positions determined according to Kabat
numbering); and [0230] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference.
[0231] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least two
identical amino acid sequences or Nanobodies.RTM. chosen from the
group consisting of SEQ ID NO's: 146-149 and 151-153.
[0232] In another preferred aspect, the invention provides a
multivalent, preferably a trivalent polypeptide comprising or
essentially consisting of at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. chosen from the following:
[0233] a) SEQ ID NO's: 146-153; [0234] b) amino acid sequences that
have no more than 3, preferably no more than 2, more preferably no
more than 1 amino acid difference with one of SEQ ID NO's: 146-153,
provided that: [0235] i) the amino acid sequence has a Proline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and Leucine (Leu, L) at position 108 (said
positions determined according to Kabat numbering); and [0236] ii)
the amino acid sequence binds protein F of hRSV with the same,
about the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence without the 3, 2 or 1 amino
acid difference.
[0237] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least three
identical amino acid sequences or Nanobodies.RTM. chosen from the
group consisting of SEQ ID NO's: 146-153.
[0238] In another preferred aspect, the invention provides a
multivalent, preferably a trivalent polypeptide comprising or
essentially consisting of at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. chosen from the following:
[0239] a) SEQ ID NO's: 146-149 and 151-153; [0240] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 146-149 and 151-153, provided that: [0241] i) the amino acid
sequence has a Proline (Pro, P) at position 14, Arginine (Arg, R)
at position 19, Leucine (Leu, L) at position 20 and Leucine (Leu,
L) at position 108 and in addition Arginine (Arg, R) at position
83, Glutamic acid (Glu, E) at position 85 and/or Glutamine (Gln, Q)
at position 105 so that when the amino acid sequence has no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with: [0242] SEQ ID NO: 146, the amino acid
sequence preferably has Glutamine (Gln, Q) at position 105; [0243]
SEQ ID NO: 147, the amino acid sequence preferably has Arginine
(Arg, R) at position 83 and Glutamine (Gln, Q) at position 105;
[0244] SEQ ID NO: 148, the amino acid sequence preferably has
Glutamic acid (Glu, E) at position 85 and Glutamine (Gln, Q) at
position 105; [0245] SEQ ID NO: 149, the amino acid sequence
preferably has Arginine (Arg, R) at position 83, Glutamic add (Glu,
E) at position 85 and Glutamine (Gln, Q) at position 105; [0246]
SEQ ID NO: 151, the amino acid sequence preferably has Arginine
(Arg, R) at position 83; [0247] SEQ ID NO: 152, the amino acid
sequence preferably has Glutamic add (Glu, E) at position 85;
[0248] SEQ ID NO: 153, the amino acid sequence preferably has
Arginine (Arg, R) at position 83 and Glutamic acid (Glu, E) at
position 85; [0249] (said positions determined according to Kabat
numbering); and [0250] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference.
[0251] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least three
identical amino acid sequences or Nanobodies.RTM. chosen from the
group consisting of SEQ ID NO's: 146-149 and 151-153.
[0252] In another aspect, the invention provides a multivalent,
preferably a bivalent or trivalent polypeptide comprising or
essentially consisting of at least one amino acid sequence or
Nanobody.RTM. chosen from the following: [0253] a) SEQ ID NO's:
138-141 and 154-157; [0254] b) amino acid sequences that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 138-141 and
154-157, provided that: [0255] i) the amino acid sequence has a
Aspartic acid (Asp, D) at position 1 (said position determined
according to Kabat numbering); and [0256] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference.
[0257] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least one amino
acid sequence or Nanobody.RTM. chosen from the group consisting of
SEQ ID NO's: 138-141 and 154-157.
[0258] In another preferred aspect, the invention provides a
multivalent, preferably a trivalent polypeptide comprising or
essentially consisting of at least one amino acid sequence or
Nanobody.RTM. chosen from the following: [0259] a) SEQ ID NO's:
138-141 and 154-157; [0260] b) amino acid sequences that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 138-141 and
154-157, provided that: [0261] i) the amino acid sequence has a
Aspartic acid (Asp, D) at position 1 (said position determined
according to Kabat numbering); and [0262] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference.
[0263] In another preferred aspect, the polypeptide of the
invention is a trivalent polypeptide that comprises or essentially
consists of at least one amino acid sequence or Nanobody chosen
from the group consisting of SEQ ID NO's: 138-141 and 154-157.
[0264] In another preferred aspect, the invention provides a
trivalent polypeptide chosen from the following polypeptides:
[0265] a) SEQ ID NO's: 77-79 and 158; [0266] b) polypeptides that
have no more than 3, preferably no more than 2, more preferably no
more than 1 amino acid difference with one of SEQ ID NO's: 77-79
and 158, provided that: [0267] i) the amino acid sequence or
Nanobody.RTM. encompassed in said polypeptide has a Glutamine (Gln,
Q) at position 105, a Leucine (Leu, L) at position 78, an Arginine
(Arg, R) at position 83 and/or a Glutamic acid (Glu, E) at position
85 (said positions determined according to Kabat numbering); and
[0268] ii) the polypeptide binds protein F of hRSV with the same,
about the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the polypeptide has the same,
about the same, or a higher potency (as defined herein) compared to
the polypeptide without the 3, 2 or 1 amino acid difference.
[0269] Preferred trivalent polypeptides of the invention comprise
or essentially consist of one of SEQ ID NO's: 77-79 and 158.
[0270] In another preferred aspect, the invention provides a
trivalent polypeptide chosen from the following polypeptides:
[0271] a) SEQ ID NO's: 78 and 79; [0272] b) polypeptides that have
no more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 78 and 79,
provided that: [0273] i) the amino acid sequence or Nanobody.RTM.
encompassed in said polypeptide has an Aspartic acid (Asp, D) at
position 54, a Glutamine (Gln, Q) at position 105, a Leucine (Leu,
L) at position 78, an Arginine (Arg, R) at position 83 and/or a
Glutamic acid (Glu, E) at position 85 (said positions determined
according to Kabat numbering); and [0274] ii) the polypeptide binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the polypeptide has the same, about the same, or a higher
potency (as defined herein) compared to the polypeptide without the
3, 2 or 1 amino acid difference.
[0275] Preferred trivalent polypeptides of the invention comprise
or essentially consist of SEQ ID NO: 78 or 79.
[0276] In another specific aspect, the polypeptide of the invention
essentially consists of the amino acid sequence of SEQ ID NO: 77.
In another specific aspect, the polypeptide of the invention
essentially consists of the amino acid sequence of SEQ ID NO: 78.
In another specific aspect, the polypeptide of the invention
essentially consists of the amino acid sequence of SEQ ID NO: 79.
In another specific aspect, the polypeptide of the invention
essentially consists of the amino acid sequence of SEQ ID NO:
158.
[0277] In another preferred aspect, the invention provides a
trivalent polypeptide chosen from the following polypeptides:
[0278] a) SEQ ID NO's: 159-461; [0279] b) polypeptides that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 159-461,
provided that: [0280] i) the amino acid sequence or Nanobody.RTM.
encompassed in said polypeptide has a Proline (Pro, P) at position
14, Arginine (Arg, R) at position 19, Leucine (Leu, L) at position
20 and Leucine (Leu, L) at position 108 (said positions determined
according to Kabat numbering); and [0281] iii) the polypeptide
binds protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the polypeptide has the same, about the same, or a higher
potency (as defined herein) compared to the amino acid sequence
without the 3, 2 or 1 amino acid difference.
[0282] Preferred trivalent polypeptides of the invention comprise
or essentially consist of one of SEQ ID NO's: 159-161.
[0283] In another preferred aspect, the invention provides a
trivalent polypeptide chosen from the following polypeptides:
[0284] a) SEQ ID NO's: 159-161; [0285] b) polypeptides that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 159-161,
provided that: [0286] i) the amino acid sequence or Nanobody.RTM.
encompassed in said polypeptide has a Praline (Pro, P) at position
14, Arginine (Arg, R) at position 19, Leucine (Leu, L) at position
20 and Leucine (Leu, L) at position 108 and in addition Arginine
(Arg, R) at position 83, Glutamic acid (Glu, E) at position 85
and/or Glutamine (Gln, Q) at position 105 so that when the
polypeptide has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with: [0287] SEQ ID
NO: 159, the amino acid sequence or Nanobody.RTM. encompassed in
said polypeptide preferably has Arginine (Arg, R) at position 83
and Glutamine (Gln, Q) at position 105; [0288] SEQ ID NO: 160, the
amino acid sequence or Nanobody.RTM. encompassed in said
polypeptide preferably has Arginine (Arg, R) at position 83,
Glutamic acid (Glu, E) at position 85 and Glutamine (Gln, Q) at
position 105; [0289] SEQ ID NO: 161, the amino acid sequence or
Nanobody.RTM. encompassed in said polypeptide preferably has
Arginine (Arg, R) at position 83 and Glutamic acid (Glu, E) at
position 85; [0290] (said positions determined according to Kabat
numbering); and [0291] ii) the polypeptide binds protein E of hRSV
with the same, about the same, or a higher affinity (said affinity
as measured by surface plasmon resonance) and/or the polypeptide
has the same, about the same, or a higher potency (as defined
herein) compared to the amino acid sequence without the 3, 2 or 1
amino acid difference.
[0292] Preferred trivalent polypeptides of the invention comprise
or essentially consist of SEQ ID NO: 159-161.
[0293] In another preferred aspect, the invention provides a
trivalent polypeptide chosen from the following polypeptides:
[0294] a) SEQ ID NO's: 142-145 and 162-165; [0295] b) polypeptides
that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NQ's: 142-145 and 162-165, provided that: [0296] i) the first amino
acid sequence or Nanobody.RTM. encompassed in said polypeptide has
an Aspartic acid (Asp, D) at position 1 (said position determined
according to Kabat numbering); and [0297] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference.
[0298] Preferred trivalent polypeptides of the invention comprise
or essentially consist of one of SEQ ID NO's: 142-445 and
162-165.
[0299] Polypeptides with these sequences show advantageous
properties for use as prophylactic, therapeutic and/or
pharmacologically active agents such as e.g. improved stability,
less immunogenicity, improved binding characteristics (suitably
measured and/or expressed as a K.sub.D-value (actual or apparent),
a K.sub.A-value (actual or apparent), a k.sub.on-rate and/or a
k.sub.off-rate, or alternatively as an IC.sub.50 value, as further
described herein), improved affinity and/or improved avidity for
protein F of hRSV and/or improved efficacy and/or potency for
neutralizing hRSV.
[0300] The invention further relates to compounds or constructs,
and in particular proteins or polypeptides (also referred to herein
as a "compound(s) of the invention") that comprise or essentially
consist of one or more amino acid sequences, Nanobodies.RTM. and/or
polypeptides of the invention (or suitable fragments thereof), and
optionally further comprise one or more other groups, residues,
moieties or binding units. As will become clear to the skilled
person from the further disclosure herein, such further groups,
residues, moieties, binding units or amino acid sequences may or
may not provide further functionality to the amino acid sequence,
Nanobody.RTM. or polypeptide of the invention (and/or to the
compound or construct in which it is present) and may or may not
modify the properties of the amino acid sequence, Nanobody.RTM.
and/or polypeptide of the invention.
[0301] It is also within the scope of the invention to use parts,
fragments, analogs, mutants, variants, alleles and/or derivatives
of the amino acid sequences and/or polypeptides of the invention,
and/or to use proteins or polypeptides comprising or essentially
consisting of one or more of such parts, fragments, analogs,
mutants, variants, alleles and/or derivatives, as long as these are
suitable for the uses envisaged herein. Such parts, fragments,
analogs, mutants, variants, alleles and/or derivatives will usually
contain (at least part of) a functional antigen-binding site for
binding against antigenic site II on protein F of hRSV; and more
preferably will be capable of specific binding to antigenic site II
on protein F of hRSV, and even more preferably capable of binding
to antigenic site II on protein F of hRSV with an affinity
(suitably measured and/or expressed as a K.sub.D-value (actual or
apparent), a K.sub.A-value (actual or apparent), a k.sub.on-rate
and/or a k.sub.off-rate, or alternatively as an IC.sub.50 value, as
further described herein) that is as defined herein. Such parts,
fragments, analogs, mutants, variants, alleles and/or derivatives
will usually also have a hRSV neutralization efficacy and/or
potency as defined herein. Some non-limiting examples of such
parts, fragments, analogs, mutants, variants, alleles, derivatives,
proteins and/or polypeptides will become clear from the further
description herein. Additional fragments or polypeptides of the
invention may also be provided by suitably combining (i.e. by
linking or genetic fusion) one or more (smaller) parts or fragments
as described herein.
[0302] The invention also relates to nucleic acids or nucleotide
sequences that encode an amino acid sequence of the invention, a
Nanobody.RTM. of the invention and/or a polypeptide of the
invention (or a suitable fragment thereof). Such a nucleic acid
will also be referred to herein as "nucleic acid(s) of the
invention" and may for example be in the form of a genetic
construct, as further described herein. Accordingly, the present
invention also relates to a nucleic acid or nucleotide sequence
that is in the form of a genetic construct.
[0303] The invention further relates to a host or host cell that
expresses (or that under suitable circumstances is capable of
expressing) an amino acid sequence of the invention, a
Nanobody.RTM. of the invention, a polypeptide of the invention
and/or a compound or construct of the invention; and/or that
contains a nucleic acid of the invention. Some preferred but
non-limiting examples of such hosts or host cells will become clear
from the further description herein.
[0304] The invention further relates to a product or composition
containing or comprising at least one amino acid sequence of the
invention (or a suitable fragment thereof), at least one
Nanobody.RTM. of the invention, at least one polypeptide of the
invention, at least one compound or construct of the invention, at
least one monovalent construct of the invention and/or at least one
nucleic acid of the invention, and optionally one or more further
components of such compositions known per se, i.e. depending on the
intended use of the composition. Such a product or composition may
for example be a pharmaceutical composition (as described herein)
or a veterinary composition. Some preferred but non-limiting
examples of such products or compositions will become clear from
the further description herein.
[0305] The invention further relates to methods for preparing the
amino acid sequences, Nanobodies.RTM., polypeptides, nucleic acids,
host cells, products and compositions described herein.
[0306] The invention further relates to applications and uses of
the amino acid sequences, Nanobodies.RTM., polypeptides, compounds,
nucleic acids, host cells, products and compositions described
herein, as well as to methods for the prevention and/or treatment
of respiratory track infection caused by hRSV. Some preferred but
non-limiting applications and uses will become clear from the
further description herein.
[0307] The amino acid sequences, Nanobodies.RTM., polypeptides,
compounds and compositions of the present invention can generally
be used to block the interaction of protein F of hRSV with the
target host cell and/or its membrane, to neutralize hRSV (different
hRSV strains and/or escape mutants), to modulate, inhibit and/or
prevent hRSV infectivity (of different hRSV strains and/or escape
mutants), to modulate, inhibit and/or prevent fusion (of different
hRSV strains and/or escape mutants) with (the cell membrane of) the
target host cell and/or to modulate, inhibit and/or prevent hRSV
entry in the target host cell (of different hRSV strains and/or
escape mutants).
[0308] As such, the amino acid sequences, Nanobodies.RTM.,
polypeptides, compounds and compositions of the present invention
can be used for the prevention and/or treatment of diseases and
disorders associated with hRSV infection. Examples of such diseases
and disorders associated with hRSV infection will be clear to the
skilled person based on the disclosure herein, and for example
include the following diseases and disorders: respiratory illness,
upper respiratory tract infection, lower respiratory tract
infection, bronchiolitis (inflammation of the small airways in the
lung), pneumonia, dyspnea, cough, (recurrent) wheezing and
asthma.
[0309] Accordingly, the present invention also relates to a method
for the prevention and/or treatment of respiratory illness, upper
respiratory tract infection, lower respiratory tract infection,
bronchiolitis (inflammation of the small airways in the lung),
pneumonia, dyspnea, cough, (recurrent) wheezing and/or asthma
caused by hRSV, said method comprising administering, to a subject
in need thereof, a pharmaceutically active amount of at least one
amino acid sequence of the invention, Nanobody.RTM. of the
invention, polypeptide of the invention, compound or construct of
the invention or monovalent construct of the invention, or a
composition of the invention.
[0310] The invention also relates to the use of an amino acid
sequence of the invention, a Nanobody.RTM. of the invention, a
polypeptide of the invention, a compound or construct of the
invention or a monovalent construct of the invention in the
preparation of a pharmaceutical composition for the prevention
and/or treatment of respiratory illness, upper respiratory tract
infection, lower respiratory tract infection, bronchiolitis
(inflammation of the small airways in the lung), pneumonia,
dyspnea, cough, (recurrent) wheezing and/or asthma; and/or for use
in one or more of the methods described herein.
[0311] The invention also relates to an amino acid sequence of the
invention, a Nanobody.RTM. of the invention, a polypeptide of the
invention, a compound or construct of the invention or monovalent
construct of the invention for prevention and/or treatment of
respiratory illness, upper respiratory tract infection, lower
respiratory tract infection, bronchiolitis (inflammation of the
small airways in the lung), pneumonia, dyspnea, cough, (recurrent)
wheezing and/or asthma.
[0312] Other applications and uses of the amino acid sequences,
Nanobodies.RTM., polypeptides and compounds and compositions of the
invention will become clear to the skilled person from the further
disclosure herein.
BRIEF DESCRIPTION OF THE DRAWINGS
[0313] FIG. 1: Competition ELISA: Synagis.RTM. Fab competes with
purified RSV binding Nanobodies.RTM. and Numax Fab for binding to
F.sub.TM-protein as described in Example 8. Nanobody.RTM. 202A5 is
an irrelevant Nanobody.RTM. binding HA of influenza.
[0314] FIG. 2: Binding of monovalent, bivalent and trivalent
Nanobodies.RTM. to F.sub.TM-protein as described in Example 10.
[0315] FIGS. 3A and B: Potency (RSV neutralization) of monovalent,
bivalent and trivalent constructs to neutralize Long and B-1 RSV
strains as described in Example 11.
[0316] FIG. 4: Neutralization assay of RSV Long and the escape
mutants R7C2/1; R7C2/11 and R7.936/4 by the monovalent
Nanobodies.RTM. 7B2 (A), 15H8, (B) NC41 (C) at a concentration
range from about 2 .mu.M to 6 nM and the trivalent Nanobodies.RTM.
RSV 400 (D), RSV 404 (E), RSV 407 (F) and RSV 403 (G) at a
concentration range of about 20 nM to 100 pM. Curve fitting was
only done for data of monovalent Nanobodies.RTM..
[0317] FIG. 5: Neutralization of RSV Long and RSV B-1 strains by
trivalent NC41 Nanobody.RTM. with different linker lengths as
described in Example 15.
[0318] FIG. 6: Schematic overview of the humanized residues
introduced in selected NC41 variants. Dots indicate the presence of
the wildtype residue; letters correspond to the humanized residue.
Numbering is according to Kabat.
[0319] FIG. 7: Alignment of preferred humanized Nanobody.RTM.
sequences of the invention.
[0320] FIG. 8: Neutralization of hRSV Long strain and B-1 strain by
monovalent and trivalent humanized NC41 variants. In FIG. 8A,
neutralization by two of the trivalent humanized NC41 variants
(RSV414 and RSV426) is compared with their corresponding monovalent
Nanobodies.RTM..
[0321] FIG. 8B shows the neutralization by the trivalent NC41
variants (RSV414, RSV426 and RSV427).
[0322] FIG. 9: Neutralization of hRSV Long (A) and B-1 (B) strains
by RSV407 and RSV434.
[0323] FIG. 10: Efficacy testing (prophylactic) of RSV407 in cotton
rat model as described in Example 21. Rats were intranasally
administered with various concentrations of RSV407 (day-1) 24 hours
prior to RSV infection (day 0). The virus titer (left, mean.+-.sem,
n=6) and viral RNA level (right) was determined in lung lavages at
the peak level of viremia, being day 4 after infection (*=P<0.05
in two tailed student's t-test versus untreated).
[0324] FIG. 11: Efficacy testing (therapeutic) of RSV434 in cotton
rat model as described in Example 21. Rats were infected with RSV
on day 0 and treated with 0, 1, 2, 4 or 20 mg/kg of RSV434 at day 2
and 3 by intranasal instillation (n=6). The virus titer in nasal
(A) and lung lavages (B) was determined at the peak level of
viremia (day 4 after infection). The horizontal lines show the
detection limits.
DETAILED DESCRIPTION OF THE INVENTION
[0325] In the present description, examples and claims: [0326] a)
Unless indicated or defined otherwise, all terms used have their
usual meaning in the art, which will be clear to the skilled
person. Reference is for example made to the standard handbooks
mentioned in paragraph a) on page 46 of WO 08/020,079. [0327] b)
Unless indicated otherwise, the terms "immunoglobulin sequence",
"sequence", "nucleotide sequence" and "nucleic acid" are as
described in paragraph b) on page 46 of WO 08/020,079. [0328] c)
Unless indicated otherwise, all methods, steps, techniques and
manipulations that are not specifically described in detail can be
performed and have been performed in a manner known per se, as will
be clear to the skilled person. Reference is for example again made
to the standard handbooks and the general background art mentioned
herein and to the further references cited therein; as well as to
for example the following reviews Presta, Adv. Drug Deliv. Rev.
2006, 58 (5-6): 640-56; Levin and Weiss, Mol. Biosyst. 2006, 2(1):
49-57; Irving et al., J. Immunol. Methods, 2001, 248(1-2), 31-45;
Schmitz et al., Placenta, 2000, 21 Suppl. A, S106-12, Gonzales et
al., Tumour Biol., 2005, 26(1), 31-43, which describe techniques
for protein engineering, such as affinity maturation and other
techniques for improving the specificity and other desired
properties of proteins such as immunoglobulins. [0329] d) Amino
acid residues will be indicated according to the standard
three-letter or one-letter amino acid code. Reference is made to
Table R-2 on page 48 of WO 08/020,079. [0330] e) When a nucleotide
sequence or amino acid sequence is said to "comprise" another
nucleotide sequence or amino acid sequence, respectively, or to
"essentially consist of" another nucleotide sequence or amino acid
sequence, this has the meaning given in paragraph i) on pages 51-52
of WO 08/020,079. [0331] f) The term "in essentially isolated form"
has the meaning given to it in paragraph j) on pages 52 and 53 of
WO 08/020,079. [0332] g) The terms "domain" and "binding domain"
have the meanings given to it in paragraph k) on page 53 of WO
08/020,079. [0333] h) The terms "antigenic determinant" and
"epitope", which may also be used interchangeably herein, have the
meanings given to it in paragraph 1) on page 53 of WO 08/020,079.
[0334] i) As further described in paragraph m) on page 53 of WO
08/020,079, an amino acid sequence (such as a Nanobody.RTM., an
antibody, a polypeptide of the invention, or generally an antigen
binding protein or polypeptide or a fragment thereof) that can
(specifically) bind to, that has affinity for and/or that has
specificity for a specific antigenic determinant, epitope, antigen
or protein (or for at least one part, fragment or epitope thereof)
is said to be "against" or "directed against" said antigenic
determinant, epitope, antigen or protein. [0335] j) The term
"specificity" has the meaning given to it in paragraph n) on pages
53-56 of WO 08/020,079; and as mentioned therein refers to the
number of different types of antigens or antigenic determinants to
which a particular antigen-binding molecule or antigen-binding
protein (such as a Nanobody.RTM. or a polypeptide of the invention)
molecule can bind. The specificity of an antigen-binding protein
can be determined based on affinity and/or avidity, as described on
pages 53-56 of WO 08/020,079 (incorporated herein by reference),
which also describes some preferred techniques for measuring
binding between an antigen-binding molecule (such as a
Nanobody.RTM. or polypeptide of the invention) and the pertinent
antigen. Typically, antigen-binding proteins (such as the amino
acid sequences, Nanobodies.RTM. and/or polypeptides of the
invention) will bind to their antigen with a dissociation constant
(K.sub.D) of 10.sup.-5 to 10.sup.-12 moles/liter or less, and
preferably 10.sup.-7 to 10.sup.-12 moles/liter or less and more
preferably 10.sup.-8 to 10.sup.12 moles/liter (i.e. with an
association constant (K.sub.A) of 10.sup.5 to 10.sup.12 liter/moles
or more, and preferably 10.sup.7 to 10.sup.12 liter/moles or more
and more preferably 10.sup.8 to 10.sup.12 liter/moles). Any K.sub.D
value greater than 10.sup.4 mol/liter (or any K.sub.A value lower
than 10.sup.4 M.sup.-1) liters/mol is generally considered to
indicate non-specific binding. Preferably, a monovalent
immunoglobulin sequence of the invention will bind to the desired
antigen with an affinity less than 500 nM, preferably less than 200
nM, more preferably less than 10 nM, such as e.g. between 10 and 5
nM. Specific binding of an antigen-binding protein to an antigen or
antigenic determinant can be determined in any suitable manner
known per se, including, for example, Scatchard analysis and/or
competitive binding assays, such as radioimmunoassays (RIA), enzyme
immunoassays (EIA) and sandwich competition assays, and the
different variants thereof known per se in the art; as well as the
other techniques mentioned herein. As will be clear to the skilled
person, and as described on pages 53-56 of WO 08/020,079, the
dissociation constant may be the actual or apparent dissociation
constant. Methods for determining the dissociation constant will be
clear to the skilled person, and for example include the techniques
mentioned on pages 53-56 of WO 08/020,079. [0336] k) The half-life
of an amino acid sequence, compound or polypeptide of the invention
can generally be defined as described in paragraph o) on page 57 of
WO 08/020,079 and as mentioned therein refers to the time taken for
the serum concentration of the amino acid sequence, compound or
polypeptide to be reduced by 50%, in vivo, for example due to
degradation of the amino acid sequence, compound or polypeptide
and/or clearance or sequestration of the amino acid sequence,
compound or polypeptide by natural mechanisms. The in vivo
half-life of an amino acid sequence, compound or polypeptide of the
invention can be determined in any manner known per se, such as by
pharmacokinetic analysis. Suitable techniques will be clear to the
person skilled in the art, and may for example generally be as
described in paragraph o) on page 57 of WO 08/020,079. As also
mentioned in paragraph o) on page 57 of WO 08/020,079, the
half-life can be expressed using parameters such as the t1/2-alpha,
t1/2-beta and the area under the curve (AUC). Reference is for
example made to the Experimental Part below, as well as to the
standard handbooks, such as Kenneth, A et al: Chemical Stability of
Pharmaceuticals: A Handbook for Pharmacists and Peters et al,
Pharmacokinetic analysis: A Practical Approach (1996). Reference is
also made to "Pharmacokinetics", M Gibaldi & D Perron,
published by Marcel Dekker, 2nd Rev. edition (1982). The terms
"increase in half-life" or "increased half-life" as also as defined
in paragraph o) on page 57 of WO 08/020,079 and in particular refer
to an increase in the t1/2-beta, either with or without an increase
in the t1/2-alpha and/or the AUC or both. [0337] l) In respect of a
target or antigen, the term "interaction site" on the target or
antigen means a site, epitope, antigenic determinant, part, domain
or stretch of amino acid residues on the target or antigen that is
a site for binding to a receptor or other binding partner, a
catalytic site, a cleavage site, a site for allosteric interaction,
a site involved in multimerization (such as homomerization or
heterodimerization) of the target or antigen; or any other site,
epitope, antigenic determinant, part, domain or stretch of amino
acid residues on the target or antigen that is involved in a
biological action or mechanism of the target or antigen. More
generally, an "interaction site" can be any site, epitope,
antigenic determinant, part, domain or stretch of amino acid
residues on the target or antigen to which an amino acid sequence
or polypeptide of the invention can bind such that the target or
antigen (and/or any pathway, interaction, biological mechanism or
biological effect in which the target or antigen is involved) is
modulated (as defined herein). [0338] m) An amino add sequence or
polypeptide is said to be "specific for" a first target or antigen
compared to a second target or antigen when is binds to the first
antigen with an affinity (as described above, and suitably
expressed as a K.sub.D value, K.sub.A value, K.sub.off rate and/or
k.sub.on rate) that is at least 10 times, such as at least 100
times, and preferably at least 1000 times, and up to 10000 times or
more better than the affinity with which said amino acid sequence
or polypeptide binds to the second target or antigen. For example,
amino acid sequence or polypeptide may bind to the first target or
antigen with a K.sub.D value that is at least 10 times less, such
as at least 100 times less, and preferably at least 1000 times
less, such as 10.000 times less or even less than that, than the
K.sub.D with which said amino acid sequence or polypeptide binds to
the second target or antigen. Preferably, when an amino acid
sequence or polypeptide is "specific for" a first target or antigen
compared to a second target or antigen, it is directed against (as
defined herein) said first target or antigen, but not directed
against said second target or antigen. [0339] n) The terms
"(cross)-block", "(cross)-blocked" and "(cross)-blocking" are used
interchangeably herein to mean the ability of an amino acid
sequence or other binding agent (such as a polypeptide of the
invention) to interfere with the binding of other amino acid
sequences or binding agents of the invention to a given target. The
extend to which an amino acid sequence or other binding agents of
the invention is able to interfere with the binding of another to
the target, and therefore whether it can be said to cross-block
according to the invention, can be determined using competition
binding assays. One particularly suitable quantitative
cross-blocking assay uses a Biacore machine which can measure the
extent of interactions using surface plasmon resonance technology.
Another suitable quantitative cross-blocking assay uses an
ELISA-based approach to measure competition between amino acid
sequences or other binding agents in terms of their binding to the
target. [0340] The following generally describes a suitable Biacore
assay for determining whether an amino acid sequence or other
binding agent cross-blocks or is capable of cross-blocking
according to the invention. It will be appreciated that the assay
can be used with any of the amino acid sequences or other binding
agents described herein. The Biacore machine (for example the
Biacore 3000) is operated in line with the manufacturer's
recommendations. Thus in one cross-blocking assay, the target
protein is coupled to a CM5 Biacore chip using standard amine
coupling chemistry to generate a surface that is coated with the
target. Typically 200-800 resonance units of the target would be
coupled to the chip (an amount that gives easily measurable levels
of binding but that is readily saturable by the concentrations of
test reagent being used). Two test amino add sequences (termed A*
and B*) to be assessed for their ability to cross-block each other
are mixed at a one to one molar ratio of binding sites in a
suitable buffer to create the test mixture. When calculating the
concentrations on a binding site basis the molecular weight of an
amino acid sequence is assumed to be the total molecular weight of
the amino acid sequence divided by the number of target binding
sites on that amino acid sequence. The concentration of each amino
acid sequence in the test mix should be high enough to readily
saturate the binding sites for that amino acid sequence on the
target molecules captured on the Biacore chip. The amino acid
sequences in the mixture are at the same molar concentration (on a
binding basis) and that concentration would typically be between
1.00 and 1.5 micromolar (on a binding site basis). Separate
solutions containing A* alone and B* alone are also prepared. A*
and B* in these solutions should be in the same buffer and at the
same concentration as in the test mix. The test mixture is passed
over the target-coated Biacore chip and the total amount of binding
recorded. The chip is then treated in such a way as to remove the
bound amino acid sequences without damaging the chip-bound target.
Typically this is done by treating the chip with 30 mM HCl for 60
seconds. The solution of A* alone is then passed over the
target-coated surface and the amount of binding recorded. The chip
is again treated to remove all of the bound amino acid sequences
without damaging the chip-bound target. The solution of B* alone is
then passed over the target-coated surface and the amount of
binding recorded. The maximum theoretical binding of the mixture of
A* and B* is next calculated, and is the sum of the binding of each
amino acid sequence when passed over the target surface alone. If
the actual recorded binding of the mixture is less than this
theoretical maximum then the two amino acid sequences are
cross-blocking each other. Thus, in general, a cross-blocking amino
acid sequence or other binding agent according to the invention is
one which will bind to the target in the above Biacore
cross-blocking assay such that during the assay and in the presence
of a second amino acid sequence or other binding agent of the
invention the recorded binding is between 80% and 0.1% (e.g. 80% to
4%) of the maximum theoretical binding, specifically between 75%
and 0.1% (e.g. 75% to 4%) of the maximum theoretical binding, and
more specifically between 70% and 0.1% (e.g. 70% to 4%) of maximum
theoretical binding (as just defined above) of the two amino acid
sequences or binding agents in combination. The Biacore assay
described above is a primary assay used to determine if amino acid
sequences or other binding agents cross-block each other according
to the invention. On rare occasions particular amino acid sequences
or other binding agents may not bind to a target coupled via amine
chemistry to a CM5 Biacore chip (this usually occurs when the
relevant binding site on the target is masked or destroyed by the
coupling to the chip). In such cases cross-blocking can be
determined using a tagged version of the target, for example a
N-terminal His-tagged version. In this particular format, an
anti-His amino acid sequence would be coupled to the Biacore chip
and then the His-tagged target would be passed over the surface of
the chip and captured by the anti-His amino acid sequence. The
cross blocking analysis would be carried out essentially as
described above, except that after each chip regeneration cycle,
new His-tagged target would be loaded back onto the anti-His amino
acid sequence coated surface. In addition to the example given
using N-terminal His-tagged target, C-terminal His-tagged target
could alternatively be used. Furthermore, various other tags and
tag binding protein combinations that are known in the art could be
used for such a cross-blocking analysis (e.g. HA tag with anti-HA
antibodies; FLAG tag with anti-FLAG antibodies; biotin tag with
streptavidin).
[0341] The following generally describes an ELISA assay for
determining whether an amino acid sequence or other binding agent
directed against a target cross-blocks or is capable of
cross-blocking as defined herein. It will be appreciated that the
assay can be used with any of the amino acid sequences (or other
binding agents such as polypeptides of the invention) described
herein. The general principal of the assay is to have an amino acid
sequence or binding agent that is directed against the target
coated onto the wells of an ELISA plate. An excess amount of a
second, potentially cross-blocking, anti-target amino acid sequence
is added in solution (i.e. not bound to the ELISA plate). A limited
amount of the target is then added to the wells. The coated amino
acid sequence and the amino acid sequence in solution compete for
binding of the limited number of target molecules. The plate is
washed to remove excess target that has not been bound by the
coated amino acid sequence and to also remove the second, solution
phase amino acid sequence as well as any complexes formed between
the second, solution phase amino acid sequence and target. The
amount of bound target is then measured using a reagent that is
appropriate to detect the target. An amino acid sequence in
solution that is able to cross-block the coated amino acid sequence
will be able to cause a decrease in the number of target molecules
that the coated amino acid sequence can bind relative to the number
of target molecules that the coated amino acid sequence can bind in
the absence of the second, solution phase, amino acid sequence. In
the instance where the first amino acid sequence, e.g. an Ab-X, is
chosen to be the immobilized amino acid sequence, it is coated onto
the wells of the ELISA plate, after which the plates are blocked
with a suitable blocking solution to minimize non-specific binding
of reagents that are subsequently added. An excess amount of the
second amino acid sequence, i.e. Ab-Y, is then added to the ELISA
plate such that the moles of Ab-Y target binding sites per well are
at least 10 fold higher than the moles of Ab-X target binding sites
that were used, per well, during the coating of the ELISA plate.
Target is then added such that the moles of target added per well
are at least 25-fold lower than the moles of Ab-X target binding
sites that were used for coating each well. Following a suitable
incubation period the ELISA plate is washed and a reagent for
detecting the target is added to measure the amount of target
specifically bound by the coated anti-target amino acid sequence
(in this case Ab-X). The background signal for the assay is defined
as the signal obtained in wells with the coated amino acid sequence
(in this case Ab-X), second solution phase amino acid sequence (in
this case Ab-Y), target buffer only (i.e. without target) and
target detection reagents. The positive control signal for the
assay is defined as the signal obtained in wells with the coated
amino acid sequence (in this case Ab-X), second solution phase
amino acid sequence buffer only (i.e. without second solution phase
amino acid sequence), target and target detection reagents. The
ELISA assay may be run in such a manner so as to have the positive
control signal be at least 6 times the background signal. To avoid
any artifacts (e.g. significantly different affinities between Ab-X
and Ab-Y for the target) resulting from the choice of which amino
acid sequence to use as the coating amino acid sequence and which
to use as the second (competitor) amino acid sequence, the
cross-blocking assay may to be run in two formats: 1) format 1 is
where Ab-X is the amino acid sequence that is coated onto the ELISA
plate and Ab-Y is the competitor amino acid sequence that is in
solution and 2) format 2 is where Ab-Y is the amino acid sequence
that is coated onto the ELISA plate and Ab-X is the competitor
amino acid sequence that is in solution. Ab-X and Ab-Y are defined
as cross-blocking if, either in format 1 or in format 2, the
solution phase anti-target amino acid sequence is able to cause a
reduction of between 60% and 100%, specifically between 70% and
100%, and more specifically between 80% and 100%, of the target
detection signal {i.e. the amount of target bound by the coated
amino acid sequence) as compared to the target detection signal
obtained in the absence of the solution phase anti-target amino
acid sequence (i.e. the positive control wells). [0342] o) An amino
acid sequence is said to be "cross-reactive" for two different
antigens or antigenic determinants (such as e.g. serum albumin from
two different species of mammal, such as e.g. human serum albumin
and cyno serum albumin, such as e.g. protein F of different strains
of hRSV, such as e.g. protein F of different escape mutants of
hRSV) if it is specific for (as defined herein) both these
different antigens or antigenic determinants. [0343] p) As further
described herein, the total number of amino acid residues in a
Nanobody.RTM. can be in the region of 110-120, is preferably
112-115, and is most preferably 113. It should however be noted
that parts, fragments, analogs or derivatives (as further described
herein) of a Nanobody.RTM. are not particularly limited as to their
length and/or size, as long as such parts, fragments, analogs or
derivatives meet the further requirements outlined herein and are
also preferably suitable for the purposes described herein. [0344]
q) As further described in paragraph q) on pages 58 and 59 of WO
08/020,079 (incorporated herein by reference), the amino acid
residues of a Nanobody.RTM. are numbered according to the general
numbering for V.sub.H domains given by Kabat et al. ("Sequence of
proteins of immunological interest", US Public Health Services, NIH
Bethesda, Md., Publication No. 91), as applied to V.sub.HH domains
from Camelids in the article of Riechmann and Muyidermans, J.
Immunol. Methods 2000 Jun. 23; 240 (1-2): 185-195 (see for example
FIG. 2 of this publication), and accordingly FR1 of a Nanobody.RTM.
comprises the amino acid residues at positions 1-30, CDR1 of a
Nanobody.RTM. comprises the amino acid residues at positions 31-35,
FR2 of a Nanobody.RTM. comprises the amino acids at positions
36-49, CDR2 of a Nanobody.RTM. comprises the amino acid residues at
positions 50-65, FR3 of a Nanobody.RTM. comprises the amino acid
residues at positions 66-94, CDR3 of a Nanobody.RTM. comprises the
amino acid residues at positions 95-102, and FR4 of a Nanobody.RTM.
comprises the amino acid residues at positions 103-1.13. [0345] r)
In the context of the present invention "target host cell (of a
virus)" generally refers to a particular cell, which is or is
derived from a living subject and which is susceptible to infection
by said virus. [0346] s) The term "infectivity of a virus", as used
herein, refers to the proportion of living subjects that, when
exposed to said virus, actually become infected by said virus.
[0347] t) The term "neutralization of a virus", as used herein,
refers to the modulation and/or reduction and/or prevention and/or
inhibition of the infectivity (as defined herein) of a virus by
binding of a neutralizing compound to the virion, as measured using
a suitable in vitro, cellular or in vivo assay (such as e.g. the
microneutralization assay described by Anderson et al. 1985 (J.
Clin. Microbiol. 22: 1050-1052) and 1988 (J. Virol. 62: 4232-4238),
modifications of these assays such as e.g. described in Example 6;
a plaque reduction assay as for example described by Johnson et al.
1997 (J. Inf. Dis. 176: 1215-1224), and modifications thereof and
those mentioned herein). In particular, "neutralizing (a virus)" or
"to neutralize (a virus)" may mean either modulating, reducing,
preventing or inhibiting the infectivity (as defined herein) of a
virus as measured using a suitable in vitro, cellular or in vivo
assay (such as those mentioned herein), by at least 1%, preferably
at least 5%, such as at least 10% or at least 25%, for example by
at least 50%, at least 60%, at least 70%, at least 80%, or 90% or
more, compared to normal (i.e. naturally occurring) infectivity (as
defined herein) of a virus, in the same assay under the same
conditions but without the presence of the amino acid sequence,
Nanobody.RTM. or polypeptide of the invention. [0348] u) The term
"potency of an amino acid sequence of the invention", "potency of a
Nanobody.RTM. of the invention", "potency of a polypeptide of the
invention", and/or "potency of compound or construct of the
invention", as used herein, refers to the capacity of said amino
acid sequence of the invention, Nanobody.RTM. of the invention,
polypeptide of the invention, and/or compound or construct of the
invention to neutralize a particular virus (such as e.g. hRSV), to
modulate, inhibit and/or prevent infectivity of a virus, to
modulate, inhibit and/or prevent fusion of a virus with (the cell
membrane of) the target host cell, and/or to modulate, inhibit
and/or prevent entry of a virus into the target host cell (as
defined herein). The potency may be measured by any suitable assay
known in the art or described herein, such as e.g. the
micro-neutralization assays as described in the Example section
and/or the assays mentioned in point t) above. [0349] v) The term
"virus attachment", as used herein, is attachment of a virus (e.g.
hRSV) to a target host cell directly (for example by interacting
with a viral receptor) or indirectly (for example by mediating the
interaction of one or more other proteins or molecules to a viral
receptor), [0350] w) The term "virus fusion", as used herein, is
fusion of a virus (e.g. hRSV) to a target host cell directly (for
example by interacting with membrane compounds of the target host
cell) or indirectly (for example by mediating the interaction of
one or more other proteins or molecules with membrane compounds of
the target host cell). [0351] x) The term "viral entry" used herein
encompasses any viral-mediated biological pathway that is needed to
accomplish virion attachment to a target host cell and/or viral
fusion with a target host cell. [0352] y) A "stretch of amino acid
residues" means two or more amino acid residues that are adjacent
to each other or in close proximity to each other, i.e. in the
primary or tertiary structure of the amino acid sequence. In the
context of the present invention, the "stretch of amino acid
residues" will be (at least partially) responsible for the binding
of the amino acid sequence, Nanobody.RTM., polypeptide, compound or
construct of the invention to antigenic site II on protein F of
hRSV. [0353] z) When comparing two stretches of amino acid residues
(or two CDR sequences), the term "amino acid difference" refers to
an insertion, deletion or substitution of a single amino acid
residue on a position of the stretch of amino acid residues (or CDR
sequence) specified in b), d) or f), compared to the stretch of
amino acid residues (or CDR sequence) of respectively a), c) or e);
it being understood that the stretch of amino acid residues (or CDR
sequence) of b), d) and f) can contain one, two or maximal three
such amino acid differences compared to the stretch of amino acid
residues of respectively a), c) or e). [0354] The "amino acid
difference" can be any one, two or maximal three substitutions,
deletions and/or insertions, or any combination thereof, that
either improve the properties of the amino acid sequence of the
invention or that at least do not detract too much from the desired
properties or from the balance or combination of desired properties
of the amino acid sequence of the invention. In this respect, the
resulting amino acid sequence of the invention should at least bind
protein F of hRSV with the same, about the same, or a higher
affinity compared to the amino acid sequence comprising the one or
more stretches of amino acid residues without the one, two or
maximal three substitutions, deletions and/or insertions, said
affinity as measured by surface plasmon resonance; and/or the
resulting amino acid sequence of the invention should at least have
a potency that is the same, about the same or higher compared to
the amino acid sequence comprising the one or more stretches of
amino acid residues without the one, two or maximal three
substitutions, deletions and/or insertions. The skilled person will
generally be able to determine and select suitable substitutions,
deletions and/or insertions, or suitable combinations thereof,
based on the disclosure herein and optionally after a limited
degree of routine experimentation, which may for example involve
introducing a limited number of possible substitutions, deletions
or insertions and determining their influence on the properties of
the amino acid sequences thus obtained. [0355] For example, and
depending on the host organism used to express the amino acid
sequence of the invention, such deletions and/or substitutions may
be designed in such a way that one or more sites for
post-translational modification (such as one or more glycosylation
sites) are removed, as will be within the ability of the person
skilled in the art. [0356] In a preferred aspect of the invention,
the "amino acid difference" is an amino acid substitution. The
amino acid substitution may be any one, two or maximal three
substitutions that either improve the properties of the amino acid
sequence of the invention or that at least do not detract too much
from the desired properties or from the balance or combination of
desired properties of the amino acid sequence of the invention. In
this respect, the resulting amino acid sequence of the invention
should at least bind protein F of hRSV with the same, about the
same, or a higher affinity compared to the amino acid sequence
comprising the one or more stretches of amino acid residues without
the one, two or maximal three substitutions, said affinity as
measured by surface plasmon resonance; and/or the resulting amino
acid sequence of the invention should at least have a potency that
is the same, about the same or higher compared to the amino acid
sequence comprising the one or more stretches of amino acid
residues without the one, two or maximal three substitutions,
deletions and/or insertions. The skilled person will generally be
able to determine and select suitable substitutions, based on the
disclosure herein and optionally after a limited degree of routine
experimentation, which may for example involve introducing a
limited number of possible substitutions and determining their
influence on the properties of the Nanobodies.RTM. thus obtained.
[0357] The amino acid substitution in the one or more stretches of
amino acid residues may be a conservative amino acid substitution.
"Conservative" amino acid substitutions are generally amino acid
substitutions in which an amino acid residue is replaced with
another amino acid residue of similar chemical structure and which
has little or essentially no influence on the function, activity or
other biological properties of the resulting amino acid sequence.
Such conservative amino acid substitutions are well known in the
art, for example from WO 04/037999, GB-A-3 357 768, WO 98/49185, WO
00/46383 and WO 01/09300; and (preferred) types and/or combinations
of such substitutions may be selected on the basis of the pertinent
teachings from WO 04/037999 as well as WO 98/49185 and from the
further references cited therein.
[0358] Such conservative substitutions preferably are substitutions
in which one amino acid within the following groups (a)-(e) is
substituted by another amino acid residue within the same group:
(a) small aliphatic, nonpolar or slightly polar residues: Ala, Ser,
Thr, Pro and Gly; (b) polar, negatively charged residues and their
(uncharged) amides: Asp, Asn, Glu and Gln; (c) polar, positively
charged residues: His, Arg and Lys; (d) large aliphatic, nonpolar
residues: Met, Leu, Ile, Val and Cys; and (e) aromatic residues:
Phe, Tyr and Trp. [0359] Particularly preferred conservative
substitutions are as follows: Ala into Gly or into Ser; Arg into
Lys; Asn into Gln or into His; Asp into Glu; Cys into Ser; Gln into
Asn; Glu into Asp; Gly into Ala or into Pro; His into Asn or into
Gln; Ile into Leu or into Val; Leu into Ile or into Val; Lys into
Arg, into Gln or into Glu; Met into Leu, into Tyr or into Ile; Phe
into Met, into Leu or into Tyr; Ser into Thr; Thr into Ser; Trp
into Tyr; Tyr into Trp; and/or Phe into Val, into Ile or into Leu.
The amino acid substitution in the one or more stretches of amino
acid residues may provide the amino acid sequence with increased
affinity for binding to protein F of hRSV. This may be done by
techniques such as random or site-directed mutagenesis and/or other
techniques for affinity maturation known per se, such as e.g.
described in WO 09/004,065, WO 05/003345, WO 06/023144, EP527809,
EP397834. [0360] Without being limiting, rules (partly or fully
followed) for substitutions of amino acid residues in the CDRs may
be as follows (i.e. substitution with amino acids with similar side
chain chemistries): [0361] K is substituted by R; [0362] R is
substituted by K; [0363] A is substituted by S or T; [0364] S is
substituted by A or T; [0365] T is substituted by A or 5; [0366] I
is substituted by L or V; [0367] L is substituted by I or V; [0368]
V is substituted by I or L; [0369] F is substituted by Y; [0370] Y
is substituted by F; [0371] N is substituted by D; [0372] D is
substituted by N; [0373] Q is substituted by E; [0374] E is
substituted by Q; [0375] G is substituted by A; [0376] M is
substituted by L; [0377] H, C, W and P are kept constant. [0378]
Furthermore, and also without being limiting, the rules (partly or
fully followed) for substitutions of amino acid residues in the
CDRs may be alternatively as follows for substitutions at positions
27 to 35 and positions 50 to 58 (using Kabat numbering system),
wherein for positions 27 to 35: [0379] Original amino acid residue
in position 27 (Kabat numbering used) is substituted by F; G; R; S;
2 out of F, G, R, S; 3 out of F, G, R, S; or all of them,
preferably all of them; [0380] Original amino acid residue in
position 28 (Kabat numbering used) is substituted by A; I; S; T; 2
out of A, I, S, T; 3 out of A, I, S, T; or all of them, preferably
all of them; [0381] Original amino acid residue in position 29
(Kabat numbering used) is substituted by F; G; L; S; 2 out of F, G,
L, 5; 3 out of F, G, L, 5; or all of them, preferably all of them;
[0382] Original amino acid residue in position 30 (Kabat numbering
used) is substituted by D; G; S; T; 2 out of D, G, S, T; 3 out of
D, G, S, T; or all of them, preferably all of them; [0383] Original
amino acid residue in position 31 (Kabat numbering used) is
substituted by D; I; N; S; T; 2 out of D, I, N, S, T; 3 out of D,
I, N, S, T; or all of them, preferably all of them; [0384] Original
amino acid residue in position 32 (Kabat numbering used) is
substituted by D; N; Y; 2 out of D, N, Y; or all of them,
preferably all of them; [0385] Original amino acid residue in
position 33 (Kabat numbering used) is substituted by A; G; T; V; 2
out of A, G, T, V; 3 out of A, G, T, V; or all of them, preferably
all of them; [0386] Original amino acid residue in position 34
(Kabat numbering used) is substituted by I; M; or all of them,
preferably all of them; [0387] Original amino acid residue in
position 35 (Kabat numbering used) is substituted by A; G; S; 2 out
of A, G, S; or all of them, preferably all of them; [0388] and
positions 50 to 58 if original amino acid sequence has an amino
acid sequence in position 52a (Kabat numbering used), [0389]
Original amino acid residue in position 50 (Kabat numbering used)
is substituted by A; C; G; S; T; 2 out of A, C, G, S, T; 3 out of
A, C, G, S, T; 4 out of A, C, G, S, T; or all of them, preferably
all of them; [0390] Original amino acid residue in position 51
(Kabat numbering used) is substituted by I; [0391] Original amino
acid residue in position 52 (Kabat numbering used) is substituted
by N; R; S; T; 2 out of N, R, S, T; 3 out of N, R, S, T; or all of
them, preferably all of them; [0392] Original amino acid residue in
position 52a (Kabat numbering used) is substituted by R; 5; T; W; 2
out of R, S, T, W; 3 out of R, S, T, W; or all of them, preferably
all of them; [0393] Original amino acid residue in position 53
(Kabat numbering used) is substituted by D; G; N; S; T; 2 out of D,
G, N, S, T; 3 out of D, G, N, S, T; 4 out of D, G, N, S, T; or all
of them, preferably all of them; [0394] Original amino acid residue
in position 54 (Kabat numbering used) is substituted by D; or all
of them, preferably all of them; [0395] Original amino acid residue
in position 55 (Kabat numbering used) is substituted by D; G; S; 2
out of D, G, 5; or all of them, preferably all of them; [0396]
Original amino acid residue in position 56 (Kabat numbering used)
is substituted by I; N; R; S; T; 2 out of I, N, R, S, T; 3 out of
I, N, R, S, T; 4 out of I, N, R, S, T; or all of them, preferably
all of them; [0397] Original amino acid residue in position 57
(Kabat numbering used) is substituted by T; [0398] Original amino
acid residue in position 58 (Kabat numbering used) is substituted
by D; H; N; S; Y; 2 out of D, H, N, S, Y; 3 out of 0, H, N, S, Y; 4
out of 0, H, N, S, Y; or all of them, preferably all of them;
[0399] and wherein for positions 50 to 58 if original amino acid
sequence has not an amino acid sequence in position 52a (Kabat
numbering used), [0400] Original amino acid residue in position 50
(Kabat numbering used) is substituted by A; C; R; S; T; 2 out of A,
G, R, S, T; 3 out of A, G, R, S, T; 4 out of A, G, R, S, T; or all
of them, preferably all of them; [0401] Original amino acid residue
in position 51 (Kabat numbering used) is substituted by I; [0402]
Original amino acid residue in position 52 (Kabat numbering used)
is substituted by N; S; T; 2 out of N, S, T; or all of them,
preferably all of them; [0403] Original amino acid residue in
position 53 (Kabat numbering used) is substituted by N; R; S; T; Y;
2 out of N, R, S, T, Y; 3 out of N, R, S, T, Y; 4 out of N, R, S,
T, Y; or all of them, preferably all of them; [0404] Original amino
acid residue in position 54 (Kabat numbering used) is substituted
by D; G; R; S; 2 out of D, G, R, S; 3 out of D, G, R, S; or all of
them, preferably all of them; [0405] Original amino acid residue in
position 55 (Kabat numbering used) is substituted by G; [0406]
Original amino acid residue in position 56 (Kabat numbering used)
is substituted by G; N; R; S; T; 2 out of D, N, R, S, T; 3 out of
D, N, R, S, T; 4 out of D, N, R, S, T; or all of them, preferably
all of them; [0407] Original amino acid residue in position 57
(Kabat numbering used) is substituted by T; [0408] Original amino
acid residue in position 58 (Kabat numbering used) is substituted
by D; N; T; Y; 2 out of D, N, T, Y; 3 out of D, N, T, Y; or all of
them, preferably all of them. [0409] after which one or more of the
potentially useful substitutions (or combinations thereof) thus
determined can be introduced into said CDR sequence (in any manner
known per se, as further described herein) and the resulting amino
acid sequence(s) can be tested for affinity for protein F of hRSV,
and/or for other desired properties such as e.g. improved binding
characteristics (suitably measured and/or expressed as a
K.sub.D-value (actual or apparent), a K.sub.A-value (actual or
apparent), a k.sub.on-rate and/or a k.sub.off-rate, or
alternatively as an IC.sub.50 value, as further described herein),
improved affinity and/or improved avidity for protein F of hRSV
and/or improved efficacy and/or potency for neutralizing hRSV. In
this way, by means of a limited degree of trial and error, other
suitable substitutions in the CDRs (or suitable combinations
thereof) can be determined by the skilled person based on the
disclosure herein. The amino acid sequences comprising a stretch of
amino acid residues that has one, two or maximal three
substitutions, insertions or deletions, and nucleic acid sequences
encoding the same, can be provided in any manner known per se, for
example using one or more of the techniques mentioned on pages 103
and 104 of WO 08/020,079. [0410] The resulting amino acid sequences
of the invention should preferably bind to protein F of hRSV with
an affinity (suitably measured and/or expressed as a K.sub.D-value
(actual or apparent), a K.sub.A-value (actual or apparent), a
k.sub.on-rate and/or a k.sub.off-rate, or alternatively as an
IC.sub.50 value, as further described herein) that is as defined
herein; and/or neutralize hRSV with an efficacy and/or potency that
is as defined herein. [0411] aa) When comparing two amino acid
sequences, the term "amino acid difference" refers to an insertion,
deletion or substitution of a single amino acid residue on a
position of the first amino acid sequence, compared to the second
amino acid sequence; it being understood that two amino acid
sequences can contain one, two or maximal three such amino acid
differences. The "amino acid difference" can be any one, any two or
maximal any three substitutions, deletions or insertions in the
amino acid sequence, i.e. in one or more of the framework regions
or in one or more of the CDRs (which may be in a CDR of the
invention (i.e. in CDR2) or in another CDR (i.e. in CDR1, CDR2 or
CDR3)), or any combination thereof, that either improve the
properties of the amino acid sequence of the invention or that at
least do not detract too much from the desired properties or from
the balance or combination of desired properties of the amino acid
sequence of the invention. In this respect, the resulting amino
acid sequence of the invention should at least bind protein F of
hRSV with the same, about the same, or a higher affinity compared
to the amino acid sequence without the one, two or maximal three
substitutions, deletions or insertions, said affinity as measured
by surface plasmon resonance; and/or the resulting amino acid
sequence of the invention should at least have a potency that is
the same, about the same or higher compared to the amino acid
sequence without the one, two or maximal three substitutions,
deletions and/or insertions. The skilled person will generally be
able to determine and select suitable substitutions, deletions or
insertions, or suitable combinations thereof, based on the
disclosure herein and optionally after a limited degree of routine
experimentation, which may for example involve introducing a
limited number of possible substitutions, deletions or insertions
and determining their influence on the properties of the amino acid
sequence thus obtained. [0412] In one aspect of the invention, the
"amino acid difference" is an amino acid substitution. The amino
acid substitution may be any one, two or maximal three
substitutions in one or more of the framework regions or in one or
more of the CDRs (which may be in a CDR of the invention (i.e. in
CDR2) or in another CDR (i.e. in CDR1, CDR2 or CDR3)), or any
combination thereof, that either improve the properties of the
amino acid sequence of the invention or that at least do not
detract too much from the desired properties or from the balance or
combination of desired properties of the amino acid sequence of the
invention. In this respect, the resulting amino acid sequence of
the invention should at least bind protein F of hRSV with the same,
about the same, or a higher affinity compared to the amino acid
sequence without the one, two or maximal three substitutions, said
affinity as measured by surface plasmon resonance; and/or the
resulting amino acid sequence of the invention should at least have
a potency that is the same, about the same or higher compared to
the amino acid sequence without the one, two or maximal three
substitutions. The skilled person will generally be able to
determine and select suitable substitutions, based on the
disclosure herein and optionally after a limited degree of routine
experimentation, which may for example involve introducing a
limited number of possible substitutions and determining their
influence on the properties of the amino acid sequences thus
obtained. [0413] As indicated above, the substitutions, insertions
or deletions can be in one or more of the framework regions and/or
in one or more of the CDR's. As discussed above (see point z)
above), the amino acid substitution in one or more of the CDRs can
be any substitution such as a "conservative substitution" (as
defined herein), it may be driven by certain rules (as defined
herein), and/or it may induce improved properties to the resulting
amino acid sequences. When such substitutions, insertions or
deletions are made in one or more of the framework regions, they
may be made at one or more of the Hallmark residues (as e.g.
defined in WO 08/020,079; Tables A-3 to A-8) and/or at one or more
of the other positions in the framework residues, although
substitutions, insertions or deletions at the Hallmark residues are
generally less preferred (unless these are suitable humanizing
substitutions as described herein). By means of non-limiting
examples, a substitution may for example be a conservative
substitution (as described herein) and/or an amino acid residue may
be replaced by another amino acid residue that naturally occurs at
the same position in another V.sub.HH domain (see WO 08/020,079,
Tables A-5 to A-8), although the invention is generally not limited
thereto. [0414] Substitutions, insertions or deletions made
(preferably) in one or more of the framework regions may be
humanizing substitution (i.e. replacing one or more amino acid
residues in the amino acid sequence of a naturally occurring
V.sub.HH sequence (and in particular in the framework sequences) by
one or more of the amino acid residues that occur at the
corresponding position(s) in a V.sub.H domain from a conventional
4-chain antibody from a human being). Some preferred, but
non-limiting humanizing substitutions (and suitable combinations
thereof) will become clear to the skilled person based on the
disclosure herein. Potentially useful humanizing substitutions can
be ascertained by comparing the sequence of the framework regions
of one of the amino acid sequence of the invention defined in a)
with the corresponding framework sequence of one or more closely
related human V.sub.H sequences, after which one or more of the
potentially useful humanizing substitutions (or combinations
thereof) thus determined can be introduced into said amino acid
sequence of the invention defined in a) (in any manner known per
se, as further described herein) and the resulting humanized amino
acid sequence can be tested for affinity for protein F of hRSV, for
stability, for ease and level of expression, and/or for other
desired properties defined herein. In this way, by means of a
limited degree of trial and error, other suitable humanizing
substitutions (or suitable combinations thereof) can be determined
by the skilled person based on the disclosure herein.
[0415] The humanizing substitutions should be chosen such that the
resulting humanized amino acid sequence and/or Nanobody.RTM. still
retains the favourable properties of Nanobodies.RTM. as defined
herein. A skilled person will generally be able to determine and
select suitable humanizing substitutions or suitable combinations
of humanizing substitutions, based on the disclosure herein and
optionally after a limited degree of routine experimentation, which
may for example involve introducing a limited number of possible
humanizing substitutions and determining their influence on the
properties of the Nanobodies.RTM. thus obtained. Generally, as a
result of humanization, the amino acid sequence and/or
Nanobody.RTM. of the invention may become more "human-like", while
still retaining the favorable properties of the Nanobodies.RTM. of
the invention as described herein. As a result, such humanized
amino acid sequence and/or Nanobody.RTM. may have several
advantages, such as a reduced immunogenicity, compared to the
corresponding naturally occurring V.sub.HH domain. Again, based on
the disclosure herein and optionally after a limited degree of
routine experimentation, the skilled person will be able to select
humanizing substitutions or suitable combinations of humanizing
substitutions which optimize or achieve a desired or suitable
balance between the favourable properties provided by the
humanizing substitutions on the one hand and the favourable
properties of naturally occurring V.sub.HH domains on the other
hand. [0416] The amino acid sequences and/or Nanobodies.RTM. of the
invention may be suitably humanized at any framework residue(s),
such as at one or more Hallmark residues (as defined herein) or at
one or more other framework residues (i.e. non-Hallmark residues)
or any suitable combination thereof. One preferred humanizing
substitution for Nanobodies.RTM. of the "P,R,S-103 group" or the
"KERE group" (as defined in WO 08/020,079) is Q108 into L108.
[0417] Depending on the host organism used to express the amino
acid sequence, Nanobody.RTM. or polypeptide of the invention, such
deletions and/or substitutions may also be designed in such a way
that one or more sites for post-translational modification (such as
one or more glycosylation sites) are removed, as will be within the
ability of the person skilled in the art. Alternatively,
substitutions or insertions may be designed so as to introduce one
or more sites for attachment of functional groups (as described
herein), for example to allow site-specific pegylation (again as
described herein). [0418] As can be seen from the data on the
V.sub.HH entropy and V.sub.HH variability given in Tables A-5-A-8
of WO 08/020,079, some amino acid residues in the framework regions
are more conserved than others. Generally, although the invention
in its broadest sense is not limited thereto, any substitutions,
deletions or insertions are preferably made at positions that are
less conserved. Also, generally, amino acid substitutions are
preferred over amino acid deletions or insertions. Any amino acid
substitutions applied to the polypeptides described herein may also
be based on the analysis of the frequencies of amino acid
variations between homologous proteins of different species
developed by Schulz et al., Principles of Protein Structure,
Springer-Verlag, 1978, on the analyses of structure forming
potentials developed by Chou and Fasman, Biochemistry 13: 211, 1974
and Adv. Enzymol., 47: 45-149, 1978, and on the analysis of
hydrophobicity patterns in proteins developed by Eisenberg et al.,
Proc. Natl. Acad. Sci. USA 81: 140-144, 1984; Kyte & Doolittle;
J Molec. Biol. 157: 105-132, 198 1, and Goldman et al., Ann. Rev.
Biophys. Chem. 15: 321-353, 1986, all incorporated herein in their
entirety by reference. Information on the primary, secondary and
tertiary structure of Nanobodies.RTM. is given in the description
herein and in the general background art cited above. Also, for
this purpose, the crystal structure of a V.sub.HH domain from a
llama is for example given by Desmyter et al., Nature Structural
Biology, Vol. 3, 9, 803 (1996); Spinelli et al., Natural Structural
Biology (1996); 3, 752-757; and Decanniere et al., Structure, Vol.
7, 4, 361 (1999). Further information about some of the amino acid
residues that in conventional V.sub.H domains form the
V.sub.H/V.sub.L interface and potential camelizing substitutions on
these positions can be found in the prior art cited above. [0419]
The amino acid sequences and/or Nanobodies.RTM. with one, two or
maximal three substitutions, insertions or deletions, and nucleic
acid sequences encoding the same, can be provided in any manner
known per se, for example using one or more of the techniques
mentioned on pages 103 and 104 of WO 08/020,079. [0420] The
resulting amino acid sequences and/or Nanobodies.RTM. of the
invention should preferably bind to protein F of hRSV with an
affinity (suitably measured and/or expressed as a K.sub.D-value
(actual or apparent), a K.sub.A-value (actual or apparent), a
k.sub.on-rate and/or a k.sub.off-rate, or alternatively as an
IC.sub.50 value, as further described herein) that is as defined
herein; and/or neutralize hRSV with an efficacy and/or potency that
is as defined herein. [0421] bb) When comparing two polypeptides,
the term "amino acid difference" refers to an insertion, deletion
or substitution of a single amino acid residue on a position of the
first polypeptide, compared to the second polypeptide; it being
understood that two polypeptides can contain one, two or maximal
three such amino acid differences. [0422] The "amino acid
difference" can be any one, any two or maximal three substitutions,
deletions or insertions in the polypeptide, i.e. in one or more of
the framework regions or in one or more of the CDRs (which may be
in a CDR of the invention (i.e. in CDR2) or in another CDR (i.e. in
CDR1, CDR2 or CDR3)), or any combination thereof, that either
improve the properties of the polypeptide of the invention or that
at least do not detract too much from the desired properties or
from the balance or combination of desired properties of the
polypeptide of the invention. In this respect, the resulting
polypeptide of the invention should at least bind protein F of hRSV
with the same, about the same, or a higher affinity compared to the
polypeptide without the one, two or maximal three substitutions,
deletions or insertions, said affinity as measured by surface
plasmon resonance; and/or the resulting polypeptide of the
invention should at least have a potency that is the same, about
the same or higher compared to the polypeptide without the one, two
or maximal three substitutions, deletions and/or insertions. The
resulting polypeptide should preferably bind to protein F of hRSV
with an affinity (suitably measured and/or expressed as a
K.sub.D-value (actual or apparent), a K.sub.A-value (actual or
apparent), a k.sub.on-rate and/or a k.sub.off-rate, or
alternatively as an IC.sub.50 value, as further described herein)
that is as defined herein; and/or neutralize hRSV with an efficacy
and/or potency that is as defined herein. The skilled person will
generally be able to determine and select suitable substitutions,
deletions or insertions, or suitable combinations thereof, based on
the disclosure herein and optionally after a limited degree of
routine experimentation, which may for example involve introducing
a limited number of possible substitutions, deletions or insertions
and determining their influence on the properties of the
polypeptide thus obtained. [0423] In one aspect of the invention,
the "amino acid difference" is an amino acid substitution. The
amino acid substitution may be any one, any two or maximal any
three substitutions in the framework regions or in one or more of
the CDRs (which may be in a CDR of the invention (i.e. present in
CDR2) or in another CDR (i.e. in CDR1, CDR2 or CDR3)), or any
combination thereof, that either improve the properties of the
polypeptide of the invention or that at least do not detract too
much from the desired properties or from the balance or combination
of desired properties of the polypeptide of the invention. In this
respect, the resulting polypeptide of the invention should at least
bind protein F of hRSV with the same, about the same, or a higher
affinity compared to the polypeptide without the one, two or
maximal three substitutions, deletions or insertions, said affinity
as measured by surface plasmon resonance; and/or the resulting
polypeptide of the invention should at least have a potency that is
the same, about the same or higher compared to the polypeptide
without the one, two or maximal three substitutions, deletions
and/or insertions. The resulting polypeptide should preferably bind
to protein F of hRSV with an affinity (suitably measured and/or
expressed as a K.sub.D-value (actual or apparent), a K.sub.A-value
(actual or apparent), a k.sub.on-rate and/or a k.sub.off-rate, or
alternatively as an IC.sub.50 value, as further described herein)
that is as defined herein; and/or neutralize hRSV with an efficacy
and/or potency that is as defined herein. The skilled person will
generally be able to determine and select suitable substitutions,
based on the disclosure herein and optionally after a limited
degree of routine experimentation, which may for example involve
introducing a limited number of possible substitutions and
determining their influence on the properties of polypeptides thus
obtained. [0424] As indicated above, the substitutions, insertions
or deletions can be in one or more of the framework regions and/or
in one or more of the CDR's. As discussed above (see point z)), the
substitutions, insertions or deletions in the CDR's may be any
possible substitutions, insertions or deletions such as
"conservative substitution" (as defined herein), it may be driven
by certain rules (as defined herein), and/or it may induce improved
properties to the resulting polypeptides. [0425] When such
substitutions, insertions or deletions are made in one or more of
the framework regions, they may be made at one or more of the
Hallmark residues (as e.g. defined in WO 08/020,079; Tables A-3 to
A-8) and/or at one or more of the other positions in the framework
residues, although substitutions, insertions or deletions at the
Hallmark residues are generally less preferred (unless these are
suitable humanizing substitutions as described herein). By means of
non-limiting examples, a substitution may for example be a
conservative substitution (as described herein) and/or an amino
acid residue may be replaced by another amino acid residue that
naturally occurs at the same position in another V.sub.HH domain
(see WO 08/020,079, Tables A-5 to A-8), although the invention is
generally not limited thereto. [0426] Substitutions, insertions or
deletions made (preferably) in one or more of the framework regions
may be humanizing substitution. Some preferred, but non-limiting
humanizing substitutions (and suitable combinations thereof) will
become clear to the skilled person based on the disclosure herein.
Potentially useful humanizing substitutions can be ascertained by
comparing the sequence of the framework regions of one of the amino
acid sequences encompassed in the polypeptide of the invention
defined in a) with the corresponding framework sequence of one or
more closely related human V.sub.H sequences, after which one or
more of the potentially useful humanizing substitutions (or
combinations thereof) thus determined can be introduced into said
polypeptide of the invention defined in a) (in any manner known per
se, as further described herein) and the resulting polypeptide
sequence can be tested for affinity for protein F of hRSV, for
stability, for ease and level of expression, and/or for other
desired properties defined herein. In this way, by means of a
limited degree of trial and error, other suitable humanizing
substitutions (or suitable combinations thereof) can be determined
by the skilled person based on the disclosure herein. [0427] The
humanizing substitutions should be chosen such that the resulting
humanized polypeptide sequences still retain the favourable
properties of Nanobodies.RTM. encompassed in the polypeptide as
defined herein. A skilled person will generally be able to
determine and select suitable humanizing substitutions or suitable
combinations of humanizing substitutions, based on the disclosure
herein and optionally after a limited degree of routine
experimentation, which may for example involve introducing a
limited number of possible humanizing substitutions and determining
their influence on the properties of the Nanobodies.RTM.
encompassed in the polypeptide thus obtained. [0428] Generally, as
a result of humanization, the polypeptide of the invention may
become more "human-like", while still retaining the favorable
properties of the Nanobodies.RTM. of the invention encompassed in
the polypeptide as described herein. As a result, such humanized
polypeptides may have several advantages, such as a reduced
immunogenicity, compared to the polypeptides that encompass
corresponding naturally occurring V.sub.HH domains. Again, based on
the disclosure herein and optionally after a limited degree of
routine experimentation, the skilled person will be able to select
humanizing substitutions or suitable combinations of humanizing
substitutions which optimize or achieve a desired or suitable
balance between the favourable properties provided by the
humanizing substitutions on the one hand and the favourable
properties of naturally occurring V.sub.HH domains on the other
hand, [0429] Polypeptides of the invention may be suitably
humanized at any framework residue(s), such as at one or more
Hallmark residues (as defined herein) or at one or more other
framework residues (i.e. non-Hallmark residues) or any suitable
combination thereof. One preferred humanizing substitution for
Nanobodies.RTM. of the "P,R,S-103 group" or the "KERE group" is
Q108 into L108. [0430] Depending on the host organism used to
express the polypeptide of the invention, such deletions and/or
substitutions may also be designed in such a way that one or more
sites for post-translational modification (such as one or more
glycosylation sites) are removed, as will be within the ability of
the person skilled in the art. Alternatively, substitutions or
insertions may be designed so as to introduce one or more sites for
attachment of functional groups (as described herein), for example
to allow site-specific pegylation (again as described herein). As
can be seen from the data on the V.sub.HH entropy and V.sub.HH
variability given in Tables A-5-A-8 of WO 08/020,079, some amino
acid residues in the framework regions are more conserved than
others. Generally, although the invention in its broadest sense is
not limited thereto, any substitutions, deletions or insertions are
preferably made at positions that are less conserved. Also,
generally, amino acid substitutions are preferred over amino acid
deletions or insertions. Any amino acid substitutions applied to
the polypeptides described herein may also be based on the analysis
of the frequencies of amino acid variations between homologous
proteins of different species developed by Schulz et al.,
Principles of Protein Structure, Springer-Verlag, 1978, on the
analyses of structure forming potentials developed by Chou and
Fasman, Biochemistry 13: 211, 1974 and Adv. Enzymol., 47: 45-149,
1978, and on the analysis of hydrophobicity patterns in proteins
developed by Eisenberg et al., Proc. Natl. Acad. Sci. USA 81:
140-144, 1984; Kyte
& Doolittle; J Molec. Biol. 157: 105-132, 198 1, and Goldman et
al., Ann. Rev. Biophys. Chem. 15: 321-353, 1986, all incorporated
herein in their entirety by reference. Information on the primary,
secondary and tertiary structure of Nanobodies.RTM. is given in the
description herein and in the general background art cited above.
Also, for this purpose, the crystal structure of a V.sub.HH domain
from a llama is for example given by Desmyter et al., Nature
Structural Biology, Vol. 3, 9, 803 (1996); Spinelli et al., Natural
Structural Biology (1996); 3, 752-757; and Decanniere et al.,
Structure, Vol. 7, 4, 361 (1999). Further information about some of
the amino acid residues that in conventional V.sub.H domains form
the V.sub.H/V.sub.L interface and potential camelizing
substitutions on these positions can be found in the prior art
cited above. [0431] The polypeptides with one, two or maximal three
substitutions, insertions or deletions, and nucleic acid sequences
encoding the same, can be provided in any manner known per se, for
example using one or more of the techniques mentioned on pages 103
and 104 of WO 08/020,079. [0432] The resulting polypeptides of the
invention should preferably bind to protein F of hRSV with an
affinity (suitably measured and/or expressed as a K.sub.D-value
(actual or apparent), a K.sub.A-value (actual or apparent), a
k.sub.on-rate and/or a k.sub.off-rate, or alternatively as an
IC.sub.50 value, as further described herein) that is as defined
herein; and/or neutralize hRSV with an efficacy and/or potency that
is as defined herein. [0433] cc) The figures, sequence listing and
the experimental part/examples are only given to further illustrate
the invention and should not be interpreted or construed as
limiting the scope of the invention and/or of the appended claims
in any way, unless explicitly indicated otherwise herein.
[0434] For binding to its epitope on protein F of hRSV, an amino
acid sequence will usually contain within its amino acid sequence
one or more amino acid residues or one or more stretches of amino
acid residues (as defined herein; i.e. with each "stretch"
comprising two or more amino acid residues that are adjacent to
each other or in close proximity to each other, i.e. in the primary
or tertiary structure of the amino acid sequence) via which the
amino acid sequence of the invention can bind to its epitope on
protein F of hRSV. These amino acid residues or stretches of amino
acid residues thus form the "site" for binding to the epitope on
protein F of hRSV (also referred to herein as the "antigen binding
site"; as further defined herein).
[0435] The present invention provides a number of stretches of
amino acid residues (as defined herein) that are particularly
suited for binding to antigenic site II on protein F of hRSV (for a
description of antigenic sites in the hRSV F protein reference is
made to Lopez et al. 1998, J. virol. 72: 6922-6928). These
stretches of amino acid residues may be present in, and/or may be
incorporated into, an amino acid sequence of the invention, in
particular in such a way that they form (part of) the antigen
binding site of the amino acid sequence of the invention. The
resulting amino acid sequences will bind a specific epitope on
protein F of hRSV that lies in, forms part of, or overlaps with
(i.e. in the primary or tertiary structure) or is in close
proximity to (i.e. in the primary or tertiary structure) antigenic
site II on protein F of hRSV. Also, the resulting amino acid
sequences of the invention will preferably be such that they can
compete with Synagis.RTM. for binding to protein F of hRSV; and/or
such that they can bind to the same epitope or binding site on
protein F of hRSV as Synagis.RTM., or to an epitope close to said
binding site and/or overlapping with said binding site.
[0436] The present invention provides a stretch of amino acid
residues (SEQ ID NO: 102) that is particularly suited for binding
to protein F of hRSV. This stretch of amino acid residues (or
variants of SEQ ID NO: 102 as defined herein) may be present in,
and/or may be incorporated into, an amino acid sequence of the
invention, in particular in such a way that they form (part of) the
antigen binding site of the amino acid sequence of the invention.
The stretch of amino acid residues has been generated as CDR2
sequence of a heavy chain antibody or V.sub.HH sequence (NC41; SEQ
ID NO: 5) that was raised against protein F of hRSV and that was
further modified in a library approach to generate humanized NC41
Nanobodies.RTM. (as described in the Example section). More in
particular, the glycine (Gly, G) residue at position 6 of the CDR2
of NC41 was substituted into an Aspartic acid (Asp, D) residue.
Surprisingly, improved binding characteristics (suitably measured
and/or expressed as a K.sub.D-value (actual or apparent), a
K.sub.A-value (actual or apparent), a k.sub.on-rate and/or a
k.sub.off-rate, or alternatively as an IC.sub.50 value, as further
described herein), improved affinity and/or improved avidity for
protein F of hRSV and/or improved efficacy and/or potency for
neutralizing hRSV have been observed for amino acid sequences that
comprise this stretch of amino acid residues (SEQ ID NO: 102). This
stretch of amino acid residues (or variants of SEQ ID NO: 102, as
defined herein) are also referred to herein as "CDR2 sequences of
the invention".
[0437] Accordingly, in one aspect, the present invention provides
amino acid sequences that comprise at least a stretch of amino acid
residues chosen from the following: [0438] a) SEQ ID NO: 102;
[0439] b) a stretch of amino acid residues that has no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with SEQ ID NO: 102, provided that: [0440] i) said
stretch of amino acid residues has an Aspartic acid (Asp, D) at
position 6 (position 54 determined according to Kabat numbering);
and [0441] ii) the amino acid sequence comprising said stretch of
amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference.
[0442] In a preferred aspect, the present invention provides amino
acid sequences that comprise two or more stretches of amino acid
residues in which one stretch is chosen from the following: [0443]
a) SEQ ID NO: 102; [0444] b) a stretch of amino acid residues that
has no more than 3, preferably no more than 2, more preferably no
more than 1 amino acid difference with SEQ ID NO: 102, provided
that: [0445] i) said stretch of amino acid residues has an Aspartic
acid (Asp, D) at position 6 (position 54 determined according to
Kabat numbering); and [0446] ii) the amino acid sequence comprising
said stretch of amino acid residues binds protein of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference;
[0447] and at least one stretch is chosen from: [0448] c) SEQ ID
NO: 98; [0449] d) a stretch of amino acid residues that has no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with SEQ ID NO: 98, provided that the amino
acid sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [0450] e) SEQ ID NO: 121; and [0451] f) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 121, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference.
[0452] such that the stretch of amino acid residues that
corresponds to one of a) and b) should always be present in the
amino acid sequence of the invention and such that the second
stretch of amino acid residues is chosen from one of c), d), e) and
f).
[0453] Even more preferably, the amino acid sequences of the
invention comprise three or more stretches of amino acid residues,
in which the first stretch of amino acid residues is chosen from
the group consisting of: [0454] a) SEQ ID NO: 98; [0455] b) a
stretch of amino acid residues that has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with SEQ ID NO: 98, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; the second stretch of amino acid residues is chosen
from the group consisting of: [0456] c) SEQ ID NO: 102; [0457] d) a
stretch of amino acid residues that has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with SEQ ID NO: 102, provided that: [0458] i) said
stretch of amino acid residues has an Aspartic acid (Asp, D) at
position 6 (position 54 determined according to Kabat numbering);
and [0459] ii) the amino acid sequence comprising said stretch of
amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference; and the third stretch
of amino acid residues is chosen from the group consisting of:
[0460] e) SEQ ID NO: 121; [0461] f) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
121, provided that the amino acid sequence comprising said stretch
of amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference.
[0462] Amino acid sequences comprising one or more of the above
specified stretches of amino acid residues show improved properties
such as e.g. improved binding characteristics (suitably measured
and/or expressed as a K.sub.D-value (actual or apparent), a
K.sub.A-value (actual or apparent), a k.sub.on-rate and/or a
k.sub.off-rate, or alternatively as an IC.sub.50 value, as further
described herein), improved affinity and/or improved avidity for
protein F of hRSV and/or improved efficacy and/or potency for
neutralizing hRSV.
[0463] More in particular, the amino acid sequences of the
invention comprising one or more of the above specified stretches
of amino acid residues can bind to protein F of hRSV with an
affinity (suitably measured and/or expressed as a K.sub.D-value
(actual or apparent), a K.sub.A-value (actual or apparent), a
k.sub.on-rate and/or a k.sub.off-rate, or alternatively as an
IC.sub.50 value, as further described herein) preferably such that
they: [0464] bind to protein F of hRSV with a dissociation constant
(K.sub.D) of 1000 nM to 1 nM or less, preferably 100 nM to 1 nM or
less, more preferably 15 nM to 1 nM or even 10 nM to 1 nM or less;
and/or such that they: [0465] bind to protein F of hRSV with a
k.sub.on-rate of between 10.sup.4 M.sup.-1s.sup.-1 to about
10.sup.7 M.sup.-1s.sup.-1, preferably between 10.sup.5
M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1, more preferably
about 10.sup.6 M.sup.-1s.sup.-1 or more; and/or such that they:
[0466] bind to protein F of hRSV with a k.sub.off rate between
10.sup.-2s.sup.-1 (t.sub.1/2=0.69 s) and 10.sup.-4 s.sup.-1
(providing a near irreversible complex with a t.sub.1/2 of multiple
days), preferably between 10.sup.-3 s.sup.-1 and 10.sup.-4
s.sup.-1, or lower;
[0467] Some preferred IC50 values for binding of the amino acid
sequences of the invention to protein F of hRSV will become clear
from the further description and examples herein.
[0468] Assays to determine the IC50 include competition assays such
as competition ELISA (e.g. competition with Synagis.RTM. or its Fab
fragment) or more preferably neutralization assays such as the
microneutralization assay described by Anderson et al. (1985, J.
Clin. Microbiol. 22: 1050-1052; 1988, J. Viral. 62: 4232-4238),
modifications of this assay such as e.g. described in Example 6, or
a plaque reduction assay as for example described by Johnson et al.
(1997, J. Inf. Dis. 176: 1215-4224), and modifications thereof.
[0469] For example, in a competition assay with the Fab fragment of
Synagis.RTM., the amino acid sequences of the invention may have
IC50 values between 1 nM and 100 nM, preferably between 10 nM and
50 nM, or less.
[0470] For example, in a microneutralization assay on hRSV Long
(such as e.g. described in Example 6) the amino acid sequences of
the invention may have IC50 values between 100 nM and 1000 nM,
preferably between 100 nM and 500 nM, or less.
[0471] It should be noted that the invention is not limited as to
the origin of the amino acid sequence of the invention (or of the
nucleotide sequence of the invention used to express it), nor as to
the way that the amino acid sequence or nucleotide sequence of the
invention is (or has been) generated or obtained. Thus, the amino
acid sequences of the invention may be naturally occurring amino
acid sequences (from any suitable species) or synthetic or
semi-synthetic amino acid sequences.
[0472] It should be noted that the invention in its broadest sense
is not limited to a specific structural role or function that these
stretches of amino acid residues may have in the amino acid
sequence of the invention, as long as these stretches of amino acid
residues allow the amino acid sequence of the invention to bind to
antigenic site II on protein F of hRSV with a certain affinity
and/or potency (as defined herein). Thus, generally, the invention
in its broadest sense comprises any amino acid sequence that is
capable of binding to antigenic site II on protein F of hRSV and
that comprises one or more stretches of amino acid residues as
defined herein (and in particular a suitable combination of two or
more such stretches of amino acid residues) that are suitably
linked to each other via one or more further amino acid sequences,
such that the entire amino acid sequence forms a binding domain
and/or binding unit that is capable of binding to antigenic site II
on protein F of hRSV.
[0473] Such an amino acid sequence may, for example, be a suitable
"protein scaffold" that comprises at least one stretch of amino
acid residues as defined herein (i.e. as part of its antigen
binding site). Suitable scaffolds for presenting amino acid
sequences will be clear to the skilled person, and for example
comprise, without limitation, to binding scaffolds based on or
derived from immunoglobulins, protein scaffolds derived from
protein A domains (such as Affibodies.TM.), tendamistat,
fibronectin, lipocalin, CTLA-4, T-cell receptors, designed ankyrin
repeats, avimers and PDZ domains (Binz et al. 2005, Nat. Biotech.
23: 1257), and binding moieties based on DNA or RNA including but
not limited to DNA or RNA aptamers (Ulrich et al. 2006, Comb. Chem.
High Throughput Screen 9(8): 619-32).
[0474] Again, any amino acid sequence of the invention that
comprises one or more of the stretches of amino acid sequences as
defined herein for the amino acid sequences of the invention is
preferably such that it can specifically bind (as defined herein)
to protein F of hRSV, and more in particular such that it can bind
to protein F of hRSV with an affinity (suitably measured and/or
expressed as a K.sub.D-value (actual or apparent), a K.sub.A-value
(actual or apparent), a k.sub.on-rate and/or a k.sub.off-rate, or
alternatively as an IC.sub.50 value, as further described herein),
that is as defined herein. Any amino acid sequence of the invention
that comprises one or more of the stretches of amino acid residues
as defined herein for the amino acid sequences of the invention is
preferably such that it can neutralize hRSV with a potency (as
measured in a suitable assay as defined herein) that is as defined
herein.
[0475] Furthermore, it will also be clear to the skilled person
that it may be possible to "graft" one or more of the CDR's defined
herein for the amino acid sequences of the invention onto other
"scaffolds", including but not limited to human scaffolds or
non-immunoglobulin scaffolds. Suitable scaffolds and techniques for
such CDR grafting will be clear to the skilled person and are well
known in the art, see for example U.S. Pat. No. 7,180,370, WO
01/27160, EP 0 605 522, EP 0 460 167, U.S. Pat. No. 7,054,297,
Nicaise et al., Protein Science (2004), 13:1882-1891; Ewert et al.,
Methods, 2004 October; 34(2):184-199; Kettleborough et al., Protein
Eng. 1991 October; 4(7): 773-783; O'Brien and Jones, Methods Mol.
Biol. 2003: 207: 81-100; and Skerra, J. Mat. Recognit. 2000: 13:
167-187, and Saerens et al., J. Mol. Biol. 2005 Sep. 23;
352(3):597-607, and the further references cited therein. For
example, techniques known per se for grafting mouse or rat CDR's
onto human frameworks and scaffolds can be used in an analogous
manner to provide chimeric proteins comprising one or more of the
CDR sequences defined herein for the amino acid sequences of the
invention and one or more human framework regions or sequences.
[0476] In one specific, but non-limiting aspect, the amino acid
sequence of the invention may be an amino acid sequence that
comprises an immunoglobulin fold or an amino acid sequence that,
under suitable conditions (such as physiological conditions) is
capable of forming an immunoglobulin fold (i.e. by folding).
Reference is inter alia made to the review by Halaby et al. (1999,
J. Protein Eng. 12: 563-71). Preferably, when properly folded so as
to form an immunoglobulin fold, the stretches of amino acid
residues may be capable of properly forming the antigen binding
site for binding the specific antigenic site II on protein F of
hRSV; and more preferably capable of binding to antigenic site lion
protein F of hRSV with an affinity (suitably measured and/or
expressed as a K.sub.B-value (actual or apparent), a K.sub.A-value
(actual or apparent), a k.sub.on-rate and/or a k.sub.off-rate, or
alternatively as an IC.sub.50 value, as further described herein)
that is as defined herein.
[0477] In another specific, but non-limiting aspect, the amino acid
sequences of the invention are immunoglobulin sequences. In
particular, but without limitation, the amino acid sequences of the
invention may be amino acid sequences that essentially consist of 4
framework regions (FR1 to FR4 respectively) and 3 complementarity
determining regions (CDR1 to CDR3 respectively); or any suitable
fragment of such an amino acid sequence that still binds antigenic
site lion protein F of hRSV.
[0478] In such an amino acid sequence of the invention, the
framework sequences may be any suitable framework sequences, and
examples of suitable framework sequences will be clear to the
skilled person, for example on the basis the standard handbooks and
the further disclosure and prior art mentioned herein.
[0479] The framework sequences are preferably (a suitable
combination of) immunoglobulin framework sequences or framework
sequences that have been derived from immunoglobulin framework
sequences (for example, by humanization or camelization). For
example, the framework sequences may be framework sequences derived
from a light chain variable domain (e.g. a V-sequence) and/or from
a heavy chain variable domain (e.g. a V.sub.H-sequence). When the
amino acid sequence of the invention is a heavy chain variable
domain sequence, it may be a heavy chain variable domain sequence
that is derived from a conventional four-chain antibody (such as,
without limitation, a V.sub.H sequence that is derived from a human
antibody) or be a so-called V.sub.HH-sequence (as defined herein)
that is derived from a so-called "heavy chain antibody" (as defined
herein). In one particularly preferred aspect, the framework
sequences are either framework sequences that have been derived
from a V.sub.HH-sequence (in which said framework sequences may
optionally have been partially or fully humanized) or are
conventional V.sub.H sequences that have been camelized (as defined
herein).
[0480] For a general description of heavy chain antibodies and the
variable domains thereof, reference is inter alia made to the prior
art cited herein, as well as to the prior art mentioned on page 59
of WO 08/020,079 and to the list of references mentioned on pages
41-43 of the international application WO 06/040153, which prior
art and references are incorporated herein by reference.
[0481] The framework sequences may preferably be such that the
amino acid sequence of the invention is a domain antibody (or an
amino acid sequence that is suitable for use as a domain antibody);
is a single domain antibody (or an amino acid sequence that is
suitable for use as a single domain antibody); is a "dAb" (or an
amino acid sequence that is suitable for use as a dAb); or is a
Nanobody.RTM. (including but not limited to V.sub.HH sequence).
Again, suitable framework sequences will be clear to the skilled
person, for example on the basis the standard handbooks and the
further disclosure and prior art mentioned herein.
[0482] In particular, the framework sequences present in the amino
acid sequences of the invention may contain one or more of Hallmark
residues (as defined in WO 08/020,079 (Tables A-3 to A-8)), such
that the amino acid sequence of the invention is a Nanobody.RTM..
Some preferred, but non-limiting examples of (suitable combinations
of) such framework sequences will become clear from the further
disclosure herein (see e.g. Table A-6). Generally, Nanobodies.RTM.
(in particular V.sub.HH sequences and partially humanized
Nanobodies.RTM.) can in particular be characterized by the presence
of one or more "Hallmark residues" in one or more of the framework
sequences (as e.g. further described in WO 08/020,079, page 61,
line 24 to page 98, line 3).
[0483] As already described herein, the amino acid sequence and
structure of a Nanobody.RTM. can be considered--without however
being limited thereto--to be comprised of four framework regions or
"FR's", which are referred to in the art and herein as "Framework
region 1" or "FR1"; as "Framework region 2" or "FR2"; as "Framework
region 3" or "FR3"; and as "Framework region 4" or "FR4",
respectively; which framework regions are interrupted by three
complementary determining regions or "CDR's", which are referred to
in the art as "Complementarity Determining Region 1" or "CDR1"; as
"Complementarity Determining Region 2" or "CDR2"; and as
"Complementarity Determining Region 3" or "CDR3", respectively.
Some preferred framework sequences and CDR's (and combinations
thereof) that are present in the Nanobodies.RTM. of the invention
are as described herein.
[0484] Thus, generally, a Nanobody.RTM. can be defined as an amino
acid sequence with the (general) structure
[0485] FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4
in which FR1 to FR4 refer to framework regions 1 to 4,
respectively, and in which CDR2 to CDR3 refer to the
complementarity determining regions 1 to 3, respectively, and in
which one or more of the Hallmark residues are as further defined
herein.
[0486] In this respect, the amino acid sequences of the invention
may essentially consist of 4 framework regions (FR1 to FR4,
respectively) and 3 complementarity determining regions (CDR1 to
CDR3, respectively), in which CDR2 is chosen from: [0487] a) SEQ ID
NO: 102; [0488] b) a stretch of amino acid residues that has no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with SEQ ID NO: 102, provided that:
[0489] i) said stretch of amino acid residues has an Aspartic acid
(Asp, D) at position 5 (position 54 determined according to Kabat
numbering); and [0490] ii) the amino acid sequence comprising said
stretch of amino acid residues binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid
difference.
[0491] These preferred complementarity determining regions (CDR2
sequences) are also referred to as "CDR2(s) of the invention".
[0492] Preferably, the amino acid sequences of the invention may
essentially consist of 4 framework regions (FR1 to FR4,
respectively) and 3 complementarity determining regions (CDR1 to
CDR3, respectively), in which CDR2 is chosen from the group
consisting of: [0493] a) SEQ ID NO: 102; [0494] b) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 102, provided that: [0495] i) said stretch of amino acid
residues has an Aspartic acid (Asp, D) at position 6 (position 54
determined according to Kabat numbering); and [0496] ii) the amino
acid sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino add sequence comprising said stretch of amino acid
residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; and at least one of CDR1 or CDR3 is chosen from: CDR1
chosen from the group consisting of: [0497] c) SEQ ID NO: 98;
[0498] d) a stretch of amino acid residues that has no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with SEQ ID NO: 98, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [0499] and/or [0500] CDR3 chosen from the group
consisting of: [0501] e) SEQ ID NO: 121; [0502] f) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 121, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid
difference.
[0503] Even more preferably, the amino acid sequences of the
invention may essentially consist of 4 framework regions (FR1 to
FR4, respectively) and 3 complementarity determining regions (CDR1
to [0504] CDR3, respectively), in which: CDR1 is chosen from the
group consisting of: [0505] a) SEQ ID NO: 98; [0506] b) a stretch
of amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 98, provided that the ammo acid sequence comprising said
stretch of amino acid residues binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference; or
[0507] and [0508] CDR2 is chosen from the group consisting of:
[0509] c) SEQ ID NO: 102; [0510] d) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
102, provided that: [0511] i) said stretch of amino add residues
has an Aspartic add (Asp, D) at position 6 (position 54 determined
according to Kabat numbering); and [0512] ii) the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [0513] and [0514] CDR3 is chosen from the group
consisting of: [0515] e) SEQ ID NO: 121; [0516] f) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 121, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein P of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid
difference.
[0517] In a specific aspect, the amino acid sequence or
Nanobody.RTM. of the invention comprises at least SEQ ID NO:
102.
[0518] In another specific aspect, the amino acid sequence or
Nanobody.RTM. of the invention comprises at least SEQ ID NO: 102
and at least one stretch of amino acid residues (CDR sequence)
chosen from: [0519] a) SEQ ID NO: 98; [0520] b) a stretch of amino
acid residues that has no more than 3, preferably no more than 2,
more preferably no more than 1 amino acid difference with SEQ ID
NO: 98, provided that the amino acid sequence comprising said
stretch of amino acid residues binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference;
[0521] c) SEQ ID NO: 121; [0522] d) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
121, provided that the amino acid sequence comprising said stretch
of amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference.
[0523] Preferably, the amino acid sequence or Nanobody.RTM. of the
invention comprises at least SEQ ID NO: 102 and at least two
stretches of amino acid residues (CDR sequences) in which one
stretch is chosen from the group consisting of the stretches of
amino acid residues defined in a) and b) and in which the other
stretch is chosen from the group consisting of the stretches of
amino acid residues defined in c) and d).
[0524] In another specific aspect, the amino acid sequence or
Nanobody.RTM. of the invention comprises at least SEQ ID NO: 102
and at least one stretch of amino acid residues (CDR sequence)
chosen from SEQ ID NO: 98 and SEQ ID NO: 121.
[0525] Preferably, the amino acid sequence or Nanobody.RTM. of the
invention comprises SEQ ID NO: 98, SEQ ID NO: 102 and SEQ ID NO:
121.
[0526] Preferred combinations of CDR1, CDR2, and CDR3 sequences are
also shown in Table A-6.
[0527] The amino acid sequences of the invention may essentially
consists of a heavy chain variable domain sequence that is derived
from a conventional four-chain antibody or may essentially consist
of a heavy chain variable domain sequence that is derived from
heavy chain antibody. The amino acid sequences of the invention may
essentially consists of a domain antibody (or an amino acid
sequence that is suitable for use as a domain antibody), of a
single domain antibody (or an amino acid sequence that is suitable
for use as a single domain antibody), of a "dAb" (or an amino acid
sequence that is suitable for use as a dAb) or of a
Nanobody.RTM..
[0528] For a general description of (single) domain antibodies,
reference is also made to the prior art cited above, as well as to
EP 0 368 684. For the term "dAb's", reference is for example made
to Ward et al. (1989, Nature 341: 544-6), to Holt et al., 2003,
Trends Biotechnol. 21: 484-490; as well as to for example WO
06/030220, WO 06/003388 and other published patent applications of
Domantis Ltd. It should also be noted that, although less preferred
in the context of the present invention because they are not of
mammalian origin, single domain antibodies or single variable
domains can be derived from certain species of shark (for example,
the so-called "IgNAR domains", see for example WO 05/18629).
[0529] In particular, the amino acid sequence of the invention may
essentially consist of or may be a Nanobody.RTM. (as defined
herein) or a suitable fragment thereof. [Note: Nanobody.RTM.,
Nanobodies.RTM. and Nanoclone.RTM. are registered trademarks of
Ablynx N.V.]
[0530] A Nanobody.RTM. can be defined as an amino acid sequence
with the (general) structure
FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4
[0531] in which FR1 to FR4 refer to framework regions 1 to 4,
respectively, and in which CDR1 to CDR3 refer to the
complementarity determining regions 1 to 3, respectively, and in
which one or more of the Hallmark residues are as defined in WO
08/020,079 (Tables A-3 to A-8).
[0532] More in particular, a Nanobody.RTM. can be an amino acid
sequence with the (general) structure
FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4
[0533] in which FR1 to FR4 refer to framework regions 1 to 4,
respectively, and in which CDR1 to CDR3 refer to the
complementarity determining regions 1 to 3, respectively, and
which: [0534] i) have at least 80% amino acid identity with at
least one of the amino acid sequences of SEQ ID NO's: 60-76,
138-141 and 146-157 (see Table A-4), in which for the purposes of
determining the degree of amino acid identity, the amino acid
residues that form the CDR sequences are disregarded. In this
respect, reference is also made to Table A-6, which lists the
framework 1 sequences (SEQ ID NO's: 81-97 and 166), framework 2
sequences (SEQ ID NO's: 99-100), framework 3 sequences (SEQ ID
NO's: 103-120 and 167-168) and framework 4 sequences (SEQ ID NO's:
123 and 169) of the Nanobodies.RTM. of SEQ ID NO's: 60-76, 138-141
and 146-157 (see Table A-4); [0535] and in which: [0536] ii)
preferably one or more of the amino acid residues at positions 11,
37, 44, 45, 47, 83, 84, 103, 104 and 108 according to the Kabat
numbering are chosen from the Hallmark residues mentioned in Table
A-3 to Table A-8 of WO 08/020,079.
[0537] For a further general description of Nanobodies.RTM.,
reference is made to the prior art cited herein, such as e.g.
described in WO 08/020,079 (page 16).
[0538] Such Nanobodies.RTM. may be derived in any suitable manner
and from any suitable source, and may for example be naturally
occurring V.sub.HH sequences (i.e. from a suitable species of
Camelid) or synthetic or semi-synthetic amino acid sequences.
[0539] Again, such Nanobodies.RTM. may be derived in any suitable
manner and from any suitable source, and may for example be
naturally occurring V.sub.HH sequences (i.e. from a suitable
species of Camelid) or synthetic or semi-synthetic amino acid
sequences, including but not limited to "humanized" (as defined
herein) Nanobodies.RTM., "camelized" (as defined herein)
immunoglobulin sequences (and in particular camelized heavy chain
variable domain sequences), as well as Nanobodies.RTM. that have
been obtained by techniques such as affinity maturation (for
example, starting from synthetic, random or naturally occurring
immunoglobulin sequences), CDR grafting, veneering, combining
fragments derived from different immunoglobulin sequences, PCR
assembly using overlapping primers, and similar techniques for
engineering immunoglobulin sequences well known to the skilled
person; or any suitable combination of any of the foregoing as
further described herein. Also, when a Nanobody.RTM. comprises a
V.sub.HH sequence, said Nanobody.RTM. may be suitably humanized, as
further described herein, so as to provide one or more further
(partially or fully) humanized Nanobodies.RTM. of the invention.
Similarly, when a Nanobody.RTM. comprises a synthetic or
semi-synthetic sequence (such as a partially humanized sequence),
said Nanobody.RTM. may optionally be further suitably humanized,
again as described herein, again so as to provide one or more
further (partially or fully) humanized Nanobodies.RTM. of the
invention.
[0540] In particular, humanized Nanobodies.RTM. may be amino acid
sequences that are as generally defined for Nanobodies.RTM. in the
previous paragraphs, but in which at least one amino acid residue
is present (and in particular, in at least one of the framework
residues) that is and/or that corresponds to a humanizing
substitution (as defined herein). Some preferred, but non-limiting
humanizing substitutions (and suitable combinations thereof) will
become clear to the skilled person based on the disclosure herein.
In addition, or alternatively, other potentially useful humanizing
substitutions can be ascertained by comparing the sequence of the
framework regions of a naturally occurring V.sub.HH sequence with
the corresponding framework sequence of one or more closely related
human V.sub.H sequences, after which one or more of the potentially
useful humanizing substitutions (or combinations thereof) thus
determined can be introduced into said V.sub.HH sequence (in any
manner known per se, as further described herein) and the resulting
humanized V.sub.HH sequences can be tested for affinity for the
target, for stability, for ease and level of expression, and/or for
other desired properties. In this way, by means of a limited degree
of trial and error, other suitable humanizing substitutions (or
suitable combinations thereof) can be determined by the skilled
person based on the disclosure herein. Also, based on the
foregoing, (the framework regions of) a Nanobody.RTM. may be
partially humanized or fully humanized.
[0541] In this respect, some preferred Nanobodies.RTM. of the
invention are Nanobodies.RTM. which specifically bind (as further
defined herein) protein F of hRSV and which: [0542] i) are a
humanized variant of the amino acid sequence with SEQ ID NO: 5 (see
Table A-1); and/or [0543] ii) have at least 80% amino acid identity
with at least one of the amino acid sequences of SEQ ID NO: 5 (see
Table A-1) and/or at least one of the amino acid sequences of SEQ
ID NO's: 60-76, 138-141 and 146-157 (see Table A-4), in which for
the purposes of determining the degree of amino acid identity, the
amino acid residues that form the CDR sequences are disregarded;
and in which: [0544] iii) preferably one or more of the amino acid
residues at positions 11, 37, 44, 45, 47, 83, 84, 103, 104 and 108
according to the Kabat numbering are chosen from the Hallmark
residues mentioned in Table A-3 to Table A-8 of WO 08/020,079.
[0545] The present invention provides a number of humanized and/or
sequence optimized amino acid sequences and/or Nanobodies.RTM. that
are particularly suited for binding protein F of hRSV. Therefore,
in one aspect of the present invention, amino acid sequences and/or
Nanobodies.RTM. are provided chosen from the following: [0546] a)
SEQ ID NO's: 60-76; [0547] b) amino acid sequences that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 60-76,
provided that: [0548] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105 (said position determined according to
Kabat numbering); and [0549] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference.
[0550] In a preferred aspect, the amino acid sequence and/or
Nanobody.RTM. of the invention comprises or essentially consists of
one of SEQ ID NO's: 60-76.
[0551] In another aspect, the present invention provides amino acid
sequences and/or Nanobodies.RTM. chosen from the following: [0552]
a) SEQ ID NO's: 62, 65, 67, 68, 75 and 76; [0553] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 62, 65, 67, 68, 75 and 76, provided that: [0554] i) the amino
acid sequence has a Glutamine (Gln, Q) at position 105, a Leucine
(Leu, L) at position 78 and/or an Arginine (Arg, R) at position 83
(said positions determined according to Kabat numbering); and
[0555] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference.
[0556] In a preferred aspect, the amino acid sequences and/or
Nanobodies.RTM. are chosen from the following: [0557] a) SEQ ID
NO's: 62, 65, 67, 68, 75 and 76; [0558] b) amino acid sequences
that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 62, 65, 67, 68, 75 and 76, provided that: [0559] i) the amino
acid sequence has a Glutamine (Gln, Q) at position 105, a Leucine
(Leu, L) at position 78 and an Arginine (Arg, R) at position 83
(said positions determined according to Kabat numbering); and
[0560] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference.
[0561] Preferred amino acid sequences and/or Nanobodies.RTM. of the
invention comprise or essentially consist of one of SEQ ID NO's:
62, 65, 67, 68, 75 and 76.
[0562] In yet another aspect, the present invention provides amino
acid sequences and/or Nanobodies.RTM. chosen from the following:
[0563] a) SEQ ID NO's: 65 and 76; [0564] b) amino acid sequences
that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 65 and 76, provided that: [0565] i) the amino acid sequence
has an Aspartic acid (Asp, D) at position 54, a Glutamine (Gln, Q)
at position 105, a Leucine (Leu, L) at position 78 and/or an
Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [0566] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference.
[0567] In a preferred aspect, the amino acid sequences and/or
Nanobodies.RTM. are chosen from the following: [0568] a) SEQ ID
NO's: 65 and 76; [0569] b) amino acid sequences that have no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with one of SEQ ID NO's: 65 and 76, provided
that: [0570] i) the amino acid sequence has an Aspartic acid (Asp,
D) at position 54, a Glutamine (Gln, Q) at position 105, a Leucine
(leu, L) at position 78 and an Arginine (Arg, R) at position 83
(said positions determined according to Kabat numbering); and
[0571] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference.
[0572] Preferably, the amino acid sequence and/or Nanobody.RTM. of
the invention comprises or essentially consists of SEQ ID NO: 65.
In another preferred aspect, the amino acid sequence and/or
Nanobody.RTM. of the invention comprises or essentially consists of
SEQ ID NO: 76. In another preferred aspect, the amino acid sequence
and/or Nanobody.RTM. of the invention comprises or essentially
consists of SEQ ID NO: 76.
[0573] The present invention also provides a number of humanized
and/or sequence optimized amino acid sequences and/or
Nanobodies.RTM. that are chosen from the following: [0574] a) SEQ
ID NO's: 146-153; [0575] b) amino acid sequences that have no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with one of SEQ ID NO's: 146-153, provided
that: [0576] i) the amino acid sequence has a Proline (Pro, P) at
position 14, Arginine (Arg, R) at position 19, Leucine (Leu, L) at
position 20 and/or Leucine (Leu, L) at position 108 (said positions
determined according to Kabat numbering); and [0577] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference.
[0578] In a preferred aspect, the amino acid sequence and/or
Nanobody.RTM. of the invention comprises or essentially consists of
one of SEQ ID NO's: 146-453.
[0579] In another aspect, the present invention provides amino acid
sequences and/or Nanobodies.RTM. chosen from the following: [0580]
a) SEQ ID NO's: 146-149 and 151-153; [0581] b) amino acid sequences
that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 146-149 and 151-153, provided that: [0582] i) the amino acid
sequence has a Proline (Pro, P) at position 14, Arginine (Arg, R)
at position 19, Leucine (Leu, L) at position 20 and/or Leucine
(Leu, L) at position 108; and in addition Arginine (Arg, R) at
position 83, Glutamic acid (Glu, E) at position 85 and/or Glutamine
(Gln, Q) at position 105; [0583] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference.
[0584] In a preferred aspect, the amino acid sequences and/or
Nanobodies.RTM. are chosen from the following: [0585] a) SEQ ID
NO's: 146-149 and 151-153; [0586] b) amino acid sequences that have
no more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 146-149 and
151-153, provided that: [0587] i) the amino acid sequence has a
Praline (Pro, P) at position 14, Arginine (Arg, R) at position 19,
Leucine (Leu, L) at position 20 and/or Leucine (Leu, L) at position
108 and in addition Arginine (Arg, R) at position 83, Glutamic acid
(Glu, E) at position 85 and/or Glutamine (Gln, Q) at position 105
so that when the amino acid sequence has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with: [0588] SEQ ID NO: 146, the amino acid sequence
preferably has Glutamine (Gln, Q) at position 105; [0589] SEQ ID
NO: 147, the amino acid sequence preferably has Arginine (Arg, R)
at position 83 and Glutamine (Gln, Q) at position 105; [0590] SEQ
ID NO: 148, the amino acid sequence preferably has Glutamic acid
(Glu, E) at position 85 and Glutamine (Gln, Q) at position 105;
[0591] SEQ ID NO: 149, the amino acid sequence preferably has
Arginine (Arg, R) at position 83, Glutamic acid (Glu, E) at
position 85 and Glutamine (Gln, Q) at position 105; [0592] SEQ ID
NO: 151, the amino acid sequence preferably has Arginine (Arg, R)
at position 83; [0593] SEQ ID NO: 152, the amino acid sequence
preferably has Glutamic acid (Glu, E) at position 85; [0594] SEQ ID
NO: 153, the amino acid sequence preferably has Arginine (Arg, R)
at position 83 and Glutamic acid (Glu, E) at position 85; [0595]
(said positions determined according to Kabat numbering); and
[0596] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference.
[0597] Preferred amino acid sequences and/or Nanobodies.RTM. of the
invention comprise or essentially consist of one of SEQ ID NO's:
146-149 and 151-153.
[0598] The amino acid sequences and/or Nanobodies.RTM. of the
present invention show reduced immunogenicity upon administration
to a human subject. In addition, the amino acid sequences and/or
Nanobodies.RTM. of the present invention show improved binding
characteristics (suitably measured and/or expressed as a
K.sub.D-value (actual or apparent), a K.sub.A-value (actual or
apparent), a k.sub.on-rate and/or a k.sub.off-rate, or
alternatively as an IC.sub.50 value, as further described herein)
for protein F of hRSV compared to their corresponding parental
amino acid sequences (as described in PCT application
PCT/EP2009/056975 entitled "Amino acid sequences directed against
envelope proteins of a virus and polypeptides comprising the same
for the treatment of viral diseases" filed by Ablynx N.V on 5 Jun.
2009).
[0599] During the production of the Nanobodies of the invention, a
high level of pyro glutamate (pGlu) on the amino terminus was
detected by RP-HPLC. Levels of more than 15% pGlu were detected
following fermentation and the level of pGlu were steadily
increasing upon storage during stability studies. Such a
modification leads to heterogeneity of the final product and needs
to be avoided. The control/prevention of pGlu formation is
therefore critical to keep therapeutic proteins within their set
specifications. Specific liquid formulations and/or storage
conditions are needed for proteins with an N-terminal Glutamic acid
thus minimizing the formation of pyro-Glutamic acid.
[0600] In the present invention, the possibility of pGlu
post-translational modification of the N-terminus was eliminated by
changing the N-terminal Glutamic acid (E) [HOOC--(CH2)2-protein]
into an Aspartic acid (D) [HOOC--CH2-protein] which lead to
increased product stability. Accordingly, the present invention
also relates to amino acid sequences and Nanobodies as described
above wherein the Glutamic acid at position 1 (said position
determined according to Kabat numbering) is changed into an
Aspartic acid.
[0601] The present invention provides a number of sequence
optimized amino acid sequences and/or Nanobodies.RTM. that show
increased stability upon storage during stability studies.
Therefore, in one aspect of the present invention, amino acid
sequences and/or Nanobodies.RTM. are provided chosen from the
following: [0602] a) SEQ ID NO's: 138-141 and 154-157; [0603] b)
amino acid sequences that have no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
one of SEQ ID NO's: 138-141 and 154-157, provided that: [0604] i)
the amino acid sequence has a Aspartic acid (Asp, D) at position 1
(said position determined according to Kabat numbering); and [0605]
ii) the amino acid sequence binds protein E of hRSV with the same,
about the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence without the 3, 2 or 1 amino
acid difference.
[0606] In a preferred aspect, the amino acid sequence and/or
Nanobody.RTM. of the invention comprises or essentially consists of
one of SEQ ID NO's: 138-141 and 154-157.
[0607] In another aspect, the amino acid sequences and/or
Nanobodies.RTM. of the invention comprise or essentially consist of
SEQ ID NO: 5, wherein position 1 (Glu) has been changed into
Asp.
[0608] In another aspect, the amino acid sequences and/or
Nanobodies.RTM. of the invention comprise or essentially consist of
SEQ ID NO: 62, wherein position 1 (Glu) has been changed into
Asp.
[0609] In another aspect, the amino acid sequences and/or
Nanobodies.RTM. of the invention comprise or essentially consist of
SEQ ID NO: 65, wherein position 1 (Glu) has been changed into
Asp.
[0610] In another aspect, the amino add sequences and/or
Nanobodies.RTM. of the invention comprise or essentially consist of
SEQ ID NO: 76, wherein position 1 (Glu) has been changed into
Asp.
[0611] In another aspect, the amino acid sequences and/or
Nanobodies.RTM. of the invention comprise or essentially consist of
one of SEQ ID NO's: 146-453, wherein position 1 (Glu) has been
changed into Asp.
[0612] Preferably, the amino acid sequence and/or Nanobody.RTM. of
the invention comprises or essentially consists of SEQ ID NO: 138.
In another preferred aspect, the amino acid sequence and/or
Nanobody.RTM. of the invention comprises or essentially consists of
SEQ ID NO: 139. In another preferred aspect, the amino acid
sequence and/or Nanobody.RTM. of the invention comprises or
essentially consists of SEQ ID NO: 140. In another preferred
aspect, the amino acid sequence and/or Nanobody.RTM. of the
invention comprises or essentially consists of SEQ ID NO: 141. In
another preferred aspect, the amino acid sequence and/or
Nanobody.RTM. of the invention comprises or essentially consists of
one of SEQ ID NO's: 154-157.
[0613] In another aspect, the amino acid sequences and/or
Nanobodies.RTM. of the invention comprise or essentially consist of
SEQ ID NO: 5, wherein one or more (such as two, three, four, five,
six, seven, eight, nine, ten, eleven or twelve) amino acid residues
have been mutated selected from the following: Val5Leu, Ala14Pro,
Ser19Arg, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp.
[0614] In another aspect, the amino acid sequences and/or
Nanobodies.RTM. of the invention comprise or essentially consist of
SEQ ID NO: 5, wherein one or more (such as two, three, four, five,
six, seven, eight or nine) amino acid residues have been mutated
selected from the following: Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp.
[0615] In another aspect, the amino acid sequences and/or
Nanobodies.RTM. of the invention comprise or essentially consist of
SEQ ID NO: 5, wherein one or more (such as two, three or four)
amino acid residues have been mutated selected from the following:
Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu.
[0616] In another aspect, the amino acid sequences and/or
Nanobodies.RTM. of the invention comprise or essentially consist of
SEQ ID NO: 5, wherein one or more (such as two, three, four, five,
six or seven) amino acid residues have been mutated selected from
the following: Ala14Pro, Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu.
[0617] In another aspect, the amino acid sequences and/or
Nanobodies.RTM. of the invention comprise or essentially consist of
SEQ ID NO: 5, wherein one or more (such as two, three, four, five,
six, seven, eight, nine, ten, eleven or twelve) amino acid residues
have been mutated selected from the following: Val5Leu, Ala14Pro,
Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp, and wherein position 1 (Glu) has
been changed into Asp.
[0618] In another aspect, the amino acid sequences and/or
Nanobodies.RTM. of the invention comprise or essentially consist of
SEQ ID NO: 5, wherein one or more (such as two, three, four, five,
six, seven, eight or nine) amino acid residues have been mutated
selected from the following: Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp, and wherein
position 1 (Glu) has been changed into Asp.
[0619] In another aspect, the amino acid sequences and/or
Nanobodies.RTM. of the invention comprise or essentially consist of
SEQ ID NO: 5, wherein one or more (such as two, three or four)
amino acid residues have been mutated selected from the following:
Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu, and wherein position 1
(Glu) has been changed into Asp.
[0620] In another aspect, the amino acid sequences and/or
Nanobodies.RTM. of the invention comprise or essentially consist of
SEQ ID NO: 5, wherein one or more (such as two, three, four, five,
six or seven) amino acid residues have been mutated selected from
the following: Ala14Pro, Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu, and wherein position 1 (Glu) has been
changed into Asp.
[0621] Preferably, the amino acid sequence and/or Nanobody.RTM. of
the invention comprises or essentially consist of SEQ ID NO: 5,
wherein following amino acid residues have been mutated: [0622]
Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu; [0623] Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu; [0624] Gly78Leu, Ala83Arg, Asp85Glu and Arg105Gln;
[0625] Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp; [0626] Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp; [0627] Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gly54Asp; [0628] Gly54Asp; [0629] Ala14Pro,
Ser19Arg, Ile20Leu and Gln108Leu; [0630] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Ala83Arg; [0631] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Asp85Glu; [0632] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Arg105Glu; [0633] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg and Asp85Glu; [0634] Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln; [0635]
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and Arg105Gln;
[0636] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu
and Arg105Gln; [0637] Glu1Asp; [0638] Glu1Asp, Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu;
[0639] Glu1Asp, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu; [0640]
Glu1Asp, Gly78Leu, Ala83Arg, Asp85Glu and Arg105Gln; [0641]
Glu1Asp, Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp; [0642] Glu1Asp, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp; [0643] Glu1Asp,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54Asp; [0644]
Glu1Asp and Gly54Asp; [0645] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu
and Gln108Leu; [0646] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Ala83Arg; [0647] Glu1Asp, Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Asp85Glu; [0648] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu and Arg105Gln; [0649] Glu1Asp,
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Asp85Glu;
[0650] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg
and Arg105Gln; [0651] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Asp85Glu and Arg105Gln; or [0652] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu and
Arg105Gln.
[0653] The amino acid sequences and/or Nanobodies.RTM. of the
present invention show improved properties such as e.g. improved
stability, less immunogenicity, improved binding characteristics
(suitably measured and/or expressed as a K.sub.r-value (actual or
apparent), a K.sub.A-value (actual or apparent), a k.sub.on-rate
and/or a k.sub.off-rate, or alternatively as an IC.sub.50 value, as
further described herein), improved affinity and/or improved
avidity for protein F of hRSV and/or improved efficacy and/or
potency for neutralizing hRSV compared to their corresponding wild
type amino acid sequences (as described in PCT application
PCT/EP2009/056975 entitled "Amino acid sequences directed against
envelope proteins of a virus and polypeptides comprising the same
for the treatment of viral diseases" filed by Ablynx N.V on 5 Jun.
2009).
[0654] More in particular, the amino acid sequences and/or
Nanobodies.RTM. of the invention can bind to protein F of hRSV with
an affinity (suitably measured and/or expressed as a K.sub.D-value
(actual or apparent), a K.sub.A-value (actual or apparent), a
k.sub.on-rate and/or a k.sub.off-rate, or alternatively as an
IC.sub.50 value, as further described herein) preferably such that
they: [0655] bind to protein F of hRSV with a dissociation constant
(K.sub.D) of 1000 nM to 1 nM or less, preferably 100 nM to 1 nM or
less, more preferably 15 nM to 1 nM or even 10 nM to 1 nM or less;
and/or such that they: [0656] bind to protein F of hRSV with a
k.sub.on-rate of between 10.sup.4 M.sup.-1s.sup.-1 to about
10.sup.7 preferably between 10.sup.5 M.sup.-1s.sup.-1 and 10.sup.7
M.sup.-1s.sup.-1, more preferably about 10.sup.6 M.sup.-1s.sup.-1
or more; and/or such that they: [0657] bind to protein F of hRSV
with a k.sub.off-rate between 10.sup.-2s.sup.-1 (t.sub.1/2=0.69 s)
and 10.sup.-4 s.sup.-1 (providing a near irreversible complex with
a t.sub.1/2 of multiple days), preferably between 10.sup.-3
s.sup.-1 and 10.sup.-4 s.sup.-1, or lower;
[0658] Some preferred IC50 values for binding of the amino acid
sequences of the invention to protein F of hRSV will become clear
from the further description and examples herein.
[0659] Assays to determine the IC50 include competition assays such
as competition ELISA (e.g. competition with Synagis.RTM. or its Fab
fragment) or more preferably neutralization assays such as the
microneutraiization assay described by Anderson et al. (1985, J.
Olin. Microbiol. 22: 1050-1052; 1988, J. Virol. 62: 4232-4238),
modifications of this assay such as e.g. described in Example 6, or
a plaque reduction assay as for example described by Johnson et al.
(1997, J. Inf. Dis. 176: 1215-1224), and modifications thereof.
[0660] For example, in a competition assay with the Fab fragment of
Synagis.RTM., the amino acid sequences of the invention may have
IC50 values between 1 nM and 100 nM, preferably between 10 nM and
50 nM, or less.
[0661] For example, in a microneutralization assay on hRSV Long
(such as e.g. described in Example 6) the amino acid sequences of
the invention may have IC50 values between 100 nM and 1000 nM,
preferably between 100 nM and 500 nM, or less.
[0662] The amino acid sequences and Nanobodies.RTM. provided by the
invention are preferably in essentially isolated form (as defined
herein), or form part of a polypeptide of the invention (also
referred to as "polypeptide of the invention" or "construct of the
invention"; both are used interchangeably), which may comprise or
essentially consist of one or more amino acid sequences or
Nanobodies.RTM. of the invention and which may optionally further
comprise one or more further amino acid sequences or
Nanobodies.RTM. (all optionally linked via one or more suitable
linkers).
[0663] Accordingly, in another aspect, the invention relates to a
polypeptide (also referred to herein as a "polypeptide of the
invention") that comprises or essentially consists of one or more
amino acid sequences or Nanobodies.RTM. of the invention (or
suitable fragments thereof).
[0664] The process of designing/selecting and/or preparing a
polypeptide of the invention, starting from an amino acid sequence
or Nanobody.RTM. of the invention, is also referred to herein as
"formatting" said amino acid sequence or Nanobody.RTM. of the
invention; and an amino acid sequence or Nanobody.RTM. of the
invention that is made part of a polypeptide of the invention is
said to be "formatted" or to be "in the format of" said polypeptide
of the invention. Examples of ways in which an amino acid sequence
or Nanobody.RTM. of the invention can be formatted and examples of
such formats will be clear to the skilled person based on the
disclosure herein; and such formatted amino acid sequences or
Nanobodies.RTM. form a further aspect of the invention.
[0665] For example, and without limitation, the one or more amino
acid sequences or Nanobodies.RTM. of the invention may be used as a
binding unit in such a polypeptide, which may optionally contain
one or more further amino add sequences that can serve as a binding
unit (i.e. against the same or another epitope on protein F of hRSV
and/or against one or more other antigens, proteins or targets than
protein F of hRSV), so as to provide a monovalent, multivalent,
multiparatopic or multispecific polypeptide of the invention,
respectively, all as described herein. The present invention thus
also relates to a polypeptide which is a monovalent polypeptide or
construct comprising or essentially consisting of an amino acid
sequence or Nanobody.RTM. of the invention. The present invention
thus also relates to a polypeptide which is a multivalent
polypeptide or construct, such as e.g. a bivalent or trivalent
polypeptide or construct. The present invention also relates to a
polypeptide which is a multispecific polypeptide or construct, such
as e.g. a bispecific or trispecific polypeptide or construct. The
present invention also relates to a polypeptide which is a
multiparatopic polypeptide or construct, such as e.g. a
bisparatopic or triparatopic polypeptide or construct.
[0666] Accordingly, in a preferred, but non-limiting aspect, the
amino acid sequence or Nanobody.RTM. of the invention comprises at
least one further amino acid sequence or Nanobody.RTM., so as to
provide a polypeptide of the invention that comprises at least two,
such as two, three, four, five or more amino acid sequences or
Nanobodies.RTM., in which said amino acid sequences or
Nanobodies.RTM. may optionally be linked via one or more linker
sequences (as defined herein). Polypeptides of the invention that
comprise two or more amino acid sequences or Nanobodies.RTM., of
which at least one, and preferably all, is/are an amino acid
sequence or Nanobody.RTM. of the invention, will also be referred
to herein as "multivalent" polypeptides of the invention, and the
amino acid sequences or Nanobodies.RTM. present in such
polypeptides will also be referred to herein as being in a
"multivalent format". For example a "bivalent" polypeptide of the
invention comprises two amino acid sequences and/or
Nanobodies.RTM., optionally linked via a linker sequence, whereas a
"trivalent" polypeptide of the invention comprises three amino acid
sequences and/or Nanobodies.RTM., optionally linked via two linker
sequences; etc.; in which at least one of the amino acid sequences
and/or Nanobodies.RTM. present in the polypeptide, and up to all of
the amino acid sequences and/or Nanobodies.RTM. present in the
polypeptide, is/are a amino acid sequences and/or Nanobodies.RTM.
of the invention.
[0667] In a multivalent polypeptide of the invention, the two or
more amino acid sequences or Nanobodies.RTM. may be the same or
different, and may be directed against the same antigen or
antigenic determinant (for example against the same part(s) or
epitope(s) or against different parts or epitopes) or may
alternatively be directed against different antigens or antigenic
determinants; or any suitable combination thereof. For example, a
bivalent polypeptide of the invention may comprise (a) two
identical amino acid sequences or Nanobodies.RTM.; (b) a first
amino acid sequence or Nanobody.RTM. directed against a first
antigenic determinant of a protein or antigen and a second amino
acid sequence or Nanobody.RTM. directed against the same antigenic
determinant of said protein or antigen which is different from the
first amino acid sequence or Nanobody.RTM.; (c) a first amino acid
sequence or Nanobody.RTM. directed against a first antigenic
determinant of a protein or antigen and a second amino acid
sequence or Nanobody.RTM. directed against another antigenic
determinant of said protein or antigen; or (d) a first amino acid
sequence or Nanobody.RTM. directed against a first protein or
antigen and a second amino acid sequence or Nanobody.RTM. directed
against a second protein or antigen (i.e. different from said first
antigen). Similarly, a trivalent polypeptide of the invention may,
for example and without being limited thereto, comprise (a) three
identical amino acid sequences or Nanobodies.RTM.; (b) two
identical amino acid sequences or Nanobody.RTM. against a first
antigenic determinant of an antigen and a third amino acid sequence
or Nanobody.RTM. directed against a different antigenic determinant
of the same antigen; (c) two identical amino acid sequences or
Nanobodies.RTM. against a first antigenic determinant of an antigen
and a third amino acid sequence or Nanobody.RTM. directed against a
second antigen different from said first antigen; (d) a first amino
acid sequence or Nanobody.RTM. directed against a first antigenic
determinant of a first antigen, a second amino acid sequence or
Nanobody.RTM. directed against a second antigenic determinant of
said first antigen and a third amino acid sequence or Nanobody.RTM.
directed against a second antigen different from said first
antigen; or (e) a first amino acid sequence or Nanobody.RTM.
directed against a first antigen, a second amino acid sequence or
Nanobody.RTM. directed against a second antigen different from said
first antigen, and a third amino acid sequence or Nanobody.RTM.
directed against a third antigen different from said first and
second antigen.
[0668] In a preferred aspect, the invention provides a multivalent,
preferably a bivalent or trivalent polypeptide comprising or
essentially consisting of at least two (preferably identical) amino
acid sequences or Nanobodies.RTM. of the invention (as described
above).
[0669] In one aspect, the invention provides a multivalent,
preferably a bivalent or trivalent polypeptide comprising or
essentially consisting of at least two (preferably identical) or at
least three (preferably identical) amino acid sequences or
Nanobodies.RTM. chosen from amino acid sequences that comprise at
least a stretch of amino acid residues chosen from the following:
[0670] a) SEQ ID NO: 102; [0671] b) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
102, provided that: [0672] i) said stretch of amino acid residues
has an Aspartic acid (Asp, D) at position 6 (position 54 determined
according to Kabat numbering); and [0673] ii) the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference.
[0674] In another aspect, the invention provides a multivalent,
preferably a bivalent or trivalent polypeptide comprising or
essentially consisting of at least two (preferably identical) or at
least three (preferably identical) amino acid sequences or
Nanobodies.RTM. chosen from amino acid sequences that comprise two
or more stretches of amino acid residues in which one stretch is
chosen from the following: [0675] a) SEQ ID NO: 102; [0676] b) a
stretch of amino acid residues that has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with SEQ ID NO: 102, provided that: [0677] i) said
stretch of amino acid residues has an Aspartic acid (Asp, D) at
position 6 (position 54 determined according to Kabat numbering);
and [0678] ii) the amino acid sequence comprising said stretch of
amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference; [0679] and at least
one stretch is chosen from: [0680] c) SEQ ID NO: 98; [0681] d) a
stretch of amino acid residues that has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with SEQ ID NO: 98, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [0682] e) SEQ ID NO: 121; and [0683] f) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 121, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference.
[0684] such that the stretch of amino acid residues that
corresponds to one of a), and b) should always be present in the
amino acid sequence that forms part of the multivalent polypeptide
and such that the second stretch of amino acid residues is chosen
from one of c), d), e) and f).
[0685] Preferred multivalent (such as bivalent or trivalent)
polypeptides may comprise or essentially consist of at least two
(preferably identical) or at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. chosen from amino acid
sequences that comprise three or more stretches of amino acid
residues, in which the first stretch of amino acid residues is
chosen from the group consisting of: [0686] a) SEQ ID NO: 98;
[0687] b) a stretch of amino acid residues that has no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with SEQ ID NO: 98, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; the second stretch of amino acid residues is chosen
from the group consisting of: [0688] c) SEQ ID NO: 102; [0689] d) a
stretch of amino acid residues that has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with SEQ ID NO: 102, provided that: [0690] i) said
stretch of amino acid residues has an Aspartic acid (Asp, D) at
position 6 (position 54 determined according to Kabat numbering);
and [0691] ii) the amino acid sequence comprising said stretch of
amino acid residues binds protein of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence comprising said
stretch of amino acid residues has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence comprising said stretch of amino acid residues without the
3, 2 or 1 amino acid difference; and the third stretch of amino
acid residues is chosen from the group consisting of: [0692] e) SEQ
ID NO: 121; [0693] f) a stretch of amino add residues that has no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with SEQ ID NO: 121, provided that the
amino acid sequence comprising said stretch of amino acid residues
binds protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference.
[0694] In yet another aspect, the invention provides a multivalent,
preferably a bivalent or trivalent polypeptide comprising or
essentially consisting of at least two (preferably identical) or at
least three (preferably identical) amino acid sequences or
Nanobodies.RTM. that essentially consist of 4 framework regions
(FR1 to FR4, respectively) and 3 complementarity determining
regions (CDR1 to CDR3, respectively), in which CDR2 is chosen from:
[0695] a) SEQ ID NO: 102; [0696] b) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
102, provided that: [0697] i) said stretch of amino acid residues
has an Aspartic acid (Asp, D) at position 6 (position 54 determined
according to Kabat numbering); and [0698] ii) the amino acid
sequence comprising said stretch of amino acid residues binds
protein of hRSV with the same, about the same, or a higher affinity
(said affinity as measured by surface plasmon resonance) and/or the
amino acid sequence comprising said stretch of amino acid residues
has the same, about the same, or a higher potency (as defined
herein) compared to the amino acid sequence comprising said stretch
of amino acid residues without the 3, 2 or 1 amino acid
difference.
[0699] In yet another aspect, the invention provides a multivalent,
preferably a bivalent or trivalent polypeptide comprising or
essentially consisting of at least two (preferably identical) or at
least three (preferably identical) amino acid sequences or
Nanobodies.RTM. that essentially consist of 4 framework regions
(FR1 to FR4, respectively) and 3 complementarity determining
regions (CDR1 to CDR3, respectively), in which CDR2 is chosen from
the group consisting of: [0700] a) SEQ ID NO: 102; or [0701] b) a
stretch of amino acid residues that has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with SEQ ID NO: 102, provided that: [0702] i) said
stretch of amino acid residues has an Aspartic acid (Asp, D) at
position 6 (position 54 determined according to Kabat numbering);
and [0703] ii) the amino acid sequence comprising said stretch of
amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference; [0704] and at least
one of CDR1 or CDR3 is chosen from: [0705] CDR1 chosen from the
group consisting of: [0706] c) SEQ ID NO: 98; [0707] d) a stretch
of amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 98, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference;
[0708] CDR3 chosen from the group consisting of: [0709] e) SEQ ID
NO: 121; or [0710] f) a stretch of amino acid residues that has no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with SEQ ID NO: 121, provided that the
amino acid sequence comprising said stretch of amino acid residues
binds protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference.
[0711] Preferably, multivalent (such as bivalent or trivalent)
polypeptides may comprise or essentially consist of at least two
(preferably identical) or at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. that essentially consist of
4 framework regions (FR1 to FR4, respectively) and 3
complementarity determining regions (CDR1 to CDR3, respectively),
in which: CDR1 is chosen from the group consisting of: [0712] a)
SEQ ID NO: 98; [0713] b) a stretch of amino acid residues that has
no more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with SEQ ID NO: 98, provided that the
amino acid sequence comprising said stretch of amino acid residues
binds protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [0714] and [0715] CDR2 is chosen from the group
consisting of: [0716] c) SEQ ID NO: 102; or [0717] d) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 102, provided that: [0718] i) said stretch of amino acid
residues has an Aspartic acid (Asp, D) at position 6 (position 54
determined according to Kabat numbering); and [0719] ii) the amino
acid sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; and [0720] CDR3 is chosen from the group consisting of:
[0721] e) SEQ ID NO: 121; [0722] f) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
121, provided that the amino acid sequence comprising said stretch
of amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference.
[0723] In a specific aspect, the multivalent (such as bivalent or
trivalent) polypeptides may comprise or essentially consist of at
least two (preferably identical) or at least three (preferably
identical) amino acid sequences or Nanobodies.RTM. that comprise at
least SEQ ID NO: 102.
[0724] In another specific aspect, the multivalent (such as
bivalent or trivalent) polypeptides may comprise or essentially
consist of at least two (preferably identical) or at least three
(preferably identical) amino acid sequences or Nanobodies.RTM. that
comprise at least SEQ ID NO: 102 and at least one stretch of amino
acid residues (CDR sequence) chosen from: [0725] c) SEQ ID NO: 98;
[0726] d) a stretch of amino acid residues that has no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with SEQ ID NO: 98, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [0727] e) SEQ ID NO: 121; [0728] f) a stretch of amino
acid residues that has no more than 3, preferably no more than 2,
more preferably no more than 1 amino acid difference with SEQ ID
NO: 121, provided that the amino acid sequence comprising said
stretch of amino acid residues binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid
difference.
[0729] Preferred multivalent (such as bivalent or trivalent)
polypeptides may comprise or essentially consist of at least two
(preferably identical) or at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. that comprise at least SEQ
ID NO: 102 and at least two stretches of amino acid residues (CDR
sequences) in which one stretch is chosen from the group consisting
of the stretches of amino acid residues defined in c) and d) and in
which the other stretch is chosen from the group consisting of the
stretches of amino acid residues defined in e) and f).
[0730] In a specific aspect, the multivalent (such as bivalent or
trivalent) polypeptides may comprise or essentially consist of at
least two (preferably identical) or at least three (preferably
identical) amino acid sequences or Nanobodies.RTM. that comprise at
least SEQ ID NO: 102 and at least one stretch of amino acid
residues (CDR sequence) chosen from SEQ ID NO: 98 and SEQ ID NO:
121; or amino acid sequences or Nanobodies.RTM. that comprise at
least SEQ ID NO: 98, SEQ ID NO: 102 and SEQ ID NO: 121.
[0731] In another preferred aspect, the invention provides a
multivalent, preferably a trivalent polypeptide comprising or
essentially consisting of at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. of the invention (as
described above). In another preferred aspect, the invention
provides a bivalent polypeptide comprising or essentially
consisting of two (preferably identical) amino acid sequences or
Nanobodies.RTM. of the invention (as described above). In another
preferred aspect, the invention provides a trivalent polypeptide
comprising or essentially consisting of three (preferably
identical) amino acid sequences or Nanobodies.RTM. of the invention
(as described above).
[0732] The invention also provides a multivalent, preferably a
bivalent or trivalent polypeptide comprising or essentially
consisting of at least two (preferably identical) amino acid
sequences or Nanobodies.RTM. chosen from the following: [0733] a)
SEQ ID NO's: 60-76; [0734] b) amino acid sequences that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 60-76,
provided that: [0735] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105 (said position determined according to
Kabat numbering); and [0736] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference.
[0737] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least two
identical amino acid sequences or Nanobodies.RTM. chosen from one
of SEQ ID NO's: 60-76.
[0738] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least two (preferably
identical) amino acid sequences or Nanobodies.RTM. chosen from the
following: [0739] a) SEQ ID NO's: 62, 65, 67, 68, 75 and 76; [0740]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76, provided that:
[0741] i) the amino acid sequence has a Glutamine (Gln, Q) at
position 105, a Leucine (Leu, L) at position 78 and/or an Arginine
(Arg, R) at position 83 (said positions determined according to
Kabat numbering); and [0742] ii) the amino add sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference.
[0743] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least two (preferably
identical) amino acid sequences or Nanobodies.RTM. chosen from the
following: [0744] a) SEQ ID NO's: 62, 65, 67, 68, 75 and 76; [0745]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76, provided that:
[0746] i) the amino acid sequence has a Glutamine (Gln, Q) at
position 105, a Leucine (Leu, L) at position 78 and an Arginine
(Arg, R) at position 83 (said positions determined according to
Kabat numbering); and [0747] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference.
[0748] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least two
identical amino acid sequences or Nanobodies.RTM. chosen from one
of SEQ ID NO's: 62, 65, 67, 68, 75 and 76.
[0749] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least two (preferably
identical) amino acid sequences or Nanobodies.RTM. chosen from the
following: [0750] a) SEQ ID NO's: 65 and 76; [0751] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 65 and 76, provided that: [0752] i) the amino acid sequence
has an Aspartic acid (Asp, D) at position 54, a Glutamine (Gln, Q)
at position 105, a Leucine (Leu, L) at position 78 and/or an
Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [0753] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference.
[0754] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least two (preferably
identical) amino acid sequences or Nanobodies.RTM. chosen from the
following: [0755] a) SEQ ID NO's: 65 and 76; [0756] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 65 and 76, provided that: [0757] i) the amino acid sequence
has an Aspartic acid (Asp, D) at position 54, a Glutamine (Gln, Q)
at position 105, a Leucine (Leu, L) at position 78 and an Arginine
(Arg, R) at position 83 (said positions determined according to
Kabat numbering); and [0758] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference.
[0759] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least two
identical amino acid sequences or Nanobodies.RTM. chosen from SEQ
ID NO's: 65 and 76.
[0760] The invention also provides a multivalent, preferably a
bivalent or trivalent polypeptide comprising or essentially
consisting of at least two (preferably identical) amino acid
sequences or Nanobodies.RTM. chosen from the following: [0761] a)
SEQ ID NO's: 146-453; [0762] b) amino acid sequences that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 146-153,
provided that: [0763] i) the amino acid sequence has a Proline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and/or Leucine (Leu, L) at position 108
(said positions determined according to Kabat numbering); and
[0764] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference.
[0765] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least two
identical amino acid sequences or Nanobodies.RTM. chosen from one
of SEQ ID NO's: 146-153.
[0766] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least two (preferably
identical) amino acid sequences or Nanobodies.RTM. chosen from the
following: [0767] a) SEQ ID NO's: 146-149 and 151-153; [0768] b)
amino acid sequences that have no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
one of SEQ ID NO's: 146-149 and 151-153, provided that: [0769] i)
the amino acid sequence has a Proline (Pro, P) at position 14,
Arginine (Arg, R) at position 19, Leucine (Leu, L) at position 20
and/or Leucine (Leu, L) at position 108; and in addition Arginine
(Arg, R) at position 83, Glutamic acid (Glu, E) at position 85
and/or Glutamine (Gln, Q) at position 105; [0770] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference.
[0771] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least two (preferably
identical) amino acid sequences or Nanobodies.RTM. chosen from the
following: [0772] a) SEQ ID NO's: 146-149 and 151-153; [0773] b)
amino acid sequences that have no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
one of SEQ ID NO's: 146-149 and 151-153, provided that: [0774] i)
the amino acid sequence has a Proline (Pro, P) at position 14,
Arginine (Arg, R) at position 19, Leucine (Leu, L) at position 20
and/or Leucine (Leu, L) at position 108 and in addition Arginine
(Arg, R) at position 83, Glutamic acid (Glu, E) at position 85
and/or Glutamine (Gln, Q) at position 105 so that when the amino
acid sequence has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with: [0775] SEQ ID
NO: 146, the amino acid sequence preferably has Glutamine (Gln, Q)
at position 105; [0776] SEQ ID NO: 147, the amino acid sequence
preferably has Arginine (Arg, R) at position 83 and Glutamine (Gln,
Q) at position 105; [0777] SEQ ID NO: 148, the amino acid sequence
preferably has Glutamic acid (Glu, E) at position 85 and Glutamine
(Gln, Q) at position 105; [0778] SEQ ID NO: 149, the amino acid
sequence preferably has Arginine (Arg, R) at position 83, Glutamic
acid (Glu, E) at position 85 and Glutamine (Gln, Q) at position
105; [0779] SEQ ID NO: 151, the amino acid sequence preferably has
Arginine (Arg, R) at position 83; [0780] SEQ ID NO: 152, the amino
acid sequence preferably has Glutamic acid (Glu, E) at position 85;
[0781] SEQ ID NO: 153, the amino acid sequence preferably has
Arginine (Arg, R) at position 83 and Glutamic acid (Glu, E) at
position 85; [0782] (said positions determined according to Kabat
numbering); and [0783] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference.
[0784] Preferred polypeptides of the invention comprises or
essentially consists of at least two identical amino acid sequences
or Nanobodies.RTM. chosen from SEQ ID NO's: 146-149 and
151-153.
[0785] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least two (preferably
identical) amino acid sequences or Nanobodies.RTM. that comprise or
essentially consist of SEQ ID NO: 5, in which one or more (such as
two, three, four, five, six, seven, eight, nine, ten, eleven or
twelve) amino acid residues have been mutated selected from the
following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54Asp.
[0786] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least two (preferably
identical) amino acid sequences or Nanobodies.RTM. that comprise or
essentially consist of SEQ ID NO: 5, in which one or more (such as
two, three, four, five, six, seven, eight or nine) amino acid
residues have been mutated selected from the following: Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp.
[0787] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least two (preferably
identical) amino acid sequences or Nanobodies.RTM. that comprise or
essentially consist of SEQ ID NO: 5, in which one or more (such as
two, three or four) amino acid residues have been mutated selected
from the following: Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu.
[0788] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least two (preferably
identical) amino acid sequences or Nanobodies.RTM. that comprise or
essentially consist of SEQ ID NO: 5, in which one or more (such as
two, three, four, five, six or seven) amino acid residues have been
mutated selected from the following: Ala14Pro, Ser19Arg, Ile20Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu.
[0789] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least two (preferably
identical) amino acid sequences or Nanobodies.RTM. that comprise or
essentially consist of SEQ ID NO: 5, in which following amino acid
residues have been mutated: [0790] Val5Leu, Ala14Pro, Glu44Gly,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu; [0791]
Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu; [0792] Gly78Leu,
Ala83Arg, Asp85Glu and Arg105Gln; [0793] Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54Asp; [0794] Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54Asp; [0795] Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gly54Asp; [0796] Gly54Asp; [0797] Ala14Pro, Ser19Arg, Ile20Leu and
Gln108Leu; [0798] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Ala83Arg; [0799] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Asp85Glu; [0800] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Arg105Gln; [0801] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg
and Asp85Glu; [0802] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu,
Ala83Arg and Arg105Gln; [0803] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Asp85Glu and Arg105Gln; or [0804] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu and Arg105Gln.
[0805] In another preferred aspect, the invention provides a
multivalent, preferably a trivalent polypeptide comprising or
essentially consisting of at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. chosen from the following:
[0806] a) SEQ ID NO's: 50-76; [0807] b) amino acid sequences that
have no more than 3, preferably no more than 2, more preferably no
more than 1 amino acid difference with one of SEQ ID NO's: 60-76,
provided that: [0808] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105 (said position determined according to
Kabat numbering); and [0809] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference.
[0810] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least three
identical amino acid sequences or Nanobodies.RTM. chosen from one
of SEQ ID NO's: 60-76.
[0811] In another preferred aspect, the invention provides a
multivalent, preferably a trivalent polypeptide comprising or
essentially consisting of at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. chosen from the following:
[0812] a) SEQ ID NO's: 62, 65, 67, 68, 75 and 76; [0813] b) amino
acid sequences that have no more than 3, preferably no more than 2,
more preferably no more than 1 amino acid difference with one of
SEQ ID NO's: 62, 65, 67, 68, 75 and 76, provided that: [0814] i)
the amino acid sequence has a Glutamine (Gln, Q) at position 105, a
Leucine (Leu, L) at position 78 and/or an Arginine (Arg, R) at
position 83 (said positions determined according to Kabat
numbering); and [0815] ii) the amino acid sequence binds protein of
hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference.
[0816] In another preferred aspect, the invention provides a
multivalent, preferably a trivalent polypeptide comprising or
essentially consisting of at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. chosen from the following:
[0817] a) SEQ ID NO's: 62, 65, 67, 68, 75 and 76; [0818] b) amino
acid sequences that have no more than 3, preferably no more than 2,
more preferably no more than 1 amino acid difference with one of
SEQ ID NO's: 62, 65, 67, 68, 75 and 76, provided that: [0819] i)
the amino acid sequence has a Glutamine (Gln, Q) at position 105, a
Leucine (Leu, L) at position 78 and an Arginine (Arg, R) at
position 83 (said positions determined according to Kabat
numbering); and [0820] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference.
[0821] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least three
identical amino acid sequences or Nanobodies.RTM. chosen from one
of SEQ ID NO's: 62, 65, 67, 68, 75 and 76.
[0822] In another preferred aspect, the invention provides a
multivalent, preferably a trivalent polypeptide comprising or
essentially consisting of at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. chosen from the following:
[0823] a) SEQ ID NO's: 65 and 76; [0824] b) amino acid sequences
that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 65 and 76, provided that: [0825] i) the amino acid sequence
has an Aspartic acid (Asp, D) at position 54, a Glutamine (Gln, Q)
at position 105, a Leucine (Leu, L) at position 78 and/or an
Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [0826] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference.
[0827] In another preferred aspect, the invention provides a
multivalent, preferably a trivalent polypeptide comprising or
essentially consisting of at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. chosen from the following:
[0828] a) SEQ ID NO's: 65 and 76; [0829] b) amino acid sequences
that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 65 and 76, provided that: [0830] i) the amino acid sequence
has an Aspartic acid (Asp, D) at position 54, a Glutamine (Gln, Q)
at position 105, a Leucine (Leu, L) at position 78 and an Arginine
(Arg, R) at position 83 (said positions determined according to
Kabat numbering); and [0831] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference.
[0832] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least three
identical amino acid sequences or Nanobodies.RTM. chosen from one
of SEQ ID NO's: 65 and 76.
[0833] The invention also provides a multivalent, preferably a
trivalent polypeptide comprising or essentially consisting of at
least three (preferably identical) amino acid sequences or
Nanobodies.RTM. chosen from the following: [0834] a) SEQ ID NO's:
146-453; [0835] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 146-153, provided that:
[0836] i) the amino acid sequence has a Proline (Pro, P) at
position 14, Arginine (Arg, R) at position 19, Leucine (Leu, L) at
position 20 and/or Leucine (Leu, L) at position 108 (said positions
determined according to Kabat numbering); and [0837] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference.
[0838] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least three
identical amino acid sequences or Nanobodies.RTM. chosen from one
of SEQ ID NO's: 146-153.
[0839] In another preferred aspect, the invention provides a
multivalent, preferably a trivalent polypeptide comprising or
essentially consisting of at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. chosen from the following:
[0840] a) SEQ ID NO's: 146-149 and 151-153; [0841] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino add difference with one of SEQ ID
NO's: 146-149 and 151-153, provided that: [0842] i) the amino acid
sequence has a Proline (Pro, P) at position 14, Arginine (Arg, R)
at position 19, Leucine (Leu, L) at position 20 and/or Leucine
(Leu, L) at position 108; and in addition Arginine (Arg, R) at
position 83, Glutamic acid (Glu, E) at position 85 and/or Glutamine
(Gln, Q) at position 105; [0843] ii) the amino acid sequence binds
protein E of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference.
[0844] In another preferred aspect, the invention provides a
multivalent, preferably a trivalent polypeptide comprising or
essentially consisting of at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. chosen from the following:
[0845] a) SEQ ID NO's: 146-149 and 151-153; [0846] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 146-149 and 151-153, provided that: [0847] i) the amino acid
sequence has a Proline (Pro, P) at position 14, Arginine (Arg, R)
at position 19, Leucine (Leu, L) at position 20 and/or Leucine
(Leu, L) at position 108 and in addition Arginine (Arg, R) at
position 83, Glutamic acid (Glu, E) at position 85 and/or Glutamine
(Gln, Q) at position 105 so that when the amino acid sequence has
no more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with: [0848] SEQ ID NO: 146, the amino
acid sequence preferably has Glutamine (Gln, Q) at position 105;
[0849] SEQ ID NO: 147, the amino acid sequence preferably has
Arginine (Arg, R) at position 83 and Glutamine (Gln, Q) at position
105; [0850] SEQ ID NO: 148, the amino acid sequence preferably has
Glutamic acid (Glu, E) at position 85 and Glutamine (Gln, Q) at
position 105; [0851] SEQ ID NO: 149, the amino acid sequence
preferably has Arginine (Arg, R) at position 83, Glutamic acid
(Glu, E) at position 85 and Glutamine (Gln, Q) at position 105;
[0852] SEQ ID NO: 151, the amino acid sequence preferably has
Arginine (Arg, R) at position 83; [0853] SEQ ID NO: 152, the amino
acid sequence preferably has Glutamic acid (Glu, E) at position 85;
[0854] SEQ ID NO: 153, the amino acid sequence preferably has
Arginine (Arg, R) at position 83 and Glutamic acid (Glu, E) at
position 85; [0855] (said positions determined according to Kabat
numbering); and [0856] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference.
[0857] Preferred polypeptides of the invention comprises or
essentially consists of at least three identical amino acid
sequences or Nanobodies.RTM. chosen from SEQ ID NO's: 146-149 and
151-153.
[0858] In another preferred aspect, the invention provides a
multivalent, preferably a trivalent polypeptide comprising or
essentially consisting of at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. that comprise or
essentially consist of SEQ ID NO: 5, in which one or more (such as
two, three, four, five, six, seven, eight, nine, ten, eleven or
twelve) amino acid residues have been mutated selected from the
following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54Asp.
[0859] In another preferred aspect, the invention provides a
multivalent, preferably a trivalent polypeptide comprising or
essentially consisting of at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. that comprise or
essentially consist of SEQ ID NO: 5, in which one or more (such as
two, three, four, five, six, seven, eight or nine) amino acid
residues have been mutated selected from the following: Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp.
[0860] In another preferred aspect, the invention provides a
multivalent, preferably a trivalent polypeptide comprising or
essentially consisting of at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. that comprise or
essentially consist of SEQ ID NO: 5, in which one or more (such as
two, three or four) amino acid residues have been mutated selected
from the following: Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu.
[0861] In another preferred aspect, the invention provides a
multivalent, preferably a trivalent polypeptide comprising or
essentially consisting of at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. that comprise or
essentially consist of SEQ ID NO: 5, in which one or more (such as
two, three, four, five, six or seven) amino acid residues have been
mutated selected from the following: Ala14Pro, Ser19Arg, Ile20Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu.
[0862] In another preferred aspect, the invention provides a
multivalent, preferably a trivalent polypeptide comprising or
essentially consisting of at least three (preferably identical)
amino acid sequences or Nanobodies.RTM. that comprise or
essentially consist of SEQ ID NO: 5, in which following amino acid
residues have been mutated: [0863] Val5Leu, Ala14Pro, Glu44Gly,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu; [0864]
Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu; [0865] Gly78Leu,
Ala83Arg, Asp85Glu and Arg105Gln; [0866] Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54Asp; [0867] Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54Asp; [0868] Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gly54Asp; [0869] Gly54Asp; [0870] Ala14Pro, Ser19Arg, Ile20Leu and
Gln108Leu; [0871] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Ala83Arg; [0872] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Asp85Glu; [0873] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Arg105Gln; [0874] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg
and Asp85Glu; [0875] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu,
Ala83Arg and Arg105Gln; [0876] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Asp85Glu and Arg105Gln; or [0877] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu and Arg105Gln.
[0878] The invention also provides a multivalent, preferably a
bivalent or trivalent polypeptide as described above in which the
Glutamic acid at position 1 has been changed into an Aspartic
acid.
[0879] In this respect, the invention provides a multivalent,
preferably a bivalent or trivalent polypeptide comprising or
essentially consisting of at least one amino acid sequence or
Nanobody.RTM. chosen from the following: [0880] a) SEQ ID NO's:
138-141 and 154-157; [0881] b) amino acid sequences that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 138-141 and
154-157, provided that: [0882] i) the amino acid sequence has an
Aspartic acid (Asp, D) at position 1 (said position determined
according to Kabat numbering); and [0883] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
add sequence without the 3, 2 or 1 amino acid difference.
[0884] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least one amino
add sequence or Nanobody.RTM. chosen from one of SEQ ID NO's:
138-141 and 154-157.
[0885] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least one amino acid
sequence or Nanobody.RTM. that comprises or essentially consists of
SEQ ID NO: 5, in which the Glutamic acid at position 1 has been
changed into Aspartic acid.
[0886] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least one amino acid
sequence or Nanobody.RTM. that comprises or essentially consists of
SEQ ID NO: 62, in which the Glutamic acid at position 1 has been
changed into Aspartic acid.
[0887] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least one amino acid
sequence or Nanobody.RTM. that comprises or essentially consists of
SEQ ID NO: 65, in which the Glutamic acid at position 1 has been
changed into Aspartic acid.
[0888] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least one amino acid
sequence or Nanobody.RTM. that comprises or essentially consists of
SEQ ID NO: 76, in which the Glutamic acid at position 1 has been
changed into Aspartic acid.
[0889] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least one amino acid
sequence or Nanobody.RTM. that comprises or essentially consists of
SEQ ID NO: 75, in which the Glutamic acid at position 1 has been
changed into Aspartic acid.
[0890] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least one amino acid
sequence or Nanobody.RTM. that comprises or essentially consists of
SEQ ID NO: 147, in which the Glutamic acid at position 1 has been
changed into Aspartic acid.
[0891] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least one amino acid
sequence or Nanobody.RTM. that comprises or essentially consists of
SEQ ID NO: 149, in which the Glutamic acid at position 1 has been
changed into Aspartic acid.
[0892] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least one amino acid
sequence or that comprises or essentially consists of SEQ ID NO:
153, in which the Glutamic acid at position 1 has been changed into
Aspartic acid.
[0893] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least one amino acid
sequence or Nanobody.RTM. that comprises or essentially consists of
SEQ ID NO: 5, in which one or more (such as two, three, four, five,
six, seven, eight, nine, ten, eleven or twelve) amino acid residues
have been mutated selected from the following: Val5Leu, Ala14Pro,
Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp, and wherein the Glutamic acid at
position 1 has been changed into Aspartic acid.
[0894] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least one amino acid
sequence or Nanobody.RTM. that comprises or essentially consists of
SEQ ID NO: 5, in which one or more (such as two, three, four, five,
six, seven, eight or nine) amino acid residues have been mutated
selected from the following: Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp, and wherein
the Glutamic acid at position 1 has been changed into Aspartic
acid.
[0895] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least one amino acid
sequence or Nanobody.RTM. that comprises or essentially consists of
SEQ ID NO: 5, in which one or more (such as two, three or four)
amino acid residues have been mutated selected from the following:
Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu, and wherein the
Glutamic acid at position 1 has been changed into Aspartic
acid.
[0896] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least one amino acid
sequence or Nanobody.RTM. that comprises or essentially consists of
SEQ ID NO: 5, in which one or more (such as two, three, four, five,
six or seven) amino acid residues have been mutated selected from
the following: Ala14Pro, Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu, and wherein the Glutamic acid at position
1 has been changed into Aspartic acid.
[0897] In another preferred aspect, the invention provides a
multivalent, preferably a bivalent or trivalent polypeptide
comprising or essentially consisting of at least one amino acid
sequence or Nanobody.RTM. that comprises or essentially consists of
SEQ ID NO: 5, in which following amino acid residues have been
mutated: [0898] Glu1Asp; [0899] Glu1Asp, Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu;
[0900] Glu1Asp, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu; [0901]
Glu1Asp, Gly78Leu, Ala83Arg, Asp85Glu and Arg105Gln; [0902]
Glu1Asp, Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp; [0903] Glu1Asp, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp; [0904] Glu1Asp,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54Asp; [0905]
Glu1Asp and Gly54Asp; [0906] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu
and Gln108Leu; [0907] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Ala83Arg; [0908] Glu1Asp, Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Asp85Glu; [0909] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu and Arg105Gln; [0910] Glu1Asp,
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Asp85Glu;
[0911] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg
and Arg105Gln; [0912] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Asp85Glu and Arg105Gln; or [0913] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu and
Arg105Gln.
[0914] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of two
(preferably identical) amino acid sequences or Nanobodies.RTM.
chosen from the following: [0915] a) SEQ ID NO's: 60-76; [0916] b)
amino acid sequences that have no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
one of SEQ ID NO's: 60-76, provided that: [0917] i) the amino acid
sequence has a Glutamine (Gln, Q) at position 105 (said position
determined according to Kabat numbering); and [0918] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference.
[0919] In another preferred aspect, the polypeptide of the
invention is a bivalent polypeptide and comprises or essentially
consists of two identical amino acid sequences or Nanobodies.RTM.
chosen from one of SEQ ID NO's: 60-76.
[0920] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of two
(preferably identical) amino acid sequences or Nanobodies.RTM.
chosen from the following: [0921] a) SEQ ID NO's: 62, 65, 67, 68,
75 and 76; [0922] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76,
provided that: [0923] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105, a Leucine (Leu, L) at position 78 and/or
an Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [0924] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference.
[0925] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of two
(preferably identical) amino acid sequences or Nanobodies.RTM.
chosen from the following: [0926] a) SEQ ID NO's: 62, 65, 67, 68,
75 and 76; [0927] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76,
provided that: [0928] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105, a Leucine (Leu, L) at position 78 and an
Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [0929] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference.
[0930] In another preferred aspect, the polypeptide of the
invention is a bivalent polypeptide and comprises or essentially
consists of two identical amino acid sequences or Nanobodies.RTM.
chosen from one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76.
[0931] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of two
(preferably identical) amino acid sequences or Nanobodies.RTM.
chosen from the following: [0932] a) SEQ ID NO's: 65 and 76; [0933]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 65 and 76, provided that: [0934] i) the
amino acid sequence has an Aspartic acid (Asp, D) at position 54, a
Glutamine (Gln, Q) at position 105, a Leucine (Leu, L) at position
78 and/or an Arginine (Arg, R) at position 83 (said positions
determined according to Kabat numbering); and [0935] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference.
[0936] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of two
(preferably identical) amino acid sequences or Nanobodies.RTM.
chosen from the following: [0937] a) SEQ ID NO's: 65 and 76; [0938]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 65 and 76, provided that: [0939] i) the
amino acid sequence has an Aspartic acid (Asp, D) at position 54, a
Glutamine (Gln, Q) at position 105, a Leucine (Leu, L) at position
78 and an Arginine (Arg, R) at position 83 (said positions
determined according to Kabat numbering); and [0940] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference.
[0941] In another preferred aspect, the polypeptide of the
invention is a bivalent polypeptide and comprises or essentially
consists of two identical amino acid sequences or Nanobodies.RTM.
chosen from SEQ ID NO's: 65 and 76.
[0942] The invention also provides a bivalent polypeptide
comprising or essentially consisting of two (preferably identical)
amino acid sequences or Nanobodies.RTM. chosen from the following:
[0943] a) SEQ ID NO's: 146-153; [0944] b) amino acid sequences that
have no more than 3, preferably no more than 2, more preferably no
more than 1 amino acid difference with one of SEQ ID NO's: 146-153,
provided that: [0945] i) the amino acid sequence has a Praline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and/or Leucine (Leu, 14 at position 108
(said positions determined according to Kabat numbering); and
[0946] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference.
[0947] In another preferred aspect, the polypeptide of the
invention is a bivalent polypeptide and comprises or essentially
consists of two identical amino acid sequences or Nanobodies.RTM.
chosen from one of SEQ ID NO's: 146-153.
[0948] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of two
(preferably identical) amino acid sequences or Nanobodies.RTM.
chosen from the following: [0949] a) SEQ ID NO's: 146-149 and
151-153; [0950] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 146-149 and 151-153,
provided that: [0951] i) the amino acid sequence has a Proline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and/or Leucine (Leu, L) at position 108;
and in addition Arginine (Arg, R) at position 83, Glutamic acid
(Glu, E) at position 85 and/or Glutamine (Gln, Q) at position 105;
[0952] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference.
[0953] In another preferred aspect, the invention a bivalent
polypeptide comprising or essentially consisting of two (preferably
identical) amino acid sequences or Nanobodies.RTM. chosen from the
following: [0954] a) SEQ ID NO's: 146-149 and 151-153; [0955] b)
amino acid sequences that have no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
one of SEQ ID NO's: 146-449 and 151-153, provided that: [0956] i)
the amino acid sequence has a Proline (Pro, P) at position 14,
Arginine (Arg, R) at position 19, Leucine (Leu, L) at position 20
and/or Leucine (Leu, L) at position 108 and in addition Arginine
(Arg, R) at position 83, Glutamic acid (Glu, E) at position 85
and/or Glutamine (Gln, Q) at position 105 so that when the amino
acid sequence has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with: [0957] SEQ ID
NO: 146, the amino acid sequence preferably has Glutamine (Gln, Q)
at position 105; [0958] SEQ ID NO: 147, the amino acid sequence
preferably has Arginine (Arg, R) at position 83 and Glutamine (Gln,
Q) at position 105; [0959] SEQ ID NO: 148, the amino acid sequence
preferably has Glutamic acid (Glu, E) at position 85 and Glutamine
(Gln, Q) at position 105; [0960] SEQ ID NO: 149, the amino acid
sequence preferably has Arginine (Arg, R) at position 83, Glutamic
acid (Glu, E) at position 85 and Glutamine (Gln, Q) at position
105; [0961] SEQ ID NO: 151, the amino acid sequence preferably has
Arginine (Arg, R) at position 83; [0962] SEQ ID NO: 152, the amino
acid sequence preferably has Glutamic acid (Glu, E) at position 85;
[0963] SEQ ID NO: 153, the amino acid sequence preferably has
Arginine (Arg, R) at position 83 and Glutamic acid (Glu, E) at
position 85; [0964] (said positions determined according to Kabat
numbering); and [0965] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference.
[0966] Preferred polypeptides of the invention comprises or
essentially consists of two amino acid sequences or Nanobodies.RTM.
chosen from SEQ ID NO's: 146-149 and 151-153.
[0967] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of two
(preferably identical) amino acid sequences or Nanobodies.RTM. that
comprise or essentially consist of SEQ ID NO: 5, in which one or
more (such as two, three, four, five, six, seven, eight, nine, ten,
eleven or twelve) amino acid residues have been mutated selected
from the following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly,
Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54Asp.
[0968] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of two
(preferably identical) amino acid sequences or Nanobodies.RTM. that
comprise or essentially consist of SEQ ID NO: 5, in which one or
more (such as two, three, four, five, six, seven, eight or nine)
amino acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp.
[0969] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of two
(preferably identical) amino acid sequences or Nanobodies.RTM. that
comprise or essentially consist of SEQ ID NO: 5, in which one or
more (such as two, three or four) amino acid residues have been
mutated selected from the following: Ala14Pro, Ser19Arg, Ile20Leu
and Gln108Leu.
[0970] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of two
(preferably identical) amino acid sequences or Nanobodies.RTM. that
comprise or essentially consist of SEQ ID NO: 5, in which one or
more (such as two, three, four, five, six or seven) amino acid
residues have been mutated selected from the following: Ala14Pro,
Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu.
[0971] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of two
(preferably identical) amino acid sequences or Nanobodies.RTM. that
comprise or essentially consist of SEQ ID NO: 5, in which following
amino acid residues have been mutated: [0972] Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu;
[0973] Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu; [0974]
Gly78Leu, Ala83Arg, Asp85Glu and Arg105Gln; [0975] Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp; [0976] Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp; [0977] Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gly54Asp; [0978] Gly54Asp; [0979] Ala14Pro, Ser19Arg,
Ile20Leu and Gln108Leu; [0980] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Ala83Arg; [0981] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Asp85Glu; [0982] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Arg105Gln; [0983] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg and Asp85Glu; [0984] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln; [0985] Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and Arg105Gln; or [0986]
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu and
Arg105Gln.
[0987] The invention also provides a bivalent polypeptide as
described above in which the Glutamic acid at position 1 has been
changed into an Aspartic acid.
[0988] In this respect, the invention also provides a bivalent
polypeptide comprising or essentially consisting of at least one
amino acid sequence or Nanobody.RTM. chosen from the following:
[0989] a) SEQ ID NO's: 138-141 and 154-157; [0990] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 138-141 and 154-157, provided that: [0991] i) the amino acid
sequence has a Aspartic acid (Asp, D) at position 1 (said position
determined according to Kabat numbering); and [0992] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference.
[0993] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least one amino
acid sequence or Nanobody.RTM. chosen from one of SEQ ID NO's:
138-141 and 154-157.
[0994] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 5, in which the Glutamic acid at
position 1 has been changed into Aspartic acid.
[0995] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 62, in which the Glutamic acid
at position 1 has been changed into Aspartic acid.
[0996] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 65, in which the Glutamic acid
at position 1 has been changed into Aspartic acid.
[0997] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 76, in which the Glutamic acid
at position 1 has been changed into Aspartic acid.
[0998] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 75, in which the Glutamic acid
at position 1 has been changed into Aspartic acid.
[0999] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 147, in which the Glutamic acid
at position 1 has been changed into Aspartic acid.
[1000] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 149, in which the Glutamic acid
at position 1 has been changed into Aspartic acid.
[1001] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 153, in which the Glutamic acid
at position 1 has been changed into Aspartic acid.
[1002] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 5, in which one or more (such as
two, three, four, five, six, seven, eight, nine, ten, eleven or
twelve) amino acid residues have been mutated selected from the
following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp,
and wherein the Glutamic acid at position 1 has been changed into
Aspartic acid.
[1003] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 5, in which one or more (such as
two, three, four, five, six, seven, eight or nine) amino acid
residues have been mutated selected from the following: Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp, and wherein the Glutamic acid at position 1
has been changed into Aspartic acid.
[1004] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 5, in which one or more (such as
two, three or four) amino acid residues have been mutated selected
from the following: Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu, and
wherein the Glutamic acid at position 1 has been changed into
Aspartic acid.
[1005] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 5, in which one or more (such as
two, three, four, five, six or seven) amino acid residues have been
mutated selected from the following: Ala14Pro, Ser19Arg, Ile20Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu, and wherein the
Glutamic acid at position 1 has been changed into Aspartic
acid.
[1006] In another preferred aspect, the invention provides a
bivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 5, in which following amino acid
residues have been mutated: [1007] Glu1Asp; [1008] Glu1Asp,
Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu; [1009] Glu1Asp, Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu; [1010] Glu1Asp, Gly78Leu, Ala83Arg,
Asp85Glu and Arg105Gln; [1011] Glu1Asp, Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54Asp; [1012] Glu1Asp, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu
and Gly54Asp; [1013] Glu1Asp, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gly54Asp; [1014] Glu1Asp and Gly54Asp; [1015]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu; [1016]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and Ala83Arg;
[1017] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Asp85Glu; [1018] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu
and Arg105Gln; [1019] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg and Asp85Glu; [1020] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln; [1021]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and
Arg105Gln; or [1022] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg, Asp85Glu and Arg105Gln.
[1023] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of three
(preferably identical) amino acid sequences or Nanobodies.RTM.
chosen from the following: [1024] a) SEQ ID NO's: 60-76; [1025] b)
amino acid sequences that have no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
one of SEQ ID NO's: 60-76, provided that: [1026] i) the amino acid
sequence has a Glutamine (Gln, Q) at position 105 (said position
determined according to Kabat numbering); and [1027] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference.
[1028] In another preferred aspect, the polypeptide of the
invention is a trivalent polypeptide and comprises or essentially
consists of three identical amino acid sequences or Nanobodies.RTM.
chosen from one of SEQ ID NO's: 60-76.
[1029] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of three
(preferably identical) amino acid sequences or Nanobodies.RTM.
chosen from the following: [1030] a) SEQ ID NO's: 62, 65, 67, 68,
75 and 76; [1031] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76,
provided that: [1032] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105, a Leucine (Leu, L) at position 78 and/or
an Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [1033] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference.
[1034] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of three
(preferably identical) amino acid sequences or Nanobodies.RTM.
chosen from the following: [1035] a) SEQ 1D NO's: 62, 65, 67, 68,
75 and 76; [1036] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76,
provided that: [1037] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105, a Leucine (Leu, L) at position 78 and an
Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [1038] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference.
[1039] In another preferred aspect, the polypeptide of the
invention is a trivalent polypeptide and comprises or essentially
consists of three identical amino acid sequences or Nanobodies.RTM.
chosen from one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76.
[1040] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of three
(preferably identical) amino acid sequences or Nanobodies.RTM.
chosen from the following: [1041] a) SEQ ID NO's: 65 and 76; [1042]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 65 and 76, provided that: [1043] i) the
amino acid sequence has an Aspartic acid (Asp, D) at position 54, a
Glutamine (Gln, Q) at position 105, a Leucine (Leu, L) at position
78 and/or an Arginine (Arg, R) at position 83 (said positions
determined according to Kabat numbering); and [1044] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference.
[1045] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of three
(preferably identical) amino acid sequences or Nanobodies.RTM.
chosen from the following: [1046] a) SEQ ID NO's: 65 and 76; [1047]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 65 and 76, provided that: [1048] i) the
amino acid sequence has an Aspartic acid (Asp, D) at position 54, a
Glutamine (Gln, Q) at position 105, a Leucine (Leu, L) at position
78 and an Arginine (Arg, R) at position 83 (said positions
determined according to Kabat numbering); and [1049] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference.
[1050] In another preferred aspect, the polypeptide of the
invention is a trivalent polypeptide and comprises or essentially
consists of three identical amino acid sequences or Nanobodies.RTM.
chosen from one of SEQ ID NO's: 65 and 76.
[1051] The invention also provides a trivalent polypeptide
comprising or essentially consisting of three (preferably
identical) amino acid sequences or Nanobodies.RTM. chosen from the
following: [1052] a) SEQ ID NO's: 146-153; [1053] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 146-153, provided that: [1054] i) the amino acid sequence has
a Proline (Pro, P) at position 14, Arginine (Arg, R) at position
19, Leucine (Leu, L) at position 20 and/or Leucine (Leu, L) at
position 108 (said positions determined according to Kabat
numbering); and [1055] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference.
[1056] In another preferred aspect, the polypeptide of the
invention is a trivalent polypeptide and comprises or essentially
consists of three identical amino acid sequences or Nanobodies.RTM.
chosen from one of SEQ ID NO's: 146-153.
[1057] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of three
(preferably identical) amino acid sequences or Nanobodies.RTM.
chosen from the following: [1058] a) SEQ ID NO's: 146-149 and
151-153; [1059] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 146-149 and 151-153,
provided that: [1060] i) the amino acid sequence has a Proline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and/or Leucine (Leu, L) at position 108;
and in addition Arginine (Arg, R) at position 83, Glutamic acid
(Glu, E) at position 85 and/or Glutamine (Gln, Q) at position 105;
[1061] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference.
[1062] In another preferred aspect, the invention a trivalent
polypeptide comprising or essentially consisting of three
(preferably identical) amino acid sequences or Nanobodies.RTM.
chosen from the following: [1063] a) SEQ ID NO's: 146-149 and
151-153; [1064] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 146-149 and 151-153,
provided that: [1065] i) the amino acid sequence has a Proline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and/or Leucine (Leu, L) at position 108 and
in addition Arginine (Arg, R) at position 83, Glutamic acid (Glu,
E) at position 85 and/or Glutamine (Gln, Q) at position 105 so that
when the amino acid sequence has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with:
[1066] SEQ ID NO: 146, the amino acid sequence preferably has
Glutamine (Gln, Q) at position 105; [1067] SEQ ID NO: 147, the
amino acid sequence preferably has Arginine (Arg, R) at position 83
and Glutamine (Gln, Q) at position 105; [1068] SEQ ID NO: 148, the
amino acid sequence preferably has Glutamic acid (Glu, E) at
position 85 and Glutamine (Gln, Q) at position 105; [1069] SEQ ID
NO: 149, the amino acid sequence preferably has Arginine (Arg, R)
at position 83, Glutamic acid (Glu, E) at position 85 and Glutamine
(Gln, Q) at position 105; [1070] SEQ ID NO: 151, the amino acid
sequence preferably has Arginine (Arg, R) at position 83; [1071]
SEQ ID NO: 152, the amino acid sequence preferably has Glutamic
acid (Glu, E) at position 85; [1072] SEQ ID NO: 153, the amino acid
sequence preferably has Arginine (Arg, R) at position 83 and
Glutamic acid (Glu, E) at position 85; [1073] (said positions
determined according to Kabat numbering); and [1074] ii) the amino
add sequence binds protein F of hRSV with the same, about the same,
or a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference.
[1075] Preferred polypeptides of the invention comprises or
essentially consists of three amino acid sequences or
Nanobodies.RTM. chosen from SEQ ID NO's: 146-149 and 151-153.
[1076] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of three
(preferably identical) amino acid sequences or Nanobodies.RTM. that
comprise or essentially consist of SEQ ID NO: 5, in which one or
more (such as two, three, four, five, six, seven, eight, nine, ten,
eleven or twelve) amino acid residues have been mutated selected
from the following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly,
Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54Asp.
[1077] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of three
(preferably identical) amino acid sequences or Nanobodies.RTM. that
comprise or essentially consist of SEQ ID NO: 5, in which one or
more (such as two, three, four, five, six, seven, eight or nine)
amino acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp.
[1078] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of three
(preferably identical) amino acid sequences or Nanobodies.RTM. that
comprise or essentially consist of SEQ ID NO: 5, in which one or
more (such as two, three or four) amino acid residues have been
mutated selected from the following: Ala14Pro, Ser19Arg, Ile20Leu
and Gln108Leu.
[1079] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of three
(preferably identical) amino acid sequences or Nanobodies.RTM. that
comprise or essentially consist of SEQ ID NO: 5, in which one or
more (such as two, three, four, five, six or seven) amino acid
residues have been mutated selected from the following: Ala14Pro,
Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu.
[1080] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of three
(preferably identical) amino acid sequences or Nanobodies.RTM. that
comprise or essentially consist of SEQ ID NO: 5, in which following
amino acid residues have been mutated: [1081] Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu;
[1082] Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu; Gly78Leu,
Ala83Arg, Asp85Glu and Arg105Gln; [1083] Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54Asp; [1084] Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54Asp; [1085] Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gly54Asp; [1086] Gly54Asp; [1087] Ala14Pro, Ser19Arg, Ile20Leu and
Gln108Leu; [1088] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Ala83Arg; [1089] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Asp85Glu; [1090] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Arg105Gln; [1091] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg
and Asp85Glu; [1092] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu,
Ala83Arg and Arg105Gln; [1093] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Asp85Glu and Arg105Gln; or [1094] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu and Arg105Gln.
[1095] A preferred multivalent polypeptide of the invention
comprises or essentially consists of three amino add sequences or
Nanobodies.RTM. with SEQ ID NO: 62. Another preferred multivalent
polypeptide of the invention comprises or essentially consists of
three amino acid sequences or Nanobodies.RTM. with SEQ ID NO: 65.
Another preferred multivalent polypeptide of the invention
comprises or essentially consists of three amino acid sequences or
Nanobodies.RTM. with SEQ ID NO: 76. Another preferred multivalent
polypeptide of the invention comprises or essentially consists of
three amino acid sequences or Nanobodies.RTM. with SEQ ID NO: 75.
Another preferred multivalent polypeptide of the invention
comprises or essentially consists of three amino acid sequences or
Nanobodies.RTM. with SEQ ID NO: 147. Another preferred multivalent
polypeptide of the invention comprises or essentially consists of
three amino acid sequences or Nanobodies.RTM. with SEQ ID NO: 149.
Another preferred multivalent polypeptide of the invention
comprises or essentially consists of three amino acid sequences or
Nanobodies.RTM. with SEQ ID NO: 153.
[1096] The invention also provides a trivalent polypeptide as
described above in which the Glutamic acid at position 1 has been
changed into an Aspartic acid.
[1097] In this respect, the invention also provides a trivalent
polypeptide comprising or essentially consisting of at least one
amino acid sequence or Nanobody.RTM. chosen from the following:
[1098] a) SEQ ID NO's: 138-141 and 154-157; [1099] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 138-141 and 154-157, provided that: [1100] i) the amino acid
sequence has a Aspartic acid (Asp, D) at position 1 (said position
determined according to Kabat numbering); and [1101] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference.
[1102] In another preferred aspect, the polypeptide of the
invention comprises or essentially consists of at least one amino
acid sequence or Nanobody.RTM. chosen from one of SEQ ID NO's:
138-141 and 154-157.
[1103] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 5, in which the Glutamic acid at
position 1 has been changed into Aspartic acid.
[1104] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 62, in which the Glutamic acid
at position 1 has been changed into Aspartic acid.
[1105] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 65, in which the Glutamic acid
at position 1 has been changed into Aspartic acid.
[1106] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 76, in which the Glutamic acid
at position 1 has been changed into Aspartic acid.
[1107] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 75, in which the Glutamic acid
at position 1 has been changed into Aspartic acid.
[1108] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 147, in which the Glutamic acid
at position 1 has been changed into Aspartic acid.
[1109] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 149, in which the Glutamic acid
at position 1 has been changed into Aspartic acid.
[1110] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 153, in which the Glutamic acid
at position 1 has been changed into Aspartic acid.
[1111] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 5, in which one or more (such as
two, three, four, five, six, seven, eight, nine, ten, eleven or
twelve) amino acid residues have been mutated selected from the
following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp,
and wherein the Glutamic acid at position 1 has been changed into
Aspartic acid.
[1112] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 5, in which one or more (such as
two, three, four, five, six, seven, eight or nine) amino acid
residues have been mutated selected from the following: Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp, and wherein the Glutamic acid at position 1
has been changed into Aspartic acid.
[1113] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 5, in which one or more (such as
two, three or four) amino acid residues have been mutated selected
from the following: Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu, and
wherein the Glutamic acid at position 1 has been changed into
Aspartic acid.
[1114] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 5, in which one or more (such as
two, three, four, five, six or seven) amino acid residues have been
mutated selected from the following: Ala14Pro, Ser19Arg, Ile20Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu, and wherein the
Glutamic acid at position 1 has been changed into Aspartic
acid.
[1115] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence or Nanobody.RTM. that comprises or
essentially consists of SEQ ID NO: 5, in which following amino acid
residues have been mutated: [1116] Glu1Asp; [1117] Glu1Asp,
Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and [1118] Gln108Leu; [1119] Glu1Asp, Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu; [1120] Glu1Asp, Gly78Leu, Ala83Arg,
Asp85Glu and Arg105Gln; [1121] Glu1Asp, Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54Asp; [1122] Glu1Asp, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu
and Gly54Asp; [1123] Glu1Asp, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gly54Asp; [1124] Glu1Asp and Gly54Asp; [1125]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu; [1126]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and Ala83Arg;
[1127] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Asp85Glu; [1128] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu
and Arg105Gln; [1129] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg and Asp85Glu; [1130] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln; [1131]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and
Arg105Gln; or [1132] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg, Asp85Glu and Arg105Gln.
[1133] In another preferred aspect, the invention provides a
trivalent polypeptide chosen from the following polypeptides:
[1134] a) SEQ ID NO's: 77-79 and 158; [1135] b) polypeptides that
have no more than 3, preferably no more than 2, more preferably no
more than 1 amino acid difference with one of SEQ ID NO's: 77-79
and 158, provided that: [1136] i) the amino acid sequences or
Nanobodies.RTM. encompassed in said polypeptide have a Glutamine
(Gln, Q) at position 105, a Leucine (Leu, L) at position 78, an
Arginine (Arg, R) at position 83 and/or a Glutamic acid (Glu, E) at
position 85 (said positions determined according to Kabat
numbering); and [1137] ii) the polypeptide binds protein F of hRSV
with the same, about the same, or a higher affinity (said affinity
as measured by surface plasmon resonance) and/or the polypeptide
has the same, about the same, or a higher potency (as defined
herein) compared to the polypeptide without the 3, 2 or 1 amino
acid difference.
[1138] In a preferred aspect, the invention provides a trivalent
polypeptide chosen from the following polypeptides: [1139] a) SEQ
ID NO is: 77-79 and 158; [1140] b) polypeptides that have no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with one of SEQ ID NO's: 77-79 and 158,
provided that: [1141] i) the amino acid sequence or Nanobody.RTM.
encompassed in said polypeptide has a Glutamine (Gln, Q) at
position 105, a Leucine (Leu, L) at position 78, an Arginine (Arg,
R) at position 83 and a Glutamic acid (Glu, E) at position 85 (said
positions determined according to Kabat numbering); and [1142] ii)
the polypeptide binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the polypeptide has the same, about the
same, or a higher potency (as defined herein) compared to the
polypeptide without the 3, 2 or 1 amino acid difference.
[1143] Preferred trivalent polypeptides of the invention comprise
or essentially consist of one of SEQ ID NO's: 77-79 and 158.
[1144] In another preferred aspect, the invention provides a
trivalent polypeptide chosen from the following polypeptides:
[1145] a) SEQ ID NO: 78 and 79; [1146] b) polypeptides that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 78 and 79,
provided that: [1147] i) the amino acid sequence or Nanobody.RTM.
encompassed in said polypeptide has an Aspartic acid (Asp, D) at
position 54, a Glutamine (Gln, Q) at position 105, a Leucine (Leu,
L) at position 78, an Arginine (Arg, R) at position 83 and/or a
Glutamic acid (Glu, E) at position 85 (said positions determined
according to Kabat numbering); and [1148] ii) the polypeptide binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the polypeptide has the same, about the same, or a higher
potency (as defined herein) compared to the polypeptide without the
3, 2 or 1 amino acid difference.
[1149] In a preferred aspect, the invention provides a trivalent
polypeptide chosen from the following polypeptides: [1150] a) SEQ
ID NO: 78 and 79; or [1151] b) polypeptides that have no more than
3, preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 78 and 79, provided that:
[1152] i) the amino acid sequence or Nanobody.RTM. encompassed in
said polypeptide has an Aspartic acid (Asp, D) at position 54, a
Glutamine (Gln, Q) at position 105, a Leucine (Leu, L) at position
78, an Arginine (Arg, R) at position 83 and a Glutamic acid (Glu,
E) at position 85 (said positions determined according to Kabat
numbering); and [1153] ii) the polypeptide binds protein F of hRSV
with the same, about the same, or a higher affinity (said affinity
as measured by surface plasmon resonance) and/or the polypeptide
has the same, about the same, or a higher potency (as defined
herein) compared to the polypeptide without the 3, 2 or 1 amino
acid difference.
[1154] A preferred trivalent polypeptide of the invention comprises
or essentially consists of SEQ ID NO: 78. Another preferred
trivalent polypeptide of the invention comprises or essentially
consists of SEQ ID NO: 79.
[1155] In another preferred aspect, the invention provides a
trivalent polypeptide chosen from the following polypeptides:
[1156] a) SEQ ID NO's: 159-161; [1157] b) polypeptides that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 159-161,
provided that: [1158] i) the amino acid sequence or Nanobody.RTM.
encompassed in said polypeptide has a Proline (Pro, P) at position
14, Arginine (Arg, R) at position 19, Leucine (Leu, L) at position
20 and/or Leucine (Leu, L) at position 108 (said positions
determined according to Kabat numbering); and [1159] ii) the
polypeptide binds protein F of hRSV with the same, about the same,
or a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the polypeptide has the same, about the same, or
a higher potency (as defined herein) compared to the polypeptide
without the 3, 2 or 1 amino acid difference.
[1160] Preferred trivalent polypeptides of the invention comprise
or essentially consist of one of SEQ ID NO's: 159-161.
[1161] In another preferred aspect, the invention provides a
trivalent polypeptide chosen from the following polypeptides:
[1162] a) SEQ ID NO's: 159-161; [1163] b) polypeptides that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 159-161,
provided that: [1164] i) the amino acid sequence or Nanobody.RTM.
encompassed in said polypeptide has a Praline (Pro, P) at position
14, Arginine (Arg, R) at position 19, Leucine (Leu, L) at position
20 and/or Leucine (Leu, L) at position 108; and in addition
Arginine (Arg, R) at position 83, Glutamic acid (Glu, E) at
position 85 and/or Glutamine (Gln, Q) at position 105 (said
positions determined according to Kabat numbering); and [1165] ii)
the polypeptide binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the polypeptide has the same, about the
same, or a higher potency (as defined herein) compared to the
polypeptide without the 3, 2 or 1 amino acid difference.
[1166] In another preferred aspect, the invention provides a
trivalent polypeptide chosen from the following polypeptides:
[1167] a) SEQ ID NO's: 159-461; [1168] b) polypeptides that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 159-161,
provided that: [1169] i) the amino acid sequence or Nanobody.RTM.
encompassed in said polypeptide has a Proline (Pro, P) at position
14, Arginine (Arg, R) at position 19, Leucine (Leu, L) at position
20 and/or Leucine (Leu, L) at position 108 and in addition Arginine
(Arg, R) at position 83, Glutamic acid (Glu, E) at position 85
and/or Glutamine (Gln, Q) at position 105 so that when the
polypeptide has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with: [1170] SEQ ID
NO: 159, the amino acid sequence or Nanobody.RTM. encompassed in
said polypeptide preferably has Arginine (Arg, R) at position 83
and Glutamine (Gln, Q) at position 105; [1171] SEQ ID NO: 160, the
amino acid sequence or Nanobody.RTM. encompassed in said
polypeptide preferably has Arginine (Arg, R) at position 83,
Glutamic add (Glu, E) at position 85 and Glutamine (Gln, Q) at
position 105; [1172] SEQ ID NO: 161, the amino acid sequence or
Nanobody.RTM. encompassed in said polypeptide preferably has
Arginine (Arg, R) at position 83 and Glutamic acid (Glu, E) at
position 85; [1173] (said positions determined according to Kabat
numbering); and [1174] ii) the polypeptide binds protein F of hRSV
with the same, about the same, or a higher affinity (said affinity
as measured by surface plasmon resonance) and/or the polypeptide
has the same, about the same, or a higher potency (as defined
herein) compared to the polypeptide without the 3, 2 or 1 amino
acid difference.
[1175] Preferred trivalent polypeptides of the invention comprise
or essentially consist of one of SEQ ID NO's: 159-161.
[1176] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 53, in which in at least one (preferably in two, more
preferably in all three) Nanobody.RTM./Nanobodies.RTM. that form(s)
part of SEQ ID NO: 53, one or more (such as two, three, four, five,
six, seven, eight, nine, ten, eleven or twelve) amino acid residues
have been mutated selected from the following: Val5Leu, Ala14Pro,
Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp.
[1177] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 53, in which in at least one (preferably in two, more
preferably in all three) Nanobody.RTM./Nanobodies.RTM. that form(s)
part of SEQ ID NO: 53, one or more (such as two, three, four, five,
six, seven, eight or nine) amino acid residues have been mutated
selected from the following: Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp.
[1178] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 53, in which in at least one (preferably in two, more
preferably in all three) Nanobody.RTM./Nanobodies.RTM. that form(s)
part of SEQ ID NO: 53, one or more (such as two, three or four)
amino acid residues have been mutated selected from the following:
Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu.
[1179] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 53, in which in at least one (preferably in two, more
preferably in all three) Nanobody.RTM./Nanobodies.RTM. that form(s)
part of SEQ ID NO: 53, one or more (such as two, three, four, five,
six or seven) amino acid residues have been mutated selected from
the following: Ala14Pro, Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Le.
[1180] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 53, in which in at least one (preferably in two, more
preferably in all three) Nanobody.RTM./Nanobodies.RTM. that form(s)
part of SEQ ID NO: 53, following amino acid residues have been
mutated: [1181] Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gln108Leu; [1182] Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu; [1183] Gly78Leu, Ala83Arg, Asp85Glu and
Arg105Gln; [1184] Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp; [1185] Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp; [1186] Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gly54Asp; [1187] Gly54Asp; [1188]
Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu; [1189] Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu and Ala83Arg; [1190] Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu and Asp85Glu; [1191] Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu and Arg105Gln; [1192] Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Asp85Glu; [1193]
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln;
[1194] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and
Arg105Gln; or [1195] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu,
Ala83Arg, Asp85Glu and Arg105Gln.
[1196] In another preferred aspect, the polypeptide of the
invention essentially consists of the amino add sequence of SEQ ID
NO: 77. In another preferred aspect, the polypeptide of the
invention essentially consists of the amino acid sequence of SEQ ID
NO: 78. In another preferred aspect, the polypeptide of the
invention essentially consists of the amino acid sequence of SEQ ID
NO: 79. In another preferred aspect, the polypeptide of the
invention essentially consists of one of SEQ ID NO's: 158-161.
[1197] During the production of the polypeptides of the invention,
a high level of pyro glutamate (pGlu) on the amino terminus was
detected by RP-HPLC. Levels of more than 15% pGlu were detected
following fermentation and the levels of pGlu were steadily
increasing upon storage during stability studies. Such a
modification leads to heterogeneity of the final product and needs
to be avoided. The control/prevention of pGlu formation is
therefore critical to keep therapeutic proteins within their set
specifications. Specific liquid formulations and/or storage
conditions are needed for proteins with an N-terminal Glutamic acid
thus minimizing the formation of pyro-Glutamic acid.
[1198] In the present invention, the possibility of pGlu
post-translational modification of the N-terminus was eliminated by
changing the N-terminal Glutamic acid (E) [HOOC--(CH2)2-protein]
into an Aspartic acid (D) [HOOC--CH2--protein] which lead to
increased product stability. Accordingly, the present invention
also relates to polypeptides as described above wherein the
Glutamic acid at position 1 is changed into an Aspartic acid.
[1199] The present invention provides a number of sequence
optimized polypeptides that show increased stability upon storage
during stability studies. Accordingly, the invention provides a
trivalent polypeptide as described above, wherein the first amino
acid (Glutamic acid) has been changed into Aspartic acid.
[1200] In one aspect, the invention provides a trivalent
polypeptide chosen from the following polypeptides: [1201] a) SEQ
ID NO's: 142-145 and 162-165; [1202] b) polypeptides that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 142-145 and
162-165, provided that: [1203] i) the first amino acid sequence or
Nanobody.RTM. encompassed in said polypeptide has an Aspartic acid
(Asp, D) at position 1; and [1204] ii) the polypeptide binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the polypeptide has the same, about the same, or a higher
potency (as defined herein) compared to the polypeptide without the
3, 2 or 1 amino acid difference.
[1205] A preferred trivalent polypeptide of the invention comprises
or essentially consists of SEQ ID NO: 142. Another preferred
trivalent polypeptide of the invention comprises or essentially
consists of SEQ ID NO: 143. Another preferred trivalent polypeptide
of the invention comprises or essentially consists of SEQ ID NO:
144. Another preferred trivalent polypeptide of the invention
comprises or essentially consists of SEQ ID NO: 145. Another
preferred trivalent polypeptide of the invention comprises or
essentially consists of one of SEQ ID NO's: 162-165.
[1206] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 53, in which the Glutamic acid at position 1 has been
changed into Aspartic acid (Glu1Asp).
[1207] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 77, in which the Glutamic acid at position 1 has been
changed into Aspartic acid (Glu1Asp).
[1208] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 78, in which the Glutamic acid at position 1 has been
changed into Aspartic acid (Glu1Asp).
[1209] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 79, in which the Glutamic acid at position 1 has been
changed into Aspartic acid (Glu1Asp).
[1210] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 158, in which the Glutamic acid at position 1 has been
changed into Aspartic acid (Glu1Asp).
[1211] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 159, in which the Glutamic acid at position 1 has been
changed into Aspartic acid (Glu1Asp).
[1212] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 160, in which the Glutamic acid at position 1 has been
changed into Aspartic acid (Glu1Asp).
[1213] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 161, in which the Glutamic acid at position 1 has been
changed into Aspartic acid (Glu1Asp).
[1214] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 53, in which in at least one (preferably in two, more
preferably in all three) Nanobody.RTM./Nanobodies.RTM. that form(s)
part of SEQ ID NO: 53, one or more (such as two, three, four, five,
six, seven, eight, nine, ten, eleven or twelve) amino acid residues
have been mutated selected from the following: Val5Leu, Ala14Pro,
Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp, and wherein the Glutamic acid at
position 1 has been changed into Aspartic acid (Glu1Asp).
[1215] Iin another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 53, in which in at least one (preferably in two, more
preferably in all three) Nanobody.RTM./Nanobodies.RTM. that form(s)
part of SEQ ID NO: 53, one or more (such as two, three, four, five,
six, seven, eight or nine) amino acid residues have been mutated
selected from the following: Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp, and wherein
the Glutamic acid at position 1 has been changed into Aspartic acid
(Glu1Asp).
[1216] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 53, in which in at least one (preferably in two, more
preferably in all three) Nanobody.RTM./Nanobodies.RTM. that form(s)
part of SEQ ID NO: 53, one or more (such as two, three or four)
amino acid residues have been mutated selected from the following:
Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu, and wherein the
Glutamic acid at position 1 has been changed into Aspartic acid
(Glu1Asp).
[1217] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 53, in which in at least one (preferably in two, more
preferably in all three) Nanobody.RTM./Nanobodies.RTM. that form(s)
part of SEQ ID NO: 53, one or more (such as two, three, four, five,
six or seven) amino acid residues have been mutated selected from
the following: Ala14Pro, Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu, and wherein the Glutamic acid at position
1 has been changed into Aspartic acid (Glu1Asp).
[1218] In another preferred aspect, the invention provides a
trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 53, in which in at least one (preferably in two, more
preferably in all three) Nanobody.RTM./Nanobodies.RTM. that form(s)
part of SEQ ID NO: 53, following amino acid residues have been
mutated: [1219] Glu1Asp [1220] Glu1Asp, Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu;
[1221] Glu1Asp, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu; [1222]
Glu1Asp, Gly78Leu, Ala83Arg, Asp85Glu and Arg105Gln; [1223]
Glu1Asp, Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp; [1224] Glu1Asp, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp; [1225] Glu1Asp,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54Asp; [1226]
Glu1Asp and Gly54Asp; [1227] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu
and Gln108Leu; [1228] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Ala83Arg; [1229] Glu1Asp, Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Asp85Glu; [1230] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu and Arg105Gln; [1231] Glu1Asp,
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Asp85Glu;
[1232] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg
and Arg105Gln; [1233] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Asp85Glu and Arg105Gln; or [1234] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu and
Arg105Gln.
[1235] In another preferred aspect, the polypeptide of the
invention essentially consists of the amino acid sequence of SEQ ID
NO: 142. In another preferred aspect, the polypeptide of the
invention essentially consists of the amino acid sequence of SEQ ID
NO: 143. In another preferred aspect, the polypeptide of the
invention essentially consists of the amino acid sequence of SEQ ID
NO: 144. In another preferred aspect, the polypeptide of the
invention essentially consists of the amino acid sequence of SEQ ID
NO: 145. In another preferred aspect, the polypeptide of the
invention essentially consists of one of SEQ ID NO's: 162-165.
[1236] Polypeptides with the amino acid sequences and polypeptide
sequences as described above have shown advantageous properties for
use as prophylactic, therapeutic and/or pharmacologically active
agents such as e.g. improved stability, less immunogenicity,
improved binding characteristics (suitably measured and/or
expressed as a K.sub.D-value (actual or apparent), a K.sub.A-value
(actual or apparent), a k.sub.on-rate and/or a k.sub.off-rate, or
alternatively as an IC.sub.50 value, as further described herein),
improved affinity and/or improved avidity for protein F of hRSV
and/or improved efficacy and/or potency for neutralizing hRSV.
[1237] More in particular, these polypeptides and compounds of the
invention can bind to protein F of hRSV with an affinity (suitably
measured and/or expressed as a K.sub.D-value (actual or apparent),
a K.sub.A-value (actual or apparent), a k.sub.on-rate and/or a
k.sub.off-rate, or alternatively as an IC.sub.50 value, as further
described herein) preferably such that they': [1238] bind to
protein F of hRSV with a dissociation constant (K.sub.D) of 100 nM
to 0.1 nM or less, [1239] preferably 10 nM to 0.1 nM or less, more
preferably 1 nM to 0.1 nM or less; and/or such that they: [1240]
bind to protein F of hRSV with a k.sub.on-rate of between 10.sup.4
M.sup.-1S.sup.-1 to about 10.sup.7 M.sup.-1s.sup.-1, preferably
between 10.sup.5 M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1,
more preferably about 10.sup.6 M.sup.-1s.sup.-1 or more; and/or
such that they: [1241] bind to protein F of hRSV with a k.sub.off
rate between 10.sup.-2 s.sup.-1 (t.sub.1/2=0.69 s) and 10.sup.-4
s.sup.-1 (providing a near irreversible complex with a t.sub.1/2 of
multiple days), preferably between 10.sup.-3 s.sup.-1 and 10.sup.-4
s.sup.-1, more preferably between 5.times.10.sup.-3 s.sup.-1 and
10.sup.-4 s.sup.-1, or lower;
[1242] Some preferred IC50 values for binding of the polypeptides
of the invention to protein F of hRSV will become clear from the
further description and examples herein.
[1243] Assays to determine the IC50 include competition assays such
as competition ELISA (e.g. competition with Synagis.RTM. or its Fab
fragment) or more preferably neutralization assays such as the
microneutralization assay described by Anderson et al. (1985, J.
Clin. Microbiol. 22: 1050-1052), modification of this assay as
described in example 6, or a plaque reduction assay as described by
Johnson et al. (1997, J. Inf. Dis. 176: 1215-1224), and
modifications thereof.
[1244] For example, in a competition assay with Synagis.RTM., the
polypeptides of the invention may have IC50 values between 1 nM and
100 nM, preferably between 10 nM and 50 nM, or less.
[1245] For example, in a microneutralization assay of RSV strain
Long (such as e.g. described in Example 6) the polypeptides of the
invention may have IC50 values between 10 pM and 1000 pM,
preferably between 10 pM and 250 pM, more preferably between 50 pM
and 200 pM or less. In a microneutralization assay, the
polypeptides of the invention may have IC50 values that are at
least the same and preferably better, at least ten times better,
preferably twenty times better, more preferably fifty times better,
even more preferably sixty, seventy, eighty or more times better
compared to the IC50 value obtained with Synagis.RTM..
[1246] The invention also relates to a monovalent polypeptide or
construct (also referred to as "monovalent polypeptide of the
invention" or "monovalent construct of the invention"), comprising
or essentially consisting of one amino acid sequence or
Nanobody.RTM. of the invention. Preferred monovalent constructs of
the invention comprise or essentially consist of one of SEQ ID
NO's: 60-76, such as one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76,
such as e.g. SEQ ID NO's: 65 or 75; one of SEQ ID NO's: 138-141;
one of SEQ ID NO's: 146-153; or one of SEQ ID NO's: 154-157. Such a
monovalent constructs, as well as the amino acid sequences and
Nanobodies.RTM. of the invention can be used for the preparation of
a polypeptide of the invention, such as e.g. the multivalent
polypeptides of the invention described above.
[1247] The polypeptides of the invention can generally be prepared
by a method which comprises at least the step of suitably linking
the amino acid sequence, Nanobody.RTM. or monovalent construct of
the invention to one or more further amino acid sequences,
Nanobodies.RTM. or monovalent constructs of the invention,
optionally via the one or more suitable linkers, so as to provide
the polypeptide of the invention. Polypeptides of the invention can
also be prepared by a method which generally comprises at least the
steps of providing a nucleic acid that encodes a polypeptide of the
invention, expressing said nucleic acid in a suitable manner, and
recovering the expressed polypeptide of the invention. Such methods
can be performed in a manner known per se, which will be clear to
the skilled person, for example on the basis of the methods and
techniques further described herein.
[1248] A method for preparing multivalent, multiparatopic and/or
multispecific amino acids or polypeptides of the invention may
comprise at least the steps of linking two or more monovalent amino
acid sequences or monovalent constructs of the invention and for
example one or more linkers together in a suitable manner. The
monovalent constructs (and linkers) can be coupled by any method
known in the art and as further described herein. Preferred
techniques include the linking of the nucleic acid sequences that
encode the monovalent constructs (and linkers) to prepare a genetic
construct that expresses the multivalent, multiparatopic and/or
multispecific amino acid sequence or polypeptide. Techniques for
linking amino acid sequences or nucleic acid sequences will be
clear to the skilled person, and reference is again made to the
standard handbooks, such as Sambrook et al. and Ausubel et al.,
mentioned above, as well as the Examples below.
[1249] Accordingly, the present invention also relates to the use
of an amino acid sequence, a Nanobody.RTM. or a monovalent
construct of the invention in preparing a multivalent polypeptide
of the invention. The method for the preparation of a multivalent
polypeptide will comprise the linking of an amino acid sequence, a
Nanobody.RTM. or a monovalent construct of the invention to at
least one further amino acid sequence, Nanobody.RTM. or monovalent
construct of the invention, optionally via one or more linkers. The
amino acid sequence, Nanobody.RTM. or monovalent construct is then
used as a binding domain or binding unit in providing and/or
preparing the multivalent polypeptide comprising two (e.g. in a
bivalent polypeptide), three (e.g. in a trivalent polypeptide) or
more (e.g. in a multivalent polypeptide) binding units. In this
respect, the amino acid sequence, Nanobody.RTM. and monovalent
construct may be used as a binding domain or binding unit in
providing and/or preparing a multivalent and preferably bivalent or
trivalent polypeptide of the invention comprising two, three or
more binding units. Preferably, the binding domains or binding
units are linked via a linker such that the multivalent polypeptide
preferably exhibits intramolecular binding compared to
intermolecular binding. Also preferably the multivalent polypeptide
can simultaneously bind both or all three binding sites on the F
protein of RSV.
[1250] Accordingly, the present invention also relates to the use
of an amino acid sequence or a Nanobody.RTM. of the invention (as
described above) in preparing a multivalent polypeptide. The method
for the preparation of the multivalent polypeptide will comprise
the linking of the amino acid sequence or Nanobody.RTM. of the
invention to at least one further amino acid sequences or
Nanobody.RTM. of the invention, optionally via one or more
linkers.
[1251] In a preferred aspect, the present invention relates to the
use of an amino acid sequence chosen from the following: [1252] a)
SEQ ID NO's: 60-76; [1253] b) amino acid sequences that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 60-76,
provided that: [1254] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105 (said position determined according to
Kabat numbering); and [1255] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference, in preparing
a multivalent polypeptide. The method for the preparation of the
multivalent polypeptide will comprise the linking of said amino
acid sequence to at least one further amino acid sequences,
optionally via one or more linkers.
[1256] In a preferred aspect, the amino acid sequence used in
preparing a multivalent polypeptide comprises or essentially
consists of one of SEQ ID NO's: 60-76.
[1257] In another preferred aspect, the present invention relates
to the use of an amino acid sequence chosen from the following:
[1258] a) SEQ ID NO's: 62, 65, 67, 68, 75 and 76; [1259] b) amino
acid sequences that have no more than 3, preferably no more than 2,
more preferably no more than 1 amino acid difference with one of
SEQ ID NO's: 62, 65, 67, 68, 75 and 76, provided that: [1260] i)
the amino acid sequence has a Glutamine (Gln, Q) at position 105, a
Leucine (Leu, L) at position 78 and/or a Arginine (Arg, R) at
position 83 (said positions determined according to Kabat
numbering); and [1261] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference, in preparing a multivalent
polypeptide. The method for the preparation of the multivalent
polypeptide will comprise the linking of said amino acid sequence
to at least one further amino acid sequences, optionally via one or
more linkers.
[1262] In another preferred aspect, the present invention relates
to the use of an amino acid sequence chosen from the following:
[1263] a) SEQ ID NO's: 62, 65, 67, 68, 75 and 76; or [1264] b)
amino acid sequences that have no more than 3, preferably no more
than 2, more preferably no more than 1 amino add difference with
one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76, provided that:
[1265] i) the amino acid sequence has a Glutamine (Gln, Q) at
position 105, a Leucine (Leu, L) at position 78 and an Arginine
(Arg, R) at position 83 (said positions determined according to
Kabat numbering); and [1266] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference, in preparing
a multivalent polypeptide. The method for the preparation of the
multivalent polypeptide will comprise the linking of said amino
acid sequence to at least one further amino acid sequences,
optionally via one or more linkers.
[1267] In a preferred aspect, the amino acid sequence used in
preparing a multivalent polypeptide comprises or essentially
consists of one of SEQ ID NO: 62, 65, 67, 68, 75 and 76.
[1268] In another preferred aspect, the present invention relates
to the use of an amino acid sequence chosen from the following:
[1269] a) SEQ ID NO's: 65 and 76; [1270] b) amino acid sequences
that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 65 and 76, provided that: [1271] i) the amino acid sequence
has an Aspartic acid (Asp, D) at position 54, a Glutamine (Gln, Q)
at position 105, a Leucine (Leu, L) at position 78 and/or an
Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [1272] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference, in
preparing a multivalent polypeptide. The method for the preparation
of the multivalent polypeptide will comprise the linking of said
amino acid sequence to at least one further amino acid sequences,
optionally via one or more linkers.
[1273] In another preferred aspect, the present invention relates
to the use of an amino acid sequence chosen from the following:
[1274] a) SEQ ID NO's: 65 and 76; [1275] b) amino acid sequences
that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino add difference with one of SEQ ID
NO's: 65 and 76, provided that: [1276] i) the amino acid sequence
has an Aspartic acid (Asp, D) at position 54, a Glutamine (Gln, Q)
at position 105, a Leucine (Leu, L) at position 78 and an Arginine
(Arg, R) at position 83 (said positions determined according to
Kabat numbering); and [1277] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference, in preparing
a multivalent polypeptide. The method for the preparation of the
multivalent polypeptide will comprise the linking of said amino
acid sequence to at least one further amino acid sequences,
optionally via one or more linkers.
[1278] In a preferred aspect, the amino acid sequence used in
preparing a multivalent polypeptide comprises or essentially
consists of SEQ ID NO: 65. In another preferred aspect, the amino
acid sequence used in preparing a multivalent polypeptide comprises
or essentially consists of SEQ ID NO: 76.
[1279] In a preferred aspect, the present invention relates to the
use of an amino acid sequence chosen from the following: [1280] a)
SEQ ID NO's: 146-153; [1281] b) amino acid sequences that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 146-153,
provided that: [1282] i) the amino acid sequence has a Proline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and/or Leucine (Leu, L) at position 108
(said positions determined according to Kabat numbering); and
[1283] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference. in preparing a multivalent
polypeptide. The method for the preparation of the multivalent
polypeptide will comprise the linking of said amino acid sequence
to at least one further amino acid sequences, optionally via one or
more linkers.
[1284] In a preferred aspect, the amino acid sequence used in
preparing a multivalent polypeptide comprises or essentially
consists of one of SEQ ID NO's: 146-153.
[1285] In another preferred aspect, the present invention relates
to the use of an amino acid sequence chosen from the following:
[1286] a) SEQ ID NO's: 146-149 and 151-153; [1287] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 146-149 and 151-153, provided that: [1288] i) the amino acid
sequence has a Praline (Pro, P) at position 14, Arginine (Arg, R)
at position 19, Leucine (Leu, L) at position 20 and/or Leucine
(Leu, L) at position 108; and in addition Arginine (Arg, R) at
position 83, Glutamic acid (Glu, E) at position 85 and/or Glutamine
(Gln, Q) at position 105 (said positions determined according to
Kabat numbering); and [1289] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference, in preparing
a multivalent polypeptide. The method for the preparation of the
multivalent polypeptide will comprise the linking of said amino
acid sequence to at least one further amino acid sequences,
optionally via one or more linkers.
[1290] In another preferred aspect, the present invention relates
to the use of an amino acid sequence chosen from the following:
[1291] a) SEQ ID NO's: 146-149 and 151-153; [1292] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 146-149 and 151-153, provided that: [1293] i) the amino acid
sequence has a Proline (Pro, P) at position 14, Arginine (Arg, R)
at position 19, Leucine (Leu, L) at position 20 and/or Leucine
(Leu, L) at position 108 and in addition Arginine (Arg, R) at
position 83, Glutamic acid (Glu, E) at position 85 and/or Glutamine
(Gln, Q) at position 105 so that when the amino acid sequence has
no more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with: [1294] SEQ ID NO: 146, the amino
acid sequence preferably has Glutamine (Gln, Q) at position 105;
[1295] SEQ ID NO: 147, the amino acid sequence preferably has
Arginine (Arg, R) at position 83 and Glutamine (Gln, Q) at position
105; [1296] SEQ ID NO: 148, the amino acid sequence preferably has
Glutamic acid (Glu, E) at position 85 and Glutamine (Gln, Q) at
position 105; [1297] SEQ ID NO: 149, the amino acid sequence
preferably has Arginine (Arg, R) at position 83, Glutamic acid
(Glu, E) at position 85 and Glutamine (Gln, Q) at position 105;
[1298] SEQ ID NO: 151, the amino acid sequence preferably has
Arginine (Arg, R) at position 83; [1299] SEQ ID NO: 152, the amino
acid sequence preferably has Glutamic acid (Glu, E) at position 85;
[1300] SEQ ID NO: 153, the amino acid sequence preferably has
Arginine (Arg, R) at position 83 and Glutamic acid (Glu, E) at
position 85; (said positions determined according to Kabat
numbering); and [1301] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference. in preparing a multivalent
polypeptide. The method for the preparation of the multivalent
polypeptide will comprise the linking of said amino acid sequence
to at least one further amino acid sequences, optionally via one or
more linkers.
[1302] In a preferred aspect, the amino acid sequence used in
preparing a multivalent polypeptide comprises or essentially
consists of one of SEQ ID NO's: 146-149 and 151-153.
[1303] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which one or more (such as two, three,
four, five, six, seven, eight or nine, ten, eleven or twelve) amino
acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp, in preparing
a multivalent polypeptide.
[1304] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which one or more (such as two, three,
four, five, six, seven, eight or nine) amino acid residues have
been mutated selected from the following: Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54Asp, in preparing a multivalent polypeptide.
[1305] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which one or more (such as two, three
or four) amino acid residues have been mutated selected from the
following: Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu, in preparing
a multivalent polypeptide.
[1306] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which one or more (such as two, three,
four, five, six or seven) amino acid residues have been mutated
selected from the following: Ala14Pro, Ser19Arg, Ile20Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu, in preparing a
multivalent polypeptide.
[1307] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which following amino acid residues
have been mutated: [1308] Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu; [1309] Ala83Arg,
Asp85Glu, Arg105Gln and Gln108Leu; [1310] Gly78Leu, Ala83Arg,
Asp85Glu and Arg105Gln; [1311] Val5Leu, Ala14Pro, Glu44Gly,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and [1312]
Gly54Asp; [1313] Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54Asp; [1314] Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gly54Asp; [1315] Gly54Asp; [1316] Ala14Pro, Ser19Arg, Ile20Leu and
Gln108Leu; [1317] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Ala83Arg; [1318] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Asp85Glu; [1319] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Arg105Gln; [1320] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg
and Asp85Glu; [1321] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu,
Ala83Arg and Arg105Gln; [1322] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Asp85Glu and Arg105Gln; or [1323] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu and Arg105Gln, in preparing
a multivalent polypeptide.
[1324] In another preferred aspect, the present invention relates
to the use of an amino acid sequence chosen from the above wherein
the amino acid (Glutamic acid) at position I has been changed into
Aspartic acid, in preparing a multivalent polypeptide.
[1325] In this respect, the present invention relates to the use of
an amino acid sequence chosen from the following: [1326] a) SEQ ID
NO's: 138-141 and 154-157; [1327] b) amino acid sequences that have
no more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 138-141 and
154-157, provided that: [1328] i) the amino acid sequence has a
Aspartic acid (Asp, D) at position 1 (said position determined
according to Kabat numbering); and [1329] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference, in
preparing a multivalent polypeptide. The method for the preparation
of the multivalent polypeptide will comprise the linking of said
amino acid sequence to at least one further amino acid sequences,
optionally via one or more linkers.
[1330] In a preferred aspect, the amino acid sequence used in
preparing a multivalent polypeptide comprises or essentially
consists of SEQ ID NO: 138. In another preferred aspect, the amino
acid sequence used in preparing a multivalent polypeptide comprises
or essentially consists of SEQ ID NO: 139. In another preferred
aspect, the amino acid sequence used in preparing a multivalent
polypeptide comprises or essentially consists of SEQ ID NO: 140. In
another preferred aspect, the amino acid sequence used in preparing
a multivalent polypeptide comprises or essentially consists of SEQ
ID NO: 141. In another preferred aspect, the amino acid sequence
used in preparing a multivalent polypeptide comprises or
essentially consists of one of SEQ ID NO's: 154-157.
[1331] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which Glutamic acid at position 1 has
been changed into Aspartic acid, in preparing a multivalent
polypeptide.
[1332] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 62, in which Glutamic acid at position 1 has
been changed into Aspartic acid, in preparing a multivalent
polypeptide.
[1333] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 65, in which Glutamic acid at position 1 has
been changed into Aspartic acid, in preparing a multivalent
polypeptide.
[1334] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 76, in which Glutamic acid at position 1 has
been changed into Aspartic acid, in preparing a multivalent
polypeptide.
[1335] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 75, in which Glutamic acid at position 1 has
been changed into Aspartic acid, in preparing a multivalent
polypeptide.
[1336] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 147, in which Glutamic acid at position 1
has been changed into Aspartic acid, in preparing a multivalent
polypeptide.
[1337] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 149, in which Glutamic acid at position 1
has been changed into Aspartic acid, in preparing a multivalent
polypeptide.
[1338] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 153, in which Glutamic acid at position 1
has been changed into Aspartic acid, in preparing a multivalent
polypeptide.
[1339] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which one or more (such as two, three,
four, five, six, seven, eight or nine, ten, eleven or twelve) amino
acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp, and wherein
Glutamic acid at position 1 has been changed into Aspartic acid, in
preparing a multivalent polypeptide.
[1340] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which one or more (such as two, three,
four, five, six, seven, eight or nine) amino acid residues have
been mutated selected from the following: Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54Asp, and wherein Glutamic acid at position 1 has been changed
into Aspartic acid, in preparing a multivalent polypeptide.
[1341] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which one or more (such as two, three
or four) amino acid residues have been mutated selected from the
following: Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu, and wherein
Glutamic acid at position 1 has been changed into Aspartic acid, in
preparing a multivalent polypeptide.
[1342] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which one or more (such as two, three,
four, five, six or seven) amino acid residues have been mutated
selected from the following: Ala14Pro, Ser19Arg, Ile20Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu, and wherein Glutamic
acid at position 1 has been changed into Aspartic acid, in
preparing a multivalent polypeptide.
[1343] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which following amino acid residues
have been mutated: [1344] Glu1Asp; [1345] Glu1Asp, Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu; [1346] Glu1Asp, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu; [1347] Glu1Asp, Gly78Leu, Ala83Arg, Asp85Glu and
Arg105Gln; [1348] Glu1Asp, Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp; [1349]
Glu1Asp, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp;
[1350] Glu1Asp, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gly54Asp; [1351] Glu1Asp and Gly54Asp; [1352] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu and Gln108Leu; [1353] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu and Ala83Arg; [1354] Glu1Asp,
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and Asp85Glu; [1355]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and Arg105Gln;
[1356] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg
and Asp85Glu; [1357] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg and Arg105Gln; [1358] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and Arg105Gln; or [1359]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg,
Asp85Glu and Arg105Gln, in preparing a multivalent polypeptide.
[1360] The present invention also relates to the use of two amino
acid sequences and/or Nanobodies.RTM. of the invention (as
described above) in preparing a bivalent polypeptide. The method
for the preparation of the bivalent polypeptide will comprise the
linking of the amino acid sequences and/or Nanobodies.RTM. of the
invention, optionally via a linker.
[1361] Accordingly, in a preferred aspect, the present invention
relates to the use of two (preferably identical) amino acid
sequences chosen from the following: [1362] a) SEQ ID NO's: 60-76;
[1363] b) amino acid sequences that have no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with one of SEQ ID NO's: 60-76, provided that: [1364] i)
the amino acid sequence has a Glutamine (Gln, Q) at position 105
(said position determined according to Kabat numbering); and [1365]
ii) the amino acid sequence binds protein F of hRSV with the same,
about the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence without the 3, 2 or 1 amino
acid difference, in preparing a bivalent polypeptide. The method
for the preparation of the bivalent polypeptide will comprise the
linking of said amino acid sequences to each other, optionally via
a linker.
[1366] In a preferred aspect, the two amino acid sequences used in
preparing the bivalent polypeptide comprise or essentially consist
of one of SEQ ID NO's: 60-76.
[1367] In another preferred aspect, the present invention relates
to the use of two (preferably identical) amino acid sequences
chosen from the following: [1368] a) SEQ ID NO's: 62, 65, 67, 68,
75 and 76; [1369] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76,
provided that: [1370] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105, a Leucine (Leu, L) at position 78 and/or
a Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [1371] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference, in
preparing a bivalent polypeptide. The method for the preparation of
the bivalent polypeptide will comprise the linking of said amino
acid sequences to each other, optionally via a linker.
[1372] In another preferred aspect, the present invention relates
to the use of two (preferably identical) amino acid sequences
chosen from the following: [1373] a) SEQ ID NO's: 62, 65, 67, 68,
75 and 76; [1374] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76,
provided that: [1375] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105, a Leucine (Leu, L) at position 78 and an
Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [1376] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference, in
preparing a bivalent polypeptide. The method for the preparation of
the bivalent polypeptide will comprise the linking of said amino
acid sequences to each other, optionally via a linker.
[1377] In a preferred aspect, the two amino acid sequences used in
preparing a bivalent polypeptide comprise or essentially consist of
one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76.
[1378] In another preferred aspect, the present invention relates
to the use of two (preferably identical) amino acid sequences
chosen from the following: [1379] a) SEQ ID NO's: 65 and 76; [1380]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 65 and 76, provided that: [1381] i) the
amino acid sequence has an Aspartic acid (Asp, D) at position 54, a
Glutamine (Gln, Q) at position 105, a Leucine (Leu, L) at position
78 and/or an Arginine (Arg, R) at position 83 (said positions
determined according to Kabat numbering); and [1382] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference, in preparing a bivalent polypeptide. The method for the
preparation of the bivalent polypeptide will comprise the linking
of said amino acid sequences to each other, optionally via a
linker.
[1383] In another preferred aspect, the present invention relates
to the use of two (preferably identical) amino acid sequences
chosen from the following: [1384] a) SEQ ID NO's: 65 and 76; [1385]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 65 and 76, provided that: [1386] i) the
amino acid sequence has an Aspartic acid (Asp, D) at position 54, a
Glutamine (Gln, Q) at position 105, a Leucine (Leu, L) at position
78 and an Arginine (Arg, R) at position 83 (said positions
determined according to Kabat numbering); and [1387] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference, in preparing a bivalent polypeptide. The method for the
preparation of the bivalent polypeptide will comprise the linking
of said amino acid sequences to each other, optionally via a
linker.
[1388] In another preferred aspect, the present invention relates
to the use of two (preferably identical) amino acid sequences
chosen from the following: [1389] a) SEQ ID NO's: 146-153; [1390]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 146-153, provided that: [1391] i) the
amino acid sequence has a Proline (Pro, P) at position 14, Arginine
(Arg, R) at position 19, Leucine (Leu, L) at position 20 and/or
Leucine (Leu, L) at position 108 (said positions determined
according to Kabat numbering); and [1392] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference. in
preparing a bivalent polypeptide. The method for the preparation of
the bivalent polypeptide will comprise the linking of said amino
acid sequence to at least one further amino acid sequence,
optionally via one or more linkers.
[1393] In a preferred aspect, the amino acid sequences used in
preparing a bivalent polypeptide comprises or essentially consists
of one of SEQ ID NO's: 146-153.
[1394] In another preferred aspect, the present invention relates
to the use of two (preferably identical) amino acid sequences
chosen from the following: [1395] a) SEQ ID NO's: 146-149 and
151-153; [1396] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 146-149 and 151-153,
provided that: [1397] i) the amino acid sequence has a Praline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and/or Leucine (Leu, L) at position 108;
and in addition Arginine (Arg, R) at position 83, Glutamic acid
(Glu, E) at position 85 and/or Glutamine (Girt, Q) at position 105
(said positions determined according to Kabat numbering); and
[1398] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference, in preparing a bivalent polypeptide.
The method for the preparation of the bivalent polypeptide will
comprise the linking of said amino add sequence to at least one
further amino acid sequence, optionally via one or more
linkers.
[1399] In another preferred aspect, the present invention relates
to the use of two (preferably identical) amino acid sequences
chosen from the following: [1400] a) SEQ ID NO's: 146-149 and
151-153; [1401] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 146-149 and 151-153,
provided that: [1402] i) the amino acid sequence has a Proline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and/or Leucine (Leu, L) at position 108 and
in addition Arginine (Arg, R) at position 83, Glutamic acid (Glu,
E) at position 85 and/or Glutamine (Gln, Q) at position 105 so that
when the amino acid sequence has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with:
[1403] SEQ ID NO: 146, the amino acid sequence preferably has
Glutamine (Gln, Q) at position 105; [1404] SEQ ID NO: 147, the
amino acid sequence preferably has Arginine (Arg, R) at position 83
and Glutamine (Gln, Q) at position 105; [1405] SEQ ID NO: 148, the
amino acid sequence preferably has Glutamic acid (Glu, E) at
position 85 and Glutamine (Gln, Q) at position 105; [1406] SEQ ID
NO: 149, the amino acid sequence preferably has Arginine (Arg, R)
at position 83, Glutamic acid (Glu, E) at position 85 and Glutamine
(Gln, Q) at position 105; [1407] SEQ ID NO: 151, the amino acid
sequence preferably has Arginine (Arg, R) at position 83; [1408]
SEQ ID NO: 152, the amino acid sequence preferably has Glutamic
acid (Glu, E) at position 85; [1409] SEQ ID NO: 153, the amino acid
sequence preferably has Arginine (Arg, R) at position 83 and
Glutamic acid (Glu, E) at position 85; [1410] (said positions
determined according to Kabat numbering); and [1411] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference. in preparing a bivalent polypeptide. The method for the
preparation of the bivalent polypeptide will comprise the linking
of said amino acid sequence to at least one further amino acid
sequences, optionally via one or more linkers.
[1412] In a preferred aspect, the amino acid sequences used in
preparing a bivalent polypeptide comprises or essentially consists
of one of SEQ ID NO's: 146-149 and 151-153.
[1413] In another preferred aspect, the present invention relates
to the use of two (preferably identical) amino acid sequences that
comprises or essentially consists of SEQ ID NO: 5, in which one or
more (such as two, three, four, five, six, seven, eight or nine,
ten, eleven or twelve) amino acid residues have been mutated
selected from the following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu,
Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp, in preparing a bivalent polypeptide.
[1414] In another preferred aspect, the present invention relates
to the use of two (preferably identical) amino acid sequences that
comprises or essentially consists of SEQ ID NO: 5, in which one or
more (such as two, three, four, five, six, seven, eight or nine)
amino acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp, in preparing a bivalent
polypeptide.
[1415] In another preferred aspect, the present invention relates
to the use of two (preferably identical) amino acid sequences that
comprises or essentially consists of SEQ ID NO: 5, in which one or
more (such as two, three or four) amino acid residues have been
mutated selected from the following: Ala14Pro, Ser19Arg, Ile20Leu
and Gln108Leu, in preparing a bivalent polypeptide.
[1416] In another preferred aspect, the present invention relates
to the use of two (preferably identical) amino acid sequences that
comprises or essentially consists of SEQ ID NO: 5, in which one or
more (such as two, three, four, five, six or seven) amino acid
residues have been mutated selected from the following: Ala14Pro,
Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu, in
preparing a bivalent polypeptide.
[1417] In another preferred aspect, the present invention relates
to the use of two (preferably identical) amino acid sequences that
comprises or essentially consists of SEQ ID NO: 5, in which
following amino acid residues have been mutated: [1418] Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu; [1419] Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu;
[1420] Gly78Leu, Ala83Arg, Asp85Glu and Arg105Gln; [1421] Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp; [1422] Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp; [1423] Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gly54Asp; or [1424] Gly54Asp; [1425] Ala14Pro,
Ser19Arg, Ile20Leu and Gln108Leu; [1426] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Ala83Arg; [1427] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Asp85Glu; [1428] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Arg105Gln; [1429] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg and Asp85Glu; [1430] Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln; [1431]
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and Arg105Gln; or
[1432] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu
and Arg105Gln, in preparing a bivalent polypeptide.
[1433] In another preferred aspect, the present invention relates
to the use of an amino acid sequence chosen from the above wherein
the amino acid (Glutamic acid) at position 1 has been changed into
Aspartic acid, in preparing a bivalent polypeptide.
[1434] In this respect, the present invention relates to the use of
an amino acid sequence chosen from the following: [1435] a) SEQ ID
NO's: 138-141 and 154-157; [1436] b) amino acid sequences that have
no more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 138-141 and
154-157, provided that: [1437] i) the amino acid sequence has a
Aspartic acid (Asp, D) at position 1 (said position determined
according to Kabat numbering); and [1438] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference, in
preparing a bivalent polypeptide. The method for the preparation of
the bivalent polypeptide will comprise the linking of said amino
acid sequence to at least one further amino acid sequences,
optionally via one or more linkers.
[1439] In a preferred aspect, the amino acid sequence used in
preparing a bivalent polypeptide comprises or essentially consists
of SEQ ID NO: 138. In another preferred aspect, the amino acid
sequence used in preparing a bivalent polypeptide comprises or
essentially consists of SEQ ID NO: 139. In another preferred
aspect, the amino acid sequence used in preparing a bivalent
polypeptide comprises or essentially consists of SEQ ID NO: 140. In
another preferred aspect, the amino acid sequence used in preparing
a bivalent polypeptide comprises or essentially consists of SEQ ID
NO: 141. In another preferred aspect, the amino acid sequence used
in preparing a bivalent polypeptide comprises or essentially
consists of SEQ ID NO: 154-457.
[1440] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which Glutamic acid at position I has
been changed into Aspartic acid, in preparing a bivalent
polypeptide.
[1441] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 62, in which Glutamic acid at position 1 has
been changed into Aspartic acid, in preparing a bivalent
polypeptide.
[1442] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 65, in which Glutamic acid at position 1 has
been changed into Aspartic acid, in preparing a bivalent
polypeptide.
[1443] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 76, in which Glutamic acid at position 1 has
been changed into Aspartic acid, in preparing a bivalent
polypeptide.
[1444] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 75, in which Glutamic acid at position 1 has
been changed into Aspartic acid, in preparing a bivalent
polypeptide.
[1445] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 147, in which Glutamic acid at position 1
has been changed into Aspartic acid, in preparing a bivalent
polypeptide.
[1446] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 149, in which Glutamic acid at position 1
has been changed into Aspartic acid, in preparing a bivalent
polypeptide.
[1447] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 153, in which Glutamic acid at position 1
has been changed into Aspartic acid, in preparing a bivalent
polypeptide.
[1448] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which one or more (such as two, three,
four, five, six, seven, eight or nine, ten, eleven or twelve) amino
acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp, and wherein
Glutamic add at position 1 has been changed into Aspartic acid, in
preparing a bivalent polypeptide.
[1449] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which one or more (such as two, three,
four, five, six, seven, eight or nine) amino acid residues have
been mutated selected from the following: Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Gln, Gln108Leu and
Gly54Asp, and wherein Glutamic acid at position 1 has been changed
into Aspartic acid, in preparing a bivalent polypeptide.
[1450] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which one or more (such as two, three
or four) amino acid residues have been mutated selected from the
following: Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu, and wherein
Glutamic acid at position 1 has been changed into Aspartic acid, in
preparing a bivalent polypeptide.
[1451] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which one or more (such as two, three,
four, five, six or seven) amino acid residues have been mutated
selected from the following: Ala14Pro, Ser19Arg, Ile20Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu, and wherein Glutamic
acid at position 1 has been changed into Aspartic acid, in
preparing a bivalent polypeptide.
[1452] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which following amino acid residues
have been mutated: [1453] Glu1Asp; [1454] Glu1Asp, Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu; [1455] Glu1Asp, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu; [1456] Glu1Asp, Gly78Leu, Ala83Arg, Asp85Glu and
Arg105Gln; [1457] Glu1Asp, Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp; [1458]
Glu1Asp, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp;
[1459] Glu1Asp, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gly54Asp; [1460] Glu1Asp and Gly54Asp; [1461] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu and Gln108Leu; [1462] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu and Ala83Arg; [1463] Glu1Asp,
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and Asp85Glu; [1464]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and Arg105Gln;
[1465] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg
and Asp85Glu; [1466] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg and Arg105Gln; [1467] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and Arg105Gln; or [1468]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg,
Asp85Glu and Arg105Gln, in preparing a bivalent polypeptide.
[1469] The present invention also relates to the use of three amino
acid sequences and/or Nanobodies.RTM. of the invention (as
described above) in preparing a trivalent polypeptide. The method
for the preparation of the trivalent polypeptide will comprise the
linking of the amino acid sequences and/or Nanobodies.RTM. of the
invention, optionally via one or two linkers.
[1470] In a preferred aspect, the present invention relates to the
use of three (preferably identical) amino acid sequences chosen
from the following: [1471] a) SEQ ID NO's: 50-76; [1472] b) amino
acid sequences that have no more than 3, preferably no more than 2,
more preferably no more than 1 amino acid difference with one of
SEQ ID NO's: 60-76, provided that: [1473] i) the amino acid
sequence has a Glutamine (Gln, Q) at position 105 (said position
determined according to Kabat numbering); and [1474] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference, in preparing a trivalent polypeptide. The method for
the preparation of the trivalent polypeptide will comprise the
linking of said amino acid sequences to each other, optionally via
one or two linkers.
[1475] In a preferred aspect, the three amino acid sequences used
in preparing the trivalent polypeptide comprise or essentially
consist of one of SEQ ID NO's: 60-76.
[1476] In another preferred aspect, the present invention relates
to the use of three (preferably identical) amino acid sequences
chosen from the following: [1477] a) SEQ ID NO's: 62, 65, 67, 68,
75 and 76; [1478] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76,
provided that: [1479] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105, a Leucine (Leu, L) at position 78 and/or
a Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [1480] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference, in
preparing a trivalent polypeptide. The method for the preparation
of the trivalent polypeptide will comprise the linking of said
amino acid sequences to each other, optionally via one or two
linkers.
[1481] In another preferred aspect, the present invention relates
to the use of three (preferably identical) amino acid sequences
chosen from the following: [1482] a) SEQ ID NO's: 62, 65, 67, 68,
75 and 76; [1483] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID N0's: 62, 65, 67, 68, 75 and 76,
provided that: [1484] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105, a Leucine (Leu, L) at position 78 and an
Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [1485] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference, in
preparing a trivalent polypeptide. The method for the preparation
of the trivalent polypeptide will comprise the linking of said
amino acid sequence to each other, optionally via one or two
linkers.
[1486] In a preferred aspect, the three amino acid sequences used
in preparing a trivalent polypeptide comprise or essentially
consist of one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76.
[1487] In another preferred aspect, the present invention relates
to the use of three (preferably identical) amino acid sequences
chosen from the following: [1488] a) SEQ ID NO's: 65 and 76; [1489]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 65 and 76, provided that: [1490] i) the
amino acid sequence has an Aspartic acid (Asp, D) at position 54, a
Glutamine (Gln, Q) at position 105, a Leucine (Leu, L) at position
78 and/or an Arginine (Arg, R) at position 83 (said positions
determined according to Kabat numbering); and [1491] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference, in preparing a trivalent polypeptide. The method for
the preparation of the trivalent polypeptide will comprise the
linking of said amino acid sequences to each other, optionally via
one or two linkers.
[1492] In another preferred aspect, the present invention relates
to the use of three (preferably identical) amino acid sequences
chosen from the following: [1493] a) SEQ ID NO's: 65 and 76; [1494]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 65 and 76, provided that: [1495] i) the
amino acid sequence has an Aspartic acid (Asp, D) at position 54, a
Glutamine (Gln, Q) at position 105, a Leucine (Leu, L) at position
78 and an Arginine (Arg, R) at position 83 (said positions
determined according to Kabat numbering); and [1496] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference, in preparing a trivalent polypeptide. The method for
the preparation of the trivalent polypeptide will comprise the
linking of said amino add sequences to each other, optionally via
one or two linkers.
[1497] In a preferred aspect, the three amino acid sequences used
in preparing the trivalent polypeptide comprise or essentially
consist of SEQ ID NO: 65. In another preferred aspect, the three
amino acid sequences used in preparing the trivalent polypeptide
comprise or essentially consist of SEQ ID NO: 76.
[1498] In another preferred aspect, the present invention relates
to the use of three (preferably identical) amino acid sequences
chosen from the following: [1499] a) SEQ ID NO's: 146-153; [1500]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 146-153, provided that: [1501] i) the
amino acid sequence has a Praline (Pro, P) at position 14, Arginine
(Arg, R) at position 19, Leucine (Leu, L) at position 20 and/or
Leucine (Leu, L) at position 108 (said positions determined
according to Kabat numbering); and [1502] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference. in
preparing a trivalent polypeptide. The method for the preparation
of the trivalent polypeptide will comprise the linking of said
amino acid sequence to at least one further amino acid sequence,
optionally via one or two linkers.
[1503] In a preferred aspect, the amino acid sequences used in
preparing a trivalent polypeptide comprise or essentially consist
of one of SEQ ID NO's: 146-153.
[1504] In another preferred aspect, the present invention relates
to the use of three (preferably identical) amino acid sequences
chosen from the following: [1505] a) SEQ ID NO's: 146-149 and
151-153; [1506] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 146-149 and 151-153,
provided that: [1507] i) the amino acid sequence has a Proline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and/or Leucine (Leu, L) at position 108;
and in addition Arginine (Arg, R) at position 83, Glutamic acid
(Glu, E) at position 85 and/or Glutamine (Gln, Q) at position 105
(said positions determined according to Kabat numbering); and
[1508] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference, in preparing a trivalent polypeptide.
The method for the preparation of the trivalent polypeptide will
comprise the linking of said amino acid sequence to at least one
further amino acid sequence, optionally via one or two linkers.
[1509] In another preferred aspect, the present invention relates
to the use of three (preferably identical) amino acid sequences
chosen from the following: [1510] a) SEQ ID NO's: 146-449 and
151-153; [1511] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 146-149 and 151-153,
provided that: [1512] i) the amino acid sequence has a Proline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and/or Leucine (Leu, L) at position 108 and
in addition Arginine (Arg, R) at position 83, Glutamic acid (Glu,
E) at position 85 and/or Glutamine (Gln, Q) at position 105 so that
when the amino acid sequence has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with:
[1513] SEQ ID NO: 146, the amino acid sequence preferably has
Glutamine (Gln, Q) at position 105; [1514] SEQ ID NO: 147, the
amino acid sequence preferably has Arginine (Arg, R) at position 83
and Glutamine (Gln, Q) at position 105; [1515] SEQ ID NO: 148, the
amino acid sequence preferably has Glutamic acid (Glu, E) at
position 85 and Glutamine (Gln, Q) at position 105; [1516] SEQ ID
NO: 149, the amino acid sequence preferably has Arginine (Arg, R)
at position 83, Glutamic acid (Glu, E) at position 85 and Glutamine
(Gln, Q) at position 105; [1517] SEQ ID NO: 151, the amino acid
sequence preferably has Arginine (Arg, R) at position 83; [1518]
SEQ ID NO: 152, the amino acid sequence preferably has Glutamic
acid (Glu, E) at position 85; [1519] SEQ ID NO: 153, the amino acid
sequence preferably has Arginine (Arg, R) at position 83 and
Glutamic acid (Glu, E) at position 85; [1520] (said positions
determined according to Kabat numbering); and [1521] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference, in preparing a trivalent polypeptide. The method for
the preparation of the trivalent polypeptide will comprise the
linking of said amino acid sequence to at least one further amino
acid sequence, optionally via one or two linkers.
[1522] In a preferred aspect, the amino acid sequences used in
preparing a trivalent polypeptide comprises or essentially consists
of one of SEQ ID NO's: 146-149 and 151-153.
[1523] In another preferred aspect, the present invention relates
to the use of three (preferably identical) amino acid sequences
that comprises or essentially consists of SEQ ID NO: 5, in which
one or more (such as two, three, four, five, six, seven, eight or
nine, ten, eleven or twelve) amino acid residues have been mutated
selected from the following: Val5Leu, Ala14Pro, Ser19Arg, Ile20Leu,
Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp, in preparing a trivalent polypeptide.
[1524] In another preferred aspect, the present invention relates
to the use of three (preferably identical) amino acid sequences
that comprises or essentially consists of SEQ ID NO: 5, in which
one or more (such as two, three, four, five, six, seven, eight or
nine) amino acid residues have been mutated selected from the
following: Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp, in preparing a
trivalent polypeptide.
[1525] In another preferred aspect, the present invention relates
to the use of three (preferably identical) amino acid sequences
that comprises or essentially consists of SEQ ID NO: 5, in which
one or more (such as two, three or four) amino acid residues have
been mutated selected from the following: Ala14Pro, Ser19Arg,
Ile20Leu and Gln108Leu, in preparing a trivalent polypeptide.
[1526] In another preferred aspect, the present invention relates
to the use of three (preferably identical) amino acid sequences
that comprises or essentially consists of SEQ ID NO: 5, in which
one or more (such as two, three, four, five, six or seven) amino
acid residues have been mutated selected from the following:
Ala14Pro, Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu, in preparing a trivalent polypeptide.
[1527] In another preferred aspect, the present invention relates
to the use of three (preferably identical) amino acid sequences
that comprises or essentially consists of SEQ ID NO: 5, in which
following amino acid residues have been mutated: [1528] Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu; [1529] Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu;
[1530] Gly78Leu, Ala83Arg, Asp85Glu and Arg105Gln; [1531] Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp; [1532] Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp; [1533] Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gly54Asp; [1534] Gly54Asp; [1535] Ala14Pro, Ser19Arg,
Ile20Leu and Gln108Leu; [1536] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Ala83Arg; [1537] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Asp85Glu; [1538] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Arg105Gln; [1539] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg and Asp85Glu; [1540] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln; [1541] Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and Arg105Gln; [1542]
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu and
Arg105Gln, in preparing a trivalent polypeptide.
[1543] In another preferred aspect, the present invention relates
to the use of SEQ ID NO: 62 in preparing SEQ ID NO: 77. The method
for the preparation of the multivalent polypeptide will comprise
the linking of an amino acid sequence with SEQ ID NO: 62 to at
least two further amino acid sequences with SEQ ID NO: 62, via a
15GS (SEQ ID NO: 128) linker.
[1544] In another preferred aspect, the present invention relates
to the use of SEQ ID NO: 65 in preparing SEQ ID NO: 78. The method
for the preparation of the multivalent polypeptide will comprise
the linking of an amino acid sequence with SEQ ID NO: 65 to at
least two further amino acid sequences with SEQ ID NO: 65, via a
15GS (SEQ ID NO: 128) linker.
[1545] In another preferred aspect, the present invention relates
to the use of SEQ ID NO: 76 in preparing SEQ ID NO: 79. The method
for the preparation of the multivalent polypeptide will comprise
the linking of an amino acid sequence with SEQ ID NO: 76 to at
least two further amino acid sequences with SEQ ID NO: 76, via a
15GS (SEQ ID NO: 128) linker.
[1546] In another preferred aspect, the present invention relates
to the use of SEQ ID NO: 75 in preparing SEQ ID NO: 158. The method
for the preparation of the multivalent polypeptide will comprise
the linking of an amino acid sequence with SEQ ID NO: 75 to at
least two further amino acid sequences with SEQ ID NO: 75, via a
15GS (SEQ ID NO: 128) linker.
[1547] In another preferred aspect, the present invention relates
to the use of SEQ ID NO: 147 in preparing SEQ ID NO: 159. The
method for the preparation of the multivalent polypeptide will
comprise the linking of an amino acid sequence with SEQ ID NO: 147
to at least two further amino acid sequences with SEQ ID NO: 147,
via a 15GS (SEQ ID NO: 128) linker.
[1548] In another preferred aspect, the present invention relates
to the use of SEQ ID NO: 149 in preparing SEQ ID NO: 160. The
method for the preparation of the multivalent polypeptide will
comprise the linking of an amino acid sequence with SEQ ID NO: 149
to at least two further amino acid sequences with SEQ ID NO: 149,
via a 1505 (SEQ ID NO: 128) linker.
[1549] In another preferred aspect, the present invention relates
to the use of SEQ ID NO: 153 in preparing SEQ ID NO: 161. The
method for the preparation of the multivalent polypeptide will
comprise the linking of an amino acid sequence with SEQ ID NO: 153
to at least two further amino acid sequences with SEQ ID NO: 153,
via a 15GS (SEQ ID NO: 128) linker.
[1550] In another preferred aspect, the present invention relates
to the use of an amino acid sequence chosen from the above wherein
the amino acid (Glutamic acid) at position 1 has been changed into
Aspartic acid, in preparing a trivalent polypeptide.
[1551] In this respect, the present invention relates to the use of
an amino acid sequence chosen from the following: [1552] a) SEQ ID
NO's: 138-141 and 154-157; [1553] b) amino acid sequences that have
no more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 138-141 and
154-157, provided that: [1554] i) the amino acid sequence has a
Aspartic acid (Asp, D) at position 1 (said position determined
according to Kabat numbering); and [1555] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference, in
preparing a trivalent polypeptide. The method for the preparation
of the trivalent polypeptide will comprise the linking of said
amino acid sequence to at least two further amino acid sequences,
optionally via one or more linkers.
[1556] In a preferred aspect, the amino acid sequence used in
preparing a trivalent polypeptide comprises or essentially consists
of SEQ ID NO: 138. In another preferred aspect, the amino acid
sequence used in preparing a trivalent polypeptide comprises or
essentially consists of SEQ ID NO: 139. In another preferred
aspect, the amino acid sequence used in preparing a trivalent
polypeptide comprises or essentially consists of SEQ ID NO: 140. In
another preferred aspect, the amino acid sequence used in preparing
a trivalent polypeptide comprises or essentially consists of SEQ ID
NO: 141. In another preferred aspect, the amino acid sequence used
in preparing a trivalent polypeptide comprises or essentially
consists of one of SEQ ID NO's: 154-157.
[1557] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which Glutamic acid at position 1 has
been changed into Aspartic acid, in preparing a trivalent
polypeptide.
[1558] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 62, in which Glutamic acid at position 1 has
been changed into Aspartic acid, in preparing a trivalent
polypeptide.
[1559] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 65, in which Glutamic acid at position 1 has
been changed into Aspartic acid, in preparing a trivalent
polypeptide.
[1560] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 76, in which Glutamic acid at position 1 has
been changed into Aspartic acid, in preparing a trivalent
polypeptide.
[1561] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 75, in which Glutamic acid at position 1 has
been changed into Aspartic acid, in preparing a trivalent
polypeptide.
[1562] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 147, in which Glutamic acid at position 1
has been changed into Aspartic acid, in preparing a trivalent
polypeptide.
[1563] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 149, in which Glutamic acid at position 1
has been changed into Aspartic acid, in preparing a trivalent
polypeptide.
[1564] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 153, in which Glutamic acid at position 1
has been changed into Aspartic acid, in preparing a trivalent
polypeptide.
[1565] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which one or more (such as two, three,
four, five, six, seven, eight or nine, ten, eleven or twelve) amino
acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp, and wherein
Glutamic acid at position 1 has been changed into Aspartic acid, in
preparing a trivalent polypeptide.
[1566] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which one or more (such as two, three,
four, five, six, seven, eight or nine) amino acid residues have
been mutated selected from the following: Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54Asp, and wherein Glutamic acid at position 1 has been changed
into Aspartic acid, in preparing a trivalent polypeptide.
[1567] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which one or more (such as two, three
or four) amino acid residues have been mutated selected from the
following: Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu, and wherein
Glutamic acid at position 1 has been changed into Aspartic acid, in
preparing a trivalent polypeptide.
[1568] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which one or more (such as two, three,
four, five, six or seven) amino acid residues have been mutated
selected from the following: Ala14Pro, Ser19Arg, Ile20Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu, and wherein Glutamic
acid at position 1 has been changed into Aspartic acid, in
preparing a trivalent polypeptide.
[1569] In another preferred aspect, the present invention relates
to the use of an amino acid sequence that comprises or essentially
consists of SEQ ID NO: 5, in which following amino acid residues
have been mutated: [1570] Glu1Asp; [1571] Glu1Asp, Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu; [1572] Glu1Asp, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu; [1573] Glu1Asp, Gly78Leu, Ala83Arg, Asp85Glu and
Arg105Gln; [1574] Glu1Asp, Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp; [1575]
Glu1Asp, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp;
[1576] Glu1Asp, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gly54Asp; [1577] Glu1Asp and Gly54Asp; [1578] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu and Gln108Leu; [1579] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu and Ala83Arg; [1580] Glu1Asp,
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and Asp85Glu; [1581]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and Arg105Gln;
[1582] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg
and Asp85Glu; [1583] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg and Arg105Gln; [1584] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and Arg105Gln; or [1585]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg,
Asp85Glu and Arg105Gln, in preparing a trivalent polypeptide.
[1586] In another preferred aspect, the present invention relates
to the use of SEQ ID NO: 138 in preparing SEQ ID NO: 142. The
method for the preparation of the multivalent polypeptide will
comprise the linking of an amino acid sequence with SEQ ID NO: 138
to at least two further amino acid sequences (preferably SEQ ID NO:
5), via a 15GS (SEQ ID NO: 128) linker.
[1587] In another preferred aspect, the present invention relates
to the use of SEQ ID NO: 139 in preparing SEQ ID NO: 143. The
method for the preparation of the multivalent polypeptide will
comprise the linking of an amino acid sequence with SEQ ID NO: 139
to at least two further amino acid sequences (preferably SEQ ID NO:
62), via a 15GS (SEQ ID NO: 128) linker.
[1588] In another preferred aspect, the present invention relates
to the use of SEQ ID NO: 140 in preparing SEQ ID NO: 144. The
method for the preparation of the multivalent polypeptide will
comprise the linking of an amino acid sequence with SEQ ID NO: 140
to at least two further amino acid sequences (preferably SEQ ID NO:
65), via a 15GS (SEQ ID NO: 128) linker.
[1589] In another preferred aspect, the present invention relates
to the use of SEQ ID NO: 154 in preparing SEQ ID NO: 162. The
method for the preparation of the multivalent polypeptide will
comprise the linking of an amino acid sequence with SEQ ID NO: 154
to at least two further amino acid sequences (preferably SEQ ID NO:
75), via a 15GS (SEQ ID NO: 128) linker.
[1590] In another preferred aspect, the present invention relates
to the use of SEQ ID NO: 155 in preparing SEQ ID NO: 163. The
method for the preparation of the multivalent polypeptide will
comprise the linking of an amino acid sequence with SEQ ID NO: 155
to at least two further amino acid sequences (preferably SEQ ID NO:
147), via a 15GS (SEQ ID NO: 128) linker.
[1591] In another preferred aspect, the present invention relates
to the use of SEQ ID NO: 156 in preparing SEQ ID NO: 164. The
method for the preparation of the multivalent polypeptide will
comprise the linking of an amino acid sequence with SEQ ID NO: 156
to at least two further amino acid sequences (preferably SEQ ID NO:
149), via a 15GS (SEQ ID NO: 128) linker.
[1592] In another preferred aspect, the present invention relates
to the use of SEQ ID NO: 157 in preparing SEQ ID NO: 165. The
method for the preparation of the multivalent polypeptide will
comprise the linking of an amino acid sequence with SEQ ID NO: 157
to at least two further amino acid sequences (preferably SEQ ID NO:
153), via a 15GS (SEQ ID NO: 128) linker.
[1593] Polypeptides of the invention that contain at least two
amino acid sequences and/or Nanobodies.RTM., in which at least one
amino acid sequence or Nanobody.RTM. is directed against a first
antigen (i.e. against protein F of hRSV) and at least one amino
acid sequence or Nanobody.RTM. is directed against a second antigen
(i.e. different from protein F of hRSV), will also be referred to
as "multispecific" polypeptides of the invention, and the amino
acid sequences or Nanobodies.RTM. present in such polypeptides will
also be referred to herein as being in a "multispecific format".
Thus, for example, a "bispecific" polypeptide of the invention is a
polypeptide that comprises at least one amino acid sequence or
Nanobody.RTM. of the invention directed against a first antigen
(i.e. protein F of hRSV) and at least one further amino acid
sequence or Nanobody.RTM. directed against a second antigen (i.e.
different from protein F of hRSV), whereas a "trispecific"
polypeptide of the invention is a polypeptide that comprises at
least one amino acid sequence or Nanobody.RTM. of the invention
directed against a first antigen (i.e. protein F of hRSV), at least
one further amino acid sequence or Nanobody.RTM. directed against a
second antigen (i.e. different from protein F of hRSV) and at least
one further amino acid sequence or Nanobody.RTM. directed against a
third antigen (i.e. different from both protein F of hRSV and the
second antigen); etc.
[1594] Accordingly, in its simplest form, a bispecific polypeptide
of the invention is a bivalent polypeptide of the invention (as
defined herein), comprising a first amino acid sequence or
Nanobody.RTM. of the invention directed against protein F of hRSV,
and a second amino acid sequence or Nanobody.RTM. directed against
a second antigen, in which said first and second amino acid
sequence or Nanobody.RTM. may optionally be linked via a linker
sequence (as defined herein); whereas a trispecific polypeptide of
the invention in its simplest form is a trivalent polypeptide of
the invention (as defined herein), comprising a first amino acid
sequence or Nanobody.RTM. of the invention directed against protein
F of hRSV, a second amino acid sequence or Nanobody.RTM. directed
against a second antigen and a third amino acid sequence or
Nanobody.RTM. directed against a third antigen, in which said
first, second and third amino acid sequence or Nanobody.RTM. may
optionally be linked via one or more, and in particular two, linker
sequences.
[1595] In a specific aspect, the polypeptide of the invention is a
trivalent, bispecific polypeptide. A trivalent, bispecific
polypeptide of the invention in its simplest form may be a
trivalent polypeptide of the invention (as defined herein),
comprising two identical amino acid sequences or Nanobodies.RTM.
against protein F of hRSV and a third amino acid sequence or
Nanobody.RTM. directed against another antigen, in which said
first, second and third amino acid sequence or Nanobody.RTM. may
optionally be linked via one or more, and in particular two, linker
sequences.
[1596] A preferred, but non-limiting example of a multispecific
polypeptide of the invention comprises at least one amino acid
sequence or Nanobody.RTM. of the invention and at least one
Nanobody.RTM. that provides for an increased half-life. Some
preferred, but non-limiting examples of such Nanobodies.RTM.
include Nanobodies.RTM. directed against serum proteins, such as
human serum albumin, thyroxine-binding protein, (human)
transferrin, fibrinogen, an immunoglobulin such as IgG, IgE or igM,
or one of the other serum proteins listed in WO 04/003019.
[1597] For example, for experiments in mice, Nanobodies.RTM.
against mouse serum albumin (MSA) can be used, whereas for
pharmaceutical use, Nanobodies.RTM. against human serum albumin can
be used.
[1598] Another embodiment of the present invention is a polypeptide
construct as described above wherein said at least one (human)
serum protein is any of (human) serum albumin, (human) serum
immunoglobulins, (human) thyroxine-binding protein, (human)
transferrin, (human) fibrinogen, etc.
[1599] Accordingly, in a specific aspect, the polypeptide of the
invention is a bispecific polypeptide comprising a first amino acid
sequence or Nanobody.RTM. of the invention against protein F of
hRSV and a second amino acid sequence or Nanobody.RTM. directed
against (human) serum albumin, in which said first and second amino
acid sequence or Nanobody.RTM. may optionally be linked via a
linker sequence.
[1600] In another specific aspect, the polypeptide of the invention
is a trivalent, bispecific polypeptide, comprising two identical
amino acid sequences or Nanobodies.RTM. of the invention against
protein F of hRSV and a third amino acid sequence or Nanobody.RTM.
directed against (human) serum albumin, in which said first, second
and third amino acid sequence or Nanobody.RTM. may optionally be
linked via one or more, and in particular two, linker
sequences.
[1601] In another specific aspect, the polypeptide of the invention
is a tetravalent, bispecific polypeptide, comprising three
identical amino acid sequences or Nanobodies.RTM. of the invention
against protein F of hRSV and a fourth amino acid sequence or
Nanobody.RTM. directed against (human) serum albumin, in which said
first, second, third and fourth amino acid sequence or
Nanobody.RTM. may optionally be linked via one or more, and in
particular two or three, linker sequences.
[1602] According to a specific, but non-limiting aspect of the
invention, the polypeptides of the invention contain, besides the
one or more amino acid sequences or Nanobodies.RTM. of the
invention, at least one Nanobody.RTM. against human serum albumin.
These Nanobodies.RTM. against human serum albumin may be as
generally described in the applications by Ablynx N.V. cited above
(see for example WO 04/062551). Some particularly preferred
Nanobodies.RTM. that provide for increased half-life and that can
be used in the polypeptides of the invention include the
Nanobodies.RTM. ALB-1 to ALB-10 disclosed in WO 06/122787 (see
Tables II and III) of which ALB-8 (SEQ ID NO: 62 in WO 06/122787)
is particularly preferred.
[1603] In another aspect, the invention relates to a compound or
construct, and in particular a protein or polypeptide (also
referred to herein as a "compound of the invention") that comprises
or essentially consists of one or more amino acid sequences,
Nanobodies.RTM. and/or polypeptides of the invention (or suitable
fragments thereof), and optionally further comprises one or more
other groups, residues, moieties or binding units. As will become
clear to the skilled person from the further disclosure herein,
such further groups, residues, moieties, binding units or amino
acid sequences may or may not provide further functionality to the
amino acid sequence, Nanobody.RTM. or polypeptide of the invention
(and/or to the compound. construct or polypeptide in which it is
present) and may or may not modify the properties of the amino acid
sequence, Nanobody.RTM. and/or polypeptide of the invention.
[1604] Such groups, residues, moieties or binding units may for
example be chemical groups, residues, moieties, which may or may
not by themselves be biologically and/or pharmacologically active.
For example, and without limitation, such groups may be linked to
the one or more amino acid sequences, Nanobodies.RTM. and/or
polypeptides of the invention so as to provide a "derivative" of an
amino acid sequence, Nanobody.RTM. and/or polypeptide of the
invention, as further described herein.
[1605] Also within the scope of the present invention are compounds
or constructs that comprise or essentially consist of one or more
derivates as described herein, and optionally further comprise one
or more other groups, residues, moieties or binding units,
optionally linked via one or more linkers. Preferably, said one or
more other groups, residues, moieties or binding units are amino
acid sequences.
[1606] In the compounds, constructs or polypeptides described
above, the one or more amino acid sequences, Nanobodies.RTM. and/or
polypeptides of the invention and the one or more groups, residues,
moieties or binding units may be linked directly to each other
and/or via one or more suitable linkers or spacers. For example,
when the one or more groups, residues, moieties or binding units
are amino acid sequences, the linkers may also be amino acid
sequences, so that the resulting compound, construct or polypeptide
is a fusion (protein) or fusion (polypeptide).
[1607] A compound or construct of the invention may comprises an
amino acid sequence, Nanobody.RTM. or polypeptide of the invention,
which is fused at its amino terminal end, at its carboxy terminal
end, or both at its amino terminal end and at its carboxy terminal
end to at least one further amino acid sequence, i.e. so as to
provide a fusion protein comprising said amino acid sequence,
Nanobody.RTM. or polypeptide of the invention and the one or more
further amino acid sequences.
[1608] The one or more further amino acid sequence may be any
suitable and/or desired amino acid sequences. The further amino
acid sequences may or may not change, alter or otherwise influence
the (biological) properties of the amino acid sequence,
Nanobody.RTM. or polypeptide of the invention, and may or may not
add further functionality to the amino acid sequence, Nanobody.RTM.
or the polypeptide of the invention. Preferably, the further amino
acid sequence is such that it confers one or more desired
properties or functionalities to the amino acid sequence,
Nanobody.RTM. or the polypeptide of the invention.
[1609] Example of such amino acid sequences will be clear to the
skilled person, and may generally comprise all amino acid sequences
that are used in peptide fusions based on conventional antibodies
and fragments thereof (including but not limited to ScFv's and
single domain antibodies). Reference is for example made to the
review by Holliger and Hudson, Nature Biotechnology, 23, 9,
1126-1136 (2005).
[1610] For example, such an amino acid sequence may be an amino
acid sequence that increases the half-life, the solubility, or the
absorption, reduces the immunogenicity or the toxicity, eliminates
or attenuates undesirable side effects, and/or confers other
advantageous properties to and/or reduces the undesired properties
of the compounds of the invention, compared to the amino acid
sequence, Nanobody.RTM. or polypeptide of the invention per se.
Some non-limiting examples of such amino acid sequences are serum
proteins, such as human serum albumin (see for example WO 00/27435)
or haptenic molecules (for example haptens that are recognized by
circulating antibodies, see for example WO 98/22141).
[1611] The further amino acid sequence may also provide a second
binding site, which binding site may be directed against any
desired protein, polypeptide, antigen, antigenic determinant or
epitope (including but not limited to the same protein,
polypeptide, antigen, antigenic determinant or epitope against
which the amino acid sequence or Nanobody.RTM. of the invention is
directed, or a different protein, polypeptide, antigen, antigenic
determinant or epitope). For example, the further amino acid
sequence may provide a second binding site that is directed against
a serum protein (such as, for example, human serum albumin or
another serum protein such as IgG), so as to provide increased
half-life in serum. Such amino acid sequences for example include
Nanobodies.RTM., as well as the small peptides and binding proteins
described in WO 91/01743, WO 01/45746 and WO 02/076489 and the
dAb's described in WO 03/002609 and WO 04/003019. Reference is also
made to Harmsen et al., Vaccine, 23 (41); 4926-42, 2005, as well as
to EP 0 368 684, as well as to WO 08/028,977, WO 08/043,821, WO
08/043,822 by Ablynx N.V. and WO 08/068,280.
[1612] Such amino acid sequences may in particular be directed
against serum albumin (and more in particular human serum albumin)
and/or against IgG (and more in particular human IgG). For example,
such amino acid sequences may be amino acid sequences that are
directed against (human) serum albumin and amino acid sequences
that can bind to amino acid residues on (human) serum albumin that
are not involved in binding of serum albumin to FcRn (see for
example WO 06/0122787) and/or amino acid sequences that are capable
of binding to amino acid residues on serum albumin that do not form
part of domain III of serum albumin (see again for example WO
06/0122787); amino acid sequences that have or can provide an
increased half-life (see for example WO 08/028,977); amino acid
sequences against human serum albumin that are cross-reactive with
serum albumin from at least one species of mammal, and in
particular with at least one species of primate (such as, without
limitation, monkeys from the genus Macaca (such as, and in
particular, cynomolgus monkeys (Macaca fascicularis) and/or rhesus
monkeys (Macaca mulatta)) and baboon (Papio ursinus), reference is
again made to WO 08/028,977); amino acid sequences that can bind to
serum albumin in a pH independent manner (see for example WO
08/043,821) and/or amino acid sequences that are conditional
binders (see for example WO 08/043,822).
[1613] According to another embodiment, the one or more further
amino acid sequences may comprise one or more parts, fragments or
domains of conventional 4-chain antibodies (and in particular human
antibodies) and/or of heavy chain antibodies. For example, although
usually less preferred, an amino acid sequence, Nanobody.RTM. or
polypeptide of the invention may be linked to a conventional
(preferably human) V.sub.H or V.sub.L domain or to a natural or
synthetic analog of a V.sub.H or V.sub.L domain, again optionally
via a linker sequence (including but not limited to other (single)
domain antibodies, such as the dAb's described by Ward et al.).
[1614] Accordingly, in the compound or construct of the invention,
said one or more other groups, residues, moieties or binding units
may be chosen from the group consisting of domain antibodies, amino
acid sequences that are suitable for use as a domain antibody,
single domain antibodies, amino acid sequences that are suitable
for use as a single domain antibody, "dAb's", amino acid sequences
that are suitable for use as a dAb, or Nanobodies.RTM..
[1615] In one specific aspect of the invention, the compound,
construct or polypeptide of the invention comprising at least one
amino acid sequence, Nanobody.RTM. or polypeptide of the invention
may have an increased half-life, compared to the corresponding
amino acid sequence, Nanobody.RTM. or polypeptide of the invention.
Some preferred, but non-limiting examples of such compounds,
constructs and polypeptides will become clear to the skilled person
based on the further disclosure herein, and for example comprise
amino acid sequences, Nanobodies.RTM. or polypeptides of the
invention that have been chemically modified to increase the
half-life thereof (for example, by means of pegylation); or
compounds of the invention that comprise at least one amino acid
sequence, Nanobody.RTM. or polypeptide of the invention that is
linked to at least one moiety (and in particular at least one amino
acid sequence) that increases the half-life of the amino acid
sequence, Nanobody.RTM. or polypeptide of the invention. Examples
of compounds of the invention that comprise such half-life
extending moieties will become clear to the skilled person based on
the further disclosure herein; and for example include, without
limitation, compounds in which the one or more amino acid
sequences, Nanobodies.RTM. or polypeptides of the invention are
suitable linked to one or more serum proteins or fragments thereof
(such as serum albumin or suitable fragments thereof) or to one or
more binding units that can bind to serum proteins (such as, for
example, Nanobodies.RTM. or (single) domain antibodies that can
bind to serum proteins such as serum albumin, serum immunoglobulins
such as IgG, or transferrine); compounds in which an amino acid
sequence, Nanobody.RTM. or polypeptide of the invention is linked
to an Fc portion (such as a human Fc) or a suitable part or
fragment thereof; or compounds in which the one or more amino acid
sequences, Nanobodies.RTM. or polypeptides of the invention are
suitable linked to one or more small proteins or peptides that can
bind to serum proteins (such as, without limitation, the proteins
and peptides described in WO 91/01743, WO 01/45746, WO
02/076489).
[1616] The at least one amino acid sequence, Nanobody.RTM. or
polypeptide may also be linked to one or more (preferably human)
C.sub.H1, C.sub.H2 and/or C.sub.H3 domains, optionally via a linker
sequence. For instance, an amino acid sequence, Nanobody.RTM. or
polypeptide linked to a suitable C.sub.H1 domain could for example
be used--together with suitable light chains--to generate antibody
fragments/structures analogous to conventional Fab fragments or
F(ab').sub.2 fragments, but in which one or (in case of an
F(ab').sub.2 fragment) one or both of the conventional V.sub.H
domains have been replaced by an amino acid sequence, Nanobody.RTM.
or polypeptide of the invention. Also, two amino acid sequences or
Nanobodies.RTM. could be linked to a C.sub.H3 domain (optionally
via a linker) to provide a construct with increased half-life in
vivo.
[1617] According to one specific aspect, one or more amino acid
sequences, Nanobodies.RTM. or polypeptides of the invention may be
linked (optionally via a suitable linker or hinge region) to one or
more constant domains (for example, 2 or 3 constant domains that
can be used as part of/to form an Fc portion), to an Fc portion
and/or to one or more antibody parts, fragments or domains that
confer one or more effector functions to the amino acid sequence,
Nanobody.RTM. or polypeptide of the invention and/or may confer the
ability to bind to one or more Fc receptors. For example, for this
purpose, and without being limited thereto, the one or more further
amino acid sequences may comprise one or more C.sub.H2 and/or
C.sub.H3 domains of an antibody, such as from a heavy chain
antibody (as described herein) and more preferably from a
conventional human 4-chain antibody; and/or may form (part of) and
Fc region, for example from IgG (e.g. from IgG1, IgG2, IgG3 or
IgG4), from IgE or from another human Ig such as IgA, IgD or IgM.
For example, WO 94/04678 describes heavy chain antibodies
comprising a Camelid V.sub.HH domain or a humanized derivative
thereof (i.e. a Nanobody.RTM.), in which the Camelidae C.sub.H2
and/or C.sub.H5 domain have been replaced by human C.sub.H2 and
C.sub.H3 domains, so as to provide an immunoglobulin that consists
of 2 heavy chains each comprising a Nanobody.RTM. and human
C.sub.H2 and C.sub.H3 domains (but no C.sub.H1 domain), which
immunoglobulin has the effector function provided by the C.sub.H2
and C.sub.H3 domains and which immunoglobulin can function without
the presence of any light chains. Other amino acid sequences that
can be suitably linked to the amino acid sequences, Nanobodies.RTM.
or polypeptides of the invention so as to provide an effector
function will be clear to the skilled person, and may be chosen on
the basis of the desired effector function(s). Reference is for
example made to WO 04/058820, WO 99/42077, WO 02/056910 and WO
05/017148, as well as the review by Holliger and Hudson, supra; and
to WO 09/068,628. Coupling of an amino acid sequence, Nanobody.RTM.
or polypeptide of the invention to an Fc portion may also lead to
an increased half-life, compared to the corresponding amino acid
sequence, Nanobody.RTM. or polypeptide of the invention. For some
applications, the use of an Fc portion and/or of constant domains
(i.e. C.sub.H2 and/or C.sub.H3 domains) that confer increased
half-life without any biologically significant effector function
may also be suitable or even preferred. Other suitable constructs
comprising one or more amino acid sequences, Nanobodies.RTM. or
polypeptides and one or more constant domains with increased
half-life in vivo will be clear to the skilled person, and may for
example comprise amino acid sequences, Nanobodies.RTM. or
polypeptides linked to a C.sub.H3 domain, optionally via a linker
sequence. Generally, any fusion protein or derivatives with
increased half-life will preferably have a molecular weight of more
than 50 kD, the cut-off value for renal absorption.
[1618] In another specific, but non-limiting, aspect, in order to
form a compound of the invention, one or more amino acid sequences,
Nanobodies.RTM. or polypeptides of the invention may be linked
(optionally via a suitable linker or hinge region) to naturally
occurring, synthetic or semisynthetic constant domains (or analogs,
variants, mutants, parts or fragments thereof) that have a reduced
(or essentially no) tendency to self-associate into dimers (i.e.
compared to constant domains that naturally occur in conventional
4-chain antibodies). Such monomeric (i.e. not self-associating) Fc
chain variants, or fragments thereof, will be clear to the skilled
person. For example, Helm et al., J Biol Chem 1996 271 7494,
describe monomeric Fc chain variants that can be used in the
polypeptide chains of the invention.
[1619] Also, such monomeric Fc chain variants are preferably such
that they are still capable of binding to the complement or the
relevant Fc receptor(s) (depending on the Fc portion from which
they are derived), and/or such that they still have some or all of
the effector functions of the Fc portion from which they are
derived (or at a reduced level still suitable for the intended
use). Alternatively, in such a polypeptide chain of the invention,
the monomeric Fc chain may be used to confer increased half-life
upon the polypeptide chain, in which case the monomeric Fc chain
may also have no or essentially no effector functions.
[1620] Generally, the amino acid sequences, Nanobodies.RTM. or
polypeptides of the invention (or compounds, constructs or
comprising the same) with increased half-life preferably have a
half-life that is at least 1.5 times, preferably at least 2 times,
such as at least 5 times, for example at least 10 times or more
than 20 times, greater than the half-life of the corresponding
amino acid sequence, Nanobody.RTM. or polypeptide of the invention
per se. For example, the amino acid sequences, Nanobodies.RTM.,
compounds, constructs or polypeptides of the invention with
increased half-life may have a half-life that is increased with
more than 1 hours, preferably more than 2 hours, more preferably
more than 6 hours, such as more than 12 hours, or even more than
24, 48 or 72 hours, compared to the corresponding amino acid
sequence, Nanobody.RTM. or polypeptide of the invention per se.
[1621] In a preferred, but non-limiting aspect of the invention,
such amino acid sequences, Nanobodies.RTM., compound, constructs or
polypeptides of the invention exhibit a serum half-life in human of
at least about 12 hours, preferably at least 24 hours, more
preferably at least 48 hours, even more preferably at least 72
hours or more. For example, compounds or polypeptides of the
invention may have a half-life of at least 5 days (such as about 5
to 10 days), at preferably at least 9 days (such as about 9 to 14
days), more preferably at least about 10 days (such as about 10 to
15 days), or at least about 11 days (such as about 11 to 16 days),
more preferably at least about 12 days (such as about 12 to 18 days
or more), or more than 14 days (such as about 14 to 19 days).
[1622] The further amino acid sequences may also form a signal
sequence or leader sequence that directs secretion of the amino
acid sequence, Nanobody.RTM. or the polypeptide of the invention
from a host cell upon synthesis (for example to provide a pre-,
pro- or prepro-form of the polypeptide of the invention, depending
on the host cell used to express the polypeptide of the
invention).
[1623] The further amino acid sequence may also form a sequence or
signal that allows the amino acid sequence, Nanobody.RTM. or
polypeptide of the invention to be directed towards and/or to
penetrate or enter into specific organs, tissues, cells, or parts
or compartments of cells, and/or that allows the amino acid
sequence, Nanobody.RTM. or polypeptide of the invention to
penetrate or cross a biological barrier such as a cell membrane, a
cell layer such as a layer of epithelial cells. Suitable examples
of such amino acid sequences will be clear to the skilled person,
and for example include, but are not limited to, the "Peptrans"
vectors mentioned above, the sequences described by Cardinale et
al. and the amino acid sequences and antibody fragments known per
se that can be used to express or produce the Nanobodies.RTM. and
polypeptides of the invention as so-called "intrabodies", for
example as described in WO 94/02610, WO 95/22618, U.S. Pat. No.
7,004,940, WO 03/014960, WO 99/07414; WO 05/01690; EP 1 512 696;
and in Cattaneo, A. & Biocca, S. (1997) intracellular
Antibodies: Development and Applications. Landes and
Springer-Verlag; and in Kontermann, Methods 34, (2004), 163-170,
and the further references described therein.
[1624] Such a protein, polypeptide, compound or construct may also
be in essentially isolated form (as defined herein).
[1625] The compounds or polypeptides of the invention can generally
be prepared by a method which comprises at least the step of
suitably linking the one or more amino acid sequences,
Nanobodies.RTM., monovalent constructs and/or polypeptides of the
invention to the one or more further groups, residues, moieties or
binding units, optionally via the one or more suitable linkers, so
as to provide the compound or polypeptide of the invention.
Polypeptides of the invention can also be prepared by a method
which generally comprises at least the steps of providing a nucleic
acid that encodes a polypeptide of the invention, expressing said
nucleic acid in a suitable manner, and recovering the expressed
polypeptide of the invention. Such methods can be performed in a
manner known per se, which will be clear to the skilled person, for
example on the basis of the methods and techniques further
described herein.
[1626] Suitable spacers or linkers for use in multivalent and/or
multispecific polypeptides or constructs will be clear to the
skilled person, and may generally be any linker or spacer used in
the art to link amino acid sequences. Preferably, said linker or
spacer is suitable for use in constructing proteins or polypeptides
that are intended for pharmaceutical use.
[1627] Some particularly preferred spacers include the spacers and
linkers that are used in the art to link antibody fragments or
antibody domains. These include the linkers mentioned in the
general background art cited above, as well as for example linkers
that are used in the art to construct diabodies or ScFv fragments
(in this respect, however, its should be noted that, whereas in
diabodies and in ScFv fragments, the linker sequence used should
have a length, a degree of flexibility and other properties that
allow the pertinent V.sub.H and V.sub.L domains to come together to
form the complete antigen-binding site, there is no particular
limitation on the length or the flexibility of the linker used in
the polypeptide of the invention, since each amino acid sequence or
Nanobody.RTM. by itself forms a complete antigen-binding site).
[1628] For example, a linker may be a suitable amino acid sequence,
and in particular amino acid sequences of between 1 and 50,
preferably between 1 and 30, such as between 1 and 10 amino acid
residues. Some preferred examples of such amino acid sequences
include gly-ser linkers, for example of the type
(gly.sub.xser.sub.y).sub.z, such as (for example
(gly.sub.4ser).sub.3 or (gly.sub.3ser.sub.2).sub.3, as described in
WO 99/42077, hinge-like regions such as the hinge regions of
naturally occurring heavy chain antibodies or similar sequences
(such as described in WO 94/04678).
[1629] Some other particularly preferred linkers are poly-alanine
(such as AAA), as well as the linkers mentioned in Table A-7, of
which GS15 is particularly preferred.
[1630] Other suitable linkers generally comprise organic compounds
or polymers, in particular those suitable for use in proteins for
pharmaceutical use. For instance, poly(ethyleneglycol) moieties
have been used to link antibody domains, see for example WO
04/081026.
[1631] It is encompassed within the scope of the invention that the
length, the degree of flexibility and/or other properties of the
linker(s) used (although not critical, as it usually is for linkers
used in ScFv fragments) may have some influence on the properties
of the final polypeptide of the invention, including but not
limited to the affinity, specificity or avidity for protein F of
hRSV, or for one or more of the other antigens. Based on the
disclosure herein, the skilled person will be able to determine the
optimal linker(s) for use in a specific polypeptide of the
invention, optionally after some limited routine experiments.
[1632] It is also within the scope of the invention that the
linker(s) used confer one or more other favourable properties or
functionality to the polypeptides of the invention, and/or provide
one or more sites for the formation of derivatives and/or for the
attachment of functional groups (e.g. as described herein for the
derivatives of the amino acid sequences, Nanobodies.RTM., compounds
and polypeptides of the invention). For example, linkers containing
one or more charged amino acid residues can provide improved
hydrophilic properties, whereas linkers that form or contain small
epitopes or tags can be used for the purposes of detection,
identification and/or purification. Again, based on the disclosure
herein, the skilled person will be able to determine the optimal
linkers for use in a specific polypeptide of the invention,
optionally after some limited routine experiments.
[1633] Finally, when two or more linkers are used in the
polypeptides of the invention, these linkers may be the same or
different. Again, based on the disclosure herein, the skilled
person will be able to determine the optimal linkers for use in a
specific polypeptide of the invention, optionally after some
limited routine experiments.
[1634] Usually, for ease of expression and production, a
polypeptide of the invention will be a linear polypeptide. However,
the invention in its broadest sense is not limited thereto. For
example, when a polypeptide of the invention comprises three of
more amino acid sequences or Nanobodies.RTM., it is possible to
link them by use of a linker with three or more "arms", which each
"arm" being linked to an amino acid sequence or Nanobody.RTM., so
as to provide a "star-shaped" construct. It is also possible,
although usually less preferred, to use circular constructs.
[1635] As will also be clear from the disclosure herein, it is also
within the scope of the invention to use parts or fragments, or
combinations of two or more parts or fragments, of the amino acid
sequences, Nanobodies.RTM. or polypeptides of the invention as
defined herein, and in particular parts or fragments of the amino
acid sequences of SEQ ID NO's: 50-76, 138-441 and 146-157 or the
polypeptides of SEQ ID N0's: 77-79, 142-145 and 158-165. Thus,
according to one embodiment of the invention, the term "amino acid
sequence of the invention", "Nanobody.RTM. of the invention" and
"polypeptide of the invention" in its broadest sense also covers
such parts or fragments.
[1636] Generally, such parts or fragments of the amino acid
sequences, Nanobodies.RTM. or polypeptides of the invention
(including variants thereof as defined herein) have amino acid
sequences in which, compared to the amino acid sequence of the
corresponding full length amino acid sequence or Nanobody.RTM. of
the invention, one or more of the amino acid residues at the
N-terminal end, one or more amino acid residues at the
&terminal end, one or more contiguous internal amino acid
residues, or any combination thereof, have been deleted and/or
removed.
[1637] The parts or fragments are preferably such that they can
bind to antigenic site II on protein F of hRSV, with an affinity
(suitably measured and/or expressed as a K.sub.D-value (actual or
apparent), a K.sub.A-value (actual or apparent), a k.sub.on-rate
and/or a k.sub.off-rate, or alternatively as an IC.sub.50 value, as
further described herein) that is as defined herein.
[1638] In particular, amino acid sequences, Nanobodies.RTM.,
polypeptides and parts or fragments are preferably such that they:
[1639] bind to protein F of hRSV with a dissociation constant
(K.sub.D) of 1000 nM to 1 nM or less, preferably 100 nM to 1 nM or
less, more preferably 10 nM to 1 nM or less; and/or such that they:
[1640] bind to protein F of hRSV with a k.sub.on-rate of between
10.sup.4 M.sup.-1s.sup.-1 to about 10.sup.7 M.sup.-1s.sup.-1,
preferably between 10.sup.5 M.sup.-1s.sup.-1 and 10.sup.7
M.sup.-1s.sup.-1, more preferably about 10.sup.6 M.sup.-1s.sup.-1
or more; and/or such that they:
[1641] bind to protein F of hRSV with a k.sub.off rate between
10.sup.-2 s.sup.-1 (t.sub.1/2=0.50 s) and 10.sup.-4 s.sup.-1
(providing a near irreversible complex with a t.sub.1/2 of multiple
days), preferably between 10.sup.-3 s.sup.-1 and 10.sup.-4
s.sup.-1, or lower.
[1642] The affinity of the parts or fragments against protein F of
hRSV, can be determined in a manner known per se, for example using
the assay described herein.
[1643] Such parts or fragments will usually also have a hRSV
neutralization efficacy and/or potency as defined herein.
[1644] Any part or fragment is preferably such that it comprises at
least 10 contiguous amino acid residues, preferably at least 20
contiguous amino acid residues, more preferably at least 30
contiguous amino acid residues, such as at least 40 contiguous
amino acid residues, of the amino acid sequence of the
corresponding full length amino acid sequence, Nanobody.RTM. or
polypeptide of the invention.
[1645] Also, any part or fragment is such preferably that it
comprises at least one of the CDR's (and preferably at least CDR3
or part thereof) and at least one other CDR (i.e. CDR1 or CDR2) or
at least part thereof, preferably connected by suitable framework
sequence(s) or at least part thereof. More preferably, any part or
fragment is such that it comprises at least one of the CDR's (and
preferably at least CDR3 or part thereof) and at least part of the
two remaining CDR's, again preferably connected by suitable
framework sequence(s) or at least part thereof.
[1646] According to another particularly preferred, but
non-limiting embodiment, such a part or fragment comprises at least
CDR3, such as FR3, CDR3 and FR4 of the corresponding full length
Nanobody.RTM. of the invention, i.e. as for example described in
the International application WO 03/050531 (tasters et al.).
[1647] As already mentioned above, it is also possible to combine
two or more of such parts or fragments (i.e. from the same or
different amino acid sequences or Nanobodies.RTM. of the
invention), i.e. to provide further parts or fragments (as defined
herein) of an amino acid sequence, a Nanobody.RTM. or a polypeptide
of the invention. It is for example also possible to combine one or
more parts or fragments of an amino acid sequence, a Nanobody.RTM.
or a polypeptide of the invention with one or more parts or
fragments of a human V.sub.H domain.
[1648] According to one preferred embodiment, the parts or
fragments have a degree of sequence identity of at least 50%,
preferably at least 60%, more preferably at least 70%, even more
preferably at least 80%, such as at least 90%, 95% or 99% or more
with one of the amino acid sequences or Nanobodies.RTM. of SEQ ID
NO's: 60-76, 138-141 and 146-157 or with one of the polypeptides of
SEQ ID NO's: 77-79, 142-145 and 158-165.
[1649] The parts and fragments, and nucleic acid sequences encoding
the same, can be provided and optionally combined in any manner
known per se. For example, such parts or fragments can be obtained
by inserting a stop codon in a nucleic acid that encodes a
full-sized amino acid sequence, Nanobody.RTM. or polypeptide of the
invention, and then expressing the nucleic acid thus obtained in a
manner known per se (e.g. as described herein). Alternatively,
nucleic acids encoding such parts or fragments can be obtained by
suitably restricting a nucleic acid that encodes a full-sized amino
acid sequence, Nanobody.RTM. or polypeptide of the invention or by
synthesizing such a nucleic acid in a manner known per se. Parts or
fragments may also be provided using techniques for peptide
synthesis known per se.
[1650] The invention in its broadest sense also comprises
derivatives of the amino acid sequences, Nanobodies.RTM., compounds
or polypeptides of the invention. Such derivatives can generally be
obtained by modification, and in particular by chemical and/or
biological (e.g. enzymatical) modification, of the amino acid
sequences, Nanobodies.RTM., compounds or polypeptides of the
invention and/or of one or more of the amino acid residues that
form the amino acid sequences, Nanobodies.RTM., compounds or
polypeptides of the invention.
[1651] Examples of such modifications, as well as examples of amino
acid residues within the amino acid sequence, Nanobody.RTM.
sequence, compound or polypeptide sequences that can be modified in
such a manner (i.e. either on the protein backbone but preferably
on a side chain), methods and techniques that can be used to
introduce such modifications and the potential uses and advantages
of such modifications will be clear to the skilled person.
[1652] For example, such a modification may involve the
introduction (e.g. by covalent linking or in an other suitable
manner) of one or more functional groups, residues or moieties into
or onto the amino acid sequence, Nanobody.RTM., compound or
polypeptide of the invention, and in particular of one or more
functional groups, residues or moieties that confer one or more
desired properties or functionalities to the amino acid sequence,
Nanobody.RTM., compound or polypeptide of the invention. Example of
such functional groups will be clear to the skilled person.
[1653] For example, such modification may comprise the introduction
(e.g. by covalent binding or in any other suitable manner) of one
or more functional groups that that increase the half-life, the
solubility and/or the absorption of the amino acid sequence,
Nanobody.RTM., compound or polypeptide of the invention, that
reduce the immunogenicity and/or the toxicity of the amino acid
sequence, Nanobody.RTM., compound or polypeptide of the invention,
that eliminate or attenuate any undesirable side effects of the
amino acid sequence, Nanobody.RTM., compound or polypeptide of the
invention, and/or that confer other advantageous properties to
and/or reduce the undesired properties of the amino acid sequence,
Nanobody.RTM., compound or polypeptide of the invention; or any
combination of two or more of the foregoing. Examples of such
functional groups and of techniques for introducing them will be
clear to the skilled person, and can generally comprise all
functional groups and techniques mentioned in the general
background art cited hereinabove as well as the functional groups
and techniques known per se for the modification of pharmaceutical
proteins, and in particular for the modification of antibodies or
antibody fragments (including ScFv's and single domain antibodies),
for which reference is for example made to Remington's
Pharmaceutical Sciences, 16th ed., Mack Publishing Co., Easton, Pa.
(1980). Such functional groups may for example be linked directly
(for example covalently) to an amino acid sequence, Nanobody.RTM.,
compound or polypeptide of the invention, or optionally via a
suitable linker or spacer, as will again be clear to the skilled
person.
[1654] One of the most widely used techniques for increasing the
half-life and/or reducing the immunogenicity of pharmaceutical
proteins comprises attachment of a suitable pharmacologically
acceptable polymer, such as poly(ethyleneglycol) (PEG) or
derivatives thereof (such as methoxypoly(ethyleneglycol) or mPEG).
Generally, any suitable form of pegylation can be used, such as the
pegylation used in the art for antibodies and antibody fragments
(including but not limited to (single) domain antibodies and
ScFv's); reference is made to for example Chapman, Nat.
Biotechnol., 54, 531-545 (2002); by Veronese and Harris, Adv. Drug
Deliv. Rev. 54, 453-456 (2003), by Harris and Chess, Nat. Rev.
Drug. Discov., 2, (2003) and in WO 04/060965. Various reagents for
pegylation of proteins are also commercially available, for example
from Nektar Therapeutics, USA.
[1655] Preferably, site-directed pegylation is used, in particular
via a cysteine-residue (see for example Yang et al., Protein
Engineering, 16, 10, 761-770 (2003). For example, for this purpose,
PEG may be attached to a cysteine residue that naturally occurs in
an amino acid sequence, Nanobody.RTM., compound or polypeptide of
the invention, an amino acid sequence, Nanobody.RTM., compound or
polypeptide of the invention may be modified so as to suitably
introduce one or more cysteine residues for attachment of PEG, or
an amino acid sequence comprising one or more cysteine residues for
attachment of PEG may be fused to the N- and/or C-terminus of an
amino acid sequence, Nanobody.RTM., compound or polypeptide of the
invention, all using techniques of protein engineering known per se
to the skilled person.
[1656] Preferably, for the amino acid sequences, Nanobodies.RTM.,
compounds or polypeptides of the invention of the invention, a PEG
is used with a molecular weight of more than 5000, such as more
than 10,000 and less than 200,000, such as less than 100,000; for
example in the range of 20,000-80,000.
[1657] Another, usually less preferred modification comprises
N-linked or O-linked glycosylation, usually as part of
co-translational and/or post-translational modification, depending
on the host cell used for expressing the amino acid sequence,
Nanobody.RTM., compound or polypeptide of the invention.
[1658] Yet another modification may comprise the introduction of
one or more detectable labels or other signal-generating groups or
moieties, depending on the intended use of the labelled amino acid
sequence, Nanobody.RTM., compound or polypeptide of the invention.
Suitable labels and techniques for attaching, using and detecting
them will be clear to the skilled person, and for example include,
but are not limited to, fluorescent labels (such as fluorescein,
isothiocyanate, rhodamine, phycoerythrin, phycocyanin,
allophycocyanin, o-phthaldehyde, and fluorescamine and fluorescent
metals such as .sup.152Eu or others metals from the lanthanide
series), phosphorescent labels, chemiluminescent labels or
bioluminescent labels (such as luminal, isoluminol, theromatic
acridinium ester, imidazole, acridinium salts, oxalate ester,
dioxetane or CFP and its analogs), radio-isotopes (such as .sup.3H,
.sup.125I, .sup.32P, .sup.35S, .sup.14C, .sup.51Cr, .sup.36Cl,
.sup.57Co, .sup.58Co, .sup.59Fe, and .sup.75Se), metals, metals
chelates or metallic cations (for example metallic cations such as
.sup.99mTc, .sup.123I, .sup.111In, .sup.131I, .sup.97Ru, .sup.67Cu,
.sup.67Ga, and .sup.68Ga or other metals or metallic cations that
are particularly suited for use in in vivo, in vitro or in situ
diagnosis and imaging, such as (.sup.157Gd, .sup.55Mn, .sup.162Dy,
.sup.52Cr, and .sup.56Fe), as well as chromophores and enzymes
(such as malate dehydrogenase, staphylococcal nuclease,
delta-V-steroid isomerase, yeast alcohol dehydrogenase,
alpha-glycerophosphate dehydrogenase, triose phosphate isomerase,
biotinavidin peroxidase, horseradish peroxidase, alkaline
phosphatase, asparaginase, glucose oxidase, .beta.-galactosidase,
ribonuclease, urease, catalase, glucose-VI-phosphate dehydrogenase,
glucoamylase and acetylcholine esterase). Other suitable labels
will be clear to the skilled person, and for example include
moieties that can be detected using NMR or ESR spectroscopy.
[1659] Such labelled amino acid sequences, Nanobodies.RTM.,
compounds or polypeptides of the invention may for example be used
for in vitro, in vivo or in situ assays (including immunoassays
known per se such as ELISA, RIA, EIA and other "sandwich assays",
etc.) as well as in vivo diagnostic and imaging purposes, depending
on the choice of the specific label.
[1660] As will be clear to the skilled person, another modification
may involve the introduction of a chelating group, for example to
chelate one of the metals or metallic cations referred to above.
Suitable chelating groups for example include, without limitation,
diethyl-enetriaminepentaacetic acid (DTPA) or
ethylenediaminetetraacetic acid (EDTA).
[1661] Yet another modification may comprise the introduction of a
functional group that is one part of a specific binding pair, such
as the biotin-(strept)avidin binding pair. Such a functional group
may be used to link the amino acid sequence, Nanobody.RTM.,
compound or polypeptide of the invention to another protein,
polypeptide or chemical compound that is bound to the other half of
the binding pair, i.e. through formation of the binding pair. For
example, an amino acid sequence, Nanobody.RTM., compound or
polypeptide of the invention may be conjugated to biotin, and
linked to another protein, polypeptide, compound or carrier
conjugated to avidin or streptavidin. For example, such a
conjugated amino acid sequence, Nanobody.RTM., compound or
polypeptide of the invention may be used as a reporter, for example
in a diagnostic system where a detectable signal-producing agent is
conjugated to avidin or streptavidin. Such binding pairs may for
example also be used to bind the amino acid sequence,
Nanobody.RTM., compound or polypeptide of the invention to a
carrier, including carriers suitable for pharmaceutical purposes.
One non-limiting example are the liposomal formulations described
by Cao and Suresh, Journal of Drug Targeting, 8, 4, 257 (2000).
Such binding pairs may also be used to link a therapeutically
active agent to the amino acid sequence, Nanobody.RTM., compound or
polypeptide of the invention.
[1662] Other potential chemical and enzymatical modifications will
be clear to the skilled person. Such modifications may also be
introduced for research purposes (e.g. to study function-activity
relationships). Reference is for example made to Lundblad and
Bradshaw, Biotechnol. Appl. Biochem., 26, 143-151 (1997).
[1663] Preferably, the derivatives are such that they bind to
protein F of hRSV, with an affinity (suitably measured and/or
expressed as a K.sub.D-value (actual or apparent), a K.sub.A-value
(actual or apparent), a k.sub.on-rate and/or a k.sub.off-rate, or
alternatively as an IC.sub.50 value, as further described herein)
that is as defined herein (i.e. as defined for the amino acid
sequences, Nanobodies.RTM., polypeptides or compounds per se). Such
derivatives will usually also have a hRSV neutralization efficacy
and/or potency as defined herein.
[1664] As mentioned above, the invention also relates to proteins
or polypeptides that essentially consist of or comprise at least
one amino acid sequence, Nanobody.RTM., compound or polypeptide of
the invention. By "essentially consist of" is meant that the amino
acid sequence of the protein or polypeptide of the invention either
is exactly the same as the amino acid sequence, Nanobody.RTM.,
compound or polypeptide of the invention or corresponds to the
amino acid sequence, Nanobody.RTM., compound or polypeptide of the
invention which has a limited number of amino acid residues, such
as 1-20 amino acid residues, for example 1-10 amino acid residues
and preferably 1-6 amino acid residues, such as 1, 2, 3, 4, 5 or 6
amino acid residues, added at the amino terminal end, at the
carboxy terminal end, or at both the amino terminal end and the
carboxy terminal end of the amino acid sequence, Nanobody.RTM.,
compound or polypeptide.
[1665] Said amino acid residues may or may not change, alter or
otherwise influence the (biological) properties of the amino acid
sequence, Nanobody.RTM., compound or polypeptide of the invention
and may or may not add further functionality to the amino acid
sequence, Nanobody.RTM., compound or polypeptide. For example, such
amino acid residues: [1666] a) can comprise an N-terminal Met
residue, for example as result of expression in a heterologous host
cell or host organism. [1667] b) may form a signal sequence or
leader sequence that directs secretion of the amino acid sequence,
Nanobody.RTM., compound or polypeptide from a host cell upon
synthesis. Suitable secretory leader peptides will be clear to the
skilled person, and may be as further described herein. Usually,
such a leader sequence will be linked to the N-terminus of the
amino acid sequence, Nanobody.RTM., compound or polypeptide,
although the invention in its broadest sense is not limited
thereto; [1668] c) may form a sequence or signal that allows the
amino acid sequence, Nanobody.RTM., compound or polypeptide to be
directed towards and/or to penetrate or enter into specific organs,
tissues, cells, or parts or compartments of cells, and/or that
allows the amino acid sequence, Nanobody.RTM., compound or
polypeptide to penetrate or cross a biological barrier such as a
cell membrane, a cell layer such as a layer of epithelial cells, a
tumor including solid tumors, or the blood-brain-barrier. Examples
of such amino acid sequences will be clear to the skilled person.
Some non-limiting examples are the small peptide vectors
("Pep-trans vectors") described in WO 03/026700 and in Temsamani et
al., Expert Opin. Biol. Ther., 1, 773 (2001); Temsamani and Vidal,
Drug Discov. Today, 9, 1012 (004) and Rousseile, J. Pharmacal. Exp.
Ther., 296, 124-131 (2001), and the membrane translocator sequence
described by Zhao et al., Apoptosis, 8, 631-637 (2003). C-terminal
and N-terminal amino acid sequences for intracellular targeting of
antibody fragments are for example described by Cardinale et al.,
Methods, 34, 171 (2004). Other suitable techniques for
intracellular targeting involve the expression and/or use of
so-called "intrabodies" comprising a amino acid sequence,
Nanobody.RTM., compound or polypeptide of the invention, as
mentioned below; [1669] d) may form a "tag", for example an amino
acid sequence or residue that allows or facilitates the
purification of the amino acid sequence, Nanobody.RTM., compound or
polypeptide, for example using affinity techniques directed against
said sequence or residue. Thereafter, said sequence or residue may
be removed (e.g. by chemical or enzymatical cleavage) to provide
the amino acid sequence, Nanobody.RTM., compound or polypeptide
(for this purpose, the tag may optionally be linked to the amino
acid sequence, Nanobody.RTM., compound or polypeptide sequence via
a cleavable linker sequence or contain a cleavable motif). Some
preferred, but non-limiting examples of such residues are multiple
histidine residues, glutathione residues and a myc-tag such as
AAAEQKLISEEDLNGAA (SEQ ID NO: 111); [1670] e) may be one or more
amino acid residues that have been functionalized and/or that can
serve as a site for attachment of functional groups. Suitable amino
acid residues and functional groups will be clear to the skilled
person and include, but are not limited to, the amino acid residues
and functional groups mentioned herein for the derivatives of the
amino acid sequences, Nanobodies.RTM., compounds or polypeptides of
the invention.
[1671] The invention further relates to methods for preparing the
amino acid sequences, Nanobodies.RTM., polypeptides, compounds,
nucleic acids, host cells, products and compositions described
herein.
[1672] The amino acid sequences, Nanobodies.RTM., polypeptides,
compounds and nucleic acids of the invention can be prepared in a
manner known per se, as will be clear to the skilled person from
the further description herein. For example, the amino acid
sequences, Nanobodies.RTM. and polypeptides of the invention can be
prepared in any manner known per se for the preparation of
antibodies and in particular for the preparation of antibody
fragments (including but not limited to (single) domain antibodies
and ScFv fragments). Some preferred, but non-limiting methods for
preparing the amino acid sequences, Nanobodies.RTM., polypeptides
and nucleic acids include the methods and techniques described
herein.
[1673] The method for producing an amino acid sequence of the
invention, a Nanobody.RTM. of the invention, a polypeptide of the
invention, or a monovalent construct of the invention may comprise
the following steps: [1674] the expression, in a suitable host cell
or host organism (also referred to herein as a "host of the
invention") or in another suitable expression system of a nucleic
acid that encodes said amino acid sequence, Nanobody.RTM. or
polypeptide of the invention (also referred to herein as a "nucleic
acid of the invention"),
[1675] optionally followed by: [1676] a isolating and/or purifying
the amino acid sequence, Nanobody.RTM. or polypeptide of the
invention thus obtained.
[1677] In particular, such a method may comprise the steps of:
[1678] cultivating and/or maintaining a host of the invention under
conditions that are such that said host of the invention expresses
and/or produces at least one amino acid sequence, Nanobody.RTM.
and/or polypeptide of the invention;
[1679] optionally followed by: [1680] isolating and/or purifying
the amino acid sequence, Nanobody.RTM. or polypeptide of the
invention thus obtained.
[1681] Accordingly, the present invention also relates to a nucleic
acid or nucleotide sequence that encodes an amino acid sequence, a
Nanobody.RTM., a polypeptide or a monovalent construct of the
invention (also referred to as "nucleic acid of the invention" or
"nucleotide sequence of the invention"). A nucleic acid of the
invention can be in the form of single or double stranded DNA or
RNA, and is preferably in the form of double stranded DNA. For
example, the nucleotide sequences of the invention may be genomic
DNA, cDNA or synthetic DNA (such as DNA with a codon usage that has
been specifically adapted for expression in the intended host cell
or host organism).
[1682] According to one embodiment of the invention, the nucleic
acid of the invention is in essentially isolated from, as defined
herein. The nucleic acid of the invention may also be in the form
of, be present in and/or be part of a vector, such as for example a
plasmid, cosmid or YAC, which again may be in essentially isolated
form.
[1683] The nucleic acids of the invention can be prepared or
obtained in a manner known per se, based on the information on the
amino acid sequences, Nanobodies.RTM. and/or polypeptides of the
invention given herein, and/or can be isolated from a suitable
natural source. Also, as will be clear to the skilled person, to
prepare a nucleic acid of the invention, also several nucleotide
sequences, such as at least one nucleotide sequence encoding an
amino acid sequence or Nanobody.RTM. and for example nucleic acids
encoding one or more linkers can be linked together in a suitable
manner.
[1684] Techniques for generating the nucleic acids of the invention
will be clear to the skilled person and may for instance include,
but are not limited to, automated DNA synthesis; site-directed
mutagenesis; combining two or more naturally occurring and/or
synthetic sequences (or two or more parts thereof), introduction of
mutations that lead to the expression of a truncated expression
product; introduction of one or more restriction sites (e.g. to
create cassettes and/or regions that may easily be digested and/or
ligated using suitable restriction enzymes), and/or the
introduction of mutations by means of a PCR reaction using one or
more "mismatched" primers. These and other techniques will be clear
to the skilled person, and reference is again made to the standard
handbooks, such as Sambrook et al. and Ausubel et al., mentioned
above, as well as the Examples below.
[1685] The nucleic acid of the invention may also be in the form
of, be present in and/or be part of a genetic construct, as will be
clear to the person skilled in the art. Such genetic constructs
generally comprise at least one nucleic acid of the invention that
is optionally linked to one or more elements of genetic constructs
known per se, such as for example one or more suitable regulatory
elements (such as a suitable promoter(s), enhancer(s),
terminator(s), etc.) and the further elements of genetic constructs
referred to herein. Such genetic constructs comprising at least one
nucleic acid of the invention will also be referred to herein as
"genetic constructs of the invention".
[1686] The genetic constructs of the invention may be DNA or RNA,
and are preferably double-stranded DNA. The genetic constructs of
the invention may also be in a form suitable for transformation of
the intended host cell or host organism, in a form suitable for
integration into the genomic DNA of the intended host cell or in a
form suitable for independent replication, maintenance and/or
inheritance in the intended host organism. For instance, the
genetic constructs of the invention may be in the form of a vector,
such as for example a plasmid, cosmid, YAC, a viral vector or
transposon. In particular, the vector may be an expression vector,
i.e. a vector that can provide for expression in vitro and/or in
vivo (e.g. in a suitable host cell, host organism and/or expression
system).
[1687] In a preferred but non-limiting embodiment, a genetic
construct of the invention comprises
a) at least one nucleic acid of the invention; operably connected
to b) one or more regulatory elements, such as a promoter and
optionally a suitable terminator; and optionally also c) one or
more further elements of genetic constructs known per se; in which
the terms "regulatory element", "promoter", "terminator" and
"operably connected" have their usual meaning in the art (as
further described herein); and in which said "further elements"
present in the genetic constructs may for example be 3'- or 5'-UTR
sequences, leader sequences, selection markers, expression
markers/reporter genes, and/or elements that may facilitate or
increase (the efficiency of) transformation or integration. These
and other suitable elements for such genetic constructs will be
clear to the skilled person, and may for instance depend upon the
type of construct used; the intended host cell or host organism;
the manner in which the nucleotide sequences of the invention of
interest are to be expressed (e.g. via constitutive, transient or
inducible expression); and/or the transformation technique to be
used. For example, regulatory sequences, promoters and terminators
known per se for the expression and production of antibodies and
antibody fragments (including but not limited to (single) domain
antibodies and ScFv fragments) may be used in an essentially
analogous manner.
[1688] Preferably, in the genetic constructs of the invention, said
at least one nucleic acid of the invention and said regulatory
elements, and optionally said one or more further elements, are
"operably linked" to each other, by which is generally meant that
they are in a functional relationship with each other. For
instance, a promoter is considered "operably linked" to a coding
sequence if said promoter is able to initiate or otherwise
control/regulate the transcription and/or the expression of a
coding sequence (in which said coding sequence should be understood
as being "under the control of" said promoter). Generally, when two
nucleotide sequences are operably linked, they will be in the same
orientation and usually also in the same reading frame. They will
usually also be essentially contiguous, although this may also not
be required.
[1689] Preferably, the regulatory and further elements of the
genetic constructs of the invention are such that they are capable
of providing their intended biological function in the intended
host cell or host organism.
[1690] For instance, a promoter, enhancer or terminator should be
"operable" in the intended host cell or host organism, by which is
meant that (for example) said promoter should be capable of
initiating or otherwise controlling/regulating the transcription
and/or the expression of a nucleotide sequence--e.g. a coding
sequence--to which it is operably linked (as defined herein).
[1691] Some particularly preferred promoters include, but are not
limited to, promoters known per se for the expression in the host
cells mentioned herein; and in particular promoters for the
expression in the bacterial cells, such as those mentioned herein
and/or those used in the Examples.
[1692] A selection marker should be such that it allows--i.e. under
appropriate selection conditions--host cells and/or host organisms
that have been (successfully) transformed with the nucleotide
sequence of the invention to be distinguished from host
cells/organisms that have not been (successfully) transformed. Some
preferred, but non-limiting examples of such markers are genes that
provide resistance against antibiotics (such as kanamycin or
ampicillin), genes that provide for temperature resistance, or
genes that allow the host cell or host organism to be maintained in
the absence of certain factors, compounds and/or (food) components
in the medium that are essential for survival of the
non-transformed cells or organisms.
[1693] A leader sequence should be such that--in the intended host
cell or host organism--it allows for the desired post-translational
modifications and/or such that it directs the transcribed mRNA to a
desired part or organelle of a cell. A leader sequence may also
allow for secretion of the expression product from said cell. As
such, the leader sequence may be any pro-, pre-, or prepro-sequence
operable in the host cell or host organism. Leader sequences may
not be required for expression in a bacterial cell. For example,
leader sequences known per se for the expression and production of
antibodies and antibody fragments (including but not limited to
single domain antibodies and ScFv fragments) may be used in an
essentially analogous manner.
[1694] An expression marker or reporter gene should be such
that--in the host cell or host organism--it allows for detection of
the expression of (a gene or nucleotide sequence present on) the
genetic construct. An expression marker may optionally also allow
for the localisation of the expressed product, e.g. in a specific
part or organelle of a cell and/or in (a) specific cell(s),
tissue(s), organ(s) or part(s) of a multicellular organism. Such
reporter genes may also be expressed as a protein fusion with the
amino acid sequence, Nanobody.RTM. or polypeptide of the invention.
Some preferred, but non-limiting examples include fluorescent
proteins such as GFP.
[1695] Some preferred, but non-limiting examples of suitable
promoters, terminator and further elements include those that can
be used for the expression in the host cells mentioned herein; and
in particular those that are suitable for expression in bacterial
cells, such as those mentioned herein and/or those used in the
Examples below. For some (further) non-limiting examples of the
promoters, selection markers, leader sequences, expression markers
and further elements that may be present/used in the genetic
constructs of the invention--such as terminators, transcriptional
and/or translational enhancers and/or integration
factors--reference is made to the general handbooks such as
Sambrook et al. and Ausubel et al. mentioned above, as well as to
the examples that are given in WO 95/07463, WO 96/23810, WO
95/07463, WO 95/21191, WO 97/11094, WO 97/42320, WO 98/06737, WO
98/21355, U.S. Pat. No. 7,207,410, U.S. Pat. No. 5,693,492 and EP 1
085 089. Other examples will be clear to the skilled person.
Reference is also made to the general background art cited above
and the further references cited herein.
[1696] The genetic constructs of the invention may generally be
provided by suitably linking the nucleotide sequence(s) of the
invention to the one or more further elements described above, for
example using the techniques described in the general handbooks
such as Sambrook et al. and Ausubel et al., mentioned above.
[1697] Often, the genetic constructs of the invention will be
obtained by inserting a nucleotide sequence of the invention in a
suitable (expression) vector known per se. Some preferred, but
non-limiting examples of suitable expression vectors are those used
in the Examples below, as well as those mentioned herein.
[1698] The nucleic acids of the invention and/or the genetic
constructs of the invention may be used to transform a host cell or
host organism, i.e. for expression and/or production of the amino
acid sequence, Nanobody.RTM. or polypeptide of the invention.
Suitable hosts or host cells will be clear to the skilled person,
and may for example be any suitable fungal, prokaryotic or
eukaryotic cell or cell line or any suitable fungal, prokaryotic or
eukaryotic organism, for example: [1699] a bacterial strain,
including but not limited to gram-negative strains such as strains
of Escherichia coli; of Proteus, for example of Proteus mirabilis;
of Pseudomonas, for example of Pseudomonas fluorescens; and
gram-positive strains such as strains of Bacillus, for example of
Bacillus subtilis or of Bacillus brevis; of Streptomyces, for
example of Streptomyces lividans; of Staphylococcus, for example of
Staphylococcus carnosus; and of Lactococcus, for example of
Lactococcus lactis; [1700] a fungal cell, including but not limited
to cells from species of Trichoderma, for example from Trichoderma
reesei; of Neurospora, for example from Neurospora crassa; of
Sordaria, for example from Sordaria macrospora; of Aspergillus, for
example from Aspergillus niger or from Aspergillus sojae; or from
other filamentous fungi; [1701] a yeast cell, including but not
limited to cells from species of Saccharomyces, for example of
Saccharomyces cerevisiae; of Schizosaccharomyces, for example of
Schizosaccharomyces pombe; of Pichia, for example of Pichia
pastoris or of Pichia methanolica; of Hansenula, for example of
Hansenula polymorpha; of Kluyveromyces, for example of
Kluyveromyces lactis; of Arxula, for example of Arxula
adeninivorans; of Yarrowia, for example of Yarrowia lipolytica;
[1702] an amphibian cell or cell line, such as Xenopus oocytes;
[1703] an insect-derived cell or cell line, such as cells/cell
lines derived from lepidoptera, including but not limited to
Spodoptera SF9 and Sf21 cells or cells/cell lines derived from
Drosophila, such as Schneider and Kc cells; [1704] a plant or plant
cell, for example in tobacco plants; and/or [1705] a mammalian cell
or cell line, for example a cell or cell line derived from a human,
a cell or a cell line from mammals including but not limited to
CHO-cells, BHK-cells (for example BILK-21 cells) and human cells or
cell lines such as HeLa, COS (for example COS-7) and PER.C6 cells;
as well as all other hosts or host cells known per se for the
expression and production of antibodies and antibody fragments
(including but not limited to (single) domain antibodies and ScFv
fragments), which will be clear to the skilled person. Reference is
also made to the general background art cited hereinabove, as well
as to for example WO 94/29457; WO 96/34103; WO 99/42077; Frenken et
al., (1998), supra; Riechmann and Muyldermans, (1999), supra; van
der Linden, (2000), supra; Thomassen et al., (2002), supra; Joosten
et al., (2003), supra; Joosten et al., (2005), supra; and the
further references cited herein.
[1706] The amino acid sequences, Nanobodies.RTM. and polypeptides
of the invention can also be introduced and expressed in one or
more cells, tissues or organs of a multicellular organism, for
example for prophylactic and/or therapeutic purposes (e.g. as a
gene therapy). For this purpose, the nucleotide sequences of the
invention may be introduced into the cells or tissues in any
suitable way, for example as such (e.g. using liposomes) or after
they have been inserted into a suitable gene therapy vector (for
example derived from retroviruses such as adenovirus, or
parvoviruses such as adeno-associated virus). As will also be clear
to the skilled person, such gene therapy may be performed in vivo
and/or in situ in the body of a patient by administering a nucleic
acid of the invention or a suitable gene therapy vector encoding
the same to the patient or to specific cells or a specific tissue
or organ of the patient; or suitable cells (often taken from the
body of the patient to be treated, such as explanted lymphocytes,
bone marrow aspirates or tissue biopsies) may be treated in vitro
with a nucleotide sequence of the invention and then be suitably
(re-)introduced into the body of the patient. All this can be
performed using gene therapy vectors, techniques and delivery
systems which are well known to the skilled person, and for example
described in Culver, K. W., "Gene Therapy", 1994, p. xii, Mary Ann
Liebert, Inc., Publishers, New York, N.Y.); Giordano, Nature F
Medicine 2 (1996), 534-539; Schaper, Circ. Res. 79 (1996), 911-919;
Anderson, Science 256 (1992), 808-813; Verma, Nature 389 (1994),
239; Isner, Lancet 348 (1996), 370-374; Muhlhauser, Circ. Res. 77
(1995), 4077-1086; Onodera, Blood 91; (1998), 30-36; Verma, Gene
Ther. 5 (1998), 692-699; Nabel, Ann. N.Y. Acad. Sci.: 811 (1997),
289-292; Verzeletti, Hum. Gene Then 9 (1998), 2243-51; Wang, Nature
Medicine 2 (1996), 714-716; WO 94/29469; WO 97/00957, U.S. Pat. No.
5,580,859; U.S. Pat. No. 5,589,466; or Schaper, Current Opinion in
Biotechnology 7 (1996), 635-640. For example, in situ expression of
ScFv fragments (Afanasieva et al., Gene Ther., 10, 1850-1859
(2003)) and of diabodies (Blanco et al., J. Immunol, 171, 1070-1077
(2003)) has been described in the art.
[1707] For expression of the amino acid sequences, Nanobodies.RTM.
or polypeptides in a cell, they may also be expressed as so-called
"intrabodies", as for example described in WO 94/02610, WO 95/22618
and U.S. Pat. No. 7,004,940; WO 03/014960; in Cattaneo, A. &
Biocca, S. (1997) Intracellular Antibodies: Development and
Applications. Landes and Springer-Verlag; and in Kontermann,
Methods 34, (2004), 163-170.
[1708] The amino add sequences, Nanobodies.RTM. and polypeptides of
the invention can for example also be produced in the milk of
transgenic mammals, for example in the milk of rabbits, cows, goats
or sheep (see for example U.S. Pat. No. 6,741,957, U.S. Pat. No.
6,304,489 and U.S. Pat. No. 6,849,992 for general techniques for
introducing transgenes into mammals), in plants or parts of plants
including but not limited to their leaves, flowers, fruits, seed,
roots or turbers (for example in tobacco, maize, soybean or
alfalfa) or in for example pupae of the silkworm Bombix mori.
[1709] Furthermore, the amino acid sequences, Nanobodies.RTM. and
polypeptides of the invention can also be expressed and/or produced
in cell-free expression systems, and suitable examples of such
systems will be clear to the skilled person. Some preferred, but
non-limiting examples include expression in the wheat germ system;
in rabbit reticulocyte lysates; or in the E. coli Zubay system.
[1710] As mentioned above, one of the advantages of the use of
Nanobodies.RTM. is that the polypeptides based thereon can be
prepared through expression in a suitable bacterial system, and
suitable bacterial expression systems, vectors, host cells,
regulatory elements, etc., will be clear to the skilled person, for
example from the references cited above. It should however be noted
that the invention in its broadest sense is not limited to
expression in bacterial systems.
[1711] Preferably, in the invention, an (in vivo or in vitro)
expression system, such as a bacterial expression system, is used
that provides the polypeptides of the invention in a form that is
suitable for pharmaceutical use, and such expression systems will
again be clear to the skilled person. As also will be clear to the
skilled person, polypeptides of the invention suitable for
pharmaceutical use can be prepared using techniques for peptide
synthesis.
[1712] For production on industrial scale, preferred heterologous
hosts for the (industrial) production of Nanobodies.RTM. or
Nanobody.RTM.-containing protein therapeutics include strains of E.
coli, Pichia pastoris, S. cerevisiae that are suitable for large
scale expression/production/fermentation, and in particular for
large scale pharmaceutical expression/production/fermentation.
Suitable examples of such strains will be clear to the skilled
person. Such strains and production/expression systems are also
made available by companies such as Biovitrum (Uppsala,
Sweden).
[1713] Alternatively, mammalian cell lines, in particular Chinese
hamster ovary (CHO) cells, can be used for large scale
expression/production/fermentation, and in particular for large
scale pharmaceutical expression/production/fermentation. Again,
such expression/production systems are also made available by some
of the companies mentioned above.
[1714] The choice of the specific expression system would depend in
part on the requirement for certain post-translational
modifications, more specifically glycosylation. The production of a
Nanobody.RTM.-containing recombinant protein for which
glycosylation is desired or required would necessitate the use of
mammalian expression hosts that have the ability to glycosylate the
expressed protein. In this respect, it will be clear to the skilled
person that the glycosylation pattern obtained (i.e. the kind,
number and position of residues attached) will depend on the cell
or cell line that is used for the expression. Preferably, either a
human cell or cell line is used (i.e. leading to a protein that
essentially has a human glycosylation pattern) or another mammalian
cell line is used that can provide a glycosylation pattern that is
essentially and/or functionally the same as human glycosylation or
at least mimics human glycosylation. Generally, prokaryotic hosts
such as E. coli do not have the ability to glycosylate proteins,
and the use of lower eukaryotes such as yeast usually leads to a
glycosylation pattern that differs from human glycosylation.
Nevertheless, it should be understood that all the foregoing host
cells and expression systems can be used in the invention,
depending on the desired amino acid sequence, Nanobody.RTM. or
polypeptide to be obtained.
[1715] Thus, according to one non-limiting embodiment of the
invention, the amino acid sequence, Nanobody.RTM. or polypeptide of
the invention is glycosylated. According to another non-limiting
embodiment of the invention, the amino acid sequence, Nanobody.RTM.
or polypeptide of the invention is non-glycosylated.
[1716] According to one preferred, but non-limiting embodiment of
the invention, the amino acid sequence, Nanobody.RTM. or
polypeptide of the invention is produced in a bacterial cell, in
particular a bacterial cell suitable for large scale pharmaceutical
production, such as cells of the strains mentioned above.
[1717] According to another preferred, but non-limiting embodiment
of the invention, the amino acid sequence, Nanobody.RTM. or
polypeptide of the invention is produced in a yeast cell, in
particular a yeast cell suitable for large scale pharmaceutical
production, such as cells of the species mentioned above.
[1718] According to yet another preferred, but non-limiting
embodiment of the invention, the amino acid sequence, Nanobody.RTM.
or polypeptide of the invention is produced in a mammalian cell, in
particular in a human cell or in a cell of a human cell line, and
more in particular in a human cell or in a cell of a human cell
line that is suitable for large scale pharmaceutical production,
such as the cell lines mentioned hereinabove.
[1719] When expression in a host cell is used to produce the amino
acid sequences, Nanobodies.RTM. and the polypeptides of the
invention, the amino acid sequences, Nanobodies.RTM. and
polypeptides of the invention can be produced either
intracellularly (e.g. in the cytosol, in the periplasma or in
inclusion bodies) and then isolated from the host cells and
optionally further purified; or can be produced extracellularly
(e.g. in the medium in which the host cells are cultured) and then
isolated from the culture medium and optionally further purified.
When eukaryotic host cells are used, extracellular production is
usually preferred since this considerably facilitates the further
isolation and downstream processing of the amino acid sequences,
Nanobodies.RTM., polypeptides and proteins obtained. Bacterial
cells such as the strains of E. coli mentioned above normally do
not secrete proteins extracellularly, except for a few classes of
proteins such as toxins and hemolysin, and secretory production in
E. coli refers to the translocation of proteins across the inner
membrane to the periplasmic space. Periplasmic production provides
several advantages over cytosolic production. For example, the
N-terminal amino acid sequence of the secreted product can be
identical to the natural gene product after cleavage of the
secretion signal sequence by a specific signal peptidase. Also,
there appears to be much less protease activity in the periplasm
than in the cytoplasm. In addition, protein purification is simpler
due to fewer contaminating proteins in the periplasm. Another
advantage is that correct disulfide bonds may form because the
periplasm provides a more oxidative environment than the cytoplasm.
Proteins overexpressed in E. coli are often found in insoluble
aggregates, so-called inclusion bodies. These inclusion bodies may
be located in the cytosol or in the periplasm; the recovery of
biologically active proteins from these inclusion bodies requires a
denaturation/refolding process. Many recombinant proteins,
including therapeutic proteins, are recovered from inclusion
bodies. Alternatively, as will be clear to the skilled person,
recombinant strains of bacteria that have been genetically modified
so as to secrete a desired protein, and in particular an amino acid
sequence, Nanobody.RTM. or a polypeptide of the invention, can be
used.
[1720] Thus, according to one non-limiting embodiment of the
invention, the amino acid sequence, Nanobody.RTM. or polypeptide of
the invention is an amino acid sequence, Nanobody.RTM. or
polypeptide that has been produced intracellularly and that has
been isolated from the host cell, and in particular from a
bacterial cell or from an inclusion body in a bacterial cell.
According to another non-limiting embodiment of the invention, the
amino acid sequence, Nanobody.RTM. or polypeptide of the invention
is an amino acid sequence, Nanobody.RTM. or polypeptide that has
been produced extracellularly, and that has been isolated from the
medium in which the host cell is cultivated.
[1721] Some preferred, but non-limiting promoters for use with
these host cells include, [1722] for expression in E. coli: lac
promoter (and derivatives thereof such as the lacUV5 promoter);
arabinose promoter; left-(PL) and rightward (PR) promoter of phage
lambda; promoter of the trp operon; hybrid lac/trp promoters (tac
and trc); T7-promoter (more specifically that of T7-phage gene 10)
and other T-phage promoters; promoter of the Tn10 tetracycline
resistance gene; engineered variants of the above promoters that
include one or more copies of an extraneous regulatory operator
sequence; [1723] for expression in S. cerevisiae: constitutive:
ADH1 (alcohol dehydrogenase 1), ENO (enolase), CYC1 (cytochrome c
iso-1), GAPDH (glyceraldehydes-3-phosphate dehydrogenase), PGK1
(phosphoglycerate kinase), PYK1 (pyruvate kinase); regulated:
GAL1,10,7 (galactose metabolic enzymes), ADH2 (alcohol
dehydrogenase 2), PHO5 (acid phosphatase), CUP1 (copper
metallothionein); heterologous: CaMV (cauliflower mosaic virus 355
promoter); [1724] for expression in Pichia pastoris: the AOX1
promoter (alcohol oxidase I); [1725] for expression in mammalian
cells: human cytomegalovirus (hCMV) immediate early
enhancer/promoter; human cytomegalovirus (hCMV) immediate early
promoter variant that contains two tetracycline operator sequences
such that the promoter can be regulated by the Tet repressor;
Herpes Simplex Virus thymidine kinase (TK) promoter; Rous Sarcoma
Virus long terminal repeat (RSV LTR) enhancer/promoter; elongation
factor 1.alpha. (hEF-1.alpha.) promoter from human, chimpanzee,
mouse or rat; the SV40 early promoter; HIV-1 long terminal repeat
promoter; .beta.-actin promoter; Some preferred, but non-limiting
vectors for use with these host cells include: [1726] vectors for
expression in mammalian cells: pMAMneo (Clontech), pcDNA3
(Invitrogen), pMC1neo (Stratagene), pSG5 (Stratagene), EBO-pSV2-neo
(ATCC 37593), pBPV-1 (8-2) (ATCC 37110), pdBPV-MMTneo (342-12)
(ATCC 37224), pRSVgpt (ATCC37199), pRSVneo (ATCC37198), pSV2-dhfr
(ATCC 37146), pUCTag (ATCC 37460) and 1ZD35 (ATCC 37565), as well
as viral-based expression systems, such as those based on
adenovirus; [1727] vectors for expression in bacterial cells: pET
vectors (Novagen) and pQE vectors (Qiagen); [1728] vectors for
expression in yeast or other fungal cells: pYES2 (Invitrogen) and
Pichia expression vectors (Invitrogen); [1729] vectors for
expression in insect cells: pBlueBacII (Invitrogen) and other
baculovirus vectors vectors for expression in plants or plant
cells: for example vectors based on cauliflower mosaic virus or
tobacco mosaic virus, suitable strains of Agrobacterium, or
Ti-plasmid based vectors.
[1730] Some preferred, but non-limiting secretory sequences for use
with these host cells include: [1731] for use in bacterial cells
such as E. coli: PeIB, BIa, OmpA, OmpC, OmpF, OmpT, SU, PhoA, PhoE,
MaIE, Lpp, LamB, and the like; TAT signal peptide, hemolysin
C-terminal secretion signal; [1732] for use in yeast:
.alpha.-mating factor prepro-sequence, phosphatase (pho1),
invertase (Suc), etc.; [1733] for use in mammalian cells:
indigenous signal in case the target protein is of eukaryotic
origin; murine Ig K-chain V-J2-C signal peptide; etc.
[1734] Suitable techniques for transforming a host or host cell of
the invention will be clear to the skilled person and may depend on
the intended host cell/host organism and the genetic construct to
be used. Reference is again made to the handbooks and patent
applications mentioned above.
[1735] After transformation, a step for detecting and selecting
those host cells or host organisms that have been successfully
transformed with the nucleotide sequence/genetic construct of the
invention may be performed. This may for instance be a selection
step based on a selectable marker present in the genetic construct
of the invention or a step involving the detection of the amino
acid sequence of the invention, e.g. using specific antibodies.
[1736] The transformed host cell (which may be in the form or a
stable cell line) or host organisms (which may be in the form of a
stable mutant line or strain) farm further aspects of the present
invention.
[1737] Preferably, these host cells or host organisms are such that
they express, or are (at least) capable of expressing (e.g. under
suitable conditions), an amino acid sequence, Nanobody.RTM. or
polypeptide of the invention (and in case of a host organism: in at
least one cell, part, tissue or organ thereof). The invention also
includes further generations, progeny and/or offspring of the host
cell or host organism of the invention, that may for instance be
obtained by cell division or by sexual or asexual reproduction.
[1738] To produce/obtain expression of the amino acid sequences,
Nanobodies.RTM. or polypeptides of the invention, the transformed
host cell or transformed host organism may generally be kept,
maintained and/or cultured under conditions such that the (desired)
amino acid sequence, Nanobody.RTM. or polypeptide of the invention
is expressed/produced. Suitable conditions will be clear to the
skilled person and will usually depend upon the host cell/host
organism used, as well as on the regulatory elements that control
the expression of the (relevant) nucleotide sequence of the
invention. Again, reference is made to the handbooks and patent
applications mentioned above in the paragraphs on the genetic
constructs of the invention.
[1739] Generally, suitable conditions may include the use of a
suitable medium, the presence of a suitable source of food and/or
suitable nutrients, the use of a suitable temperature, and
optionally the presence of a suitable inducing factor or compound
(e.g. when the nucleotide sequences of the invention are under the
control of an inducible promoter); all of which may be selected by
the skilled person. Again, under such conditions, the amino acid
sequences of the invention may be expressed in a constitutive
manner, in a transient manner, or only when suitably induced.
[1740] It will also be clear to the skilled person that the amino
acid sequence, Nanobody.RTM. or polypeptide of the invention may
(first) be generated in an immature form (as mentioned above),
which may then be subjected to post-translational modification,
depending on the host cell/host organism used. Also, the amino acid
sequence, Nanobody.RTM. or polypeptide of the invention may be
glycosylated, again depending on the host cell/host organism
used.
[1741] The amino acid sequence, Nanobody.RTM. or polypeptide of the
invention may then be isolated from the host cell/host organism
and/or from the medium in which said host cell or host organism was
cultivated, using protein isolation and/or purification techniques
known per se, such as (preparative) chromatography and/or
electrophoresis techniques, differential precipitation techniques,
affinity techniques (e.g. using a specific, cleavable amino acid
sequence fused with the amino acid sequence, Nanobody.RTM. or
polypeptide of the invention) and/or preparative immunological
techniques (i.e. using antibodies against the amino acid sequence
to be isolated).
[1742] The invention further relates to a product or composition
containing or comprising at least one amino acid sequence of the
invention (or a suitable fragment thereof), at least one
Nanobody.RTM. of the invention, at least one polypeptide of the
invention, at least one compound or construct of the invention, at
least one monovalent construct of the invention and/or at least one
nucleic acid of the invention, and optionally one or more further
components of such compositions known per se, i.e. depending on the
intended use of the composition. Such a product or composition may
for example be a pharmaceutical composition (as described herein),
a veterinary composition or a product or composition for diagnostic
use (as also described herein). Some preferred but non-limiting
examples of such products or compositions will become clear from
the further description herein.
[1743] Generally, for pharmaceutical use, the amino acid sequences,
Nanobodies.RTM. and polypeptides of the invention may be formulated
as a pharmaceutical preparation or compositions comprising at least
one amino acid sequence, Nanobody.RTM. or polypeptide of the
invention and at least one pharmaceutically acceptable carrier,
diluent or excipient and/or adjuvant, and optionally one or more
further pharmaceutically active polypeptides and/or compounds. By
means of non-limiting examples, such a formulation may be in a form
suitable for oral administration, for parenteral administration
(such as by intravenous, intramuscular or subcutaneous injection or
intravenous infusion), for topical administration, for
administration by inhalation, by a skin patch, by an implant, by a
suppository, etc. Such suitable administration forms--which may be
solid, semi-solid or liquid, depending on the manner of
administration--as well as methods and carriers for use in the
preparation thereof, will be clear to the skilled person, and are
further described herein.
[1744] Thus, in a further aspect, the invention relates to a
pharmaceutical composition that contains at least one amino acid of
the invention, at least one Nanobody.RTM. of the invention, at
least one compound or construct of the invention or at least one
polypeptide of the invention and at least one suitable carrier,
diluent or excipient (i.e. suitable for pharmaceutical use), and
optionally one or more further active substances.
[1745] Generally, the amino acid sequences, Nanobodies.RTM.,
compounds, constructs and polypeptides of the invention can be
formulated and administered in any suitable manner known per se,
for which reference is for example made to the general background
art cited above (and in particular to WO 04/041862, WO 04/041863,
WO 04/041865, WO 04/041867 and WO 08/020,079) as well as to the
standard handbooks, such as Remington's Pharmaceutical Sciences,
18.sup.th Ed., Mack Publishing Company, USA (1990), Remington, the
Science and Practice of Pharmacy, 21st Edition, Lippincott Williams
and Wilkins (2005); or the Handbook of Therapeutic Antibodies (S.
Dubel, Ed.), Wiley, Weinheim, 2007 (see for example pages
252-255).
[1746] For example, the amino acid sequences, Nanobodies.RTM.,
compounds, constructs and polypeptides of the invention may be
formulated and administered in any manner known per se for
conventional antibodies and antibody fragments (including ScFv's
and diabodies) and other pharmaceutically active proteins. Such
formulations and methods for preparing the same will be clear to
the skilled person, and for example include preparations suitable
for parenteral administration (for example intravenous,
intraperitoneal, subcutaneous, intramuscular, intraluminal,
intra-arterial or intrathecal administration) or for topical (i.e.
transdermal or intradermal) administration.
[1747] Preparations for parenteral administration may for example
be sterile solutions, suspensions, dispersions or emulsions that
are suitable for infusion or injection. Suitable carriers or
diluents for such preparations for example include, without
limitation, those mentioned on page 143 of WO 08/020,079. Usually,
aqueous solutions or suspensions will be preferred.
[1748] The amino acid sequences, Nanobodies.RTM., compounds,
constructs and polypeptides of the invention can also be
administered using gene therapy methods of delivery. See, e.g.,
U.S. Pat. No. 5,399,346, which is incorporated by reference in its
entirety. Using a gene therapy method of delivery, primary cells
transfected with the gene encoding an amino acid sequence,
Nanobody.RTM. or polypeptide of the invention can additionally be
transfected with tissue specific promoters to target specific
organs, tissue, grafts, tumors, or cells and can additionally be
transfected with signal and stabilization sequences for
subcelluiarly localized expression.
[1749] Thus, the amino acid sequences, Nanobodies.RTM., compounds,
constructs and polypeptides of the invention may be systemically
administered, e.g., orally, in combination with a pharmaceutically
acceptable vehicle such as an inert diluent or an assimilable
edible carrier. They may be enclosed in hard or soft shell gelatin
capsules, may be compressed into tablets, or may be incorporated
directly with the food of the patient's diet. For oral therapeutic
administration, the amino acid sequences, Nanobodies.RTM.,
compounds, constructs and polypeptides of the invention may be
combined with one or more excipients and used in the form of
ingestible tablets, buccal tablets, troches, capsules, elixirs,
suspensions, syrups, wafers, and the like. Such compositions and
preparations should contain at least 0.1% of the amino acid
sequence, Nanobody.RTM., compound, construct or polypeptide of the
invention. Their percentage in the compositions and preparations
may, of course, be varied and may conveniently be between about 2
to about 60% of the weight of a given unit dosage form. The amount
of the amino acid sequence, Nanobody.RTM., compound, construct or
polypeptide of the invention in such therapeutically useful
compositions is such that an effective dosage level will be
obtained.
[1750] The tablets, troches, pIIIs, capsules, and the like may also
contain binders, excipients, disintegrating agents, lubricants and
sweetening or flavouring agents, for example those mentioned on
pages 143-144 of WO 08/020,079. When the unit dosage form is a
capsule, it may contain, in addition to materials of the above
type, a liquid carrier, such as a vegetable oil or a polyethylene
glycol. Various other materials may be present as coatings or to
otherwise modify the physical form of the solid unit dosage form.
For instance, tablets, pIIIs, or capsules may be coated with
gelatin, wax, shellac or sugar and the like. A syrup or elixir may
contain the amino acid sequences, Nanobodies.RTM., compounds,
constructs and polypeptides of the invention, sucrose or fructose
as a sweetening agent, methyl and propylparabens as preservatives,
a dye and flavoring such as cherry or orange flavor. Of course, any
material used in preparing any unit dosage form should be
pharmaceutically acceptable and substantially non-toxic in the
amounts employed. In addition, the amino acid sequences,
Nanobodies.RTM., compounds, constructs and polypeptides of the
invention may be incorporated into sustained-release preparations
and devices.
[1751] Preparations and formulations for oral administration may
also be provided with an enteric coating that will allow the
constructs of the invention to resist the gastric environment and
pass into the intestines. More generally, preparations and
formulations for oral administration may be suitably formulated for
delivery into any desired part of the gastrointestinal tract. In
addition, suitable suppositories may be used for delivery into the
gastrointestinal tract.
[1752] The amino acid sequences, Nanobodies.RTM., compounds,
constructs and polypeptides of the invention may also be
administered intravenously or intraperitoneally by infusion or
injection, as further described on pages 144 and 145 of WO
08/020,079.
[1753] For topical administration, the amino acid sequences,
Nanobodies.RTM., compounds, constructs and polypeptides of the
invention may be applied in pure form, i.e., when they are liquids.
However, it will generally be desirable to administer them to the
skin as compositions or formulations, in combination with a
dermatologically acceptable carrier, which may be a solid or a
liquid, as further described on page 145 of WO 08/020,079.
[1754] Generally, the concentration of the amino acid sequences,
Nanobodies.RTM., compounds, constructs and polypeptides of the
invention in a liquid composition, such as a lotion, will be from
about 0.1-25 wt-%, preferably from about 0.5-10 wt-%. The
concentration in a semi-solid or solid composition such as a gel or
a powder will be about 0.1-5 wt-%, preferably about 0.5-2.5
wt-%.
[1755] In a preferred aspect, the amino acid sequences,
Nanobodies.RTM., compounds, constructs and/or polypeptides of the
invention and/or compositions comprising the same are administered
to the pulmonary tissue. In the context of the present invention,
"pulmonary tissue" is for the purposes of this invention equivalent
with lung tissue or lung. The lung comprises 2 distinct zones: a
conducting and a respiratory zone, within which the airway and
vascular compartments lie (see e.g. "Pulmonary Drug Delivery",
Edited by Karoline Bechtold-Peters and Henrik Luessen, 2007, ISBN
978-3-87193-322-6 pages 16-28).
[1756] For pulmonary delivery, the amino acid sequences,
Nanobodies.RTM., compounds, constructs and polypeptides of the
invention may be applied in pure form, i.e., when they are liquids
or a dry powder. However, it will be preferred to administer them
to the pulmonary tissue as composition or formulation comprising an
amino acid sequence, Nanobody.RTM., compound, construct and/or
polypeptide of the invention and a carrier suitable for pulmonary
delivery. Accordingly the present invention also relates to a
pharmaceutical composition comprising the amino acid sequence,
Nanobody.RTM., compound, construct and/or polypeptide of the
invention and a carrier suitable for pulmonary delivery. Carriers
suitable for pulmonary delivery are known in the art.
[1757] The amino acid sequences, Nanobodies.RTM., compounds,
constructs and/or polypeptides of the invention may also be
administered as micro- or nanoparticles of pure drugs with particle
sizes and distributions favorable for pulmonary delivery.
[1758] Accordingly the present invention also relates to a
pharmaceutical device suitable for the pulmonary delivery of the
amino acid sequences, Nanobodies.RTM., compounds, constructs and/or
polypeptides of the invention and suitable in the use of a
composition comprising the same. This device may be an inhaler for
liquids (e.g. a suspension of fine solid particles or droplets)
comprising the amino acid sequence, Nanobody.RTM., compound,
constructs and/or polypeptide of the invention. Preferably this
device is an aerosol comprising the amino acid sequence,
Nanobody.RTM., compound, construct and/or polypeptide of the
invention. The device may also be a dry powder inhaler comprising
the amino acid sequence, Nanobody.RTM., compound, construct and/or
polypeptide of the invention in the form of a dry powder.
[1759] In a preferred method, the administration to the pulmonary
tissue is performed by inhaling the amino acid sequences,
Nanobodies.RTM., compounds, constructs and/or polypeptides of the
invention and/or the composition comprising the same in an aerosol
cloud. According to the invention, inhaling of the aerosol cloud
can be performed by an inhaler device. The device should generate
from a formulation comprising the amino acid sequences,
Nanobodies.RTM., compounds, constructs and/or polypeptides of the
invention (and/or composition comprising the same) an aerosol cloud
of the desired particle size (distribution) at the appropriate
moment of the mammal's inhalation cycle, containing the right dose
of the amino acid sequences, Nanobodies.RTM., compounds, constructs
and/or polypeptides of the invention ("Pulmonary drug delivery",
Bechtold-Peters and Luessen, eds., ISBN 978-3-87193-322-6, page
125).
[1760] In the context of the present invention, "aerosol" denotes a
suspension of fine solid particles or liquid droplets (or
combination thereof) in a gas wherein for the purposes of this
invention the particles and/or droplets comprise the amino acid
sequences, Nanobodies.RTM., compounds, constructs and/or
polypeptides of the invention.
[1761] The device should generate from the formulation an aerosol
cloud of the desired particle size (distribution) at the
appropriate moment of the mammal's inhalation cycle, containing the
right dose of amino acid sequences, Nanobodies.RTM., compounds,
constructs and/or polypeptides of the invention. The following 4
requirements (formulation, particle size, time and dose) should be
considered ("Pulmonary Drug Delivery", Bechtold-Peters and Luessen,
eds., supra, pages 125 and 126): [1762] The formulations that are
used in the devices may vary from aqueous solutions or suspensions
used in nebulizers to the propellant-based solutions or suspensions
used in metered dose inhaler or even specially engineered powder
mixtures for the dry powder inhalers. All these different
formulations require different principles for aerosol generation,
which emphasizes the mutual dependency of device and formulation;
[1763] Since the site of deposition of aerosol particles depends on
their (aerodynamic) size and velocity, the desired particle size of
the aerosol cloud varies depending on the desired site of
deposition in the lung, which is related to the therapeutic goal of
the administration; [1764] As the aerosol cloud can be tuned to be
released at different moments during the inhalation cycle generated
by the mammal, it is preferred that for the agents of the invention
(to be deposited in the peripheral parts of the lung) the aerosol
is released at the start of the inhalation cycle; [1765] Doses may
vary considerably and may e.g. vary e.g. for a human from a few
microgram to several hundreds of microgram or even milligrams, e.g.
about up to about 10 to 100 milligrams.
[1766] Various inhalation systems are e.g. described on pages 129
to 148 in the review ("Pulmonary Drug Delivery", Bechtold-Peters
and Luessen, eds., supra) and include, but are not limited to,
nebulizers, metered dose inhalers, metered dose liquid inhalers,
and dry powder inhalers. Devices taking into account optimized and
individualized breathing pattern for controlled inhalation
maneuvers may also be used (see AKITA.RTM. technology on page 157
of "Pulmonary Drug Delivery", Bechtold-Peters and Luessen, eds.,
supra).
[1767] However, not only the device is important to pulmonary
delivery of the amino acid sequences, Nanobodies.RTM., compounds,
constructs and/or polypeptides of the invention but also the right
formulation is critical to achieve an effective delivery. This can
be in principle achieved by using one of the following approaches:
[1768] Administration of aqueous solutions or suspensions
comprising the amino acid sequences, Nanobodies.RTM., compounds,
constructs and/or polypeptides of the invention (e.g. nasal drops)
into the nasal cavities; [1769] Nebulisation of aqueous solutions
or suspensions comprising the amino acid sequences,
Nanobodies.RTM., compounds, constructs and/or polypeptides of the
invention; [1770] Atomization by means of liquefied propellants;
and [1771] Dispersion of dry powders.
[1772] Hence formulations of the amino acid sequences,
Nanobodies.RTM., compounds, constructs and/or polypeptides of the
invention have to be adopted and adjusted to the chosen inhalation
device. Appropriate formulations, i.e. the excipients in addition
to the amino acid sequences, Nanobodies.RTM., compounds, constructs
and/or polypeptides of the invention, are e.g. described in chapter
IV of "Pulmonary Drug Delivery", Bechtold-Peters and Luessen, eds.,
supra. In this respect, reference is also made to U.S. provisional
application No. 61/303,447 entitled "Methods and compositions for
the preparation of aerosols" filed by Ablynx N.V. on 12 Feb.
2010.
[1773] The amount of the amino acid sequences, Nanobodies.RTM.,
compounds, constructs and polypeptides of the invention required
for use in treatment will vary not only with the particular amino
acid sequence, Nanobody.RTM., compounds, constructs or polypeptide
selected but also with the route of administration, the nature of
the condition being treated and the age and condition of the
patient and will be ultimately at the discretion of the attendant
physician or clinician. Also the dosage of the amino acid
sequences, Nanobodies.RTM., compounds, constructs and polypeptides
of the invention varies depending on the target host cell, tumor,
tissue, graft, or organ.
[1774] The desired dose may conveniently be presented in a single
dose or as divided doses administered at appropriate intervals, for
example, as two, three, four or more sub-doses per day. The
sub-dose itself may be further divided, e.g., into a number of
discrete loosely spaced administrations; such as multiple
inhalations from an insufflator or by application of a plurality of
drops into the eye.
[1775] An administration regimen could include long-term, daily
treatment. By "long-term" is meant at least two weeks and
preferably, several weeks, months, or years of duration. Necessary
modifications in this dosage range may be determined by one of
ordinary skill in the art using only routine experimentation given
the teachings herein. See Remington's Pharmaceutical Sciences
(Martin, E. W., ed. 4), Mack Publishing Co., Easton, Pa. The dosage
can also be adjusted by the individual physician in the event of
any complication.
[1776] The invention further relates to applications and uses of
the amino acid sequences, Nanobodies.RTM., polypeptides, compounds,
nucleic acids, host cells, products and compositions described
herein, as well as to methods for the prevention and/or treatment
respiratory track infection caused by hRSV. Some preferred but
non-limiting applications and uses will become clear from the
further description herein.
[1777] The amino acid sequences, Nanobodies.RTM., polypeptides,
compounds and compositions of the present invention can generally
be used to block the interaction of protein F of hRSV with the
target host cell and/or its membrane, to neutralize hRSV (different
hRSV strains and/or escape mutants), to modulate, inhibit and/or
prevent hRSV infectivity (of different hRSV strains and/or escape
mutants), to modulate, inhibit and/or prevent fusion (of different
hRSV strains and/or escape mutants) with (the cell membrane of) the
target host cell and/or to modulate, inhibit and/or prevent hRSV
entry in the target host cell (of different hRSV strains and/or
escape mutants).
[1778] In one aspect, the amino acid sequences, Nanobodies.RTM.,
polypeptides, compounds and compositions of the present invention
can block the interaction of protein F of hRSV with the target host
cell and/or its membrane by at least 1%, preferably at least 5%,
such as at least 10% or at least 25%, for example by at least 50%,
at least 60%, at least 70%, at least 80%, or 90% or more, compared
to the interaction of protein F of hRSV with the target host cell
and/or its membrane under the same conditions but without the
presence of the amino acid sequence, Nanobody.RTM. or polypeptide
of the invention, measured in any suitable manner known per se, for
example using one of the assays described herein.
[1779] In another aspect, the amino acid sequences,
Nanobodies.RTM., polypeptides, compounds and compositions of the
present invention neutralize hRSV infectivity by at least 1%,
preferably at least 5%, such as at least 10% or at least 25%, for
example by at least 50%, at least 60%, at least 70%, at least 80%,
or 90% or more, compared to, the neutralization of hRSV under the
same conditions but without the presence of the amino acid
sequence, Nanobody.RTM. or polypeptide of the invention, measured
in any suitable manner known per se, for example using one of the
assays described herein.
[1780] In the context of the present invention, "modulating" or "to
modulate" generally means either reducing, preventing or inhibiting
viral infectivity, fusion and/or viral entry and/or reducing,
preventing or inhibiting the biological pathways that are mediated
by protein F of hRSV, as measured using a suitable in vitro,
cellular or in vivo assay (such as those mentioned herein). In
particular, "modulating" or "to modulate" may mean either reducing,
preventing or inhibiting viral infectivity, fusion and/or viral
entry and/or reducing, preventing or inhibiting the biological
pathways that are mediated by protein F of hRSV as measured using a
suitable in vitro, cellular or in vivo assay (such as those
mentioned herein), by at least 1%, preferably at least 5%, such as
at least 10% or at least 25%, for example by at least 50%, at least
60%, at least 70%, at least 80%, or 90% or more, compared to normal
(i.e. naturally occurring) viral infectivity, fusion and/or viral
entry and/or normal (i.e. naturally occurring) the biological
pathways that are mediated by protein F of hRSV in the same assay
under the same conditions but without the presence of the amino
acid sequence, Nanobody.RTM. or polypeptide of the invention.
[1781] In one aspect, the amino acid sequences, Nanobodies.RTM.,
polypeptides, compounds and compositions of the present invention
may modulate, inhibit and/or prevent hRSV infectivity by at least
1%, preferably at least 5%, such as at least 10% or at least 25%,
for example by at least 50%, at least 60%, at least 70%, at least
80%, or 90% or more, compared to the infectivity under the same
conditions but without the presence of the amino acid sequence,
Nanobody.RTM. or polypeptide of the invention, measured in any
suitable manner known per se, for example using one of the assays
described herein.
[1782] The term "viral entry" used herein encompasses any
viral-mediated biological pathway that is needed to accomplish
virion attachment to a target host cell and/or viral fusion with a
target host cell. It is encompassed in the present invention that
viral entry, which may be any viral-mediated biological pathway
that is needed to accomplish virion attachment to a target host
cell and/or viral fusion with a target host cell, can be modulated
and/or reduced and/or prevented and/or inhibited by specific
binding of the amino acid sequences, Nanobodies.RTM., polypeptides
and/or compounds of the invention, as measured using a suitable in
vitro, cellular or in vivo assay (such as those mentioned herein).
In particular, viral entry, which can be mediated by protein F of
hRSV, can be modulated, reduced, prevented or inhibited by specific
binding of the amino acid sequences, Nanobodies.RTM., polypeptides
and/or compounds of the invention to protein F of hRSV, as measured
using a suitable in vitro, cellular or in vivo assay (such as those
mentioned herein), by at least 1%, preferably at least 5%, such as
at least 10% or at least 25%, for example by at least 50%, at least
60%, at least 70%, at least 80%, or 90% or more, compared to normal
(i.e. naturally occurring) viral entry (as defined herein), which
can be mediated by protein F of hRSV, in the same assay under the
same conditions but without the presence of the amino acid
sequence, Nanobody.RTM., polypeptide and/or compound of the
invention. Thus, it is also encompassed that that viral attachment
and/or viral fusion can be modulated and/or reduced and/or
prevented and/or inhibited by specific binding of the amino acid
sequences, Nanobodies.RTM., polypeptides and/or compounds of the
invention to protein F of hRSV, as measured using a suitable in
vitro, cellular or in vivo assay (such as those mentioned herein).
In particular, viral attachment and/or viral fusion, which can be
mediated by protein F of hRSV, can be modulated, reduced, prevented
or inhibited by specific binding of the amino acid sequences,
Nanobodies.RTM., polypeptides and/or compounds of the invention to
protein F of hRSV, as measured using a suitable in vitro, cellular
or in vivo assay (such as those mentioned herein), by at least 1%,
preferably at least 5%, such as at least 10% or at least 25%, for
example by at least 50%, at least 60%, at least 70%, at least 80%,
or 90% or more, compared to normal (i.e. naturally occurring) viral
attachment and/or viral fusion, which can be mediated by protein F
of hRSV in the same assay under the same conditions but without the
presence of the amino acid sequence, Nanobody.RTM., polypeptide
and/or compound of the invention.
[1783] In this respect, the amino acid sequences, Nanobodies.RTM.,
polypeptides, compounds and compositions of the present invention
may modulate, inhibit and/or prevent hRSV entry in the target host
cell by at least 1%, preferably at least 5%, such as at least 10%
or at least 25%, for example by at least 50%, at least 60%, at
least 70%, at least 80%, or 90% or more, compared to the entry in
the target host cell under the same conditions but without the
presence of the amino acid sequence, Nanobody.RTM. or polypeptide
of the invention, for example using one of the assays described
herein.
[1784] The amino acid sequences, Nanobodies.RTM., polypeptides,
compounds and compositions of the present invention may also
modulate, inhibit and/or prevent fusion of hRSV with (the cell
membrane of) the target host cell by at least 1%, preferably at
least 5%, such as at least 10% or at least 25%, for example by at
least 50%, at least 60%, at least 70%, at least 80%, or 90% or
more, compared to fusion of hRSV with (the cell membrane of) the
target host cell under the same conditions but without the presence
of the amino acid sequence, Nanobody.RTM. or polypeptide of the
invention, measured in any suitable manner known per se, for
example using one of the assays described herein.
[1785] The multivalent (such as bivalent or trivalent) polypeptides
of the invention have shown improved affinity and/or improved
cross-reactivity for different genotypes, subtypes, viral escape
mutants and/or strains of hRSV compared to the monovalent amino
acid sequence or Nanobody.RTM.. In one aspect, the multivalent
(such as bivalent or trivalent) polypeptides of the invention may
bind different strains of RSV (such as e.g. Long, A-2 and/or B-1).
In yet another aspect, the multivalent (such as bivalent or
trivalent) polypeptides of the invention may bind different escape
mutants of hRSV (such as e.g. described in Lopez et al. 1998, J.
Virol. 72: 6922-6928) and/or escape mutants specific for antigen
site II, antigen site IV-VI or the combination of both antigenic
sites.
[1786] Accordingly, the invention also relates to the use of a
multivalent (e.g. trivalent, bivalent) polypeptide of the
invention, and/or of a pharmaceutical composition comprising the
same for binding and/or neutralization of different strains of a
hRSV. In a preferred aspect, a bivalent humanized and/or sequence
optimized NC41 Nanobody.RTM. (such as e.g. a bivalent polypeptide
comprising two Nanobodies.RTM. selected from SEQ ID NO's: 60-76,
138-141 and 146-157) is used. In another preferred aspect, a
trivalent humanized and/or sequence optimized NC41 Nanobody.RTM.
(such as e.g. a trivalent polypeptide comprising three
Nanobodies.RTM. selected from SEQ ID NO/s: 60-76, 138-141 and
146-157) is used. In another preferred aspect, one of SEQ ID NO's:
77-79, 142-145 and 158-165 is used.
[1787] The invention also relates to the use of a multivalent (e.g.
trivalent, bivalent) polypeptide of the invention, and/or of a
pharmaceutical composition comprising the same for binding and/or
neutralization of one or more escape mutants of a hRSV. In a
preferred aspect, a bivalent humanized NC41 Nanobody.RTM. (such as
e.g. a bivalent polypeptide comprising two Nanobodies.RTM. selected
from SEQ ID NO's: 60-76, 138-141 and 146-157) is used. In another
preferred aspect, a trivalent humanized NC41 Nanobody.RTM. (such as
e.g. a trivalent polypeptide comprising three Nanobodies.RTM.
selected from SEQ ID NO's: 60-76, 138-141 and 146-157) is used. In
another preferred aspect, one of SEQ ID NO's: 77-79, 142-145 and
158-165 is used.
[1788] The invention also relates to a method for the prevention
and/or treatment of at least one viral disease, said method
comprising administering, to a subject in need thereof, a
pharmaceutically active amount of an amino acid sequence of the
invention, of a Nanobody.RTM. of the invention, of a polypeptide of
the invention, of a compound or construct of the invention and/or
of a pharmaceutical composition comprising the same.
[1789] As such, the amino acid sequences, Nanobodies.RTM.,
polypeptides, compounds and compositions of the present invention
can be used for the prevention and/or treatment of diseases and
disorders associated with hRSV infection. Examples of such diseases
and disorders associated with hRSV infection will be clear to the
skilled person based on the disclosure herein, and for example
include the following diseases and disorders: respiratory illness,
upper respiratory tract infection, lower respiratory tract
infection, bronchiolitis (inflammation of the small airways in the
lung), pneumonia, dyspnea, cough, (recurrent) wheezing and
asthma.
[1790] Accordingly, the present invention also relates to a method
for the prevention and/or treatment of respiratory illness, upper
respiratory tract infection, lower respiratory tract infection,
bronchiolitis (inflammation of the small airways in the lung),
pneumonia, dyspnea, cough, (recurrent) wheezing and/or asthma
caused by hRSV, said method comprising administering, to a subject
in need thereof, a pharmaceutically active amount of at least one
amino acid sequence of the invention, Nanobody.RTM. of the
invention, polypeptide of the invention, compound or construct of
the invention or monovalent construct of the invention, or a
composition of the invention.
[1791] The invention also relates to the use of an amino acid
sequence of the invention, a Nanobody.RTM. of the invention, a
polypeptide of the invention, a compound or construct of the
invention or monovalent construct of the invention in the
preparation of a pharmaceutical composition for prevention and/or
treatment of respiratory illness, upper respiratory tract
infection, lower respiratory tract infection, bronchiolitis
(inflammation of the small airways in the lung), pneumonia,
dyspnea, cough, (recurrent) wheezing and/or asthma; and/or for use
in one or more of the methods described herein.
[1792] The invention also relates to an amino acid sequence of the
invention, a Nanobody.RTM. of the invention, a polypeptide of the
invention, a compound or construct of the invention or monovalent
construct of the invention for prevention and/or treatment of
respiratory illness, upper respiratory tract infection, lower
respiratory tract infection, bronchiolitis (inflammation of the
small airways in the lung), pneumonia, dyspnea, cough, (recurrent)
wheezing and/or asthma.
[1793] In the context of the present invention, the term
"prevention and/or treatment" not only comprises preventing and/or
treating the disease, but also generally comprises preventing the
onset of the disease, slowing or reversing the progress of disease,
preventing or slowing the onset of one or more symptoms associated
with the disease, reducing and/or alleviating one or more symptoms
associated with the disease, reducing the severity and/or the
duration of the disease and/or of any symptoms associated therewith
and/or preventing a further increase in the severity of the disease
and/or of any symptoms associated therewith, preventing, reducing
or reversing any physiological damage caused by the disease, and
generally any pharmacological action that is beneficial to the
patient being treated.
[1794] The subject to be treated may be any warm-blooded animal,
but is in particular a mammal, and more in particular a human
being. As will be clear to the skilled person, the subject to be
treated will in particular be a person suffering from, or at risk
of, the diseases and disorders mentioned herein.
[1795] More in particular, the present invention may relate to a
method for the prevention and/or treatment of infection by hRSV,
said method comprising administering, to a subject in need thereof,
a pharmaceutically active amount of a multivalent (e.g. trivalent
or bivalent) polypeptide or compound of the invention, and/or of a
pharmaceutical composition comprising the same. More in particular,
the present invention may relate to a method for the prevention
and/or treatment of infection by hRSV, said method comprising
administering, to a subject in need thereof, a pharmaceutically
active amount of a bivalent compound or polypeptide of the
invention. More in particular, the present invention may relate to
a method for the prevention and/or treatment of infection by hRSV,
said method comprising administering, to a subject in need thereof,
a pharmaceutically active amount of a bivalent humanized and/or
sequence optimized NC41 Nanobody.RTM. (such as e.g. a bivalent
polypeptide comprising two Nanobodies.RTM. selected from SEQ ID
NO's: 60-76, 138-141 and 146-157). More in particular, the present
invention may relate to a method for the prevention and/or
treatment of infection by hRSV, said method comprising
administering, to a subject in need thereof, a pharmaceutically
active amount of a trivalent compound or polypeptide of the
invention. More in particular, the present invention may relate to
a method for the prevention and/or treatment of infection by hRSV,
said method comprising administering, to a subject in need thereof,
a pharmaceutically active amount of a trivalent humanized NC41
Nanobody.RTM. (such as e.g. a trivalent polypeptide comprising
three Nanobodies.RTM. selected from SEQ ID NO's: 60-76, 138-141 and
146-157). More in particular, the present invention may relate to a
method for the prevention and/or treatment of infection by hRSV,
said method comprising administering, to a subject in need thereof,
a pharmaceutically active amount of one of SEQ ID NO's: 77-79,
142-145 and 158-165.
[1796] More in particular, the present invention may relate to a
method for the prevention and/or treatment of infection by hRSV
said method comprising administering to the pulmonary tissue of a
subject in need thereof, a pharmaceutically active amount of an
amino acid sequence of the invention, of a Nanobody.RTM. of the
invention, of a polypeptide of the invention, and/or of a
pharmaceutical composition comprising the same.
[1797] In another aspect, the invention relates to a method for
immunotherapy, and in particular for passive immunotherapy, which
method comprises administering, to a subject suffering from or at
risk of the diseases and disorders mentioned herein, a
pharmaceutically active amount of an amino acid sequence of the
invention, of a Nanobody.RTM. of the invention, of a polypeptide of
the invention, of a compound or construct of the invention and/or
of a pharmaceutical composition comprising the same.
[1798] In the above methods, the amino acid sequences,
Nanobodies.RTM., compounds or constructs and/or polypeptides of the
invention and/or the compositions comprising the same can be
administered in any suitable manner, depending on the specific
pharmaceutical formulation or composition to be used. Thus, the
amino acid sequences, Nanobodies.RTM. and/or polypeptides of the
invention and/or the compositions comprising the same can for
example be administered orally, intraperitoneally (e.g.
intravenously, subcutaneously, intramuscularly, or via any other
route of administration that circumvents the gastrointestinal
tract), intranasally, transdermally, topically, by means of a
suppository, by inhalation, again depending on the specific
pharmaceutical formulation or composition to be used. The clinician
will be able to select a suitable route of administration and a
suitable pharmaceutical formulation or composition to be used in
such administration, depending on the disease or disorder to be
prevented or treated and other factors well known to the
clinician.
[1799] Thus, in general, the amino acid sequences, Nanobodies.RTM.,
compounds or constructs and polypeptides according to the invention
and/or the compositions comprising the same can be administered in
any suitable manner; for example but not limited thereto, the amino
acid sequences, Nanobodies.RTM., compounds or constructs and
polypeptides according to the invention and compositions comprising
the same can be administered intranasally and/or by inhalation
and/or by any other suitable form of pulmonary delivery; methods
for pulmonary delivery and/or intranasal delivery and/or delivery
by inhalation of a Nanobody.RTM., amino acid sequence, compound or
construct and/or polypeptide of the invention will be known to the
skilled person and are e.g. described in the handbook "Drug
Delivery: Principles and Applications" (2005) by Binghe Wang,
Teruna Siahaan and Richard Soltero (Eds, Wiley Interscience (John
Wiley & Sons)); in the International application WO 08/049,897
of Ablynx N.V. entitled "intranasal delivery of polypeptides and
proteins"; in "Pharmacology PreTest.TM. Self-Assessment and Review"
(11.sup.th Edition) by Rosenfeld G. C., Loose-Mitchell D. S.; and
in "Pharmacology" (3.sup.rd Edition) by Lippincott Williams &
Wilkins, New York; Shlafer M. McGraw-Hill Medical Publishing
Division, New York; Yang K. Y., Graff L. R., Caughey A. B.
Blueprints Pharmacology, Blackwell Publishing.
[1800] Accordingly, the present invention also relates to a method
for administering an effective amount of a amino acid sequence,
Nanobody.RTM., compound or construct and/or polypeptide of the
invention and/or a composition comprising the same, wherein said
method comprises the step of administering the amino acid sequence,
Nanobody.RTM., compound or construct and/or polypeptide and/or
composition comprising the same to the pulmonary tissue. In such
method, the amino acid sequence, Nanobody.RTM., compound or
construct and/or polypeptide and/or a composition comprising the
same can be administered by any method know in the art for
pulmonary delivery such as e.g. by use of an inhaler or intranasal
delivery device or aerosol.
[1801] In a preferred aspect of the invention, the amino acid
sequence, Nanobody.RTM., compound or construct and/or polypeptide
will bind and/or neutralize virus present in the pulmonary tissue.
Preferably in such method for pulmonary delivery at least 5%,
preferably at least 10%, 20%, 30%, 40%, more preferably at least
50%, 60%, 70%, and even more preferably at least 80% or more of the
amino acid sequence, Nanobody.RTM., compound or construct and/or
polypeptide of the invention is stable in the pulmonary tissue for
at least 24 hours, preferably at least 48 hours more preferably at
least 72 hours.
[1802] It has been surprisingly found that the amino acid
sequences, Nanobodies.RTM., compounds or constructs and/or
polypeptides of the invention have a long lasting stability in the
pulmonary tissue. E.g. it has been found that a Nanobody.RTM.
directed against hRSV remains functional in the lung for at least
48 hours (see PCT/EP2009/056975 entitled Amino acid sequences
directed against envelope proteins of a virus and polypeptides
comprising the same for the treatment of viral diseases filed by
Ablynx N.V. on 5 Jun. 2009). Thus, embodiments of the invention
with treatment intervals such as once a day, once every 2.sup.nd,
3.sup.rd, 4.sup.th, 5.sup.th, 6.sup.th or once every week are
thought to be possible taken the estimated long lasting stability
of the amino acid sequences, Nanobodies.RTM., compounds or
constructs and/or polypeptides of the invention.
[1803] Accordingly, the invention relates to a method for
delivering an amino acid sequence, Nanobody.RTM., compound or
construct and/or polypeptide of the invention to the pulmonary
tissue of a subject without being inactivated, said method
comprising the step of pulmonary administering said amino acid
sequence, Nanobody.RTM., compound or construct and/or polypeptide
of the invention to said subject.
[1804] The invention also relates to a method for the prevention
and/or treatment of hRSV infection, said method comprising
administering to the pulmonary tissue of a subject in need thereof,
a pharmaceutically active amount of an amino acid sequence of the
invention, of a Nanobody.RTM. of the invention, of a polypeptide of
the invention, of a compound or construct of the invention and/or
of a pharmaceutical composition comprising the same.
[1805] More in particular, the invention relates to a method for
the prevention and/or treatment of respiratory illness, upper
respiratory tract infection, lower respiratory tract infection,
bronchiolitis (inflammation of the small airways in the lung),
pneumonia, dyspnea, cough, (recurrent) wheezing and/or asthma, said
method comprising administering, to the pulmonary tissue of a
subject in need thereof, a pharmaceutically active amount of an
amino acid sequence of the invention, of a Nanobody.RTM. of the
invention, of a polypeptide of the invention, of a compound or
construct of the invention and/or of a pharmaceutical composition
comprising the same.
[1806] More in particular, the present invention may relate to a
method for the prevention and/or treatment of infection by hRSV,
said method comprising administering, to the pulmonary tissue of a
subject in need thereof, a pharmaceutically active amount of a
multivalent (e.g. trivalent, bivalent) polypeptide or compound of
the invention, and/or of a pharmaceutical composition comprising
the same. More in particular, the present invention may relate to a
method for the prevention and/or treatment of infection by hRSV,
said method comprising administering, to the pulmonary tissue of a
subject in need thereof, a pharmaceutically active amount of a
bivalent compound or polypeptide of the invention. More in
particular, the present invention may relate to a method for the
prevention and/or treatment of infection by hRSV, said method
comprising administering, to the pulmonary tissue of a subject in
need thereof, a pharmaceutically active amount of a bivalent
humanized NC41 Nanobody.RTM. (such as e.g. a bivalent polypeptide
comprising two Nanobodies.RTM. selected from SEQ ID NO's: 60-76,
138-141 and 146-157). More in particular, the present invention may
relate to a method for the prevention and/or treatment of infection
by hRSV, said method comprising administering, to the pulmonary
tissue of a subject in need thereof, a pharmaceutically active
amount of a trivalent compound or polypeptide of the invention.
More in particular, the present invention may relate to a method
for the prevention and/or treatment of infection by hRSV, said
method comprising administering, to the pulmonary tissue of a
subject in need thereof, a pharmaceutically active amount of a
trivalent humanized NC41 Nanobody.RTM. (such as e.g. a trivalent
polypeptide comprising three Nanobodies.RTM. selected from SEQ ID
NO's: 60-76, 138-141 and 146-157). More in particular, the present
invention may relate to a method for the prevention and/or
treatment of infection by hRSV, said method comprising
administering, to the pulmonary tissue of a subject in need
thereof, a pharmaceutically active amount of one of SEQ ID NO's:
77-79, 142-145 and 158-165.
[1807] Also for example but not limited thereto, the amino acid
sequences, Nanobodies.RTM., compounds or constructs, and
polypeptides according to the invention and compositions comprising
the same, can be administered intramuscularly and/or by any
suitable form of delivery to the brain, such as any suitable form
of delivery which allows said amino acid sequences,
Nanobodies.RTM., polypeptides, compounds or constructs and
compositions comprising the same to be transported across the
blood-brain-barrier. Such methods for intramuscular delivery and/or
any suitable form of delivery to the brain of a Nanobody.RTM.,
amino acid sequence and/or polypeptide of the invention will be
known to the skilled person and are e.g. described in the handbook
"Drug Delivery: Principles and Applications" (2005) by Binghe Wang,
Teruna Siahaan and Richard Soltero (Eds. Wiley Interscience (John
Wiley & Sons)); in "Pharmacology PreTest.TM. Self-Assessment
and Review" (11.sup.th Edition) by Rosenfeld G. C., Loose-Mitchell
D. S.; and in "Pharmacology" (3.sup.rd Edition) by Lippincott
Williams & Wilkins, New York; Shlafer M. McGraw-Hill Medical
Publishing Division, New York; Yang K. Y., Graff L. R., Caughey A.
B. Blueprints Pharmacology, Blackwell Publishing.
[1808] The amino acid sequences, Nanobodies.RTM., compounds or
constructs and/or polypeptides of the invention and/or the
compositions comprising the same are administered according to a
regime of treatment that is suitable for preventing and/or treating
the disease or disorder to be prevented or treated. The clinician
will generally be able to determine a suitable treatment regimen,
depending on factors such as the disease or disorder to be
prevented or treated, the severity of the disease to be treated
and/or the severity of the symptoms thereof, the specific amino
acid sequence, Nanobody.RTM., compound or construct or polypeptide
of the invention to be used, the specific route of administration
and pharmaceutical formulation or composition to be used, the age,
gender, weight, diet, general condition of the patient, and similar
factors well known to the clinician.
[1809] Generally, the treatment regimen will comprise the
administration of one or more amino acid sequences,
Nanobodies.RTM., compounds or constructs and/or polypeptides of the
invention, or of one or more compositions comprising the same, in
one or more pharmaceutically effective amounts or doses. The
specific amount(s) or doses to administered can be determined by
the clinician, again based on the factors cited above.
[1810] Generally, for the prevention and/or treatment of the
diseases and disorders mentioned herein and depending on the
specific disease or disorder to be treated, the potency of the
specific amino acid sequence, Nanobody.RTM., compound or construct
and polypeptide of the invention to be used, the specific route of
administration and the specific pharmaceutical formulation or
composition used, the amino acid sequences, Nanobodies.RTM.,
compounds or constructs and polypeptides of the invention will
generally be administered in an amount between 1 gram and 1
microgram per kg body weight per day, preferably between 0.1 gram
and 10 microgram per kg body weight per day, most preferably
between 0.01 gram and 100 microgram per kg body weight per day such
as about 0.1, 0.5, 1, 2, 5 or 10 milligram per kg body weight per
day, either continuously (e.g. by infusion), as a single daily dose
or as multiple divided doses during the day. Amino acid sequences,
Nanobodies.RTM., compounds or constructs and polypeptides of the
invention that contain a half-life extending moiety may be
administered in an amount between 1 milligram and 100 milligram per
kg body weight, preferably between 1 milligram and 50 milligram per
kg body weight, such as about 10, 15, 20 or 30 milligram per kg
body weight once or twice a month. The clinician will generally be
able to determine a suitable daily dose, depending on the factors
mentioned herein. It will also be clear that in specific cases, the
clinician may choose to deviate from these amounts, for example on
the basis of the factors cited above and his expert judgment.
Generally, some guidance on the amounts to be administered can be
obtained from the amounts usually administered for comparable
conventional antibodies or antibody fragments against the same
target administered via essentially the same route, taking into
account however differences in affinity/avidity, efficacy,
biodistribution, and similar factors well known to the skilled
person.
[1811] When the amino acid sequence, Nanobody.RTM., compound or
construct and/or polypeptide and/or a composition comprising the
same is administered to the pulmonary tissue the treatment regime
may be once or twice daily, preferably once daily, or once every 2,
3, 4, 5, 6, or 7 days.
[1812] Usually, in the above method, a single amino acid sequence,
Nanobody.RTM., compound or construct, or polypeptide of the
invention will be used. It is however within the scope of the
invention to use two or more amino acid sequences, Nanobodies.RTM.,
compounds or constructs and/or polypeptides of the invention in
combination.
[1813] The Nanobodies.RTM., amino acid sequences, compounds or
constructs and polypeptides of the invention may also be used in
combination with one or more further pharmaceutically active
compounds or principles, i.e. as a combined treatment regimen,
which may or may not lead to a synergistic effect. Again, the
clinician will be able to select such further compounds or
principles, as well as a suitable combined treatment regimen, based
on the factors cited above and his expert judgement.
[1814] In particular, the amino acid sequences, Nanobodies.RTM.,
compounds or constructs, and polypeptides of the invention may be
used in combination with other pharmaceutically active compounds or
principles that are or can be used for the prevention and/or
treatment of the diseases and disorders cited herein, as a result
of which a synergistic effect may or may not be obtained. Examples
of such compounds and principles, as well as routes, methods and
pharmaceutical formulations or compositions for administering them
will be clear to the clinician.
[1815] When two or more substances or principles are to be used as
part of a combined treatment regimen, they can be administered via
the same route of administration or via different routes of
administration, at essentially the same time or at different times
(e.g. essentially simultaneously, consecutively, or according to an
alternating regime). When the substances or principles are to be
administered simultaneously via the same route of administration,
they may be administered as different pharmaceutical formulations
or compositions or part of a combined pharmaceutical formulation or
composition, as will be clear to the skilled person.
[1816] Also, when two or more active substances or principles are
to be used as part of a combined treatment regimen, each of the
substances or principles may be administered in the same amount and
according to the same regimen as used when the compound or
principle is used on its own, and such combined use may or may not
lead to a synergistic effect. However, when the combined use of the
two or more active substances or principles leads to a synergistic
effect, it may also be possible to reduce the amount of one, more
or all of the substances or principles to be administered, while
still achieving the desired therapeutic action. This may for
example be useful for avoiding, limiting or reducing any unwanted
side-effects that are associated with the use of one or more of the
substances or principles when they are used in their usual amounts,
while still obtaining the desired pharmaceutical or therapeutic
effect.
[1817] The effectiveness of the treatment regimen used according to
the invention may be determined and/or followed in any manner known
per se for the disease or disorder involved, as will be clear to
the clinician. The clinician will also be able, where appropriate
and on a case-by-case basis, to change or modify a particular
treatment regimen, so as to achieve the desired therapeutic effect,
to avoid, limit or reduce unwanted side-effects, and/or to achieve
an appropriate balance between achieving the desired therapeutic
effect on the one hand and avoiding, limiting or reducing undesired
side effects on the other hand.
[1818] Generally, the treatment regimen will be followed until the
desired therapeutic effect is achieved and/or for as long as the
desired therapeutic effect is to be maintained. Again, this can be
determined by the clinician.
[1819] In another aspect, the invention relates to the use of an
amino acid sequence, Nanobody.RTM., compound or construct, or
polypeptide of the invention in the preparation of a pharmaceutical
composition for prevention and/or treatment of at least one viral
disease; and/or for use in one or more of the methods of treatment
mentioned herein.
[1820] The subject to be treated may be any warm-blooded animal,
but is in particular a mammal, and more in particular a human
being. As will be clear to the skilled person, the subject to be
treated will in particular be a person suffering from, or at risk
of, the diseases and disorders mentioned herein.
[1821] The invention also relates to the use of an amino acid
sequence, Nanobody.RTM., compound or construct or polypeptide of
the invention in the preparation of a pharmaceutical composition
for the prevention and/or treatment of at least one disease or
disorder that can be prevented and/or treated by administering an
amino acid sequence, Nanobody.RTM., compound or construct or
polypeptide of the invention to a patient.
[1822] More in particular, the invention relates to the use of an
amino acid sequence, Nanobody.RTM., compound or construct or
polypeptide of the invention in the preparation of a pharmaceutical
composition for the prevention and/or treatment of viral diseases,
and in particular for the prevention and treatment of one or more
of the diseases and disorders listed herein.
[1823] Again, in such a pharmaceutical composition, the one or more
amino acid sequences, Nanobodies.RTM., compounds or constructs or
polypeptides of the invention may also be suitably combined with
one or more other active principles, such as those mentioned
herein.
[1824] Further uses of the amino acid sequences, Nanobodies.RTM.,
polypeptides, nucleic acids, genetic constructs and hosts and host
cells of the invention will be clear to the skilled person based on
the disclosure herein. For example, and without limitation, the
amino acid sequences of the invention can be linked to a suitable
carrier or solid support so as to provide a medium than can be used
in a manner known per se to purify an envelope protein of a virus
from compositions and preparations comprising the same. Derivatives
of the amino acid sequences of the invention that comprise a
suitable detectable label can also be used as markers to determine
(qualitatively or quantitatively) the presence of an envelope
protein of a virus in a composition or preparation or as a marker
to selectively detect the presence of an envelope protein of a
virus on the surface of a cell or tissue (for example, in
combination with suitable cell sorting techniques).
[1825] The invention will now be further described by means of the
following non-limiting preferred aspects, examples and figures:
[1826] The entire contents of all of the references (including
literature references, issued patents, published patent
applications, and co-pending patent applications) cited throughout
this application are hereby expressly incorporated by reference, in
particular for the teaching that is referenced hereinabove.
Aspects
[1827] Aspect A-1. Amino acid sequence that is directed against
and/or specifically binds protein F of hRSV and that comprises at
least a stretch of amino acid residues chosen from the following:
[1828] a) SEQ ID NO: 102; [1829] b) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
102, provided that: [1830] i) said stretch of amino acid residues
has an Aspartic acid (Asp, D) at position 6 (position 54 determined
according to Kabat numbering); and [1831] ii) the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference. [1832] Aspect A-2. Amino acid sequence according to
aspect A-1, that comprises two or more stretches of amino acid
residues in which one stretch is chosen from the following: [1833]
a) SEQ ID NO: 102; [1834] b) a stretch of amino acid residues that
has no more than 3, preferably no more than 2, more preferably no
more than 1 amino acid difference with SEQ ID NO: 102, provided
that: [1835] i) said stretch of amino acid residues has an Aspartic
acid (Asp, D) at position 6 (position 54 determined according to
Kabat numbering); and [1836] ii) the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference;
[1837] and at least one stretch is chosen from: [1838] c) SEQ ID
NO: 98; [1839] d) a stretch of amino acid residues that has no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with SEQ ID NO: 98, provided that the amino
acid sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [1840] e) SEQ ID NO: 121; and [1841] f) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 121, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference.
[1842] such that the stretch of amino acid residues that
corresponds to one of a) and b) should always be present in the
amino acid sequence of the invention and such that the second
stretch of amino acid residues is chosen from one of c), d), e) and
f). [1843] Aspect A-3. Amino acid sequence according to aspect A-1
or A-2, that comprises three or more stretches of amino acid
residues, in which the first stretch of amino acid residues is
chosen from the group consisting of: [1844] a) SEQ ID NO: 98;
[1845] b) a stretch of amino acid residues that has no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with SEQ ID NO: 98, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [1846] the second stretch of amino acid residues is
chosen from the group consisting of: [1847] c) SEQ ID NO: 102;
[1848] d) a stretch of amino acid residues that has no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with SEQ ID NO: 102, provided that: [1849] i) said
stretch of amino acid residues has an Aspartic acid (Asp, D) at
position 6 (position 54 determined according to Kabat numbering);
and [1850] ii) the amino acid sequence comprising said stretch of
amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference; [1851] and the third
stretch of amino acid residues is chosen from the group consisting
of: [1852] e) SEQ ID NO: 121; [1853] f) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
121, provided that the amino acid sequence comprising said stretch
of amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference. [1854] Aspect A-4.
Amino acid sequence according to any of aspects A-1 to A-3, that
specifically binds antigenic site II on protein F of hRSV and/or
that competes with Synagis.RTM. for binding protein F of hRSV.
[1855] Aspect A-5, Amino acid sequence according to any of aspects
A-1 to A-4, that is a naturally occurring amino acid sequence (from
any suitable species) or a synthetic or semi-synthetic amino acid
sequence. [1856] Aspect A-6. Amino acid sequence according to any
of aspects A-1 to A-5, that comprises an immunoglobulin fold or
that under suitable conditions is capable of forming an
immunoglobulin fold. [1857] Aspect A-7. Amino acid sequence
according to any of aspects A-1 to A-6, that is an immunoglobulin
sequence. [1858] Aspect A-8. Amino acid sequence according to any
of aspects A-1 to A-7, that is a naturally occurring immunoglobulin
sequence (from any suitable species) or a synthetic or
semi-synthetic immunoglobulin sequence. [1859] Aspect A-9. Amino
acid sequence according to any of aspects A-1 to A-8, that is a
humanized immunoglobulin sequence, a camelized immunoglobulin
sequence or an immunoglobulin sequence that has been obtained by
techniques such as affinity maturation. [1860] Aspect A-10. Amino
acid sequence according to any of aspects A-1 to A-9, that
essentially consists of a heavy chain variable domain sequence
(e.g. a V.sub.H-sequence). [1861] Aspect A-11. Amino acid sequence
according to any of aspects A-1 to A-10, that essentially consists
of a heavy chain variable domain sequence that is derived from a
conventional four-chain antibody or that essentially consist of a
heavy chain variable domain sequence that is derived from heavy
chain antibody. [1862] Aspect A-12. Amino acid sequence according
to any of aspects A-1 to A-11, that essentially consists of a
domain antibody (or an amino acid sequence that is suitable for use
as a domain antibody), of a single domain antibody (or an amino
acid sequence that is suitable for use as a single domain
antibody), of a "dAb" (or an amino acid sequence that is suitable
for use as a dAb) or of a Nanobody.RTM. (including but not limited
to a V.sub.H, sequence). [1863] Aspect A-13. Amino acid sequence
according to any of aspects A-1 to A-12, that essentially consist
of 4 framework regions (FR1 to FR4, respectively) and 3
complementarity determining regions (CDR1 to CDR3, respectively),
in which CDR2 is chosen from: [1864] a) SEQ ID NO: 102; [1865] b) a
stretch of amino acid residues that has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with SEQ ID NO: 102, provided that: [1866] i) said
stretch of amino acid residues has an Aspartic acid (Asp, D) at
position 6 (position 54 determined according to Kabat numbering);
and [1867] ii) the amino acid sequence comprising said stretch of
amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference. [1868] Aspect A-14.
Amino acid sequence according to aspect A-13, that essentially
consists of 4 framework regions (FR1 to FR4, respectively) and 3
complementarity determining regions (CDR1 to CDR3, respectively),
in which CDR2 is chosen from the group consisting of: [1869] a) SEQ
ID NO: 102; or [1870] b) a stretch of amino acid residues that has
no more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with SEQ ID NO: 102, provided that:
[1871] i) said stretch of amino acid residues has an Aspartic acid
(Asp, D) at position 6 (position 54 determined according to Kabat
numbering); and [1872] ii) the amino acid sequence comprising said
stretch of amino acid residues binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference;
[1873] and at least one of CDR1 or CDR3 is chosen from: [1874] CDR1
chosen from the group consisting of: [1875] c) SEQ ID NO: 98;
[1876] d) a stretch of amino acid residues that has no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with SEQ ID NO: 98, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [1877] and/or [1878] CDR3 chosen from the group
consisting of: [1879] e) SEQ ID NO: 121; [1880] f) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 121, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference.
[1881] Aspect A-15. Amino acid sequence according to any of aspects
A-13 or A-14, that consists of 4 framework regions (FR1 to FR4,
respectively) and 3 complementarity determining regions (CDR1 to
CDR3, respectively), in which: CDR1 is chosen from the group
consisting of: [1882] a) SEQ ID NO: 98; [1883] b) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 98, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference;
[1884] and CDR2 is chosen from the group consisting of: [1885] c)
SEQ ID NO: 102; [1886] d) a stretch of amino acid residues that has
no more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with SEQ ID NO: 102, provided that:
[1887] i) said stretch of amino acid residues has an Aspartic acid
(Asp, D) at position 6 (position 54 determined according to Kabat
numbering); and [1888] ii) the amino acid sequence comprising said
stretch of amino acid residues binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference;
[1889] and CDR3 is chosen from the group consisting of: [1890] e)
SEQ ID NO: 121; [1891] f) a stretch of amino acid residues that has
no more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with SEQ ID NO: 121, provided that the
amino acid sequence comprising said stretch of amino acid residues
binds protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference. [1892] Aspect A-16. Amino acid sequence according to
any of aspects A-1 to A-15, that comprises at least SEQ ID NO:
102.
[1893] Aspect A-17. Amino acid sequence according to aspect A-16,
that comprises at least SEQ ID NO: 102 and at least one stretch of
amino acid residues (CDR sequence) chosen from: [1894] a) SEQ ID
NO: 98; [1895] b) a stretch of amino acid residues that has no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with SEQ ID NO: 98, provided that the amino
acid sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [1896] c) SEQ ID NO: 121; and [1897] d) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 121, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference.
[1898] Aspect A-18, Amino acid sequence according to any of aspects
A-16 or A-17, that comprises at least SEQ ID NO: 102 and a CDR1
sequence chosen from: [1899] a) SEQ ID NO: 98; and [1900] b) a
stretch of amino acid residues that has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with SEQ ID NO: 98, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [1901] and a CDR3 sequence chosen from: [1902] c) SEQ
ID NO: 121; and [1903] d) a stretch of amino acid residues that has
no more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with SEQ ID NO: 121, provided that the
amino acid sequence comprising said stretch of amino acid residues
binds protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference. [1904] Aspect A-19. Amino acid sequence according to
any of aspects A-16 to A-18, that comprises at least SEQ ID NO: 102
and at least one stretch of amino acid residues (CDR sequence)
chosen from SEQ ID NO: 98 and SEQ ID NO: 121. [1905] Aspect A-20.
Amino acid sequence according to any of aspects A-16 to A-19, that
comprises SEQ ID NO: 98, SEQ ID NO: 102 and SEQ ID NO: 121. [1906]
Aspect A-21. Amino acid sequence according to any of aspects A-1 to
A-20, that essentially consists of a Nanobody.RTM. that:
[1907] a) has at least 80% amino acid identity with at least one of
the amino acid sequences of SEQ ID NO's: 60-76, 138-141 and 146457,
in which for the purposes of determining the degree of amino acid
identity, the amino acid residues that form the CDR sequences are
disregarded; [1908] and in which: [1909] b) preferably one or more
of the amino acid residues at positions 11, 37, 44, 45, 47, 83, 84,
103, 104 and 108 according to the Kabat numbering are chosen from
the Hallmark residues mentioned in Table A-3 to Table A-8 of WO
08/020,079. [1910] Aspect A-22. Amino acid sequence according to
any of aspects A-1 to A-21, that essentially consists of a
humanized Nanobody.RTM.. [1911] Aspect A-23. Amino acid sequence
according to aspect A-22, that essentially consists of a humanized
Nanobody.RTM. which can bind (as further defined herein) to protein
F of hRSV and which: [1912] i) is a humanized variant of the amino
acid sequences of SEQ ID NO: 5 (see Table A-1); and/or [1913] ii)
has at least 80% amino acid identity with the amino acid sequences
of SEQ ID NO: 5 (see Table A-1) and/or at least one of the amino
acid sequences of SEQ ID NO's: 60-76, 138-141 and 146-157 (see
Table A-4), in which for the purposes of determining the degree of
amino acid identity, the amino acid residues that form the CDR
sequences are disregarded; [1914] and in which: [1915] iii)
preferably one or more of the amino acid residues at positions 11,
37, 44, 45, 47, 83, 84, 103, 104 and 108 according to the Kabat
numbering are chosen from the Hallmark residues mentioned in Table
A-3 to Table A-8 of WO 08/020,079. [1916] Aspect A-24. Amino acid
sequence according to any of aspects A-1 to A-23, that is in
essentially isolated form. [1917] Aspect A-25. Amino acid sequence
according to any of aspects A-1 to A-24, for administration to a
subject, wherein said amino acid sequence does not naturally occur
in said subject. [1918] Aspect A-26. Amino acid sequence according
to any of aspects A-1 to A-25, that can specifically bind to
protein F of hRSV with a dissociation constant (K.sub.D) of 1000 nM
to 1 nM or less, preferably 100 nM to 1 nM or less, more preferably
10 nM to 1 nM or less. [1919] Aspect A-27. Amino acid sequence
according to any of aspects A-1 to A-26, that can specifically bind
to protein F of hRSV with a k.sub.on-rate of between 10.sup.4
M.sup.-1s.sup.-1 to about 10.sup.7 M.sup.-1s.sup.-1 preferably
between 10.sup.5 and 10.sup.7 M.sup.-1s.sup.-1, more preferably
about 10.sup.6 M.sup.-1s.sup.-1 or more. [1920] Aspect A-28. Amino
acid sequence according to any of aspects A-1 to A-27, that can
specifically bind to protein F of hRSV with a k.sub.off rate
between 10.sup.-2 s.sup.-1 (t.sub.1/2=0.69 s) and 10.sup.-4
s.sup.-1 (providing a near irreversible complex with a t.sub.1/2 of
multiple days), preferably between 10.sup.-3 s.sup.-1 and 10.sup.-4
s.sup.-1, or lower. [1921] Aspect A-29. Amino acid sequence
according to any of aspects A-1 to A-28, that can neutralize hRSV
(for example, as measured in a microneutralization assay on hRSV
Long (such as e.g. described in Example 6) with an IC50 value
between 100 nM and 1000 nM, preferably between 100 nM and 500 nM,
or less. [1922] Aspect B-1. Nanobody.RTM. that is directed against
and/or that specifically binds protein F of hRSV, in which CDR2 is
chosen from: [1923] a) SEQ ID NO: 102; [1924] b) a stretch of amino
acid residues that has no more than 3, preferably no more than 2,
more preferably no more than 1 amino acid difference with SEQ ID
NO: 102, provided that: [1925] i) said stretch of amino acid
residues has an Aspartic acid (Asp, D) at position 6 (position 54
determined according to Kabat numbering); and [1926] ii) the amino
acid sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference. [1927] Aspect B-2. Nanobody.RTM. according to aspect
B-1, in which CDR2 is chosen from the group consisting of: [1928]
a) SEQ ID NO: 102; or [1929] b) a stretch of amino acid residues
that has no more than 3, preferably no more than 2, more preferably
no more than 1 amino acid difference with SEQ ID NO: 102, provided
that: [1930] i) said stretch of amino acid residues has an Aspartic
acid (Asp, D) at position 6 (position 54 determined according to
Kabat numbering); and [1931] ii) the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference;
[1932] and at least one of CDR1 or CDR3 is chosen from: CDR1 chosen
from the group consisting of: [1933] c) SEQ ID NO: 98; [1934] d) a
stretch of amino acid residues that has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with SEQ ID NO: 98, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [1935] and/or CDR3 chosen from the group consisting of:
[1936] e) SEQ ID NO: 121; [1937] f) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
121, provided that the amino acid sequence comprising said stretch
of amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference. [1938] Aspect 8-3.
Nanobody.RTM. according to any of aspects B-1 or B-2, in which:
CDR1 is chosen from the group consisting of: [1939] a) SEQ ID NO:
98; [1940] b) a stretch of amino acid residues that has no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with SEQ ID NO: 98, provided that the amino
acid sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [1941] and CDR2 is chosen from the group consisting of:
[1942] c) SEQ ID NO: 102; [1943] d) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
102, provided that: [1944] i) said stretch of amino acid residues
has an Aspartic acid (Asp, D) at position 6 (position 54 determined
according to Kabat numbering); and [1945] ii) the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [1946] and CDR3 is chosen from the group consisting of:
[1947] e) SEQ ID NO: 121; [1948] f) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
121, provided that the amino acid sequence comprising said stretch
of amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference. [1949] Aspect 6-4.
Nanobody.RTM. according to any of aspects 6-1 to 6-3, that
comprises at least SEQ ID NO: 102. [1950] Aspect B-5. Nanobody.RTM.
according to aspect 13-4, that comprises at least SEQ ID NO: 102
and at least one CDR sequence chosen from: [1951] a) SEQ ID NO: 98;
[1952] b) a stretch of amino acid residues that has no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with SEQ ID NO: 98, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [1953] c) SEQ ID NO: 121; and [1954] d) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 121, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference.
[1955] Aspect B-6, Nanobody.RTM. according to any of aspects B-4 or
B-5, that comprises at least SEQ ID NO: 102 and a CDR1 sequence
chosen from: [1956] a) SEQ ID NO: 98; and [1957] b) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 98, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference;
[1958] and a CDR3 sequence chosen from: [1959] c) SEQ ID NO: 121;
and [1960] d) a stretch of amino acid residues that has no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with SEQ ID NO: 121, provided that the amino
acid sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference. [1961] Aspect 8-7. Nanobody.RTM. according to any of
aspects 8-4 to 3-6, that comprises at least SEQ ID NO: 102 and at
least one CDR sequence chosen from SEQ ID NO: 98 and SEQ ID NO:
121. [1962] Aspect B-8. Nanobody.RTM. according to any of aspects
B-4 to 8-7, that comprises SEQ ID NO: 98, SEQ ID NO: 102 and SEQ ID
NO: 121. [1963] Aspect 8-9. Nanobody.RTM. according to any of
aspects B-1 to 8-8, that is in essentially isolated form. [1964]
Aspect B-10. Nanobody.RTM. according to any of aspects B-1 to 8-9,
that can specifically bind to protein F of hRSV with a dissociation
constant (K.sub.D) of 1000 nM to 1 nM or less, preferably 100 nM to
1 nM or less, more preferably 10 nM to 1 nM or less. [1965] Aspect
B-11. Nanobody.RTM. according to any of aspects 8-1 to 8-10, that
can specifically bind to protein F of hRSV with a k.sub.on-rate of
between 10.sup.4 M.sup.-1s.sup.-1 to about 10.sup.7
M.sup.-1s.sup.-1, preferably between 10.sup.5 M.sup.-1s.sup.-1 and
10.sup.7 M.sup.-1s.sup.-1, more preferably about 10.sup.6
M.sup.-1s.sup.-1 or more. [1966] Aspect B-12. Nanobody.RTM.
according to any of aspects B-1 to B-11, that can specifically bind
to protein F of hRSV with a k.sub.off rate between
10.sup.-2s.sup.-1 (t.sub.1/2=0.69 s) and 10.sup.-4s.sup.-1
(providing a near irreversible complex with a t.sub.1/2 of multiple
days), preferably between 10.sup.-3 s.sup.-1 and 10.sup.-4
s.sup.-1, or lower. [1967] Aspect B-13. Nanobody.RTM. according to
any of aspects B-1 to 8-12, that can neutralize hRSV (for example,
as measured in a microneutralization assay on hRSV Long (such as
e.g. described in Example 6) with an IC50 value between 100 nM and
1000 nM, preferably between 100 nM and 500 nM, or less. [1968]
Aspect B-14. Nanobody.RTM. according to any of aspects B-1 to B-13,
that is a naturally occurring Nanobody.RTM. (from any suitable
species) or a synthetic or semi-synthetic Nanobody.RTM.. [1969]
Aspect B-15. Nanobody.RTM. according to any of aspects B-1 to B-14,
that is a V.sub.HH sequence, a partially humanized V.sub.HH
sequence, a fully humanized V.sub.HH sequence, a camelized heavy
chain variable domain or a Nanobody.RTM. that has been obtained by
techniques such as affinity maturation. [1970] Aspect B-16.
Nanobody.RTM. according to any of aspects B-1 to B-15, which is a
partially humanized Nanobody.RTM.. [1971] Aspect B-17.
Nanobody.RTM. according to any of aspects B-1 to B-16, which is a
fully humanized Nanobody.RTM.. [1972] Aspect B-18. Nanobody.RTM.
according to any of aspects B-1 to B-17, that essentially consists
of a humanized Nanobody.RTM. which can bind (as further defined
herein) to protein F of hRSV and which:
[1973] i) is a humanized variant of the amino acid sequences of SEQ
ID NO: 5 (see Table A-1); and/or [1974] ii) has at least 80% amino
acid identity with the amino acid sequences of SEQ ID NO: 5 (see
Table A-1) and/or at least one of the amino acid sequences of SEQ
ID NO's: 60-76, 138-141 and 146-157 (see Table A-4), in which for
the purposes of determining the degree of amino acid identity, the
amino acid residues that form the CDR sequences are disregarded;
[1975] and in which: [1976] iii) preferably one or more of the
amino acid residues at positions 11, 37, 44, 45, 47, 83, 84, 103,
104 and 108 according to the Kabat numbering are chosen from the
Hallmark residues mentioned in Table A-3 to Table A-8 of WO
08/020,079. [1977] Aspect C-1: Amino acid sequence that is directed
against and/or specifically binds protein F of hRSV chosen from the
following: [1978] a) SEQ ID NO's: 60-76; [1979] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 60-76, provided that: [1980] i) the amino acid sequence has a
Glutamine (Gln, Q) at position 105 (said position determined
according to Kabat numbering); and [1981] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference. [1982]
Aspect C-2: Amino acid sequence according to aspect C-1, that
comprises or essentially consists of one of SEQ ID NO's: 60-76.
[1983] Aspect C-3: Amino acid sequence that is directed against
and/or specifically binds protein F of hRSV chosen from the
following: [1984] a) SEQ ID NO's: 62, 65, 67, 68, 75 and 76; [1985]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76, provided that:
[1986] i) the amino acid sequence has a Glutamine (Gln, Q) at
position 105, a Leucine (Leu, L) at position 78 and/or an Arginine
(Arg, R) at position 83 (said positions determined according to
Kabat numbering); and [1987] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference. [1988] Aspect
C-4: Amino acid sequence according to aspect C-3, that is chosen
from the following: [1989] a) SEQ ID NO's: 62, 65, 67, 68, 75 and
76; [1990] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76,
provided that: [1991] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105, a Leucine (Leu, L) at position 78 and an
Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [1992] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference. [1993]
Aspect C-5: Amino acid sequence according to any of aspects C-3 or
C-4, that comprises or essentially consists of one of SEQ ID NO's:
62, 65, 67, 68, 75 and 76. [1994] Aspect C-6: Amino acid sequence
that is directed against and/or specifically binds protein F of
hRSV chosen from the following: [1995] a) SEQ ID NO's: 65 and 76;
[1996] b) amino acid sequences that have no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with one of SEQ ID NO's: 65 and 76, provided that:
[1997] i) the amino add sequence has an Aspartic acid (Asp, D) at
position 54, a Glutamine (Gln, Q) at position 105, a Leucine (Leu,
L) at position 78 and/or an Arginine (Arg, R) at position 83 (said
positions determined according to Kabat numbering); and [1998] ii)
the amino acid sequence binds protein F of hRSV with the same,
about the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence without the 3, 2 or 1 amino add
difference. [1999] Aspect C-7: Amino acid sequence according to
aspect C-6, that is chosen from the following: [2000] a) SEQ ID
NO's: 65 and 76; [2001] b) amino acid sequences that have no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with one of SEQ ID NO's: 65 and 76, provided
that: [2002] i) the amino acid sequence has an Aspartic acid (Asp,
D) at position 54, a Glutamine (Gln, Q) at position 105, a Leucine
(Leu, L) at position 78 and an Arginine (Arg, R) at position 83
(said positions determined according to Kabat numbering); and
[2003] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference. [2004] Aspect C-8: Amino acid
sequence that is directed against and/or specifically binds protein
F of hRSV chosen from the following: [2005] a) SEQ ID NO's:
146-153; [2006] b) amino add sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 146-153, provided that:
[2007] i) the amino acid sequence has a Praline (Pro, P) at
position 14, Arginine (Arg, R) at position 19, Leucine (Leu, L) at
position 20 and Leucine (Leu, L) at position 108 (said positions
determined according to Kabat numbering); and [2008] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference. [2009] Aspect C-9: Amino acid sequence according to
aspect C-8, that comprises or essentially consists of one of SEQ ID
NO's: 146-153. [2010] Aspect C-10: Amino acid sequence that is
directed against and/or specifically binds protein F of hRSV chosen
from the following: [2011] a) SEQ ID NO's: 146-149 and 151-153;
[2012] b) amino acid sequences that have no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with one of SEQ ID NO's: 146-149 and 151-153, provided
that: [2013] i) the amino acid sequence has a Proline (Pro, P) at
position 14, Arginine (Arg, R) at position 19, Leucine (Leu, L) at
position 20 and Leucine (Leu, L) at position 108; and in addition
Arginine (Arg, R) at position 83, Glutamic acid (Glu, E) at
position 85 and/or Glutamine (Gln, Q) at position 105 (said
positions determined according to Kabat numbering); and [2014] ii)
the amino acid sequence binds protein F of hRSV with the same,
about the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence without the 3, 2 or 1 amino
acid difference. [2015] Aspect C-11: Amino acid sequence according
to aspect C-10, that is chosen from the following: [2016] a) SEQ ID
NO's: 146-149 and 151-153; [2017] b) amino acid sequences that have
no more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 146-149 and
151-153, provided that: [2018] i) the amino acid sequence has a
Proline (Pro, P) at position 14, Arginine (Arg, R) at position 19,
Leucine (Leu, L) at position 20 and Leucine (Leu, L) at position
108 and in addition Arginine (Arg, R) at position 83, Glutamic acid
(Glu, E) at position 85 and/or Glutamine (Gln, Q) at position 105
so that when the amino acid sequence has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with: [2019] SEQ ID NO: 146, the amino acid sequence
preferably has Glutamine (Gln, Q) at position 105; [2020] SEQ ID
NO: 147, the amino acid sequence preferably has Arginine (Arg, R)
at position 83 and Glutamine (Gln, Q) at position 105; [2021] SEQ
ID NO: 148, the amino acid sequence preferably has Glutamic acid
(Glu, E) at position 85 and Glutamine (Gln, Q) at position 105;
[2022] SEQ ID NO: 149, the amino acid sequence preferably has
Arginine (Arg, R) at position 83, Glutamic acid (Glu, E) at
position 85 and Glutamine (Gln, Q) at position 105; [2023] SEQ ID
NO: 151, the amino acid sequence preferably has Arginine (Arg, R)
at position 83; [2024] SEQ ID NO: 152, the amino acid sequence
preferably has Glutamic acid (Glu, E) at position 85; [2025] SEQ ID
NO: 153, the amino acid sequence preferably has Arginine (Arg, R)
at position 83 and Glutamic acid (Glu, E) at position 85; [2026]
(said positions determined according to Kabat numbering); and
[2027] ii) the amino add sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference. [2028] Aspect C-12: Amino acid
sequence according to any of aspects C-10 or C-11, that comprises
or essentially consists of one of SEQ ID NO's: 146-449 and 151-453.
[2029] Aspect C-13: Amino acid sequence comprising or essentially
consisting of SEQ ID NO: 5, in which one or more amino acid
residues have been mutated selected from the following: Val5Leu,
Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54D. [2030] Aspect C-14:
Amino acid sequence according to aspect C-13, comprising or
essentially consisting of SEQ ID NO: 5, in which two or more amino
acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D. [2031] Aspect
C-15: Amino acid sequence according to aspect C-14, comprising or
essentially consisting of SEQ ID NO: 5, in which three or more
amino acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D. [2032] Aspect
C-16: Amino acid sequence according to aspect C-15, comprising or
essentially consisting of SEQ ID NO: 5, in which four or more amino
acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D. [2033] Aspect
C-17: Amino acid sequence according to aspect C-16, comprising or
essentially consisting of SEQ ID NO: 5, in which five or more amino
acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D. [2034] Aspect
C-18: Amino acid sequence according to aspect C-17, comprising or
essentially consisting of SEQ ID NO: 5, in which six or more amino
acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D. [2035] Aspect
C-19: Amino acid sequence according to aspect C-18, comprising or
essentially consisting of SEQ ID NO: 5, in which seven or more
amino acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D. [2036] Aspect
C-20: Amino acid sequence according to aspect C-19, comprising or
essentially consisting of SEQ ID NO: 5, in which eight or more
amino acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D. [2037] Aspect
C-21: Amino acid sequence according to aspect C-20, comprising or
essentially consisting of SEQ ID NO: 5, in which nine or more amino
acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D. [2038] Aspect
C-22: Amino acid sequence according to aspect C-21, comprising or
essentially consisting of SEQ ID NO: 5, in which ten or more amino
acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D. [2039] Aspect
C-23: Amino acid sequence according to aspect C-22, comprising or
essentially consisting of SEQ ID NO: 5, in which following amino
acid residues have been mutated: Val5Leu, Ala14Pro, Ser19R,
Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54D. [2040] Aspect C-24: Amino acid
sequence according to aspect C-13, comprising or essentially
consisting of SEQ ID NO: 5, in which one or more amino acid
residues have been mutated selected from the following: Ser19R,
Ile20Leu, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gly54D. [2041] Aspect C-25: Amino acid sequence according to aspect
C-13, comprising or essentially consisting of SEQ ID NO: 5, in
which one or more amino acid residues have been mutated selected
from the following: Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gly54D. [2042] Aspect C-26: Amino acid sequence according to aspect
C-25, comprising or essentially consisting of SEQ ID NO: 5, in
which following amino acid residues have been mutated: Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gly54D. [2043] Aspect C-27: Amino
acid sequence comprising or essentially consisting of SEQ ID NO: 5,
in which one or more amino acid residues have been mutated selected
from the following: Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu.
[2044] Aspect C-28: Amino acid sequence comprising or essentially
consisting of SEQ ID NO: 5, in which one or more amino acid
residues have been mutated selected from the following: Ala14Pro,
Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu.
[2045] Aspect C-29: Amino acid sequence according to aspect C-8,
comprising or essentially consisting of SEQ ID NO: 5, wherein
following amino acid residues have been mutated:
[2046] Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu; [2047] Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu; [2048] Gly78Leu, Ala83Arg, Asp85Glu and Arg105Gln;
[2049] Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp; [2050] Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp; [2051] Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gly54Asp; [2052] Gly54Asp; [2053] Ala14Pro,
Ser19Arg, Ile20Leu and Gln108Leu; [2054] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Ala83Arg; [2055] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Asp85Glu; [2056] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Arg105Gln; [2057] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg and Asp85Glu; [2058] Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln; [2059]
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and Arg105Gln; or
[2060] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu
and Arg105Gln. [2061] Aspect C-30: Amino acid sequence comprising
or essentially consisting of SEQ ID NO: 62. [2062] Aspect C-31:
Amino acid sequence comprising or essentially consisting of SEQ ID
NO: 65. [2063] Aspect C-32: Amino acid sequence comprising or
essentially consisting of SEQ ID NO: 76. [2064] Aspect C-33: Amino
acid sequence comprising or essentially consisting of any of SEQ ID
NO's: 146-153: 76 [2065] Aspect C-34: Amino acid sequence according
to any of aspects C-1 to C-33, that can specifically bind to
protein F of hRSV with a dissociation constant (K.sub.D) of 1000 nM
to 1 nM or less, preferably 100 nM to 1 nM or less, more preferably
10 nM to 1 nM or less. [2066] Aspect C-35: Amino acid sequence
according to any of aspects C-1 to C-34, that can specifically bind
to protein F of hRSV with a k-rate of between 10.sup.4
M.sup.-1s.sup.-1 to about 10.sup.7 M.sup.-1s.sup.-1, preferably
between 10.sup.5 M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1,
more preferably about 10.sup.6M.sup.-1s.sup.-1 or more. [2067]
Aspect C-36: Amino acid sequence according to any of aspects C-1 to
C-35, that can specifically bind to protein F of hRSV with a
k.sub.off rate between 10.sup.-2s.sup.-1 (t.sub.1/2=0.69 s) and
10.sup.-4 s.sup.-1 (providing a near irreversible complex with a
t.sub.1/2 of multiple days), preferably between 10.sup.-3 s.sup.-1
and 10.sup.-4 s.sup.-1, or lower. [2068] Aspect C-37: Amino acid
sequence according to any of aspects C-1 to C-36, that can
neutralize hRSV (for example, as measured in a microneutralization
assay on hRSV Long (such as e.g. described in Example 6) with an
IC50 value between 100 nM and 1000 nM, preferably between 100 nM
and 500 nM, or less. [2069] Aspect C-38: Amino acid sequence
according to any of aspects C-1 to C-37, that specifically binds
antigenic site II on protein F of hRSV and/or that competes with
Synagis.RTM. for binding protein F of hRSV. [2070] Aspect D-1:
Nanobody.RTM. that is directed against and/or specifically binds
protein F of hRSV, chosen from the following: [2071] a) SEQ ID
NO's: 60-76; [2072] b) amino acid sequences that have no more than
3, preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 60-76, provided that:
[2073] i) the amino acid sequence has a Glutamine (Gln, Q) at
position 105 (said position determined according to Kabat
numbering); and [2074] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference. [2075] Aspect D-2: Nanobody.RTM.
according to aspect D-1, that comprises or essentially consists of
one of SEQ ID NO's: 60-76. [2076] Aspect D-3: Nanobody.RTM. that is
directed against and/or specifically binds protein F of hRSV chosen
from the following: [2077] a) SEQ ID NO's: 62, 65, 67, 68, 75 and
76; [2078] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76,
provided that: [2079] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105, a Leucine (Leu, L) at position 78 and/or
an Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [2080] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference. [2081]
Aspect D-4: Nanobody.RTM. according to any of aspect D-3, that is
chosen from the following: [2082] a) SEQ ID NO's: 62, 65, 67, 68,
75 and 76; [2083] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76,
provided that: [2084] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105, a Leucine (Leu, L) at position 78 and an
Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [2085] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference. [2086]
Aspect D-5: Nanobody.RTM. according to any of aspects D-3 or D-4,
that comprises or essentially consists of one of SEQ ID NO's: 62,
65, 67, 68, 75 and 76. [2087] Aspect D-6: Nanobody.RTM. that is
directed against and/or specifically binds protein r of hRSV chosen
from the following: [2088] a) SEQ ID NO's: 65 and 76; [2089] b)
amino acid sequences that have no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
one of SEQ ID NO's: 65 and 76, provided that: [2090] i) the amino
acid sequence has an Aspartic acid (Asp, D) at position 54, a
Glutamine (Gln, Q) at position 105, a Leucine (Leu, L) at position
78 and/or an Arginine (Arg, R) at position 83 (said positions
determined according to Kabat numbering); and [2091] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference. [2092] Aspect D-7: Nanobody.RTM. according to any of
aspect D-6, that is chosen from the following: [2093] a) SEQ ID
NO's: 65 and 76; [2094] b) amino acid sequences that have no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with one of SEQ ID NO's: 65 and 76, provided
that: [2095] i) the amino acid sequence has an Aspartic acid (Asp,
D) at position 54, a Glutamine (Gln, Q) at position 105, a Leucine
(Leu, L) at position 78 and an Arginine (Arg, R) at position 83
(said positions determined according to Kabat numbering); and
[2096] the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference. [2097] Aspect D-8: Nanobody.RTM. that
is directed against and/or specifically binds protein F of hRSV
chosen from the following: [2098] a) SEQ ID NO's: 146-153; [2099]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 146-153, provided that: [2100] i) the
amino acid sequence has a Praline (Pro, P) at position 14, Arginine
(Arg, R) at position 19, Leucine (Leu, L) at position 20 and
Leucine (Leu, L) at position 108 (said positions determined
according to Kabat numbering); and [2101] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference. [2102]
Aspect D-9: Nanobody according to aspect D-8, that comprises or
essentially consists of one of SEQ ID NO's: 146-153. [2103] Aspect
D-10: Nanobody that is directed against and/or specifically binds
protein F of hRSV chosen from the following: [2104] a) SEQ ID NO's:
146-149 and 151-153; [2105] b) amino acid sequences that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 146-149 and
151-153, provided that: [2106] i) the amino acid sequence has a
Proline (Pro, P) at position 14, Arginine (Arg, R) at position 19,
Leucine (Leu, L) at position 20 and Leucine (Leu, L) at position
108; and in addition Arginine (Arg, R) at position 83, Glutamic add
(Glu, E) at position 85 and/or Glutamine (Gln, Q) at position 105
(said positions determined according to Kabat numbering); and
[2107] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference. [2108] Aspect D-11: Nanobody
according to aspect D-10, that is chosen from the following: [2109]
a) SEQ ID NO's: 146-149 and 151-153; [2110] b) amino acid sequences
that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 146-149 and 151-153, provided that: [2111] i) the amino acid
sequence has a Proline (Pro, P) at position 14, Arginine (Arg, R)
at position 19, Leucine (Leu, L) at position 20 and Leucine (Leu,
L) at position 108 and in addition Arginine (Arg, R) at position
83, Glutamic acid (Glu, E) at position 85 and/or Glutamine (Gln, Q)
at position 105 so that when the amino acid sequence has no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with: [2112] SEQ ID NO: 146, the amino acid
sequence preferably has Glutamine (Gln, Q) at position 105; [2113]
SEQ ID NO: 147, the amino acid sequence preferably has Arginine
(Arg, R) at position 83 and Glutamine (Gln, Q) at position 105;
[2114] SEQ ID NO: 148, the amino acid sequence preferably has
Glutamic acid (Glu, E) at position 85 and Glutamine (Gln, Q) at
position 105; [2115] SEQ ID NO: 149, the amino acid sequence
preferably has Arginine (Arg, R) at position 83, Glutamic acid
(Glu, E) at position 85 and Glutamine (Gln, Q) at position 105;
[2116] SEQ ID NO: 151, the amino add sequence preferably has
Arginine (Arg, R) at position 83; [2117] SEQ ID NO: 152, the amino
acid sequence preferably has Glutamic acid (Glu, E) at position 85;
[2118] SEQ ID NO: 153, the amino acid sequence preferably has
Arginine (Arg, R) at position 83 and Glutamic acid (Glu, E) at
position 85; [2119] (said positions determined according to Kabat
numbering); and [2120] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference. [2121] Aspect D-12: Nanobody
according to any of aspects D-10 or D-11, that comprises or
essentially consists of one of SEQ ID NO's: 146-149 and 151-153.
[2122] Aspect D-13: Nanobody.RTM. comprising or essentially
consisting of SEQ ID NO: 5, in which one or more amino acid
residues have been mutated selected from the following: Val5Leu,
Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54D. [2123] Aspect D-14:
Nanobody.RTM. according to aspect D-13, comprising or essentially
consisting of SEQ ID NO: 5, in which two or more amino acid
residues have been mutated selected from the following: Val5Leu,
Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54D. [2124] Aspect D-15:
Nanobody.RTM. according to aspect D-14, comprising or essentially
consisting of SEQ ID NO: 5, in which three or more amino acid
residues have been mutated selected from the following: Val5Leu,
Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54D. [2125] Aspect D-16:
Nanobody.RTM. according to aspect D-150, comprising or essentially
consisting of SEQ ID NO: 5, in which four or more amino acid
residues have been mutated selected from the following: Val5Leu,
Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54D. [2126] Aspect D-17:
Nanobody.RTM. according to aspect D-16, comprising or essentially
consisting of SEQ ID NO: 5, in which five or more amino acid
residues have been mutated selected from the following: Val5Leu,
Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln, an 108Leu and Gly54D. [2127] Aspect D-18:
Nanobody.RTM. according to aspect D-17, comprising or essentially
consisting of SEQ ID NO: 5, in which six or more amino acid
residues have been mutated selected from the following: Val5Leu,
Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54D. [2128] Aspect D-19:
Nanobody.RTM. according to aspect D-18, comprising or essentially
consisting of SEQ ID NO: 5, in which seven or more amino acid
residues have been mutated selected from the following: Val5Leu,
Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54D. [2129] Aspect D-20:
Nanobody.RTM. according to aspect D-19, comprising or essentially
consisting of SEQ ID NO: 5, in which eight or more amino acid
residues have been mutated selected from the following: Val5Leu,
Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54D. [2130] Aspect D-21:
Nanobody.RTM. according to aspect D-20, comprising or essentially
consisting of SEQ ID NO: 5, in which nine or more amino acid
residues have been mutated selected from the following: Val5Leu,
Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54D.
[2131] Aspect D-22: Nanobody.RTM. according to aspect D-21,
comprising or essentially consisting of SEQ ID NO: 5, in which ten
or more amino acid residues have been mutated selected from the
following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D.
[2132] Aspect D-23: Nanobody.RTM. according to aspect D-22,
comprising or essentially consisting of SEQ ID NO: 5, in which
following amino acid residues have been mutated: Val5Leu, Ala14Pro,
Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54D. [2133] Aspect D-24: Nanobody.RTM.
according to aspect D-13, comprising or essentially consisting of
SEQ ID NO: 5, in which one or more amino acid residues have been
mutated selected from the following: Ser19R, Ile20Leu, Ala74Ser,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54D. [2134] Aspect
D-25: Nanobody.RTM. according to aspect D-8, comprising or
essentially consisting of SEQ ID NO: 5, in which one or more amino
acid residues have been mutated selected from the following:
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54D. [2135] Aspect
D-26: Nanobody.RTM. according to aspect D-20, comprising or
essentially consisting of SEQ ID NO: 5, in which following amino
acid residues have been mutated: Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gly54D. [2136] Aspect D-27: Nanobody.RTM. comprising
or essentially consisting of SEQ ID NO: 5, in which one or more
amino acid residues have been mutated selected from the following:
Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu. [2137] Aspect D-28:
Nanobody.RTM. comprising or essentially consisting of SEQ ID NO: 5,
in which one or more amino acid residues have been mutated selected
from the following: Ala14Pro, Ser19Arg, Ile20Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gln108Leu. [2138] Aspect D-29:
Nanobody.RTM. according to aspect D-13, comprising or essentially
consisting of SEQ ID NO: 5, wherein following amino acid residues
have been mutated: [2139] Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu; [2140] Ala83Arg,
Asp85Glu, Arg105Gln and Gln108Leu; [2141] Gly78Leu, Ala83Arg,
Asp85Glu and Arg105Gln; [2142] Val5Leu, Ala14Pro, Glu44Gly,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp;
[2143] Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp;
[2144] Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54Asp; [2145]
Gly54Asp; [2146] Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu; [2147]
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and Ala83Arg; [2148]
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and Asp85Glu; [2149]
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and Arg105Gln; [2150]
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Asp85Glu;
[2151] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and
Arg105Gln; [2152] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu
and Arg105Gln; or [2153] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu,
Ala83Arg, Asp85Glu and Arg105Gln. [2154] Aspect D-30: Nanobody.RTM.
comprising or essentially consisting of SEQ ID NO: 62. [2155]
Aspect D-31: Nanobody.RTM. comprising or essentially consisting of
SEQ ID NO: 65. [2156] Aspect D-32: Nanobody.RTM. comprising or
essentially consisting of SEQ ID NO: 76. [2157] Aspect D-33:
Nanobody.RTM. comprising or essentially consisting of any of SEQ ID
NO's: 146-153. [2158] Aspect D-34: Nanobody.RTM. according to any
of aspects D-1 to D-33, that can specifically bind to protein F of
hRSV with a dissociation constant (K.sub.D) of 1000 nM to 1 nM or
less, preferably 100 nM to 1 nM or less, more preferably 10 nM to 1
nM or less. [2159] Aspect D-35: Nanobody.RTM. according to any of
aspects D-1 to D-34, that can specifically bind to protein F of
hRSV with a k.sub.on-rate of between 10.sup.4 M.sup.-1s.sup.-1 to
about 10.sup.7 M.sup.-1 s.sup.-1, preferably between 10.sup.5
M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1, more preferably
about 10.sup.5 M.sup.-1s.sup.-1 or more. [2160] Aspect D-36:
Nanobody.RTM. according to any of aspects D-1 to 0-35, that can
specifically bind to protein F of hRSV with a k.sub.off rate
between 10.sup.-2s.sup.-1 (t.sub.1/2=0.69 s) and 10.sup.-4 s.sup.-1
(providing a near irreversible complex with a t.sub.1/2 of multiple
days), preferably between 10.sup.-3 s.sup.-1 and 10.sup.-4
s.sup.-1, or lower. [2161] Aspect D-37: Nanobody.RTM. according to
any of aspects D-1 to D-36, that can neutralize hRSV (for example,
as measured in a microneutralization assay on hRSV Long (such as
e.g. described in Example 6) with an IC50 value between 100 nM and
1000 nM, preferably between 100 nM and 500 nM, or less. [2162]
Aspect D-38: Nanobody.RTM. according to any of aspects D-1 to D-37,
that specifically binds antigenic site II on protein F of hRSV
and/or that competes with Synagis.RTM. for binding protein F of
hRSV. [2163] Aspect W-1: Amino acid sequence according to any of
aspects A-1 to A-29 and C-1 to C-38, that is directed against
and/or specifically binds protein F of hRSV, wherein the amino acid
sequence has Aspartic acid (Asp, D) at position 1 (said position
determined according to Kabat numbering). [2164] Aspect W-2: Amino
acid sequence that is directed against and/or specifically binds
protein F of hRSV chosen from the following: [2165] a) SEQ ID NO's:
138-141 and 154-157; [2166] b) amino acid sequences that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 138-141 and
154-157, provided that: [2167] i) the amino acid sequence has a
Aspartic acid (Asp, D) at position 1 (said position determined
according to Kabat numbering); and [2168] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference. [2169]
Aspect W-3: Amino acid sequence according to aspect W-2, that
comprises or essentially consists of one of SEQ ID NO's: 138-141
and 154-157. [2170] Aspect W-4: Amino acid sequence comprising or
essentially consisting of SEQ ID NO: 5, in which the Glutamic acid
at position 1 has been changed into Aspartic acid. [2171] Aspect
W-5: Amino acid sequence comprising or essentially consisting of
SEQ ID NO: 62, in which the Glutamic acid at position 1 has been
changed into Aspartic acid. [2172] Aspect W-6: Amino acid sequence
comprising or essentially consisting of SEQ ID NO: 65, in which the
Glutamic acid at position 1 has been changed into Aspartic acid.
[2173] Aspect W-7: Amino acid sequence comprising or essentially
consisting of SEQ ID NO: 76, in which the Glutamic acid at position
1 has been changed into Aspartic acid. [2174] Aspect W-8: Amino
acid sequence comprising or essentially consisting of SEQ ID NO:
75, in which the Glutamic acid at position 1 has been changed into
Aspartic acid. [2175] Aspect W-9: Amino acid sequence comprising or
essentially consisting of SEQ ID NO: 147, in which the Glutamic add
at position 1 has been changed into Aspartic acid. [2176] Aspect
W-10: Amino acid sequence comprising or essentially consisting of
SEQ ID ND: 149, in which the Glutamic acid at position 1 has been
changed into Aspartic acid. [2177] Aspect W-11: Amino acid sequence
comprising or essentially consisting of SEQ ID NO: 153, in which
the Glutamic acid at position 1 has been changed into Aspartic
acid. [2178] Aspect W-12: Amino acid sequence comprising or
essentially consisting of SEQ ID NO: 5, in which one or more amino
acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D, and wherein
the Glutamic acid at position 1 has been changed into Aspartic
acid. [2179] Aspect W-13: Amino acid sequence according to aspect
W-12, comprising or essentially consisting of SEQ ID NO: 5, in
which two or more amino acid residues have been mutated selected
from the following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly,
Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54D, and wherein the Glutamic acid at position 1 has been
changed into Aspartic acid. [2180] Aspect W-14: Amino acid sequence
according to aspect W-13, comprising or essentially consisting of
SEQ ID NO: 5, in which three or more amino acid residues have been
mutated selected from the following: Val5Leu, Ala14Pro, Ser19R,
Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54D, and wherein the Glutamic acid at
position 1 has been changed into Aspartic acid. [2181] Aspect W-15:
Amino acid sequence according to aspect W-14, comprising or
essentially consisting of SEQ ID NO: 5, in which four or more amino
acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D, and wherein
the Glutamic acid at position 1 has been changed into Aspartic
acid. [2182] Aspect W-16: Amino acid sequence according to aspect
W-15, comprising or essentially consisting of SEQ ID NO: 5, in
which five or more amino acid residues have been mutated selected
from the following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly,
Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54D, and wherein the Glutamic acid at position 1 has been
changed into Aspartic acid. [2183] Aspect W-17: Amino acid sequence
according to aspect W-16, comprising or essentially consisting of
SEQ ID NO: 5, in which six or more amino acid residues have been
mutated selected from the following: Val5Leu, Ala14Pro, Ser19R,
Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54D, and wherein the Glutamic acid at
position 1 has been changed into Aspartic acid. [2184] Aspect W-18:
Amino acid sequence according to aspect W-17, comprising or
essentially consisting of SEQ ID NO: 5, in which seven or more
amino acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D, and wherein
the Glutamic acid at position 1 has been changed into Aspartic
acid. [2185] Aspect W-19: Amino acid sequence according to aspect
W-18, comprising or essentially consisting of SEQ ID NO: 5, in
which eight or more amino acid residues have been mutated selected
from the following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly,
Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54D, and wherein the Glutamic acid at position 1 has been
changed into Aspartic acid. [2186] Aspect W-20: Amino acid sequence
according to aspect W-19, comprising or essentially consisting of
SEQ ID NO: 5, in which nine or more amino acid residues have been
mutated selected from the following: Val5Leu, Ala14Pro, Ser19R,
Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54D, and wherein the Glutamic acid at
position 1 has been changed into Aspartic acid. [2187] Aspect W-21:
Amino acid sequence according to aspect W-20, comprising or
essentially consisting of SEQ ID NO: 5, in which ten or more amino
acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D, and wherein
the Glutamic acid at position 1 has been changed into Aspartic add.
[2188] Aspect W-22: Amino acid sequence according to aspect W-21,
comprising or essentially consisting of SEQ ID NO: 5, in which
following amino acid residues have been mutated: Val5Leu, Ala14Pro,
Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54D, and wherein the Glutamic acid at
position 1 has been changed into Aspartic acid. [2189] Aspect W-23:
Amino acid sequence according to aspect W-12, comprising or
essentially consisting of SEQ ID NO: 5, in which one or more amino
acid residues have been mutated selected from the following:
Ser19R, Ile20Leu, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln
and Gly54D, and wherein the Glutamic acid at position 1 has been
changed into Aspartic acid. [2190] Aspect W-24: Amino acid sequence
according to aspect W-12, comprising or essentially consisting of
SEQ ID NO: 5, in which one or more amino acid residues have been
mutated selected from the following: Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gly54D, and wherein the glutamic acid at position 1
has been changed into Aspartic acid. [2191] Aspect W-25: Amino acid
sequence according to aspect W-24, comprising or essentially
consisting of SEQ ID NO: 5, in which following amino acid residues
have been mutated: Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gly54D, and wherein the glutamic acid at position 1 has been
changed into Aspartic acid. [2192] Aspect W-26: Amino acid sequence
comprising or essentially consisting of SEQ ID NO: 5, in which one
or more amino acid residues have been mutated selected from the
following: Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu, and wherein
the Glutamic acid at position 1 has been changed into Aspartic
acid. [2193] Aspect W-27: Amino acid sequence comprising or
essentially consisting of SEQ ID NO: 5, in which one or more amino
acid residues have been mutated selected from the following:
Ala14Pro, Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu, and wherein the Glutamic acid at position 1 has been
changed into Aspartic acid. [2194] Aspect W-28: Amino acid sequence
according to aspect W-2 or W-3, comprising or essentially
consisting of SEQ ID NO: 5, wherein following amino acid residues
have been mutated: [2195] Glu1Asp, Val5Leu, Ala14Pro, Glu44Gly,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu; [2196]
Glu1Asp, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu; [2197]
Glu1Asp, Gly78Leu, Ala83Arg, Asp85Glu and Arg105Gln; [2198]
Glu1Asp, Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
[2199] Arg105Gln, Gln108Leu and Gly54Asp; [2200] Glu1Asp, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp; [2201] Glu1Asp,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54Asp; [2202]
Glu1Asp and Gly54Asp; [2203] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu
and Gln108Leu; [2204] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Ala83Arg; [2205] Glu1Asp, Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Asp85Glu; [2206] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu and Arg105Gln; [2207] Glu1Asp,
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Asp85Glu;
[2208] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg
and Arg105Gln; [2209] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Asp85Glu and Arg105Gln; or [2210] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu and Arg105Gln.
[2211] Aspect W-29: Amino acid sequence comprising or essentially
consisting of SEQ ID NO: 138.
[2212] Aspect W-30: Amino acid sequence comprising or essentially
consisting of SEQ ID NO: 139. [2213] Aspect W-31: Amino acid
sequence comprising or essentially consisting of SEQ ID NO: 140.
[2214] Aspect W-32: Amino acid sequence comprising or essentially
consisting of SEQ ID NO: 141. [2215] Aspect W-33: Amino acid
sequence comprising or essentially consisting of any of SEQ ID
NO's: 154-157. [2216] Aspect W-34: Amino acid sequence according to
any of aspects W-1 to W-33, that can specifically bind to protein F
of hRSV with a dissociation constant (K.sub.D) of 1000 nM to 1 nM
or less, preferably 100 nM to 1 nM or less, more preferably 10 nM
to 1 nM or less. [2217] Aspect W-35: Amino acid sequence according
to any of aspects W-1 to W-34, that can specifically bind to
protein F of hRSV with a k.sub.on-rate of between 10.sup.4
M.sup.-1s.sup.-1 to about 10.sup.7 M.sup.-1s.sup.-1, preferably
between 10.sup.5 M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1,
more preferably about 10.sup.6 or more. [2218] Aspect W-36: Amino
acid sequence according to any of aspects W-1 to W-35, that can
specifically bind to protein F of hRSV with a k.sub.off rate
between 10.sup.-2 s.sup.-1 (t.sub.1/2=0.69 s) and 10.sup.-4
s.sup.-1 (providing a near irreversible complex with a t.sub.1/2 of
multiple days), preferably between 10.sup.-3 s.sup.-1 and 10.sup.-4
s.sup.-1, or lower. [2219] Aspect W-37: Amino acid sequence
according to any of aspects W-1 to W-36, that can neutralize hRSV
(for example, as measured in a microneutralization assay on hRSV
Long (such as e.g. described in Example 6) with an IC50 value
between 100 nM and 1000 nM, preferably between 100 nM and 500 nM,
or less. [2220] Aspect W-38: Amino acid sequence according to any
of aspects W-1 to W-37, that specifically binds antigenic site II
on protein F of hRSV and/or that competes with Synagis.RTM. for
binding protein F of hRSV. [2221] Aspect X-1: Nanobody.RTM. that is
directed against and/or specifically binds protein F of hRSV
according to any of aspects B-1 to B-18 and D-1 to 0-38, wherein
the Nanobody has Aspartic acid (Asp, D) at position 1 (said
position determined according to Kabat numbering). [2222] Aspect
X-2: Nanobody.RTM. that is directed against and/or specifically
binds protein F of hRSV, chosen from the following: [2223] a) SEQ
ID NO's: 138-141 and 154-157; amino add sequences that have no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with one of SEQ ID NO's: 138-141 and 154-157,
provided that: [2224] i) the amino add sequence has a Aspartic acid
(Asp, D) at position 1 (said position determined according to Kabat
numbering); and [2225] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference. [2226] Aspect X-3: Nanobody.RTM.
according to aspect X-2, that comprises or essentially consists of
one of SEQ ID NO's: 138-141 and 154-157. [2227] Aspect X-4:
Nanobody.RTM. comprising or essentially consisting of SEQ ID NO: 5,
in which Glutamic acid at position 1 has been changed into Aspartic
acid. [2228] Aspect X-5: Nanobody.RTM. comprising or essentially
consisting of SEQ ID NO: 62, in which Glutamic acid at position 1
has been changed into Aspartic acid. [2229] Aspect X-6:
Nanobody.RTM. comprising or essentially consisting of SEQ ID NO:
65, in which Glutamic acid at position 1 has been changed into
Aspartic acid. [2230] Aspect X-7: Nanobody.RTM. comprising or
essentially consisting of SEQ ID NO: 76, in which Glutamic acid at
position 1 has been changed into Aspartic acid. [2231] Aspect X-8:
Nanobody.RTM. comprising or essentially consisting of SEQ ID NO:
75, in which Glutamic acid at position 1 has been changed into
Aspartic acid. [2232] Aspect X-9: Nanobody.RTM. comprising or
essentially consisting of SEQ ID NO: 147, in which Glutamic acid at
position 1 has been changed into Aspartic acid. [2233] Aspect X-10:
Nanobody.RTM. comprising or essentially consisting of SEQ ID NO:
149, in which Glutamic acid at position 1 has been changed into
Aspartic acid. [2234] Aspect X-11: Nanobody.RTM. comprising or
essentially consisting of SEQ ID NO: 153, in which Glutamic acid at
position 1 has been changed into Aspartic acid. [2235] Aspect X-12:
Nanobody.RTM. comprising or essentially consisting of SEQ ID NO: 5,
in which one or more amino acid residues have been mutated selected
from the following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly,
Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54D, and wherein Glutamic acid at position 1 has been changed
into Aspartic acid. [2236] Aspect X-13: Nanobody.RTM. according to
aspect X-12, comprising or essentially consisting of SEQ ID NO: 5,
in which two or more amino acid residues have been mutated selected
from the following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly,
Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54D, and wherein Glutamic acid at position 1 has been changed
into Aspartic acid. [2237] Aspect X-14: Nanobody.RTM. according to
aspect X-13, comprising or essentially consisting of SEQ ID NO: 5,
in which three or more amino acid residues have been mutated
selected from the following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu,
Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54D, and wherein Glutamic acid at position 1 has
been changed into Aspartic acid. [2238] Aspect X-15: Nanobody.RTM.
according to aspect X-14, comprising or essentially consisting of
SEQ ID NO: 5, in which four or more amino acid residues have been
mutated selected from the following: Val5Leu, Ala14Pro, Ser19R,
Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54D, and wherein Glutamic acid at
position 1 has been changed into Aspartic acid. [2239] Aspect X-16:
Nanobody.RTM. according to aspect X-15, comprising or essentially
consisting of SEQ ID NO: 5, in which five or more amino acid
residues have been mutated selected from the following: Val5Leu,
Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54D, and wherein Glutamic
acid at position 1 has been changed into Aspartic acid. [2240]
Aspect X-17: Nanobody.RTM. according to aspect X-16, comprising or
essentially consisting of SEQ ID NO: 5, in which six or more amino
acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D, and wherein
Glutamic acid at position 1 has been changed into Aspartic acid.
[2241] Aspect X-18: Nanobody.RTM. according to aspect X-17,
comprising or essentially consisting of SEQ ID NO: 5, in which
seven or more amino acid residues have been mutated selected from
the following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly,
Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54D, and wherein Glutamic acid at position 1 has been changed
into Aspartic acid. [2242] Aspect X-19: Nanobody.RTM. according to
aspect X-18, comprising or essentially consisting of SEQ ID NO: 5,
in which eight or more amino acid residues have been mutated
selected from the following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu,
Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54D, and wherein Glutamic acid at position 1 has
been changed into Aspartic acid. [2243] Aspect X-20: Nanobody.RTM.
according to aspect X-19, comprising or essentially consisting of
SEQ ID NO: 5, in which nine or more amino acid residues have been
mutated selected from the following: Val5Leu, Ala14Pro, Ser19R,
Ile20Leu, Glu4-4Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54D, and wherein Glutamic acid at
position 1 has been changed into Aspartic acid. [2244] Aspect X-21:
Nanobody.RTM. according to aspect X-20, comprising or essentially
consisting of SEQ ID NO: 5, in which ten or more amino acid
residues have been mutated selected from the following: Val5Leu,
Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54D, and wherein Glutamic
acid at position 1 has been changed into Aspartic acid. [2245]
Aspect X-22: Nanobody.RTM. according to aspect X-21, comprising or
essentially consisting of SEQ ID NO: 5, in which following amino
acid residues have been mutated: Val5Leu, Ala14Pro, Ser19R,
Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54D, and wherein Glutamic acid at
position 1 has been changed into Aspartic acid. [2246] Aspect X-23:
Nanobody.RTM. according to aspect X-12, comprising or essentially
consisting of SEQ ID NO: 5, in which one or more amino acid
residues have been mutated selected from the following: Ser19R,
Ile20Leu, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gly54D, and wherein Glutamic acid at position 1 has been changed
into Aspartic acid. [2247] Aspect X-24: Nanobody.RTM. according to
aspect X-12, comprising or essentially consisting of SEQ ID NO: 5,
in which one or more amino acid residues have been mutated selected
from the following: Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gly54D, and wherein Glutamic acid at position 1 has been changed
into Aspartic acid. [2248] Aspect X-25: Nanobody.RTM. according to
aspect X-24, comprising or essentially consisting of SEQ ID NO: 5,
in which following amino acid residues have been mutated: Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gly54D, and wherein Glutamic acid
at position 1 has been changed into Aspartic acid. [2249] Aspect
X-26: Nanobody.RTM. comprising or essentially consisting of SEQ ID
NO: 5, in which one or more amino acid residues have been mutated
selected from the following: Ala14Pro, Ser19Arg, Ile20Leu and
Gln108Leu, and wherein Glutamic acid at position 1 has been changed
into Aspartic acid. [2250] Aspect X-27: Nanobody.RTM. comprising or
essentially consisting of SEQ ID NO: 5, in which one or more amino
acid residues have been mutated selected from the following:
Ala14Pro, Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu, and wherein Glutamic acid at position 1 has been changed
into Aspartic acid. [2251] Aspect X-28: Nanobody.RTM. according to
aspect X-2, comprising or essentially consisting of SEQ ID NO: 5,
wherein following amino acid residues have been mutated: [2252]
Glu1Asp, Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu; [2253] Glu1Asp, Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu; [2254] Glu1Asp, Gly78Leu, Ala83Arg,
Asp85Glu and Arg105Gln; [2255] Glu1Asp, Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, [2256] Arg105Gln, Gln108Leu
and Gly54Asp; [2257] Glu1Asp, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp; [2258] Glu1Asp, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gly54Asp; [2259] Glu1Asp and Gly54Asp;
[2260] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu; [2261]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and Ala83Arg;
[2262] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Asp85Glu; [2263] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu
and Arg105Gln; [2264] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg and Asp85Glu; [2265] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln; [2266]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and
Arg105Gln; or [2267] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg, Asp85Glu and Arg105Gln. [2268] Aspect X-29:
Nanobody.RTM. comprising or essentially consisting of SEQ ID NO:
138. [2269] Aspect X-30: Nanobody.RTM. comprising or essentially
consisting of SEQ ID NO: 139. [2270] Aspect X-31: Nanobody.RTM.
comprising or essentially consisting of SEQ ID NO: 140. [2271]
Aspect X-32: Nanobody.RTM. comprising or essentially consisting of
SEQ ID NO: 141. [2272] Aspect X-33: Nanobody.RTM. comprising or
essentially consisting of any of SEQ ID NO's: 154-157. [2273]
Aspect X-34: Nanobody.RTM. according to any of aspects X-1 to X-33,
that can specifically bind to protein F of hRSV with a dissociation
constant (K.sub.D) of 1000 nM to 1 nM or less, preferably 100 nM to
1 nM or less, more preferably 10 nM to 1 nM or less. [2274] Aspect
X-35: Nanobody.RTM. according to any of aspects X-1 to X-34, that
can specifically bind to protein F of hRSV with a k.sub.on-rate of
between 10.sup.4 M.sup.-1s.sup.-1 to about 10.sup.7
M.sup.-1s.sup.-1, preferably between 10.sup.5 M.sup.-1s.sup.-1 and
10.sup.7 M.sup.-1s.sup.-1, more preferably about 10.sup.6
M.sup.-1s.sup.-1 or more. [2275] Aspect X-36: Nanobody.RTM.
according to any of aspects X-1 to X-35, that can specifically bind
to protein F of hRSV with a k.sub.off rate between 10.sup.2
s.sup.-1 (t.sub.1/2=0.69 s) and 10.sup.-4 s.sup.-3'' (providing a
near irreversible complex with a t.sub.1/2 of multiple days),
preferably between 10.sup.-3 s.sup.-1 and 10.sup.-4 s.sup.-1, or
lower. [2276] Aspect X-37: Nanobody.RTM. according to any of
aspects X-1 to X-36, that can neutralize hRSV (for example, as
measured in a microneutralization assay on hRSV Long (such as e.g.
described in Example 6) with an IC50 value between 100 nM and 1000
nM, preferably between 100 nM and 500 nM, or less. [2277] Aspect
X-38: Nanobody.RTM. according to any of aspects X-1 to X-37, that
specifically binds antigenic site II on protein F of hRSV and/or
that competes with Synagis.RTM. for binding protein F of hRSV.
[2278] Aspect E-1: Polypeptide that comprises or essentially
consists of one or more amino acid sequences according to any of
aspects A-1 to A-29, C-1 to C-38 and W-1 to W-38 and/or one or more
Nanobodies.RTM. according to any of aspects B-1 to B-18, D-1 to
D-38 and X-1 to X-38, and optionally further comprises one or more
other amino acid binding units, optionally linked via one or more
peptidic linkers. [2279] Aspect E-2: Polypeptide according to
aspect E-1, in which said one or more other binding units are
immunoglobulin sequences. [2280] Aspect E-3: Polypeptide according
to any of aspects E-1 or E-2, in which said one or more other
binding units are chosen from the group consisting of domain
antibodies, amino acid sequences that are suitable for use as a
domain antibody, single domain antibodies, amino acid sequences
that are suitable for use as a single domain antibody, "dAb's",
amino acid sequences that are suitable for use as a dAb, or
Nanobodies.RTM.. [2281] Aspect E-4: Polypeptide according to any of
aspects E-1 to E-3, in which said one or more amino acid sequences
are immunoglobulin sequences. [2282] Aspect E-5: Polypeptide
according to any of aspects E-1 to E-4, in which said one or more
amino acid sequences are chosen from the group consisting of domain
antibodies, amino acid sequences that are suitable for use as a
domain antibody, single domain antibodies, amino acid sequences
that are suitable for use as a single domain antibody,
"dAb's", amino add sequences that are suitable for use as a dAb, or
Nanobodies.RTM.. [2283] Aspect E-6: Polypeptide according to any of
aspects E-1 to E-5, that comprises or essentially consists of one
or more Nanobodies.RTM. according to any of aspects B-1 to B-18,
D-1 to D-8 and X-1 to X-38 and in which said one or more other
binding units are Nanobodies.RTM.. [2284] Aspect E-7: Polypeptide
according to any of aspects E-1 to E-6, which is a multivalent
construct. [2285] Aspect E-8: Multivalent polypeptide according to
aspect E-7, that comprises or essentially consists of at least two
amino acid sequences according to any of aspects A-1 to A-29 and
C-1 to C-38 and/or Nanobodies.RTM. according to any of aspects B-1
to B-18 and D-1 to D-38 and/or at least one amino acid sequence
according to any of aspects W-1 to W-38 and/or at least one
Nanobody.RTM. according to any of aspects X-1 to X-38. [2286]
Aspect E-9: Multivalent polypeptide according to aspect E-8,
wherein said at least two amino acid sequences and/or
Nanobodies.RTM. are identical. [2287] Aspect E-10: Multivalent
polypeptide according to any of aspects E-7 to E-9, comprising or
essentially consisting of at least two amino acid sequences and/or
Nanobodies.RTM. that comprise at least a stretch of amino acid
residues chosen from the following: [2288] a) SEQ ID NO: 102;
[2289] b) a stretch of amino acid residues that has no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with SEQ ID NO: 102, provided that: [2290] i) said
stretch of amino acid residues has an Aspartic acid (Asp, D) at
position 6 (position 54 determined according to Kabat numbering);
and [2291] ii) the amino acid sequence comprising said stretch of
amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference. [2292] Aspect E-11:
Multivalent polypeptide according to any of aspects E-7 to E-10,
comprising or essentially consisting of at least two amino acid
sequences and/or Nanobodies.RTM. that comprise at Feast a stretch
of amino acid residues chosen from the following: [2293] a) SEQ ID
NO: 102; [2294] b) a stretch of amino acid residues that has no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with SEQ ID NO: 102, provided that:
[2295] i) said stretch of amino acid residues has an Aspartic acid
(Asp, D) at position 6 (position 54 determined according to Kabat
numbering); and [2296] ii) the amino acid sequence comprising said
stretch of amino acid residues binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or 2 higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference;
[2297] and at least one stretch is chosen from: [2298] c) SEQ ID
NO: 98; [2299] d) a stretch of amino acid residues that has no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with SEQ ID NO: 98, provided that the amino
acid sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [2300] e) SEQ ID NO: 121; and [2301] f) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 121, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference.
[2302] such that the stretch of amino acid residues that
corresponds to one of a) and b) should always be present in the
amino acid sequence of the invention and such that the second
stretch of amino acid residues is chosen from one of c), d), e) and
f). [2303] Aspect E-12: Multivalent polypeptide according to any of
aspects E-7 to E-11, comprising or essentially consisting of at
least two amino acid sequences and/or Nanobodies.RTM. that comprise
at least a stretch of amino acid residues chosen from the
following: [2304] a) SEQ ID NO: 98; [2305] b) a stretch of amino
acid residues that has no more than 3, preferably no more than 2,
more preferably no more than 1 amino acid difference with SEQ ID
NO: 98, provided that the amino acid sequence comprising said
stretch of amino acid residues binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference;
[2306] a second stretch of amino acid residues chosen from the
group consisting of:
[2307] c) SEQ ID NO: 102; [2308] d) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
102, provided that: [2309] i) said stretch of amino acid residues
has an Aspartic acid (Asp, D) at position 6 (position 54 determined
according to Kabat numbering); and [2310] ii) the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [2311] and a third stretch of amino acid residues
chosen from the group consisting of: [2312] e) SEQ ID NO: 121;
[2313] f) a stretch of amino acid residues that has no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with SEQ ID NO: 121, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference. [2314] Aspect E-13: Multivalent polypeptide according
to any of aspects E-7 to E-12, comprising or essentially consisting
of at least two amino acid sequences and/or Nanobodies.RTM. that
comprise at least SEQ ID NO: 102. [2315] Aspect E-14: Multivalent
polypeptide according to any of aspects E-7 to E-13, comprising or
essentially consisting of at least two amino acid sequences and/or
Nanobodies.RTM. that comprise at least SEQ ID NO: 102 and at least
one stretch of amino acid residues (CDR sequence) chosen from:
[2316] a) SEQ ID NO: 98; [2317] b) a stretch of amino acid residues
that has no more than 3, preferably no more than 2, more preferably
no more than 1 amino acid difference with SEQ ID NO: 98, provided
that the amino acid sequence comprising said stretch of amino acid
residues binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence comprising said stretch
of amino acid residues has the same, about the same, or a higher
potency (as defined herein) compared to the amino acid sequence
comprising said stretch of amino acid residues without the 3, 2 or
1 amino acid difference; [2318] c) SEQ ID NO: 121; and [2319] d) a
stretch of amino acid residues that has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with SEQ ID NO: 121, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino add sequence comprising said stretch of amino add
residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference. [2320] Aspect E-15: Multivalent polypeptide according
to any of aspects E-7 to E-14, comprising or essentially consisting
of at least two amino acid sequences and/or Nanobodies.RTM. that
comprise at least SEQ ID NO: 102 and a CDR1 sequence chosen from:
[2321] a) SEQ ID NO: 98; [2322] b) a stretch of amino acid residues
that has no more than 3, preferably no more than 2, more preferably
no more than 1 amino acid difference with SEQ ID NO: 98, provided
that the amino add sequence comprising said stretch of amino acid
residues binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence comprising said stretch
of amino acid residues has the same, about the same, or a higher
potency (as defined herein) compared to the amino acid sequence
comprising said stretch of amino acid residues without the 3, 2 or
1 amino acid difference; [2323] and a CDR3 sequence chosen from:
[2324] c) SEQ ID NO: 121; [2325] d) a stretch of amino add residues
that has no more than 3, preferably no more than 2, more preferably
no more than 1 amino acid difference with SEQ ID NO: 121, provided
that the amino acid sequence comprising said stretch of amino acid
residues binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence comprising said stretch
of amino acid residues has the same, about the same, or a higher
potency (as defined herein) compared to the amino acid sequence
comprising said stretch of amino acid residues without the 3, 2 or
1 amino acid difference. [2326] Aspect E-16: Multivalent
polypeptide according to any of aspects E-7 to E-15, comprising or
essentially consisting of at least two amino acid sequences and/or
Nanobodies.RTM. that comprise at least SEQ ID NO: 102 and at least
one stretch of amino acid residues (CDR sequence) chosen from SEQ
ID NO: 98 and SEQ ID NO: 121. [2327] Aspect E-17: Multivalent
polypeptide according to any of aspects E-7 to E-16, comprising or
essentially consisting of at least two amino acid sequences and/or
Nanobodies.RTM. that comprise SEQ ID NO: 98, SEQ ID NO: 102 and SEQ
ID NO: 121. [2328] Aspect E-18: Multivalent polypeptide according
to any of aspect E-8 to E-17, wherein said at least two amino acid
sequences and/or Nanobodies.RTM. are identical. [2329] Aspect E-19:
Multivalent polypeptide according to any of aspects E-7 to E-9,
comprising or essentially consisting of at least two amino acid
sequences and/or Nanobodies.RTM. chosen from the following: [2330]
a) SEQ ID NO's: 60-76; [2331] b) amino acid sequences that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 60-76,
provided that: [2332] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105 (said position determined according to
Kabat numbering); and [2333] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference. [2334] Aspect
E-20: Multivalent polypeptide according to aspect E-19, wherein
said at least two amino acid sequences and/or Nanobodies.RTM. are
identical. [2335] Aspect E-21: Multivalent polypeptide according to
aspect E-20, that comprises or essentially consists of at least two
identical amino acid sequences and/or Nanobodies.RTM. chosen from
one of SEQ ID NO's: 60-76. [2336] Aspect E-22: Multivalent
polypeptide according to any of aspects E-7 to E-9, comprising or
essentially consisting of at least two amino acid sequences and/or
Nanobodies.RTM. chosen from the following: [2337] a) SEQ ID NO's:
62, 65, 67, 68, 75 and 76; [2338] b) amino acid sequences that have
no more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 62, 65, 67,
68, 75 and 76, provided that: [2339] i) the amino acid sequence has
a Glutamine (Gln, Q) at position 105, a Leucine (Leu, L) at
position 78 and/or an Arginine (Arg, R) at position 83 (said
positions determined according to Kabat numbering); and [2340] ii)
the amino acid sequence binds protein F of hRSV with the same,
about the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence without the 3, 2 or 1 amino
acid difference. [2341] Aspect E-23: Multivalent polypeptide
according to aspect E-22, comprising or essentially consisting of
at least two amino acid sequences and/or Nanobodies.RTM. chosen
from the following: [2342] a) SEQ ID NO's: 62, 65, 67, 58, 75 and
76; [2343] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76,
provided that: [2344] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105, a Leucine (Leu, L) at position 78 and an
Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [2345] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference. [2346]
Aspect E-24: Multivalent polypeptide according to any of aspects
E-22 or E-23, wherein said at least two amino acid sequences and/or
Nanobodies.RTM. are identical. [2347] Aspect E-25: Multivalent
polypeptide according to aspect E-24, that comprises or essentially
consists of at least two identical amino acid sequences and/or
Nanobodies.RTM. chosen from one of SEQ ID NO's: 62, 65, 67, 68, 75
and 76. [2348] Aspect E-26: Multivalent polypeptide according to
any of aspects E-7 to E-9, comprising or essentially consisting of
at least two amino acid sequences and/or Nanobodies.RTM. chosen
from the following: [2349] a) SEQ ID NO's: 65 and 76; [2350] b)
amino acid sequences that have no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
one of SEQ ID NO's: 65 and 76, provided that: [2351] i) the amino
acid sequence has an Aspartic acid (Asp, D) at position 54, a
Glutamine (Gln, Q) at position 105, a Leucine (Leu, L) at position
78 and/or an Arginine (Arg, R) at position 83 (said positions
determined according to Kabat numbering); and [2352] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference. [2353] Aspect E-27: Multivalent polypeptide according
to aspect E-26, comprising or essentially consisting of at least
two amino acid sequences and/or Nanobodies.RTM. chosen from the
following: [2354] a) SEQ ID NO's: 65 and 76; [2355] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 65 and 76, provided that: [2356] i) the amino acid sequence
has an Aspartic acid (Asp, D) at position 54, a Glutamine (Gln, Q)
at position 105, a Leucine (Leu, L) at position 78 and an Arginine
(Arg, R) at position 83 (said positions determined according to
Kabat numbering); and [2357] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference. [2358] Aspect
E-28: Multivalent polypeptide according to any of aspects E-26 or
E-27, wherein said at least two amino acid sequences and/or
Nanobodies.RTM. are identical. [2359] Aspect E-29: Multivalent
polypeptide according to aspect E-28, that comprises or essentially
consists of at least two identical amino acid sequences and/or
Nanobodies.RTM. chosen from SEQ ID NO's: 65 and 76. [2360] Aspect
E-30: Multivalent polypeptide according to any of aspects E-7 to
E-9, comprising or essentially consisting of at least two amino
acid sequences and/or Nanobodies.RTM. chosen from the following:
[2361] a) SEQ ID NO's: 146-453; [2362] b) amino acid sequences that
have no more than 3, preferably no more than 2, more preferably no
more than 1 amino acid difference with one of SEQ ID NO's: 146-153,
provided that: [2363] i) the amino acid sequence has a Praline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and Leucine (Leu, L) at position 108 (said
positions determined according to Kabat numbering); and [2364] ii)
the amino add sequence binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence without the 3, 2 or 1 amino
acid difference. [2365] Aspect E-31: Multivalent polypeptide
according to aspect E-30, wherein said at least two amino acid
sequences and/or Nanobodies.RTM. are identical. [2366] Aspect E-32:
Multivalent polypeptide according to aspect E-31, that comprises or
essentially consists of at least two identical amino acid sequences
and/or Nanobodies.RTM. chosen from one of SEQ ID NO's: 146-153.
[2367] Aspect E-33: Multivalent polypeptide according to any of
aspects E-7 to E-9, comprising or essentially consisting of at
least two amino acid sequences and/or Nanobodies.RTM. chosen from
the following: [2368] a) SEQ ID NO's: 146-149 and 151-453; [2369]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 146-149 and 151-153, provided that: [2370]
i) the amino acid sequence has a Proline (Pro, P) at position 14,
Arginine (Arg, R) at position 19, Leucine (Leu, L) at position 20
and Leucine (Leu, L) at position 108 and in addition Arginine (Arg,
R) at position 83, Glutamic acid (Glu, E) at position 85 and/or
Glutamine (Gln, Q) at position 105 (said positions determined
according to Kabat numbering); and [2371] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference. [2372]
Aspect E-34: Multivalent polypeptide according to aspect E-33,
comprising or essentially consisting of at least two amino acid
sequences and/or Nanobodies.RTM. chosen from the following: [2373]
a) SEQ ID NO's: 146-449 and 151-153; [2374] b) amino acid sequences
that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 146-149 and 151-153, provided that:
[2375] i) the amino acid sequence has a Proline (Pro, P) at
position 14, Arginine (Arg, R) at position 19, Leucine (Leu, L) at
position 20 and Leucine (Leu, L) at position 108 and in addition
Arginine (Arg, R) at position 83, Glutamic acid (Glu, E) at
position 85 and/or Glutamine (Gln, Q) at position 105 so that when
the amino acid sequence has no more than 3, preferably no more than
2, more preferably no more than 1 amino acid difference with:
[2376] SEQ ID NO: 146, the amino acid sequence preferably has
Glutamine (Gln, Q) at position 105; [2377] SEQ ID NO: 147, the
amino acid sequence preferably has Arginine (Arg, R) at position 83
and Glutamine (Gln, Q) at position 105; [2378] SEQ ID NO: 148, the
amino acid sequence preferably has Glutamic acid (Glu, E) at
position 85 and Glutamine (Gln, Q) at position 105; [2379] SEQ ID
NO: 149, the amino acid sequence preferably has Arginine (Arg, R)
at position 83, Glutamic acid (Glu, E) at position 85 and Glutamine
(Gln, Q) at position 105; [2380] SEQ ID NO: 151, the amino acid
sequence preferably has Arginine (Arg, R) at position 83; [2381]
SEQ ID NO; 152, the amino acid sequence preferably has Glutamic
acid (Glu, E) at position 85; [2382] SEQ ID NO: 153, the amino acid
sequence preferably has Arginine (Arg, R) at position 83 and
Glutamic acid (Glu, E) at position 85; [2383] (said positions
determined according to Kabat numbering); and [2384] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference. [2385] Aspect E-35: Multivalent polypeptide according
to any of aspects E-33 or E-34, wherein said at least two amino
acid sequences and/or Nanobodies.RTM. are identical. [2386] Aspect
E-36: Multivalent polypeptide according to aspect E-35, that
comprises or essentially consists of at least two identical amino
acid sequences and/or Nanobodies.RTM. chosen from one of SEQ ID
NO's: 62, 65, 67, 68, 75, 76, 147, 149 and 153. [2387] Aspect E-37:
Multivalent polypeptide comprising or essentially consisting of at
least two amino acid sequences and/or Nanobodies.RTM. with SEQ ID
NO: 5, in which one or more (such as two, three, four, five, six,
seven, eight or nine, ten, eleven, or twelve) amino acid residues
have been mutated selected from the following: Val5Leu, Ala14Pro,
Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp. [2388] Aspect E-38: Multivalent
polypeptide according to aspect E-37, comprising or essentially
consisting of at least two amino acid sequences and/or
Nanobodies.RTM. with SEQ ID NO: 5, in which following amino acid
residues have been mutated: Val5Leu, Ala14Pro, Ser19R, Ile20Leu,
Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54D. [2389] Aspect E-39: Multivalent polypeptide
according to aspect E-37, comprising or essentially consisting of
at least two amino acid sequences and/or Nanobodies.RTM. with SEQ
ID NO: 5, in which one or more (such as two, three, four, five,
six, seven or eight) amino acid residues have been mutated selected
from the following: Ser19R, Ile20Leu, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gly54D. [2390] Aspect E-40: Multivalent
polypeptide according to aspect E-37, comprising or essentially
consisting of at least two amino acid sequences and/or
Nanobodies.RTM. with SEQ ID NO: 5, in which one or more (such as
two, three, four or five) amino acid residues have been mutated
selected from the following: Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gly54D. [2391] Aspect E-41: Multivalent polypeptide
according to aspect E-40, comprising or essentially consisting of
at least two amino acid sequences and/or Nanobodies.RTM. with SEQ
ID NO: 5, in which following amino acid residues have been mutated:
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54D. [2392] Aspect
E-42: Multivalent polypeptide comprising or essentially consisting
of at least two amino acid sequences and/or Nanobodies.RTM. with
SEQ ID NO: 5, in which one or more (such as two, three or four)
amino acid residues have been mutated selected from the following:
Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu. [2393] Aspect E-43:
Multivalent polypeptide comprising or essentially consisting of at
least two amino acid sequences and/or Nanobodies.RTM. with SEQ ID
NO: 5, in which one or more (such as two, three, four, five, six or
seven) amino acid residues have been mutated selected from the
following: Ala14Pro, Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu. [2394] Aspect E-44: Multivalent
polypeptide according to aspect E-37, comprising or essentially
consisting of at least two amino acid sequences and/or
Nanobodies.RTM. with SEQ ID NO: 5, in which following amino acid
residues have been mutated: [2395] Val5Leu, Ala14Pro, Glu44Gly,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu; [2396]
Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu; [2397] Gly78Leu,
Ala83Arg, Asp85Glu and Arg105Gln; [2398] Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54Asp; [2399] Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54Asp; [2400] Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gly54Asp; [2401] Gly54Asp; [2402] Ala14Pro, Ser19Arg, Ile20Leu and
Gln108Leu; [2403] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Ala83Arg; [2404] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Asp85Glu; [2405] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Arg105Gln; [2406] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg
and Asp85Glu; [2407] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu,
Ala83Arg and Arg105Gln; [2408] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Asp85Glu and Arg105Gln; or [2409] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu and Arg105Gln. [2410]
Aspect E-45: Multivalent polypeptide according to aspect E-7, that
comprises or essentially consists of at least three amino acid
sequences according to any of aspects A-1 to A-29, C-1 to C-38 and
W-1 to W-38 and/or Nanobodies.RTM. according to any of aspects B-1
to B-18, D-1 to D-38 and X-1 to X-38. [2411] Aspect E-46:
Multivalent polypeptide according to aspect E-45, wherein said at
least three amino acid sequences and/or Nanobodies.RTM. are
identical. [2412] Aspect E-47: Multivalent polypeptide according to
any of aspects E-45 or E-46, comprising or essentially consisting
of at least three amino acid sequences and/or Nanobodies.RTM. that
comprise at least a stretch of amino acid residues chosen from the
following: [2413] a) SEQ ID NO: 102; [2414] b) a stretch of amino
acid residues that has no more than 3, preferably no more than 2,
more preferably no more than 1 amino acid difference with SEQ ID
NO: 102, provided that: [2415] i) said stretch of amino acid
residues has an Aspartic acid (Asp, D) at position 6 (position 54
determined according to Kabat numbering); and [2416] ii) the amino
acid sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference. [2417] Aspect E-48: Multivalent polypeptide according
to any of aspects E-45 or E-46, comprising or essentially
consisting of at least three amino acid sequences and/or
Nanobodies.RTM. that comprise at least a stretch of amino acid
residues chosen from the following: [2418] a) SEQ ID NO: 102;
[2419] b) a stretch of amino acid residues that has no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with SEQ ID NO: 102, provided that: [2420] i) said
stretch of amino acid residues has an Aspartic acid (Asp, D) at
position 6 (position 54 determined according to Kabat numbering);
and [2421] ii) the amino acid sequence comprising said stretch of
amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference; [2422] and at least
one stretch is chosen from: [2423] c) SEQ ID NO: 98; [2424] d) a
stretch of amino acid residues that has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with SEQ ID NO: 98, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [2425] e) SEQ ID NO: 121; and [2426] f) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 121, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference.
[2427] such that the stretch of amino acid residues that
corresponds to one of a) and b) should always be present in the
amino acid sequence of the invention and such that the second
stretch of amino acid residues is chosen from one of c), d), e) and
f). [2428] Aspect E-49: Multivalent polypeptide according to any of
aspects E-45 or E-46, comprising or essentially consisting of at
least three amino acid sequences and/or Nanobodies.RTM. that
comprise at least a stretch of amino acid residues chosen from the
following: [2429] a) SEQ ID NO: 98; and [2430] b) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 98, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference;
[2431] a second stretch of amino acid residues chosen from the
group consisting of: [2432] c) SEQ ID NO: 102; and [2433] d) a
stretch of amino acid residues that has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with SEQ ID NO: 102, provided that: [2434] i) said
stretch of amino acid residues has an Aspartic acid (Asp, D) at
position 6 (position 54 determined according to Kabat numbering);
and [2435] ii) the amino acid sequence comprising said stretch of
amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino add difference; [2436] and a third
stretch of amino acid residues chosen from the group consisting of:
[2437] e) SEQ ID NO: 121; and [2438] f) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
121, provided that the amino acid sequence comprising said stretch
of amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference. [2439] Aspect E-50:
Multivalent polypeptide according to any of aspects E-45 to E-46,
comprising or essentially consisting of at least three amino acid
sequences and/or Nanobodies.RTM. that comprise at least SEQ ID NO:
102. [2440] Aspect E-51: Multivalent polypeptide according to any
of aspects E-45 to E-46, comprising or essentially consisting of at
least three amino acid sequences and/or Nanobodies.RTM. that
comprise at least SEQ ID NO: 102 and at least one stretch of amino
acid residues (CDR sequence) chosen from: [2441] a) SEQ ID NO: 98;
[2442] b) a stretch of amino acid residues that has no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with SEQ ID NO: 98, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [2443] c) SEQ ID NO: 121; and [2444] d) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 121, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference.
[2445] Aspect E-52: Multivalent polypeptide according to any of
aspects E-45 to E-46, comprising or essentially consisting of at
least three amino acid sequences and/or Nanobodies
.RTM. that comprises at least SEQ ID NO: 102 and a CDR1 sequence
chosen from: [2446] a) SEQ ID NO: 98; and [2447] b) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 98, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference;
[2448] and a CDR3 sequence chosen from: [2449] c) SEQ ID NO: 121;
and [2450] d) a stretch of amino acid residues that has no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with SEQ ID NO: 121, provided that the amino
acid sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference. [2451] Aspect E-53: Multivalent polypeptide according
to any of aspects E-45 to E-46, comprising or essentially
consisting of at least three amino acid sequences and/or
Nanobodies.RTM. that comprise at least SEQ ID NO: 102 and at least
one stretch of amino acid residues (CDR sequence) chosen from SEQ
ID NO: 98 and SEQ ID NO: 121. [2452] Aspect E-54: Multivalent
polypeptide according to any of aspects E-45 to E-46, comprising or
essentially consisting of at least three amino acid sequences
and/or Nanobodies.RTM. that comprise SEQ ID NO: 98, SEQ ID NO: 102
and SEQ ID NO: 121. [2453] Aspect E-55: Multivalent polypeptide
according to any of aspect E-47 to E-53, wherein said at least
three amino acid sequences and/or Nanobodies.RTM. are identical.
[2454] Aspect E-56: Multivalent polypeptide according to any of
aspects E-45 or E-46, comprising or essentially consisting of at
least three amino acid sequences and/or Nanobodies.RTM. chosen from
the following: [2455] a) SEQ ID NO's: 60-75; [2456] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 60-76, provided that: [2457] i) the amino acid sequence has a
Glutamine (Gln, Q) at position 105 (said position determined
according to Kabat numbering); and [2458] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference. [2459]
Aspect E-57: Multivalent polypeptide according to aspect E-56,
wherein said at least three amino acid sequences and/or
Nanobodies.RTM. are identical. [2460] Aspect E-58: Multivalent
polypeptide according to aspect E-57, that comprises or essentially
consists of at least three identical amino acid sequences and/or
Nanobodies.RTM. chosen from one of SEQ ID NO's: 60-76. [2461]
Aspect E-59: Multivalent polypeptide according to any of aspects
E-45 or E-46, comprising or essentially consisting of at least
three amino acid sequences and/or Nanobodies.RTM. chosen from the
following: [2462] a) SEQ ID NO's: 62, 65, 67, 68, 75 and 76; [2463]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76, provided that:
[2464] i) the amino acid sequence has a Glutamine (Gln, Q) at
position 105, a Leucine (Leo, L) at position 78 and/or an Arginine
(Arg, R) at position 83 (said positions determined according to
Kabat numbering); and [2465] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference. [2466] Aspect
E-60: Multivalent polypeptide according to aspect E-59, comprising
or essentially consisting of at least three amino acid sequences
and/or Nanobodies.RTM. chosen from the following: [2467] a) SEQ ID
NO's: 62, 65, 67, 68, 75 and 76; [2468] b) amino acid sequences
that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 62, 65, 67, 68, 75 and 76, provided that: [2469] i) the amino
acid sequence has a Glutamine (Gln, Q) at position 105, a Leucine
(Leu, L) at position 78 and an Arginine (Arg, R) at position 83
(said positions determined according to Kabat numbering); and
[2470] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference. [2471] Aspect E-61: Multivalent
polypeptide according to any of aspects E-59 or E-60, wherein said
at least three amino acid sequences and/or Nanobodies.RTM. are
identical. [2472] Aspect E-62: Multivalent polypeptide according to
aspect E-61, that comprises or essentially consists of at least
three identical amino acid sequences and/or Nanobodies.RTM. chosen
from one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76. [2473] Aspect
E-63: Multivalent polypeptide according to any of aspects E-45 or
E-46, comprising or essentially consisting of at least three amino
acid sequences and/or Nanobodies.RTM. chosen from the following:
[2474] a) SEQ ID WO's: 65 and 76; [2475] b) amino acid sequences
that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 65 and 76, provided that: [2476] i) the amino acid sequence
has an Aspartic acid (Asp, D) at position 54, a Glutamine (Gln, Q)
at position 105, a Leucine (Leu, L) at position 78 and/or an
Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [2477] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference. [2478]
Aspect E-64: Multivalent polypeptide according to aspect E-63,
comprising or essentially consisting of at least three amino acid
sequences and/or Nanobodies' chosen from the following: [2479] a)
SEQ ID NO's: 65 and 76; [2480] b) amino acid sequences that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 65 and 76,
provided that: [2481] i) the amino acid sequence has an Aspartic
acid (Asp, D) at position 54, a Glutamine (Gln, Q) at position 105,
a Leucine (Leu, L) at position 78 and an Arginine (Arg, R) at
position 83 (said positions determined according to Kabat
numbering); and [2482] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference. [2483] Aspect E-65: Multivalent
polypeptide according to any of aspects E-63 or E-64, wherein said
at least three amino acid sequences and/or Nanobodies.RTM. are
identical. [2484] Aspect E-66: Multivalent polypeptide according to
aspect E-65, that comprises or essentially consists of at least
three identical amino add sequences and/or Nanobodies.RTM. chosen
from SEQ ID NO's: 65 and 76. [2485] Aspect E-67: Multivalent
polypeptide according to any of aspects E-45 or E-46, comprising or
essentially consisting of at least three amino acid sequences
and/or Nanobodies.RTM. chosen from the following: [2486] a) SEQ ID
NO's: 146-153; [2487] b) amino acid sequences that have no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with one of SEQ ID NO's: 146-153, provided
that: [2488] i) the amino acid sequence has a Proline (Pro, P) at
position 14, Arginine (Arg, R) at position 19, Leucine (Leu, L) at
position 20 and Leucine (Leu, L) at position 108 (said positions
determined according to Kabat numbering); and [2489] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference. [2490] Aspect E-68: Multivalent polypeptide according
to aspect E-67, wherein said at least three amino acid sequences
and/or Nanobodies.RTM. are identical. [2491] Aspect E-69:
Multivalent polypeptide according to aspect E-68, that comprises or
essentially consists of at least three identical amino acid
sequences and/or Nanobodies.RTM. chosen from one of SEQ ID NO's:
146-153. [2492] Aspect E-70: Multivalent polypeptide according to
any of aspects E-45 or E-46, comprising or essentially consisting
of at least three amino acid sequences and/or Nanobodies.RTM.
chosen from the following: [2493] a) SEQ ID NO's: 146-149 and
151-153; [2494] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 146-149 and 151-153,
provided that: [2495] i) the amino acid sequence has a Proline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and Leucine (Leu, L) at position 108 and in
addition Arginine (Arg, R) at position 83, Glutamic acid (Glu, E)
at position 85 and/or Glutamine (Gln, Q) at position 105 (said
positions determined according to Kabat numbering); and [2496] ii)
the amino acid sequence binds protein F of hRSV with the same,
about the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence without the 3, 2 or 1 amino
acid difference. [2497] Aspect E-71: Multivalent polypeptide
according to aspect E-70, comprising or essentially consisting of
at least three amino acid sequences and/or Nanobodies.RTM. chosen
from the following: [2498] a) SEQ ID NO's: 146-149 and 151-153;
[2499] b) amino acid sequences that have no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with one of SEQ ID NO's: 146-149 and 151-153, provided
that: [2500] i) the amino acid sequence has a Praline (Pro, P) at
position 14, Arginine (Arg, R) at position 19, Leucine (Leu, L) at
position 20 and Leucine (Leu, L) at position 108 and in addition
Arginine (Arg, R) at position 83, Glutamic acid (Glu, E) at
position 85 and/or Glutamine (Gln, Q) at position 105 so that when
the amino acid sequence has no more than 3, preferably no more than
2, more preferably no more than 1 amino acid difference with:
[2501] SEQ ID NO: 146, the amino acid sequence preferably has
Glutamine (Gln, Q) at position 105; [2502] SEQ ID NO: 147, the
amino acid sequence preferably has Arginine (Arg, R) at position 83
and Glutamine (Gln, Q) at position 105; [2503] SEQ ID NO: 148, the
amino acid sequence preferably has Glutamic acid (Glu, E) at
position 85 and Glutamine (Gln, Q) at position 105; [2504] SEQ ID
NO: 149, the amino acid sequence preferably has Arginine (Arg, R)
at position 83, Glutamic acid (Glu, E) at position 85 and Glutamine
(Gln, Q) at position 105; [2505] SEQ ID NO: 151, the amino acid
sequence preferably has Arginine (Arg, R) at position 83; [2506]
SEQ ID NO: 152, the amino acid sequence preferably has Glutamic
acid (Glu, E) at position 85; [2507] SEQ ID NO: 153, the amino acid
sequence preferably has Arginine (Arg, R) at position 83 and
Glutamic acid (Glu, E) at position 85; [2508] (said positions
determined according to Kabat numbering); and [2509] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference. [2510] Aspect E-72: Multivalent polypeptide according
to any of aspects E-70 or E-71, wherein said at least three amino
acid sequences and/or Nanobodies.RTM. are identical. [2511] Aspect
E-73: Multivalent polypeptide according to aspect E-72, that
comprises or essentially consists of at least three identical amino
acid sequences and/or Nanobodies.RTM. chosen from one of SEQ ID
NO's: 62, 65, 67, 68, 75, 76, 147, 149 and 153. [2512] Aspect E-74:
Multivalent polypeptide comprising or essentially consisting of at
least three amino acid sequences and/or Nanobodies.RTM. with SEQ ID
NO: 5, in which one or more (such as two, three, four, five, six,
seven, eight or nine, ten, eleven, or twelve) amino acid residues
have been mutated selected from the following: Val5Leu, Ala14Pro,
Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp. [2513] Aspect E-75: Multivalent
polypeptide according to aspect E-74, comprising or essentially
consisting of at least three amino acid sequences and/or
Nanobodies.RTM. with SEQ ID NO: 5, in which following amino acid
residues have been mutated: Val5Leu, Ala14Pro, Ser19R, Ile20Leu,
Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54D. [2514] Aspect E-76: Multivalent polypeptide
according to aspect E-74, comprising or essentially consisting of
at least three amino acid sequences and/or Nanobodies.RTM. with SEQ
ID NO: 5, in which one or more (such as two, three, four, five,
six, seven or eight amino acid residues have been mutated selected
from the following: Ser19R, Ile20Leu, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gly54D. [2515] Aspect E-77: Multivalent
polypeptide according to aspect E-74, comprising or essentially
consisting of at least three amino acid sequences and/or
Nanobodies
.RTM. with SEQ ID NO: 5, in which one or more (such as two, three,
four or five) amino acid residues have been mutated selected from
the following: Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54D.
[2516] Aspect E-78: Multivalent polypeptide according to aspect
E-77, comprising or essentially consisting of at least three amino
acid sequences and/or Nanobodies.RTM. with SEQ ID NO: 5, in which
following amino acid residues have been mutated: Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gly54D. [2517] Aspect E-79:
Multivalent polypeptide comprising or essentially consisting of at
least three amino acid sequences and/or Nanobodies.RTM. with SEQ ID
NO: 5, in which one or more (such as two, three or four) amino acid
residues have been mutated selected from the following: Ala14Pro,
Ser19Arg, Ile20Leu and Gln108Leu. [2518] Aspect E-80: Multivalent
polypeptide comprising or essentially consisting of at least three
amino acid sequences and/or Nanobodies.RTM. with SEQ ID NO: 5, in
which one or more (such as two, three, four, five, six or seven)
amino acid residues have been mutated selected from the following:
Ala14Pro, Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu. [2519] Aspect E-81: Multivalent polypeptide according to
aspect E-74, comprising or essentially consisting of at least three
amino acid sequences and/or Nanobodies.RTM. with SEQ ID NO: 5, in
which following amino acid residues have been mutated: [2520]
Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu; [2521] Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu; [2522] Gly78Leu, Ala83Arg, Asp85Glu and Arg105Gln;
[2523] Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp; [2524] Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp; [2525] Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gly54Asp; [2526] Gly54Asp; [2527] Ala14Pro,
Ser19Arg, Ile20Leu and Gln108Leu; [2528] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Ala83Arg; [2529] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Asp85Glu; [2530] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Arg105Gln; [2531] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg and Asp85Glu; [2532] Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln; [2533]
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and Arg105Gln; or
[2534] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu
and Arg105Gln, [2535] Aspect E-82: Multivalent polypeptide
according to any of aspects E-7 to E-9, comprising or essentially
consisting of at least one amino add sequence and/or Nanobody.RTM.
chosen from the following: [2536] a) SEQ ID NO's: 138-141 and
154-157; [2537] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 138-141, provided that:
[2538] i) the amino acid sequence has a Aspartic acid (Asp, D) at
position 1 (said position determined according to Kabat numbering);
and [2539] ii) the amino acid sequence binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference. [2540] Aspect E-83: Multivalent
polypeptide according to aspect E-82, that comprises or essentially
consists of at least one amino acid sequence and/or Nanobody.RTM.
chosen from one of SEQ ID NO's: 138-141 and 154-157. [2541] Aspect
E-84: Multivalent polypeptide comprising or essentially consisting
of at least one amino acid sequence and/or Nanobody.RTM. with SEQ
ID NO: 5, in which the Glutamic acid at position 1 has been changed
into Aspartic acid. [2542] Aspect E-85: Multivalent polypeptide
comprising or essentially consisting of at least one amino acid
sequence and/or Nanobody.RTM. with SEQ ID NO: 62, in which the
Glutamic acid at position 1 has been changed into Aspartic acid.
[2543] Aspect E-86: Multivalent polypeptide comprising or
essentially consisting of at least one amino acid sequence and/or
Nanobody.RTM. with SEQ ID NO: 65, in which the Glutamic acid at
position 1 has been changed into Aspartic acid. [2544] Aspect E-87:
Multivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence and/or Nanobody.RTM. with SEQ ID NO:
76, in which the Glutamic acid at position 1 has been changed into
Aspartic acid. [2545] Aspect E-88: Multivalent polypeptide
comprising or essentially consisting of at least one amino acid
sequence and/or Nanobody.RTM. with SEQ ID NO: 75, in which the
Glutamic acid at position 1 has been changed into Aspartic acid.
[2546] Aspect E-89: Multivalent polypeptide comprising or
essentially consisting of at least one amino acid sequence and/or
Nanobody.RTM. with SEQ ID NO: 147, in which the Glutamic acid at
position 1 has been changed into Aspartic acid. [2547] Aspect E-90:
Multivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence and/or Nanobody.RTM. with SEQ ID NO:
149, in which the Glutamic acid at position 1 has been changed into
Aspartic acid. [2548] Aspect E-91: Multivalent polypeptide
comprising or essentially consisting of at least one amino acid
sequence and/or Nanobody.RTM. with SEQ ID NO: 153, in which the
Glutamic acid at position 1 has been changed into Aspartic acid.
[2549] Aspect E-92: Multivalent polypeptide comprising or
essentially consisting of at least one amino acid sequence and/or
Nanobody.RTM. with SEQ ID NO: 5, in which one or more (such as two,
three, four, five, six, seven, eight or nine, ten, eleven or
twelve) amino acid residues have been mutated selected from the
following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp,
and wherein the Glutamic acid at position 1 has been changed into
Aspartic acid. [2550] Aspect E-93: Multivalent polypeptide
according to aspect E-92, comprising or essentially consisting of
at least one amino acid sequence and/or Nanobody.RTM. with SEQ ID
NO: 5, in which following amino acid residues have been mutated:
Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D, and wherein
the Glutamic acid at position 1 has been changed into Aspartic
acid. [2551] Aspect E-94: Multivalent polypeptide according to
aspect E-92, comprising or essentially consisting of at least one
amino acid sequence and/or Nanobody.RTM. with SEQ ID NO: 5, in
which one or more (such as two three, four, five, six, seven or
eight) amino acid residues have been mutated selected from the
following: Ser19R, Ile20Leu, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gly54D, and wherein the Glutamic acid at
position 1 has been changed into Aspartic acid. [2552] Aspect E-95:
Multivalent polypeptide according to aspect E-92, comprising or
essentially consisting of at least one amino acid sequence and/or
Nanobody.RTM. with SEQ ID NO: 5, in which one or more (such as two,
three, four or five) amino acid residues have been mutated selected
from the following: Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gly54D, and wherein the Glutamic acid at position 1 has been
changed into Aspartic acid. [2553] Aspect E-96: Multivalent
polypeptide according to aspect E-95, comprising or essentially
consisting of at least one amino acid sequence and/or Nanobody.RTM.
with SEQ ID NO: 5, in which following amino acid residues have been
mutated: Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54D, and
wherein the Glutamic acid at position 1 has been changed into
Aspartic acid. [2554] Aspect E-97: Multivalent polypeptide
comprising or essentially consisting of at least one amino acid
sequence and/or Nanobody.RTM. with SEQ ID NO: 5, in which one or
more (such as two, three or four) amino acid residues have been
mutated selected from the following: Ala14Pro, Ser19Arg, Ile20Leu
and Gln108Leu, and wherein the Glutamic acid at position 1 has been
changed into Aspartic acid. [2555] Aspect E-98: Multivalent
polypeptide comprising or essentially consisting of at least one
amino acid sequence and/or Nanobody.RTM. with SEQ ID NO: 5, in
which one or more (such as two, three, four, five, six or seven)
amino acid residues have been mutated selected from the following:
Ala14Pro, Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu, and wherein the Glutamic acid at position 1 has been
changed into Aspartic acid. [2556] Aspect E-99: Multivalent
polypeptide according to aspect E-92, comprising or essentially
consisting of at least one amino acid sequence and/or Nanobody.RTM.
with SEQ ID NO: 5, in which following amino acid residues have been
mutated: [2557] Glu1Asp; [2558] Glu1Asp, Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu;
[2559] Glu1Asp, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu; [2560]
Glu1Asp, Gly78Leu, Ala83Arg, Asp85Glu and Arg105Gln; [2561]
Glu1Asp, Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp; [2562] Glu1Asp, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp; [2563] Glu1Asp,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54Asp; [2564]
Glu1Asp and Gly54Asp; [2565] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu
and Gln108Leu; [2566] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Ala83Arg; [2567] Glu1Asp, Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Asp85Glu; [2568] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu and Arg105Gln; [2569] Glu1Asp,
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Asp85Glu;
[2570] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg,
Arg105Gln; [2571] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu,
Asp85Glu and Arg105Gln; or [2572] Glu1Asp, Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu and Arg105Gln. [2573]
Aspect E-100: Bivalent polypeptide according to aspect E-7, that
comprises or essentially consists of two amino acid sequences
according to any of aspects A-1 to A-29, C-1 to C-38 and W-1 to
W-38 and/or Nanobodies.RTM. according to any of aspects B-1 to
B-18, D-1 to D-38 and X-1 to X-38. [2574] Aspect E-101: Bivalent
polypeptide according to aspect E-100, wherein said two amino acid
sequences and/or Nanobodies.RTM. are identical. [2575] Aspect
E-102: Bivalent polypeptide according to any of aspects E-100 or
E-101, comprising or essentially consisting of two amino acid
sequences and/or Nanobodies.RTM. that comprise at least a stretch
of amino acid residues chosen from the following: [2576] a) SEQ ID
NO: 102; [2577] b) a stretch of amino acid residues that has no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with SEQ ID NO: 102, provided that:
[2578] i) said stretch of amino acid residues has an Aspartic acid
(Asp, D) at position 6 (position 54 determined according to Kabat
numbering); and [2579] ii) the amino acid sequence comprising said
stretch of amino acid residues binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference.
[2580] Aspect E-103: Bivalent polypeptide according to any of
aspects E-100 or E-101, comprising or essentially consisting of two
amino acid sequences and/or Nanobodies.RTM. that comprise at least
a stretch of amino acid residues chosen from the following: [2581]
a) SEQ ID NO: 102; [2582] b) a stretch of amino acid residues that
has no more than 3, preferably no more than 2, more preferably no
more than 1 amino acid difference with SEQ ID NO: 102, provided
that: [2583] i) said stretch of amino acid residues has an Aspartic
acid (Asp, D) at position 6 (position 54 determined according to
Kabat numbering); and [2584] ii) the amino add sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference;
and at least one stretch is chosen from: [2585] c) SEQ ID NO: 98;
[2586] d) a stretch of amino acid residues that has no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with SEQ ID NO: 98, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [2587] e) SEQ ID NO: 121; and [2588] f) a stretch of
amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 121, provided that the amino acid sequence comprising
said stretch of amino acid residues binds protein F of hRSV with
the same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence comprising said stretch of amino acid residues has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence comprising said stretch of
amino acid residues without the 3, 2 or 1 amino acid difference.
[2589] such that the stretch of amino acid residues that
corresponds to one of a) and b) should always be present in the
amino acid sequence of the invention and such that the second
stretch of amino acid residues is chosen from one of c), d), e) and
f). [2590] Aspect E-104: Bivalent polypeptide according to any of
aspects E-100 or E-101, comprising or essentially consisting of two
amino acid sequences and/or Nanobodies.RTM. that comprise at least
a stretch of amino acid residues chosen from the following: [2591]
a) SEQ ID NO: 98; [2592] b) a stretch of amino acid residues that
has no more than 3, preferably no more than 2, more preferably no
more than 1 amino acid difference with SEQ ID NO: 98, provided that
the amino acid sequence comprising said stretch of amino acid
residues binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence comprising said stretch
of amino acid residues has the same, about the same, or a higher
potency (as defined herein) compared to the amino acid sequence
comprising said stretch of amino acid residues without the 3, 2 or
1 amino acid difference;
[2593] a second stretch of amino acid residues chosen from the
group consisting of: [2594] c) SEQ ID NO: 102; [2595] d) a stretch
of amino acid residues that has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
SEQ ID NO: 102, provided that: [2596] i) said stretch of amino acid
residues has an Aspartic acid (Asp, D) at position 6 (position 54
determined according to Kabat numbering); and [2597] ii) the amino
acid sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [2598] and a third stretch of amino acid residues
chosen from the group consisting of: [2599] e) SEQ ID NO: 121;
[2600] f) a stretch of amino acid residues that has no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with SEQ ID NO: 121, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference. [2601] Aspect E-105: Bivalent polypeptide according to
any of aspects E-100 or E-101, comprising or essentially consisting
of two amino acid sequences and/or Nanobodies.RTM. that comprise at
least SEQ ID NO: 102. [2602] Aspect E-106: Bivalent polypeptide
according to any of aspects E-100 or E-101, comprising or
essentially consisting of two amino acid sequences and/or
Nanobodies.RTM. that comprise at least SEQ ID NO: 102 and at least
one stretch of amino acid residues (CDR sequence) chosen from:
[2603] a) SEQ ID NO: 98; [2604] b) a stretch of amino acid residues
that has no more than 3, preferably no more than 2, more preferably
no more than 1 amino acid difference with SEQ ID NO: 98, provided
that the amino acid sequence comprising said stretch of amino acid
residues binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence comprising said stretch
of amino acid residues has the same, about the same, or a higher
potency (as defined herein) compared to the amino acid sequence
comprising said stretch of amino acid residues without the 3, 2 or
1 amino acid difference; [2605] c) SEQ ID NO: 121; and [2606] d) a
stretch of amino acid residues that has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with SEQ ID NO: 121, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference. [2607] Aspect E-107: Bivalent polypeptide according to
any of aspects E-100 or E-101, comprising or essentially consisting
of two amino acid sequences and/or Nanobodies.RTM. that comprise at
least SEQ ID NO: 102 and a CDR1 sequence chosen from: [2608] a) SEQ
ID NO: 98; and [2609] b) a stretch of amino add residues that has
no more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with SEQ ID NO: 98, provided that the
amino acid sequence comprising said stretch of amino acid residues
binds protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino add residues without the 3, 2 or 1 amino acid
difference; and a CDR3 sequence chosen from: [2610] c) SEQ ID NO:
121; and [2611] d) a stretch of amino acid residues that has no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with SEQ ID NO: 121, provided that the
amino acid sequence comprising said stretch of amino acid residues
binds protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference. [2612] Aspect E-108: Bivalent polypeptide according to
any of aspects E-100 or E-101, comprising or essentially consisting
of two amino acid sequences and/or Nanobodies.RTM. that comprise at
least SEQ ID NO: 102 and at least one stretch of amino acid
residues (CDR sequence) chosen from SEQ ID NO: 98 and SEQ ID NO:
121. [2613] Aspect E-109: Bivalent polypeptide according to any of
aspects E-100 or E-101, comprising or essentially consisting of two
amino acid sequences and/or Nanobodies.RTM. that comprise SEQ ID
NO: 98, SEQ ID NO: 102 and SEQ ID NO: 121. [2614] Aspect E-110:
Bivalent polypeptide according to any of aspect E-102 to E-109,
wherein said at least two amino acid sequences and/or
Nanobodies.RTM. are identical. [2615] Aspect E-111: Bivalent
polypeptide according to any of aspects E-100 or E-101, comprising
or essentially consisting of two amino acid sequences and/or
Nanobodies.RTM. chosen from the following: [2616] a) SEQ ID NO's:
60-76; [2617] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino add
difference with one of SEQ ID NO's: 60-76, provided that: [2618] i)
the amino acid sequence has a Glutamine (Gln, Q) at position 105
(said position determined according to Kabat numbering); and [2619]
ii) the amino add sequence hinds protein F of hRSV with the same,
about the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence without the 3, 2 or 1 amino
acid difference. [2620] Aspect E-112: Bivalent polypeptide
according to aspect E-111, wherein said two amino acid sequences
and/or Nanobodies.RTM. are identical. [2621] Aspect E-113: Bivalent
polypeptide according to aspect E-112, that comprises or
essentially consists of two identical amino acid sequences and/or
Nanobodies.RTM. chosen from one of SEQ ID NO's: 60-76. [2622]
Aspect E-114: Bivalent polypeptide according to any of aspects
E-100 or 8-101, comprising or essentially consisting of two amino
acid sequences and/or Nanobodies.RTM. chosen from the following:
[2623] a) SEQ ID NO's: 62, 65, 67, 68, 75 and 76; [2624] b) amino
acid sequences that have no more than 3, preferably no more than 2,
more preferably no more than 1 amino acid difference with one of
SEQ ID NO's: 62, 65, 67, 68, 75 and 76, provided that: [2625] i)
the amino acid sequence has a Glutamine (Gln, Q) at position 105, a
Leucine (Leu, at position 78 and/or an Arginine (Arg, R) at
position 83 (said positions determined according to Kabat
numbering); and [2626] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference. [2627] Aspect E-115: Bivalent
polypeptide according to aspect E-114, comprising or essentially
consisting of two amino acid sequences and/or Nanobodies.RTM.
chosen from the following: [2628] a) SEQ ID NO's: 62, 65, 67, 68,
75 and 76; [2629] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76,
provided that: [2630] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105, a Leucine (Leu, L) at position 78 and an
Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [2631] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference. [2632]
Aspect E-116: Bivalent polypeptide according to any of aspects
E-114 or E415, wherein said two amino acid sequences and/or
Nanobodies.RTM. are identical. [2633] Aspect E-117: Bivalent
polypeptide according to aspect E-116, that comprises or
essentially consists of two identical amino acid sequences and/or
Nanobodies.RTM. chosen from one of SEQ ID NO's: 62, 65, 67, 68, 75
and 76. [2634] Aspect E-118: Bivalent polypeptide according to any
of aspects E-100 or E-101, comprising or essentially consisting of
two amino acid sequences and/or Nanobodies.RTM. chosen from the
following: [2635] a) SEQ ID NO's: 65 and 76; [2636] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 65 and 76, provided that: [2637] i) the amino acid sequence
has an Aspartic acid (Asp, D) at position 54, a Glutamine (Gln, Q)
at position 105, a Leucine (Leu, L) at position 78 and/or an
Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [2638] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference. [2639]
Aspect E-119: Bivalent polypeptide according to aspect E-118,
comprising or essentially consisting of two amino acid sequences
and/or Nanobodies.RTM. chosen from the following: [2640] a) SEQ ID
NO's: 65 and 76; [2641] b) amino acid sequences that have no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with one of SEQ ID NO's: 65 and 76, provided
that: [2642] i) the amino acid sequence has an Aspartic acid (Asp,
D) at position 54, a Glutamine (Gln, Q) at position 105, a Leucine
(Leu, L) at position 78 and an Arginine (Arg, R) at position 83
(said positions determined according to Kabat numbering); and
[2643] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference. [2644] Aspect E-120: Bivalent
polypeptide according to any of aspects E-118 or E-119, wherein
said two amino acid sequences and/or Nanobodies.RTM. are identical.
[2645] Aspect E-121: Bivalent polypeptide according to aspect
E-120, that comprises or essentially consists of two identical
amino acid sequences and/or Nanobodies.RTM. chosen from SEQ ID
NO's: 65 and 76. [2646] Aspect E-122: Bivalent polypeptide
according to any of aspects E-100 or E-101, comprising or
essentially consisting of two amino acid sequences and/or
Nanobodies.RTM. chosen from the following: [2647] a) SEQ ID NO's:
146-153; [2648] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 146-453, provided that:
[2649] i) the amino acid sequence has a Proline (Pro, P) at
position 14, Arginine (Arg, R) at position 19, Leucine (Leu, L) at
position 20 and Leucine (Leu, L) at position 108 (said positions
determined according to Kabat numbering); and [2650] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino add sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference. [2651] Aspect E-123: Bivalent polypeptide according to
aspect E-122, wherein said two amino acid sequences and/or
Nanobodies.RTM. are identical. [2652] Aspect E-124: Bivalent
polypeptide according to aspect E-123, that comprises or
essentially consists of two identical amino acid sequences and/or
Nanobodies.RTM. chosen from one of SEQ ID NO's: 146-453. [2653]
Aspect E-125: Bivalent polypeptide according to any of aspects E400
or E-101, comprising or essentially consisting of two amino acid
sequences and/or Nanobodies.RTM. chosen from the following: [2654]
a) SEQ ID NO's: 146-149 and 151-153; [2655] b) amino acid sequences
that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 146-149 and 151-153, provided that: [2656] i) the amino acid
sequence has a Proline (Pro, P) at position 14, Arginine (Arg, R)
at position 19, Leucine (Leu, L) at position 20 and Leucine (Leu,
L) at position 108 and in addition Arginine (Arg, R) at position
83, Glutamic acid (Glu, E) at position 85 and/or Glutamine (Gln, Q)
at position 105 (said positions determined according to Kabat
numbering); and [2657] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference. [2658] Aspect E-126: Bivalent
polypeptide according to aspect E-125, comprising or essentially
consisting of two amino acid sequences and/or Nanobodies.RTM.
chosen from the following: [2659] a) SEQ ID NO's: 146-449 and
151-453; [2660] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 146-149 and 151-453,
provided that:
[2661] i) the amino acid sequence has a Proline (Pro, P) at
position 14, Arginine (Arg, R) at position 19, Leucine (Leu, L) at
position 20 and Leucine (Leu, L) at position 108 and in addition
Arginine (Arg, R) at position 83, Glutamic acid (Glu, E) at
position 85 and/or Glutamine (Gln, Q) at position 105 so that when
the amino acid sequence has no more than 3, preferably no more than
2, more preferably no more than 1 amino acid difference with:
[2662] SEQ ID NO: 146, the amino acid sequence preferably has
Glutamine (Gln, Q) at position 105; [2663] SEQ ID NO: 147, the
amino acid sequence preferably has Arginine (Arg, R) at position 83
and Glutamine (Gln, Q) at position 105; [2664] SEQ ID NO: 148, the
amino acid sequence preferably has Glutamic acid (Glu, E) at
position 85 and Glutamine (Gln, Q) at position 105; [2665] SEQ ID
NO: 149, the amino acid sequence preferably has Arginine (Arg, R)
at position 83, Glutamic acid (Glu, E) at position 85 and Glutamine
(Gln, Q) at position 105; [2666] SEQ ID NO: 151, the amino acid
sequence preferably has Arginine (Arg, R) at position 83; [2667]
SEQ ID NO: 152, the amino acid sequence preferably has Glutamic
acid (Glu, E) at position 85; [2668] SEQ ID NO: 153, the amino acid
sequence preferably has Arginine (Arg, R) at position 83 and
Glutamic acid (Glu, E) at position 85; [2669] (said positions
determined according to Kabat numbering); and [2670] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference. [2671] Aspect E-127: Bivalent polypeptide according to
any of aspects E-125 or E-126, wherein said two amino acid
sequences and/or Nanobodies.RTM. are identical. [2672] Aspect
E-128: Bivalent polypeptide according to aspect E-127, that
comprises or essentially consists of two identical amino acid
sequences and/or Nanobodies.RTM. chosen from one of SEQ ID NO's:
62, 65, 67, 68, 75, 76, 147, 149 and 153. [2673] Aspect E-129:
Bivalent polypeptide comprising or essentially consisting of two
amino acid sequences and/or Nanobodies.RTM. with SEQ ID NO: 5, in
which one or more (such as two, three, four, five, six, seven,
eight or nine, ten, eleven or twelve) amino acid residues have been
mutated selected from the following: Val5Leu, Ala14Pro, Ser19R,
Ile20Leu, Glu4-4Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp. [2674] Aspect E-130: Bivalent
polypeptide according to aspect E-129, comprising or essentially
consisting of two amino acid sequences and/or Nanobodies.RTM. with
SEQ ID NO: 5, in which following amino acid residues have been
mutated: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D.
[2675] Aspect E-131: Bivalent polypeptide according to aspect
E-129, comprising or essentially consisting of two amino acid
sequences and/or Nanobodies.RTM. with SEQ ID NO: 5, in which one or
more (two, three, four, five, six, seven or eight) amino acid
residues have been mutated selected from the following: Ser19R,
Ile20Leu, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gly54D. [2676] Aspect E-132: Bivalent polypeptide according to
aspect E-129, comprising or essentially consisting of two amino
acid sequences and/or Nanobodies.RTM. with SEQ ID NO: 5, in which
one or more (such as two, three, four or five) amino acid residues
have been mutated selected from the following: Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gly54D. [2677] Aspect E-133: Bivalent
polypeptide according to aspect E-132, comprising or essentially
consisting of two amino acid sequences and/or Nanobodies.RTM. with
SEQ ID NO: 5, in which following amino acid residues have been
mutated: Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54D. [2678]
Aspect E-134: Bivalent polypeptide comprising or essentially
consisting of two amino acid sequences and/or Nanobodies.RTM. with
SEQ ID NO: 5, in which one or more (such as two, three or four)
amino acid residues have been mutated selected from the following:
Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu. [2679] Aspect E-135:
Bivalent polypeptide comprising or essentially consisting of two
amino acid sequences and/or Nanobodies.RTM. with SEQ ID NO: 5, in
which one or more (such as two, three, four, five, six or seven)
amino acid residues have been mutated selected from the following:
Ala14Pro, Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu. [2680] Aspect E-136: Bivalent polypeptide according to
aspect E-129, comprising or essentially consisting of two amino
acid sequences and/or Nanobodies.RTM. with SEQ ID NO: 5, in which
following amino acid residues have been mutated: [2681] Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu; [2682] Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu;
[2683] Gly78Leu, Ala83Arg, Asp85Glu and Arg105Gln; [2684] Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp; [2685] Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp; [2686] Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gly54Asp; [2687] Gly54Asp; [2688] Ala14Pro, Ser19Arg,
Ile20Leu and Gln108Leu; [2689] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Ala83Arg; [2690] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Asp85Glu; [2691] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Arg105Gln; [2692] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg and Asp85Glu; [2693] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln; [2694] Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and Arg105Gln; or [2695]
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu and
Arg105Gln. [2696] Aspect E-137: Bivalent polypeptide according to
any of aspects E-100 or E-101, comprising or essentially consisting
of at least one amino acid sequence and/or Nanobody.RTM. chosen
from the following: [2697] a) SEQ ID NO's: 138-141 and 154-157;
[2698] b) amino acid sequences that have no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with one of SEQ ID NO's: 138-141 and 154-157, provided
that: [2699] i) the amino acid sequence has a Aspartic acid (Asp,
D) at position 1 (said position determined according to Kabat
numbering); and [2700] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference. [2701] Aspect E-138: Bivalent
polypeptide according to aspect E-137, that comprises or
essentially consists of at least one amino acid sequence and/or
Nanobody.RTM. chosen from one of SEQ ID NO's: 138-141 and 154-157.
[2702] Aspect E-139: Bivalent polypeptide comprising or essentially
consisting of at least one amino acid sequence and/or Nanobody.RTM.
with SEQ ID NO: 5, in which the Glutamic acid at position 1 is
changed into Aspartic acid. [2703] Aspect E-140: Bivalent
polypeptide comprising or essentially consisting of at least one
amino acid sequence and/or Nanobody.RTM. with SEQ ID NO: 62, in
which the Glutamic acid at position 1 is changed into Aspartic
acid. [2704] Aspect E-141: Bivalent polypeptide comprising or
essentially consisting of at least one amino acid sequence and/or
Nanobody.RTM. with SEQ ID NO: 65, in which the Glutamic acid at
position 1 is changed into Aspartic acid. [2705] Aspect E-142:
Bivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence and/or Nanobody.RTM. with SEQ ID NO:
76, in which the Glutamic acid at position 1 is changed into
Aspartic acid. [2706] Aspect E-143: Bivalent polypeptide comprising
or essentially consisting of at least one amino acid sequence
and/or Nanobody.RTM. with SEQ ID NO: 75, in which the Glutamic acid
at position 1 is changed into Aspartic acid. [2707] Aspect E-144:
Bivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence and/or Nanobody.RTM. with SEQ ID NO:
147, in which the Glutamic acid at position 1 is changed into
Aspartic acid. [2708] Aspect E-145: Bivalent polypeptide comprising
or essentially consisting of at least one amino acid sequence
and/or Nanobody.RTM. with SEQ ID NO: 149, in which the Glutamic
acid at position 1 is changed into Aspartic acid. [2709] Aspect
E-146: Bivalent polypeptide comprising or essentially consisting of
at least one amino acid sequence and/or Nanobody.RTM. with SEQ ID
NO: 153, in which the Glutamic acid at position 1 is changed into
Aspartic acid. [2710] Aspect E-147: Bivalent polypeptide comprising
or essentially consisting of at least one amino acid sequence
and/or Nanobody.RTM. with SEQ ID NO: 5, in which one or more (such
as two, three, four, five, six, seven, eight or nine, ten, eleven
or twelve) amino acid residues have been mutated selected from the
following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp,
wherein the Glutamic acid at position 1 is changed into Aspartic
acid. [2711] Aspect E-148: Bivalent polypeptide according to aspect
E-147, comprising or essentially consisting of at least one amino
acid sequence and/or Nanobody.RTM. with SEQ ID NO: 5, in which
following amino acid residues have been mutated: Val5Leu, Ala14Pro,
Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54D, wherein the Glutamic acid at
position 1 is changed into Aspartic acid. [2712] Aspect E-149:
Bivalent polypeptide according to aspect E-147, comprising or
essentially consisting of at least one amino acid sequence and/or
Nanobody.RTM. with SEQ ID NO: 5, in which one or more (such as two,
three, four, five, six, seven or eight) amino acid residues have
been mutated selected from the following: Ser19R, Ile20Leu,
Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54D,
wherein the Glutamic acid at position 1 is changed into Aspartic
acid. [2713] Aspect E-150: Bivalent polypeptide according to aspect
E-147, comprising or essentially consisting of at least one amino
acid sequence and/or Nanobody.RTM. with SEQ ID NO: 5, in which one
or more (such as two, three, four or five) amino acid residues have
been mutated selected from the following: Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gly54D, wherein the Glutamic acid at
position 1 is changed into Aspartic acid. [2714] Aspect E-151:
Bivalent polypeptide according to aspect E-150, comprising or
essentially consisting of at least one amino acid sequence and/or
Nanobody.RTM. with SEQ ID NO: 5, in which following amino acid
residues have been mutated: Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln
and Gly54D, wherein the Glutamic acid at position 1 is changed into
Aspartic acid. [2715] Aspect E-152: Bivalent polypeptide comprising
or essentially consisting of at least one amino acid sequence
and/or Nanobody.RTM. with SEQ ID NO: 5, in which one or more (such
as two, three or four) amino acid residues have been mutated
selected from the following: Ala14Pro, Ser19Arg, Ile20Leu and
Gln108Leu, wherein the Glutamic acid at position 1 is changed into
Aspartic acid. [2716] Aspect E-153: Bivalent polypeptide comprising
or essentially consisting of at least one amino acid sequence
and/or Nanobody.RTM. with SEQ ID NO: 5, in which one or more (such
as two, three, four, five, six or seven) amino acid residues have
been mutated selected from the following: Ala14Pro, Ser19Arg,
Ile20Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu, wherein the
Glutamic acid at position 1 is changed into Aspartic acid. [2717]
Aspect E-154: Bivalent polypeptide according to aspect E-147,
comprising or essentially consisting of at least one amino acid
sequence and/or Nanobody.RTM. with SEQ ID NO: 5, in which following
amino acid residues have been mutated: [2718] Glu1Asp; [2719]
Glu1Asp, Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu [2720] Glu1Asp, Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu; [2721] Glu1Asp, Gly78Leu, Ala83Arg,
Asp85Glu and Arg105Gln; [2722] Glu1Asp, Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54Asp; [2723] Glu1Asp, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu
and Gly54Asp; [2724] Glu1Asp, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gly54Asp; [2725] Glu1Asp and Gly54Asp; [2726]
Glu1Asp, Ala14Pro, Ser1.9Arg, Ile20Leu and Gln108Leu; [2727]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and Ala83Arg;
[2728] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Asp85Glu; [2729] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu
and Arg105Gln; [2730] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg and Asp85Glu; [2731] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln; [2732]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and
Arg105Gln; or [2733] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg, Asp85Glu and Arg105Gln. [2734] Aspect E-155:
Trivalent polypeptide according to aspect E-7, that comprises or
essentially consists of three amino acid sequences according to any
of aspects A-1 to A-29, C-1 to C-38 and W-1 to W-38 and/or
Nanobodies.RTM. according to any of aspects B-1 to B-18, D-1 to
D-38 and X-1 to X-38. [2735] Aspect E-156: Trivalent polypeptide
according to aspect E-155, wherein said three amino acid sequences
and/or Nanobodies.RTM. are identical. [2736] Aspect E-157:
Trivalent polypeptide according to any of aspects E-155 or E-156,
comprising or essentially consisting of three amino acid sequences
and/or Nanobodies.RTM. that comprise at least a stretch of amino
acid residues chosen from the following: [2737] a) SEQ ID NO: 102;
[2738] b) a stretch of amino acid residues that has no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with SEQ ID NO: 102, provided that: [2739] i) said
stretch of amino acid residues has an Aspartic acid (Asp, D) at
position 6 (position 54 determined according to Kabat numbering);
and [2740] ii) the amino acid sequence comprising said stretch of
amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference. [2741] Aspect E-158:
Trivalent polypeptide according to any of aspects E-155 or E-156,
comprising or essentially consisting of three amino acid sequences
and/or Nanobodies.RTM. that comprise at least a stretch of amino
acid residues chosen from the following:
[2742] a) SEQ ID NO: 102; [2743] b) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
102, provided that: [2744] i) said stretch of amino acid residues
has an Aspartic acid (Asp, D) at position 6 (position 54 determined
according to Kabat numbering); and [2745] ii) the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [2746] and at least one stretch is chosen from: [2747]
c) SEQ ID NO: 98; [2748] d) a stretch of amino acid residues that
has no more than 3, preferably no more than 2, more preferably no
more than 1 amino acid difference with SEQ ID NO: 98, provided that
the amino acid sequence comprising said stretch of amino acid
residues binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence comprising said stretch
of amino acid residues has the same, about the same, or a higher
potency (as defined herein) compared to the amino acid sequence
comprising said stretch of amino acid residues without the 3, 2 or
1 amino acid difference; [2749] e) SEQ ID NO: 121; and [2750] f) a
stretch of amino acid residues that has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with SEQ ID NO: 121, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference. [2751] such that the stretch of amino acid residues
that corresponds to one of a) and b) should always be present in
the amino acid sequence of the invention and such that the second
stretch of amino acid residues is chosen from one of c), d), e) and
f). [2752] Aspect E-159: Trivalent polypeptide according to any of
aspects E-155 or E-156, comprising or essentially consisting of
three amino acid sequences and/or Nanobodies.RTM. that comprise at
least a stretch of amino acid residues chosen from the following:
[2753] a) SEQ ID NO: 98; and [2754] b) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO: 98,
provided that the amino acid sequence comprising said stretch of
amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference; [2755] a second
stretch of amino acid residues chosen from the group consisting of:
[2756] c) SEQ ID NO: 102; and [2757] d) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
102, provided that: [2758] i) said stretch of amino acid residues
has an Aspartic acid (Asp, D) at position 6 (position 54 determined
according to Kabat numbering); and [2759] ii) the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino add sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference; [2760] and a third stretch of amino acid residues
chosen from the group consisting of: [2761] e) SEQ ID NO: 121; and
[2762] f) a stretch of amino acid residues that has no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with SEQ ID NO: 121, provided that the amino acid
sequence comprising said stretch of amino add residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference. [2763] Aspect E-160: Trivalent polypeptide according to
any of aspects E-155 or E-156, comprising or essentially consisting
of three amino acid sequences and/or Nanobodies.RTM. that comprise
at least SEQ ID NO: 102. [2764] Aspect E-161: Trivalent polypeptide
according to any of aspects E-155 or E-156, comprising or
essentially consisting of three amino acid sequences and/or
Nanobodies.RTM. that comprise at least SEQ ID NO: 102 and at least
one stretch of amino acid residues (CDR sequence) chosen from:
[2765] a) SEQ ID NO: 98; [2766] b) a stretch of amino acid residues
that has no more than 3, preferably no more than 2, more preferably
no more than 1 amino acid difference with SEQ ID NO: 98, provided
that the amino acid sequence comprising said stretch of amino acid
residues binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence comprising said stretch
of amino acid residues has the same, about the same, or a higher
potency (as defined herein) compared to the amino acid sequence
comprising said stretch of amino acid residues without the 3, 2 or
1 amino acid difference; [2767] c) SEQ ID NO: 121; and [2768] d) a
stretch of amino acid residues that has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with SEQ ID NO: 121, provided that the amino acid
sequence comprising said stretch of amino acid residues binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence comprising said stretch of amino
acid residues has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence comprising said
stretch of amino acid residues without the 3, 2 or 1 amino acid
difference. [2769] Aspect E-162: Trivalent polypeptide according to
any of aspects E-155 or E-156, comprising or essentially consisting
of three amino acid sequences and/or Nanobodies.RTM. that comprises
at least SEQ ID NO: 102 and a CDR1 sequence chosen from: [2770] a)
SEQ ID NO: 98; and [2771] b) a stretch of amino acid residues that
has no more than 3, preferably no more than 2, more preferably no
more than 1 amino acid difference with SEQ ID NO: 98, provided that
the amino acid sequence comprising said stretch of amino acid
residues binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence comprising said stretch
of amino acid residues has the same, about the same, or a higher
potency (as defined herein) compared to the amino acid sequence
comprising said stretch of amino acid residues without the 3, 2 or
1 amino acid difference; [2772] and a CDR3 sequence chosen from:
[2773] c) SEQ ID NO: 121; and [2774] d) a stretch of amino acid
residues that has no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with SEQ ID NO:
121, provided that the amino acid sequence comprising said stretch
of amino acid residues binds protein F of hRSV with the same, about
the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence
comprising said stretch of amino acid residues has the same, about
the same, or a higher potency (as defined herein) compared to the
amino acid sequence comprising said stretch of amino acid residues
without the 3, 2 or 1 amino acid difference. [2775] Aspect E-163:
Trivalent polypeptide according to any of aspects E-155 or E-156,
comprising or essentially consisting of three amino acid sequences
and/or Nanobodies.RTM. that comprise at least SEQ ID NO: 102 and at
least one stretch of amino acid residues (CDR sequence) chosen from
SEQ ID NO: 98 and SEQ ID NO: 121. [2776] Aspect E-164: Trivalent
polypeptide according to any of aspects E-155 or E-156, comprising
or essentially consisting of three amino acid sequences and/or
Nanobodies.RTM. that comprise SEQ ID NO: 98, SEQ ID NO: 102 and SEQ
ID NO: 121. [2777] Aspect E-165: Trivalent polypeptide according to
any of aspect E-157 to E-164, wherein said at least three amino
acid sequences and/or Nanobodies.RTM. are identical. [2778] Aspect
E-166: Trivalent polypeptide according to any of aspects E-155 or
E-156, comprising or essentially consisting of three amino acid
sequences and/or Nanobodies.RTM. chosen from the following: [2779]
a) SEQ ID NO's: 60-76; [2780] b) amino acid sequences that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 60-76,
provided that: [2781] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105 (said position determined according to
Kabat numbering); and [2782] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference. [2783] Aspect
E-167: Trivalent polypeptide according to aspect E-166, wherein
said three amino acid sequences and/or Nanobodies.RTM. are
identical. [2784] Aspect E-168: Trivalent polypeptide according to
aspect E-167, that comprises or essentially consists of three
identical amino acid sequences and/or Nanobodies.RTM. chosen from
one of SEQ ID NO's: 60-76. [2785] Aspect E-169: Trivalent
polypeptide according to any of aspects E-155 or E-156, comprising
or essentially consisting of three amino acid sequences and/or
Nanobodies.RTM. chosen from the following: [2786] a) SEQ ID NO's:
62, 65, 67, 68, 75 and 76; [2787] b) amino acid sequences that have
no more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 62, 65, 67,
68, 75 and 76, provided that: [2788] i) the amino acid sequence has
a Glutamine (Gln, Q) at position 105, a Leucine (Leu, L) at
position 78 and/or an Arginine (Arg, R) at position 83 (said
positions determined according to Kabat numbering); and [2789] ii)
the amino acid sequence binds protein F of hRSV with the same,
about the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence without the 3, 2 or 1 amino
acid difference. [2790] Aspect E-170: Trivalent polypeptide
according to aspect E-169, comprising or essentially consisting of
three amino acid sequences and/or Nanobodies.RTM. chosen from the
following: [2791] a) SEQ ID NO's: 62, 65, 67, 68, 75 and 76; [2792]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76, provided that:
[2793] i) the amino acid sequence has a Glutamine (Gln, Q) at
position 105, a Leucine (Leu, L) at position 78 and an Arginine
(Arg, R) at position 83 (said positions determined according to
Kabat numbering); and [2794] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference. [2795] Aspect
E-171: Trivalent polypeptide according to any of aspects B-169 or
E-170, wherein said three amino acid sequences and/or
Nanobodies.RTM. are identical. [2796] Aspect E-172: Trivalent
polypeptide according to aspect S-171, that comprises or
essentially consists of three identical amino acid sequences and/or
Nanobodies.RTM. chosen from one of SEQ ID NO's: 62, 65, 67, 68, 75
and 76. [2797] Aspect E-173; Trivalent polypeptide according to any
of aspects E-155 or E-156, comprising or essentially consisting of
three amino acid sequences and/or Nanobodies.RTM. chosen from the
following: [2798] a) SEQ ID NO's: 65 and 76; [2799] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 65 and 76, provided that: [2800] i) the amino acid sequence
has an Aspartic acid (Asp, D) at position 54, a Glutamine (Gln, Q)
at position 105, a Leucine (Leu, L) at position 78 and/or an
Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [2801] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference. [2802]
Aspect E-174: Trivalent polypeptide according to aspect E-173,
comprising or essentially consisting of three amino acid sequences
and/or Nanobodies.RTM. chosen from the following: [2803] a) SEQ ID
NO's: 65 and 76; [2804] b) amino acid sequences that have no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with one of SEQ ID NO's: 65 and 76, provided
that: [2805] i) the amino acid sequence has an Aspartic acid (Asp,
D) at position 54, a Glutamine (Gln, Q) at position 105, a Leucine
(Leu, L) at position 78 and an Arginine (Arg, R) at position 83
(said positions determined according to Kabat numbering); and
[2806] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference.
[2807] Aspect E-175: Trivalent polypeptide according to any of
aspects E-173 or E-174, wherein said three amino acid sequences
and/or Nanobodies.RTM. are identical. [2808] Aspect E-176:
Trivalent polypeptide according to aspect E-175, that comprises or
essentially consists of three identical amino acid sequences and/or
Nanobodies.RTM. chosen from SEQ ID NO's: 65 and 76. [2809] Aspect
E-177: Trivalent polypeptide according to any of aspects E-155 or
E-156, comprising or essentially consisting of three amino acid
sequences and/or Nanobodies.RTM. chosen from the following: [2810]
a) SEQ ID NO's: 146-153; [2811] b) amino acid sequences that have
no more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 146-153,
provided that: [2812] i) the amino acid sequence has a Proline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and Leucine (Leu, L) at position 108 (said
positions determined according to Kabat numbering); and [2813] ii)
the amino acid sequence binds protein F of hRSV with the same,
about the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence without the 3, 2 or 1 amino
acid difference. [2814] Aspect E-178: Trivalent polypeptide
according to aspect E-177, wherein said three amino acid sequences
and/or Nanobodies.RTM. are identical. [2815] Aspect E-179:
Trivalent polypeptide according to aspect E-178, that comprises or
essentially consists of three identical amino acid sequences and/or
Nanobodies.RTM. chosen from one of SEQ ID NO's: 146-153. [2816]
Aspect E-180: Trivalent polypeptide according to any of aspects
E-155 or E-156, comprising or essentially consisting of three acid
sequences and/or Nanobodies.RTM. chosen from the following: [2817]
a) SEQ ID NO's: 146-149 and 151-153; [2818] b) amino add sequences
that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 146-149 and 151-153, provided that: [2819] i) the amino acid
sequence has a Proline (Pro, P) at position 14, Arginine (Arg, R)
at position 19, Leucine (Leu, L) at position 20 and Leucine (Leu,
L) at position 108 and in addition Arginine (Arg, R) at position
83, Glutamic acid (Glu, E) at position 85 and/or Glutamine (Gln, Q)
at position 105 (said positions determined according to Kabat
numbering); and [2820] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference. [2821] Aspect E-181: Trivalent
polypeptide according to aspect E-180, comprising or essentially
consisting of three amino acid sequences and/or Nanobodies.RTM.
chosen from the following: [2822] a) SEQ ID NO's: 146-149 and
151-153; [2823] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 146-149 and 151-153,
provided that: [2824] i) the amino acid sequence has a Proline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and Leucine (Leu, L) at position 108 and in
addition Arginine (Arg, R) at position 83, Glutamic acid (Glu, E)
at position 85 and/or Glutamine (Gln, Q) at position 105 so that
when the amino acid sequence has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with:
[2825] SEQ ID NO: 146, the amino acid sequence preferably has
Glutamine (Gln, Q) at position 105; [2826] SEQ ID NO: 147, the
amino acid sequence preferably has Arginine (Arg, R) at position 83
and Glutamine (Gln, Q) at position 105; [2827] SEQ ID NO: 148, the
amino acid sequence preferably has Glutamic acid (Glu, E) at
position 85 and Glutamine (Gln, Q) at position 105; [2828] SEQ ID
NO: 149, the amino acid sequence preferably has Arginine (Arg, R)
at position 83, Glutamic acid (Glu, E) at position 85 and Glutamine
(Gln, Q) at position 105; [2829] SEQ ID NO: 151, the amino acid
sequence preferably has Arginine (Arg, R) at position 83; [2830]
SEQ ID NO: 152, the amino acid sequence preferably has Glutamic
acid (Glu, E) at position 85; [2831] SEQ ID NO: 153, the amino acid
sequence preferably has Arginine (Arg, R) at position 83 and
Glutamic acid (Glu, E) at position 85; [2832] (said positions
determined according to Kabat numbering); and [2833] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference. [2834] Aspect E-182: Trivalent polypeptide according to
any of aspects E-180 or E-181, wherein said three amino acid
sequences and/or Nanobodies.RTM. are identical. [2835] Aspect
E-183: Trivalent polypeptide according to aspect E-182, that
comprises or essentially consists of three identical amino acid
sequences and/or Nanobodies.RTM. chosen from one of SEQ ID NO's:
62, 65, 67, 68, 75, 76, 147, 149 and 153. [2836] Aspect E-184:
Trivalent polypeptide comprising or essentially consisting of three
amino acid sequences and/or Nanobodies.RTM. with SEQ ID NO: 5, in
which one or more (such as two, three, four, five, six, seven,
eight or nine, ten, eleven or twelve) amino acid residues have been
mutated selected from the following: Val5Leu, Ala14Pro, Ser19R,
Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp. [2837] Aspect E-185: Trivalent
polypeptide according to aspect E-184, comprising or essentially
consisting of three amino acid sequences and/or Nanobodies.RTM.
with SEQ ID NO: 5, in which following amino acid residues have been
mutated: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D.
[2838] Aspect E-186: Trivalent polypeptide according to aspect
E-184, comprising or essentially consisting of three amino acid
sequences and/or Nanobodies.RTM. with SEQ ID NO: 5, in which one or
more (such as two, three, four, five, six, seven or eight) amino
add residues have been mutated selected from the following: Ser19R,
Ile20Leu, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gly54D. [2839] Aspect E-187: Trivalent polypeptide according to
aspect E-184, comprising or essentially consisting of three amino
acid sequences and/or Nanobodies.RTM. with SEQ ID NO: 5, in which
one or more (such as two, three, four or five) amino acid residues
have been mutated selected from the following: Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gly54D. [2840] Aspect E-188: Trivalent
polypeptide according to aspect E-187, comprising or essentially
consisting of three amino acid sequences and/or Nanobodies.RTM.
with SEQ ID NO: 5, in which following amino acid residues have been
mutated: Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54D. [2841]
Aspect E-189: Trivalent polypeptide comprising or essentially
consisting of three amino acid sequences and/or Nanobodies.RTM.
with SEQ ID NO: 5, in which one or more (such as two, three or
four) amino acid residues have been mutated selected from the
following: Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu. [2842]
Aspect E-190: Trivalent polypeptide comprising or essentially
consisting of three amino acid sequences and/or Nanobodies.RTM.
with SEQ ID NO: 5, in which one or more (such as two, three, four,
five, six or seven) amino acid residues have been mutated selected
from the following: Ala14Pro, Ser19Arg, Ile20Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gln108Leu. [2843] Aspect E-191: Trivalent
polypeptide according to aspect E-184, comprising or essentially
consisting of three amino acid sequences and/or Nanobodies.RTM.
with SEQ ID NO: 5, in which following amino acid residues have been
mutated: [2844] Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gln108Leu; [2845] Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu; [2846] Gly78Leu, Ala83Arg, Asp85Glu and
Arg105Gln; [2847] Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp; [2848] Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp; [2849] Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gly54Asp; [2850] Gly54Asp; [2851]
Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu; [2852] Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu and Ala83Arg; [2853] Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu and Asp85Glu; [2854] Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu and Arg105Gln; [2855] Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Asp85Glu; [2856]
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln;
[2857] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and
Arg105Gln; or [2858] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu,
Ala83Arg, Asp85Glu and Arg105Gln. [2859] Aspect E-192: Trivalent
polypeptide comprising or essentially consisting of three amino
acid sequences and/or Nanobodies.RTM. with SEQ ID NO: 62. [2860]
Aspect E-193: Trivalent polypeptide comprising or essentially
consisting of three amino acid sequences and/or Nanobodies.RTM.
with SEQ ID NO: 65. [2861] Aspect E-194: Trivalent polypeptide
comprising or essentially consisting of three amino acid sequences
and/or Nanobodies.RTM. with SEQ ID NO: 76. [2862] Aspect E-195:
Trivalent polypeptide comprising or essentially consisting of three
amino acid sequences and/or Nanobodies.RTM. with SEQ ID NO: 75.
[2863] Aspect E-196: Trivalent polypeptide comprising or
essentially consisting of three amino acid sequences and/or
Nanobodies.RTM. with SEQ ID NO: 147. [2864] Aspect E-197: Trivalent
polypeptide comprising or essentially consisting of three amino
acid sequences and/or Nanobodies.RTM. with SEQ ID NO: 149. [2865]
Aspect E-198: Trivalent polypeptide comprising or essentially
consisting of three amino acid sequences and/or Nanobodies.RTM.
with SEQ ID NO: 153. [2866] Aspect E-199: Trivalent polypeptide
according to any of aspects E-155 or E-156, comprising or
essentially consisting of at least one amino acid sequence and/or
Nanobody.RTM. chosen from the following: [2867] a) SEQ ID NO's:
138-141 and 154-157; [2868] b) amino acid sequences that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 138-141 and
154-157, provided that: [2869] i) the amino acid sequence has a
Aspartic acid (Asp, D) at position 1 (said position determined
according to Kabat numbering); and [2870] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference. [2871]
Aspect E-200: Trivalent polypeptide according to aspect E-199, that
comprises or essentially consists of at least one amino acid
sequence and/or Nanobody.RTM. chosen from one of SEQ ID NO's:
138-141 and 154-157. [2872] Aspect E-201: Trivalent polypeptide
comprising or essentially consisting of at least one amino acid
sequence and/or Nanobody.RTM. with SEQ ID NO: 5, in which the
Glutamic acid at position 1 as been changed into Aspartic acid.
[2873] Aspect E-202: Trivalent polypeptide comprising or
essentially consisting of at least one amino acid sequence and/or
Nanobody.RTM. with SEQ ID NO: 62, in which the Glutamic acid at
position 1 as been changed into Aspartic acid. [2874] Aspect E-203:
Trivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence and/or Nanobody.RTM. with SEQ ID NO:
65, in which the Glutamic acid at position 1 as been changed into
Aspartic acid. [2875] Aspect E-204: Trivalent polypeptide
comprising or essentially consisting of at least one amino acid
sequence and/or Nanobody.RTM. with SEQ ID NO: 76, in which the
Glutamic acid at position 1 as been changed into Aspartic acid.
[2876] Aspect E-205: Trivalent polypeptide comprising or
essentially consisting of at least one amino acid sequence and/or
Nanobody.RTM. with SEQ ID NO: 75, in which the Glutamic acid at
position 1 as been changed into Aspartic acid. [2877] Aspect E-206:
Trivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence and/or Nanobody.RTM. with SEQ ID NO:
147, in which the Glutamic acid at position 1 as been changed into
Aspartic acid. [2878] Aspect E-207: Trivalent polypeptide
comprising or essentially consisting of at least one amino acid
sequence and/or Nanobody.RTM. with SEQ ID NO: 149, in which the
Glutamic acid at position 1 as been changed into Aspartic acid.
[2879] Aspect E-208: Trivalent polypeptide comprising or
essentially consisting of at least one amino acid sequence and/or
Nanobody.RTM. with SEQ ID NO: 153, in which the Glutamic acid at
position 1 as been changed into Aspartic acid. [2880] Aspect E-209:
Trivalent polypeptide comprising or essentially consisting of at
least one amino acid sequence and/or Nanobody.RTM. with SEQ ID NO:
5, in which one or more (such as two, three, four, five, six,
seven, eight or nine, ten, eleven or twelve) amino acid residues
have been mutated selected from the following: Val5Leu, Ala14Pro,
Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp, and wherein the Glutamic acid at
position 1 as been changed into Aspartic acid. [2881] Aspect E-210:
Trivalent polypeptide according to aspect E-209, comprising or
essentially consisting of at least one amino acid sequence and/or
Nanobody.RTM. with SEQ ID NO: 5, in which following amino acid
residues have been mutated: Val5Leu, Ala14Pro, Ser19R, Ile20Leu,
Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54D, and wherein the Glutamic acid at position 1
as been changed into Aspartic acid. [2882] Aspect E-211: Trivalent
polypeptide according to aspect E-209, comprising or essentially
consisting of at least one amino acid sequence and/or Nanobody.RTM.
with SEQ ID NO: 5, in which one or more (such as two, three, four,
five, six, seven or eight) amino acid residues have been mutated
selected from the following: Ser19R, Ile20Leu, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gly54D, and wherein the Glutamic
acid at position 1 as been changed into Aspartic acid. [2883]
Aspect E-212: Trivalent polypeptide according to aspect E-209,
comprising or essentially consisting of at least one amino acid
sequence and/or Nanobody.RTM. with SEQ ID NO: 5, in which one or
more (such as two, three, four or five) amino acid residues have
been mutated selected from the following: Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gly54D, and wherein the Glutamic acid at
position 1 as been changed into Aspartic acid.
[2884] Aspect E-213: Trivalent polypeptide according to aspect
E-212, comprising or essentially consisting of at least one amino
acid sequence and/or Nanobody.RTM. with SEQ ID NO: 5, in which
following amino acid residues have been mutated: Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gly54D, and wherein the Glutamic
acid at position 1 as been changed into Aspartic acid. [2885]
Aspect E-214: Trivalent polypeptide according to aspect E-209,
comprising or essentially consisting of at least one amino acid
sequence and/or Nanobody.RTM. with SEQ ID NO: 5, in which following
amino acid residues have been mutated: [2886] Glu1Asp; [2887]
Glu1Asp, Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu; [2888] Glu1Asp, Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu; [2889] Glu1Asp, Gly78Leu, Ala83Arg,
Asp85Glu and Arg105Gln; [2890] Glu1Asp, Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and
Gly54Asp; [2891] Glu1Asp, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu
and Gly54Asp; [2892] Glu1Asp, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gly54Asp; [2893] Glu1Asp and Gly54Asp; [2894]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu; [2895]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and Ala83Arg;
[2896] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Asp85Glu; [2897] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu
and Arg105Gln; [2898] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg and Asp85Glu; [2899] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln; [2900]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and
Arg105Gln; or [2901] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg, Asp85Glu and Arg105Gln. [2902] Aspect E-215:
Trivalent polypeptide that is directed against and/or specifically
binds protein F of hRSV, chosen from the following polypeptides:
[2903] a) SEQ ID NO's: 77-79 and 158; [2904] b) polypeptides that
have no more than 3, preferably no more than 2, more preferably no
more than 1 amino acid difference with one of SEQ ID NO's: 77-79
and 158, provided that: [2905] i) the amino acid sequences or
Nanobodies.RTM. encompassed in said polypeptide have a Glutamine
(Gln, Q) at position 105, a Leucine (Leu, L) at position 78, an
Arginine (Arg, R) at position 83 and/or a Glutamic acid (Glu, E) at
position 85 (said positions determined according to Kabat
numbering); and [2906] ii) the polypeptide binds protein F of hRSV
with the same, about the same, or a higher affinity (said affinity
as measured by surface plasmon resonance) and/or the polypeptide
has the same, about the same, or a higher potency (as defined
herein) compared to the polypeptide without the 3, 2 or 1 amino
acid difference. [2907] Aspect E-215: Trivalent polypeptide
according to aspect E-215, chosen from the following polypeptides:
[2908] a) SEQ ID NO's: 77-79 and 158; [2909] b) polypeptides that
have no more than 3, preferably no more than 2, more preferably no
more than 1 amino acid difference with one of SEQ ID NO's: 77-79
and 158, provided that: [2910] i) the amino acid sequence or
Nanobody.RTM. encompassed in said polypeptide has a Glutamine (Gln,
Q) at position 105, a Leucine (Leu, L) at position 78, an Arginine
(Arg, R) at position 83 and a Glutamic acid (Glu, E) at position 85
(said positions determined according to Kabat numbering); and
[2911] ii) the polypeptide binds protein F of hRSV with the same,
about the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the polypeptide has the same,
about the same, or a higher potency (as defined herein) compared to
the polypeptide without the 3, 2 or 1 amino acid difference. [2912]
Aspect E-217: Trivalent polypeptide that is directed against and/or
specifically binds protein F of hRSV, chosen from the following
polypeptides: [2913] a) SEQ ID NO: 78 and 79; [2914] b)
polypeptides that have no more than 3, preferably no more than 2,
more preferably no more than 1 amino acid difference with one of
SEQ ID NO's: 78 and 79, provided that: [2915] i) the amino acid
sequence or Nanobody.RTM. encompassed in said polypeptide has an
Aspartic acid (Asp, D) at position 54, a Glutamine (Gln, Q) at
position 105, a Leucine (Leu, L) at position 78, an Arginine (Arg,
R) at position 83 and/or a Glutamic acid (Glu, E) at position 85
(said positions determined according to Kabat numbering); and
[2916] ii) the polypeptide binds protein F of hRSV with the same,
about the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the polypeptide has the same,
about the same, or a higher potency (as defined herein) compared to
the polypeptide without the 3, 2 or I amino acid difference. [2917]
Aspect E-218: Trivalent polypeptide according to aspect E-217,
chosen from the following polypeptides: [2918] a) SEQ ID NO: 78 and
79; or b) polypeptides that have no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with
one of SEQ ID NO's: 78 and 79, provided that: [2919] i) the amino
acid sequence or Nanobody.RTM. encompassed in said polypeptide has
an Aspartic acid (Asp, D) at position 54, a Glutamine (Gln, Q) at
position 105, a Leucine (Leu, L) at position 78, an Arginine (Arg,
R) at position 83 and a Glutamic add (Glu, E) at position 85 (said
positions determined according to Kabat numbering); and [2920] ii)
the polypeptide binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the polypeptide has the same, about the
same, or a higher potency (as defined herein) compared to the
polypeptide without the 3, 2 or 1 amino acid difference. [2921]
Aspect E-219: Trivalent polypeptide that is directed against and/or
specifically binds protein F of hRSV, chosen from the following
polypeptides: [2922] a) SEQ ID NO's: 159-161; [2923] b)
polypeptides that have no more than 3, preferably no more than 2,
more preferably no more than 1 amino acid difference with one of
SEQ ID NO's: 159-161, provided that: [2924] i) the amino acid
sequence or Nanobody.RTM. encompassed in said polypeptide has a
Praline (Pro, P) at position 14, Arginine (Arg, R) at position 19,
Leucine (Leu, L) at position 20 and Leucine (Leu, L) at position
108 (said positions determined according to Kabat numbering); and
[2925] ii) the polypeptide binds protein F of hRSV with the same,
about the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the polypeptide has the same,
about the same, or a higher potency (as defined herein) compared to
the polypeptide without the 3, 2 or 1 amino acid difference. [2926]
Aspect E-220: Trivalent polypeptide according to aspect E-219,
chosen from the following polypeptides: [2927] a) SEQ ID NO's:
159-161; [2928] b) polypeptides that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 159-161, provided that:
[2929] i) the amino acid sequence or Nanobody.RTM. encompassed in
said polypeptide has a Proline (Pro, P) at position 14, Arginine
(Arg, R) at position 19, Leucine (Leu, L) at position 20 and
Leucine (Leu, L) at position 108; and in addition Arginine (Arg, R)
at position 83, Glutamic acid (Glu, E) at position 85 and/or
Glutamine (Gln, Q) at position 105 (said positions determined
according to Kabat numbering); and [2930] ii) the polypeptide binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the polypeptide has the same, about the same, or a higher
potency (as defined herein) compared to the polypeptide without the
3, 2 or 1 amino acid difference. [2931] Aspect E-221: Trivalent
polypeptide according to any of aspects E-219 or E-220, chosen from
the following polypeptides: [2932] a) SEQ ID NO's: 159-161; [2933]
b) polypeptides that have no more than 3, preferably no more than
2, more preferably no more than 1 amino acid difference with one of
SEQ ID NO's: 159-161, provided that: [2934] i) the amino acid
sequence or Nanobody.RTM. encompassed in said polypeptide has a
Proline (Pro, P) at position 14, Arginine (Arg, R) at position 19,
Leucine (Leu, L) at position 20 and Leucine (Leu, L) at position
108; and in addition Arginine (Arg, R) at position 83, Glutamic
acid (Glu, E) at position 85 and/or Glutamine (Gln, 4) at position
105 so that when the polypeptide has no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with: [2935] SEQ ID NO: 159, the amino acid sequence or
Nanobody.RTM. encompassed in said polypeptide preferably has
Arginine (Arg, R) at position 83 and Glutamine (Gln, 4) at position
105; [2936] SEQ ID NO: 160, the amino acid sequence or
Nanobody.RTM. encompassed in said polypeptide preferably has
Arginine (Arg, R) at position 83, Glutamic acid (Glu, E) at
position 85 and Glutamine (Gln, Q) at position 105; [2937] SEQ ID
NO: 161, the amino acid sequence or Nanobody.RTM. encompassed in
said polypeptide preferably has Arginine (Arg, R) at position 83
and Glutamic acid (Glu, E) at position 85; [2938] (said positions
determined according to Kabat numbering); and [2939] ii) the
polypeptide binds protein F of hRSV with the same, about the same,
or a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the polypeptide has the same, about the same, or
a higher potency (as defined herein) compared to the polypeptide
without the 3, 2 or 1 amino acid difference. [2940] Aspect E-222:
Trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 53, in which in at least one (preferably in two, more
preferably in all three) Nanobody.RTM./Nanobodies.RTM. that form(s)
part of SEQ ID NO: 53, one or more (such as two, three, four, five,
six, seven, eight or nine, ten, eleven or twelve) amino acid
residues have been mutated selected from the following: Val5Leu,
Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp. [2941] Aspect E-223:
Trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 53, in which in at least one (preferably in two, more
preferably in all three) Nanobody.RTM./Nanobodies.RTM. that form(s)
part of SEQ ID NO: 53, following amino acid residues have been
mutated: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D.
[2942] Aspect E-224: Trivalent polypeptide comprising or
essentially consisting of SEQ ID NO: 53, in which in at least one
(preferably in two, more preferably in all three)
Nanobody.RTM./Nanobodies.RTM. that form(s) part of SEQ ID NO: 53,
one or more (such as two, three, four, five, six, seven or eight)
amino acid residues have been mutated selected from the following:
Ser19R, Ile20Leu, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln
and Gly54D. [2943] Aspect E-225: Trivalent polypeptide comprising
or essentially consisting of SEQ ID NO: 53, in which in at least
one (preferably in two, more preferably in all three)
Nanobody.RTM./Nanobodies.RTM. that form(s) part of SEQ ID NO: 53,
one or more (such as two, three, four or five) amino acid residues
have been mutated selected from the following: Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gly54D. [2944] Aspect E-226: Trivalent
polypeptide comprising or essentially consisting of SEQ ID NO: 53,
in which in at least one (preferably in two, more preferably in all
three) Nanobody.RTM./Nanobodies.RTM. that form(s) part of SEQ ID
NO: 53, following amino acid residues have been mutated: Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gly54D. [2945] Aspect E-227:
Trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 53, in which in at least one (preferably in two, more
preferably in all three) Nanobody.RTM./Nanobodies.RTM. that form(s)
part of SEQ ID NO: 53, one or more (such as two, three or four)
amino acid residues have been mutated selected from the following:
Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu. [2946] Aspect E-228:
Trivalent polypeptide comprising or essentially consisting of SEQ
ID NO: 53, in which in at least one (preferably in two, more
preferably in all three) Nanobody.RTM./Nanobodies.RTM. that form(s)
part of SEQ ID NO: 53, one or more (such as two, three, four, five,
six or seven) amino acid residues have been mutated selected from
the following: Ala14Pro, Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu. [2947] Aspect E-229: Trivalent polypeptide
comprising or essentially consisting of SEQ ID NO: 53, in which in
at least one (preferably in two, more preferably in all three)
Nanobody.RTM./Nanobodies.RTM. that form(s) part of SEQ ID NO: 53,
following amino acid residues have been mutated: [2948] Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu; [2949] Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu;
[2950] Gly78Leu, Ala83Arg, Asp85Glu and Arg105Gln; [2951] Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, [2952]
Gln108Leu and Gly54Asp; [2953] Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp; [2954] Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gly54Asp; [2955] Gly54Asp; [2956] Ala14Pro, Ser19Arg,
Ile20Leu and Gln108Leu; [2957] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Ala83Arg; [2958] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Asp85Glu; [2959] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Arg105Gln; [2960] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg and Asp85Glu; [2961] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln; [2962] Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and Arg105Gln; or [2963]
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu and
Arg105Gln. [2964] Aspect E-230: Trivalent polypeptide comprising or
essentially consist of SEQ ID ND: 77. [2965] Aspect E-231:
Trivalent polypeptide comprising or essentially consist of SEQ ID
NO: 78. [2966] Aspect E-232: Trivalent polypeptide comprising or
essentially consist of SEQ ID ND: 79. [2967] Aspect E-233:
Trivalent polypeptide comprising or essentially consist of one of
SEQ ID NO's: 159-161. [2968] Aspect E-234: Trivalent polypeptide
that is directed against and/or specifically binds protein F of
hRSV, chosen from the following polypeptides: [2969] a) SEQ ID
NO's: 142-145 and 162-165; [2970] b) polypeptides that have no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with one of SEQ ID NO's: 142-145 and 162-165,
provided that: [2971] i) the first amino add sequence or
Nanobody.RTM. encompassed in said polypeptide has an Aspartic acid
(Asp, D) at position 1; and [2972] ii) the polypeptide binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the polypeptide has the same, about the same, or a higher
potency (as defined herein) compared to the polypeptide without the
3, 2 or 1 amino acid difference.
[2973] Aspect E-235: Trivalent polypeptide comprising or
essentially consisting of SEQ ID NO: 53, in which the first
Glutamic acid has been changed into Aspartic acid. [2974] Aspect
E-236: Trivalent polypeptide comprising or essentially consisting
of SEQ ID NO: 77, in which the first Glutamic acid has been changed
into Aspartic acid. [2975] Aspect E-237: Trivalent polypeptide
comprising or essentially consisting of SEQ ID NO: 78, in which the
first Glutamic acid has been changed into Aspartic acid. [2976]
Aspect E-238: Trivalent polypeptide comprising or essentially
consisting of SEQ ID NO: 79, in which the first Glutamic acid has
been changed into Aspartic acid. [2977] Aspect E-239: Trivalent
polypeptide comprising or essentially consisting of SEQ ID NO: 158,
in which the first Glutamic acid has been changed into Aspartic
acid. [2978] Aspect E-240: Trivalent polypeptide comprising or
essentially consisting of SEQ ID NO: 159, in which the first
Glutamic acid has been changed into Aspartic acid. [2979] Aspect
E-241: Trivalent polypeptide comprising or essentially consisting
of SEQ ID NO: 160, in which the first Glutamic acid has been
changed into Aspartic acid. [2980] Aspect E-242: Trivalent
polypeptide comprising or essentially consisting of SEQ ID NO: 161,
in which the first Glutamic acid has been changed into Aspartic
acid. [2981] Aspect E-243: Trivalent polypeptide comprising or
essentially consisting of SEQ ID NO: 53, in which in at least one
(preferably in two, more preferably in all three)
Nanobody.RTM./Nanobodies.RTM. that form(s) part of SEQ ID NO: 53,
one or more (such as two, three, four, five, six, seven, eight or
nine, ten, eleven or twelve) amino acid residues have been mutated
selected from the following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu,
Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp, and wherein the first Glutamic acid has
been changed into Aspartic acid. [2982] Aspect E-244: Trivalent
polypeptide comprising or essentially consisting of SEQ ID NO: 53,
in which in at least one (preferably in two, more preferably in all
three) Nanobody.RTM./Nanobodies.RTM. that form(s) part of SEQ ID
NO: 53, following amino acid residues have been mutated: Val5Leu,
Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54D, and wherein the first
Glutamic acid has been changed into Aspartic acid. [2983] Aspect
E-245: Trivalent polypeptide comprising or essentially consisting
of SEQ ID NO: 53, in which in at least one (preferably in two, more
preferably in all three) Nanobody.RTM./Nanobodies.RTM. that form(s)
part of SEQ ID NO: 53, one or more (such as two, three, four, five,
six, seven or eight) amino acid residues have been mutated selected
from the following: Ser19R, Ile20Leu, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gly540, and wherein the first Glutamic acid
has been changed into Aspartic acid. [2984] Aspect E-246: Trivalent
polypeptide comprising or essentially consisting of SEQ ID NO: 53,
in which in at least one (preferably in two, more preferably in all
three) Nanobody.RTM./Nanobodies.RTM. that form(s) part of SEQ ID
NO: 53, one or more (such as two, three, four or five) amino acid
residues have been mutated selected from the following: Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gly54D, and wherein the first
Glutamic acid has been changed into Aspartic acid. [2985] Aspect
E-247: Trivalent polypeptide comprising or essentially consisting
of SEQ ID NO: 53, in which in at least one (preferably in two, more
preferably in all three) Nanobody.RTM./Nanobodies.RTM. that form(s)
part of SEQ ID NO: 53, following amino acid residues have been
mutated: Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54D, and
wherein the first Glutamic acid has been changed into Aspartic
acid. [2986] Aspect E-248: Trivalent polypeptide comprising or
essentially consisting of SEQ ID NO: 53, in which in at least one
(preferably in two, more preferably in all three)
Nanobody.RTM./Nanobodies.RTM. that form(s) part of SEQ ID NO: 53,
one or more (such as two, three or four) amino acid residues have
been mutated selected from the following: Ala14Pro, Ser19Arg,
Ile20Leu and Gln108Leu, and wherein the first Glutamic acid has
been changed into Aspartic acid. [2987] Aspect E-249: Trivalent
polypeptide comprising or essentially consisting of SEQ ID NO: 53,
in which in at least one (preferably in two, more preferably in all
three) Nanobody.RTM./Nanobodies.RTM. that form(s) part of SEQ ID
NO: 53, one or more (such as two, three, four, five, six or seven)
amino acid residues have been mutated selected from the following:
Ala14Pro, Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu, and wherein the first Glutamic acid has been changed
into Aspartic acid. [2988] Aspect E-250: Trivalent polypeptide
comprising or essentially consisting of SEQ ID NO: 53, in which in
at least one (preferably in two, more preferably in all three)
Nanobody.RTM./Nanobodies.RTM. that form(s) part of SEQ ID NO: 53,
following amino acid residues have been mutated: [2989] Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu; [2990] Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu;
[2991] Gly78Leu, Ala83Arg, Asp85Glu and Arg105Gln; [2992] Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp; [2993] Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp; [2994] Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gly54Asp; [2995] Gly54Asp; [2996] Ala14Pro, Ser19Arg,
Ile20Leu and Gln108Leu; [2997] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Ala83Arg; [2998] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Asp85Glu; [2999] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Arg105Gln; [3000] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg and Asp85Glu; [3001] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln; [3002] Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and Arg105Gln; or [3003]
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu and
Arg105Gln, [3004] and wherein the first Glutamic acid has been
changed into Aspartic acid. [3005] Aspect E-251: Trivalent
polypeptide comprising or essentially consist of SEQ ID NO: 142.
[3006] Aspect E-252: Trivalent polypeptide comprising or
essentially consist of SEQ ID NO: 143. [3007] Aspect E-253:
Trivalent polypeptide comprising or essentially consist of SEQ ID
NO: 144. [3008] Aspect E-254: Trivalent polypeptide comprising or
essentially consist of SEQ ID NO: 145. [3009] Aspect E-255:
Trivalent polypeptide comprising or essentially consist of one of
SEQ ID NO's: 162-165 [3010] Aspect E-256: Polypeptide according to
any of aspects E-1 to E-255, that can specifically bind to protein
F of hRSV with a dissociation constant (K.sub.D) of 100 nM to 0.1
nM or less, preferably 10 nM to 0.1 nM or less, more preferably 1
nM to 0.1 nM or less. [3011] Aspect E-257: Polypeptide according to
any of aspects E-1 to E-256, that can specifically bind to protein
F of hRSV with a k.sub.on-rate of between 10.sup.4 M.sup.-1s.sup.-1
to about 10.sup.7 M.sup.-1s.sup.-1, preferably between 10.sup.5
M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1, more preferably
about 10.sup.6 M.sup.-1s.sup.-1 or more. [3012] Aspect E-258:
Polypeptide according to any of aspects E-1 to E-257, that can
specifically bind to protein F of hRSV with a k.sub.off rate
between 10.sup.-2 s.sup.-1 (t.sub.1/22=0.69 s) and 10.sup.-4
s.sup.-1 (providing a near irreversible complex with a t.sub.1/2 of
multiple days), preferably between 10.sup.-3 s.sup.-1 and
10.sup.-4s.sup.-1, more preferably between 5.times.10.sup.-3
s.sup.-1 and 10.sup.-4 s.sup.-1, or lower. [3013] Aspect E-259:
Polypeptide y according to any of aspects E-1 to E-258, that can
neutralize hRSV (for example, as measured in a microneutralization
assay on hRSV Long (such as e.g. described in Example 6) with an
IC50 value between 10 pM and 1000 pM, preferably between 10 pM and
250 pM, more preferably between 50 pM and 200 pM or less. [3014]
Aspect E-260: Polypeptide according to any of aspects E-1 to E-259,
that can neutralize hRSV (for example, as measured in a
microneutralization assay on hRSV Long (such as e.g. described in
Example 6) with an IC50 value that is at least the same and
preferably better, at least ten times better, preferably twenty
times better, more preferably fifty times better, even more
preferably sixty, seventy, eighty or more times better compared to
the IC50 value obtained with Synagis.RTM.. [3015] Aspect E-261:
Polypeptide according to any of aspects E-1 to E-260, which is a
multispecific construct. [3016] Aspect F-1: Monovalent construct,
comprising or essentially consisting of one amino acid sequence
according to any of aspects A-1 to A-29, C-1 to C-38 and W-1 to
W-38 and/or one Nanobody.RTM. according to any of aspects B-1 to
B-18, D-1 to D-38 and X-1 to X-38. [3017] Aspect F-2: Monovalent
construct according to aspect F-1, in which said amino acid
sequence is chosen from the group consisting of domain antibodies,
amino acid sequences that are suitable for use as a domain
antibody, single domain antibodies, amino acid sequences that are
suitable for use as a single domain antibody, "dAb's", amino acid
sequences that are suitable for use as a dAb, or Nanobodies.RTM..
[3018] Aspect F-3: Monovalent construct, comprising or essentially
consisting of one Nanobody.RTM. according to any of aspects B-1 to
B-18, D-1 to D-38 and X-1 to X-38. [3019] Aspect F-4: Monovalent
construct, that is chosen from the group consisting of SEQ ID NO's:
76, SEQ ID NO's: 138-141 and SEQ ID NO's: 146-157. [3020] Aspect
F-5: Use of a monovalent construct according to any of aspects F-1
to F-4, in preparing a multivalent polypeptide according to any of
aspects F-1 to E-261. [3021] Aspect F-6: Use of a monovalent
construct according to aspect F-5, wherein the monovalent construct
is used as a binding domain or binding unit in preparing a
multivalent construct comprising two or more binding units. [3022]
Aspect F-7: Use of a monovalent construct according to any of
aspects F-5 or F-6, in preparing a multivalent polypeptide that
preferably exhibits intramolecular binding compared to
intermolecular binding. [3023] Aspect F-8: Use of a monovalent
construct according to any of aspects F-5 to F-7, as a binding
domain or binding unit in preparing a multivalent construct,
wherein the binding domains or binding units are linked via a
linker such that the multivalent polypeptide preferably exhibits
intramolecular binding compared to intermolecular binding and/or
the multivalent polypeptide can simultaneously bind all binding
site on protein F of hRSV. [3024] Aspect F-9: Use of a monovalent
construct according to any of aspects F-5 to F-8, wherein the
monovalent construct is chosen from the following: [3025] a) SEQ ID
NO's: 60-76; [3026] b) amino acid sequences that have no more than
3, preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 60-76, provided that:
[3027] i) the amino acid sequence has a Glutamine (Gln, Q) at
position 105 (said position determined according to Kabat
numbering); and [3028] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference, [3029] in preparing a multivalent
polypeptide. [3030] Aspect F-10: Use of a monovalent construct
according to aspect F-9, wherein the monovalent construct
essentially consists of one of SEQ ID NO's: 60-76. [3031] Aspect
F-11: Use of a monovalent construct according to any of aspects F-5
to F-8, wherein the monovalent construct is chosen from the
following: [3032] a) SEQ ID NO's: 62, 65, 67, 68, 75 and 76; [3033]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76, provided that:
[3034] i) the amino acid sequence has a Glutamine (Gln, Q) at
position 105, a Leucine (Leu, L) at position 78 and/or a Arginine
(Arg, R) at position 83 (said positions determined according to
Kabat numbering); and [3035] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference, [3036] in
preparing a multivalent polypeptide. [3037] Aspect F-12: Use of a
monovalent construct according to aspect F-11, wherein the
monovalent construct is chosen from the following: [3038] a) SEQ ID
NO's: 62, 65, 67, 68, 75 and 76; or [3039] b) amino acid sequences
that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 62, 65, 67, 68, 75 and 76, provided that: [3040] i) the amino
acid sequence has a Glutamine (Gln, Q) at position 105, a Leucine
(Leu, L) at position 78 and an Arginine (Arg, R) at position 83
(said positions determined according to Kabat numbering); and
[3041] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference, [3042] in preparing a multivalent
polypeptide. [3043] Aspect F-13: Use of a monovalent construct
according to aspect F-11 or F-12, wherein the monovalent
essentially consists of one of SEQ ID NO: 62, 65, 67, 68, 75 and
76. [3044] Aspect F-14: Use of a monovalent construct according to
any of aspects F-5 to F-8, wherein the monovalent construct is
chosen from the following: [3045] a) SEQ ID NO's: 65 and 76; [3046]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 65 and 76, provided that: [3047] i) the
amino acid sequence has an Aspartic add (Asp, D) at position 54, a
Glutamine (Gln, Q) at position 105, a Leucine (Leu, L) at position
78 and/or an Arginine (Arg, R) at position 83 (said positions
determined according to Kabat numbering); and [3048] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference, in preparing a multivalent polypeptide.
[3049] Aspect F-15: Use of a monovalent construct according aspect
F-14, wherein the monovalent construct is chosen from the
following: [3050] a) SEQ ID NO's: 65 and 76; [3051] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 65 and 76, provided that: [3052] i) the amino acid sequence
has an Aspartic acid (Asp, D) at position 54, a Glutamine (Gln, Q)
at position 105, a Leucine (Leu, L) at position 78 and an Arginine
(Arg, R) at position 83 (said positions determined according to
Kabat numbering); and [3053] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference, [3054] in
preparing a multivalent polypeptide. [3055] Aspect F-16: Use of a
monovalent construct essentially consisting of SEQ ID NO: 62 in
preparing a multivalent polypeptide. [3056] Aspect F-17: Use of a
monovalent construct essentially consisting of SEQ ID NO: 65 in
preparing a multivalent polypeptide. [3057] Aspect F-18: Use of a
monovalent construct essentially consisting of SEQ ID NO: 76 in
preparing a multivalent polypeptide. [3058] Aspect F-19: Use of a
monovalent construct according to any of aspects F-5 to F-8,
wherein the monovalent construct is chosen from the following:
[3059] a) SEQ ID NO's: 146-153; [3060] b) amino acid sequences that
have no more than 3, preferably no more than 2, more preferably no
more than 1 amino acid difference with one of SEQ ID NO's: 146-153,
provided that: [3061] i) the amino acid sequence has a Proline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and Leucine (Leu, L) at position 108 (said
positions determined according to Kabat numbering); and [3062] ii)
the amino acid sequence binds protein F of hRSV with the same,
about the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence without the 3, 2 or 1 amino
acid difference, [3063] in preparing a multivalent polypeptide.
[3064] Aspect F-20: Use of a monovalent construct according to
aspect F-19, wherein the monovalent construct essentially consists
of one of SEQ ID NO's: 146-153. [3065] Aspect F-21: Use of a
monovalent construct according to any of aspects F-5 to F-8,
wherein the monovalent construct is chosen from the following:
[3066] a) SEQ ID NO's: 146-149 and 151-153; [3067] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 146-149 and 151-153, provided that: [3068] i) the amino acid
sequence has a Proline (Pro, P) at position 14, Arginine (Arg, R)
at position 19, Leucine (Leu, L) at position 20 and Leucine (Leu,
L) at position 108; and in addition Arginine (Arg, R) at position
83, Glutamic acid (Glu, E) at position 85 and/or Glutamine (Gln, Q)
at position 105 (said positions determined according to Kabat
numbering); and [3069] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference, [3070] in preparing a multivalent
polypeptide. [3071] Aspect F-22: Use of a monovalent construct
according to aspect F-21, wherein the monovalent construct is
chosen from the following: [3072] a) SEQ ID NO's: 146-149 and
151-153; [3073] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 146-149 and 151-153,
provided that: [3074] i) the amino acid sequence has a Proline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and Leucine (Leu, L) at position 108 and in
addition Arginine (Arg, R) at position 83, Glutamic acid (Glu, E)
at position 85 and/or Glutamine (Gln, Q) at position 105 so that
when the amino acid sequence has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with:
[3075] SEQ ID NO: 146, the amino acid sequence preferably has
Glutamine (Gln, Q) at position 105; [3076] SEQ ID NO: 147, the
amino acid sequence preferably has Arginine (Arg, R) at position 83
and Glutamine (Gln, Q) at position 105; [3077] SEQ ID NO: 148, the
amino acid sequence preferably has Glutamic acid (Glu, E) at
position 85 and Glutamine (Gln, Q) at position 105; [3078] SEQ ID
NO: 149, the amino acid sequence preferably has Arginine (Arg, R)
at position 83, Glutamic acid (Glu, E) at position 85 and Glutamine
(Gln, Q) at position 105; [3079] SEQ ID NO: 151, the amino acid
sequence preferably has Arginine (Arg, R) at position 83; [3080]
SEQ ID NO: 152, the amino acid sequence preferably has Glutamic
acid (Glu, E) at position 85; [3081] SEQ ID NO: 153, the amino acid
sequence preferably has Arginine (Arg, R) at position 83 and
Glutamic acid (Glu, E) at position 85; [3082] (said positions
determined according to Kabat numbering); and [3083] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference, [3084] in preparing a multivalent polypeptide. [3085]
Aspect F-23: Use of a monovalent construct according to aspect F-21
or F-22, wherein the monovalent essentially consists of one of SEQ
ID NO: 146-149 and 151-153. [3086] Aspect F-24: Use of a monovalent
construct according to any of aspects F-5 to F-8, wherein the
monovalent construct essentially consists of SEQ ID NO: 5, in which
one or more (such as two, three, four, five, six, seven, eight or
nine, ten, eleven or twelve) amino acid residues have been mutated
selected from the following: Val5Leu, Ala14Pro, Ser19R, Ile20Leu,
Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp, in preparing a multivalent polypeptide.
[3087] Aspect F-25: Use of a monovalent construct according to
aspects F-24, wherein the monovalent construct essentially consists
of SEQ ID NO: 5, in which following amino acid residues have been
mutated: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D, in
preparing a multivalent polypeptide. [3088] Aspect F-26: Use of a
monovalent construct according to aspects F-24, wherein the
monovalent construct essentially consists of SEQ ID NO: 5, in which
one or more (such as two, three, four, five, six, seven or eight)
amino acid residues have been mutated selected from the following:
Ser19R, Ile20Leu, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln
and Gly54D, in preparing a multivalent polypeptide. [3089] Aspect
F-27: Use of a monovalent construct according to aspects F-24,
wherein the monovalent construct essentially consists of SEQ ID NO:
5, in which one or more (such as two, three, four or five) amino
acid residues have been mutated selected from the following:
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54D, in preparing a
multivalent polypeptide. [3090] Aspect F-28: Use of a monovalent
construct according to aspects F-27, wherein the monovalent
construct essentially consists of SEQ ID NO: 5, in which following
amino acid residues have been mutated: Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gly54D, in preparing a multivalent
polypeptide. [3091] Aspect F-29: Use of a monovalent construct
according to any of aspects F-5 to F-8, wherein the monovalent
construct essentially consists of SEQ ID NO: 5, in which one or
more (such as two, three or four) amino acid residues have been
mutated selected from the following: Ala14Pro, Ser19Arg, Ile20Leu
and Gln108Leu, in preparing a multivalent polypeptide. [3092]
Aspect F-30: Use of a monovalent construct according to any of
aspects F-5 to F-8, wherein the monovalent construct essentially
consists of SEQ ID NO: 5, in which one or more (such as two, three,
four, five, six or seven) amino acid residues have been mutated
selected from the following: Ala14Pro, Ser19Arg, Ile20Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu, in preparing a
multivalent polypeptide. [3093] Aspect F-31: Use of a monovalent
construct according to aspects F-24, wherein the monovalent
construct essentially consists of SEQ ID NO: 5, in which following
amino acid residues have been mutated: [3094] Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu;
[3095] Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu; [3096]
Gly78Leu, Ala83Arg, Asp85Glu and Arg105Gln; [3097] Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, [3098]
Gln108Leu and Gly54Asp; [3099] Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp; [3100] Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gly54Asp; [3101] Gly54Asp; [3102] Ala14Pro, Ser19Arg,
Ile20Leu and Gln108Leu; [3103] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Ala83Arg; [3104] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Asp85Glu; [3105] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Arg105Gln; [3106] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg and Asp85Glu; [3107] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln; [3108] Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and Arg105Gln; or [3109]
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu and
Arg105Gln, [3110] in preparing a multivalent polypeptide. [3111]
Aspect F-32: Use of a monovalent construct according to any of
aspects F-5 to F-8, wherein the monovalent construct is chosen from
the following: [3112] a) SEQ ID NO's; 138-141 and 154-157; [3113]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 138-141 and 154-457, provided that: [3114]
i) the amino acid sequence has a Aspartic acid (Gln, Q) at position
1 (said position determined according to Kabat numbering); and
[3115] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference, [3116] in preparing a multivalent
polypeptide. [3117] Aspect F-33: Use of a monovalent construct
according to aspect F-32, wherein the monovalent construct
essentially consists of one of SEQ ID NO's: 138-141 and 154-457.
[3118] Aspect F-34: Use of a monovalent construct according to any
of aspects F-5 to F-8, wherein the monovalent construct essentially
consists of SEQ ID NO: 5, in which the Glutamic acid at position 1
has been changed into Aspartic acid, in preparing a multivalent
polypeptide. [3119] Aspect F-35: Use of a monovalent construct
according to any of aspects F-5 to F-8, wherein the monovalent
construct essentially consists of SEQ ID NO: 62, in which the
Glutamic acid at position 1 has been changed into Aspartic acid, in
preparing a multivalent polypeptide. [3120] Aspect F-36: Use of a
monovalent construct according to any of aspects F-5 to F-8,
wherein the monovalent construct essentially consists of SEQ ID NO:
65, in which the Glutamic acid at position 1 has been changed into
Aspartic acid, in preparing a multivalent polypeptide. [3121]
Aspect F-37: Use of a monovalent construct according to any of
aspects F-5 to F-8, wherein the monovalent construct essentially
consists of SEQ ID NO: 76, in which the Glutamic acid at position 1
has been changed into Aspartic acid, in preparing a multivalent
polypeptide. [3122] Aspect F-38: Use of a monovalent construct
according to any of aspects F-5 to F-8, wherein the monovalent
construct essentially consists of SEQ ID NO: 75, in which the
Glutamic acid at position 1 has been changed into Aspartic acid, in
preparing a multivalent polypeptide. [3123] Aspect F-39: Use of a
monovalent construct according to any of aspects F-5 to F-8,
wherein the monovalent construct essentially consists of SEQ ID NO:
147, in which the Glutamic acid at position 1 has been changed into
Aspartic acid, in preparing a multivalent polypeptide. [3124]
Aspect F-40: Use of a monovalent construct according to any of
aspects F-5 to F-8, wherein the monovalent construct essentially
consists of SEQ ID NO: 149, in which the Glutamic acid at position
1 has been changed into Aspartic acid, in preparing a multivalent
polypeptide. [3125] Aspect F-41: Use of a monovalent construct
according to any of aspects F-5 to F-8, wherein the monovalent
construct essentially consists of SEQ ID NO: 153, in which the
Glutamic acid at position 1 has been changed into Aspartic acid, in
preparing a multivalent polypeptide. [3126] Aspect F-42: Use of a
monovalent construct according to any of aspects F-5 to F-8,
wherein the monovalent construct essentially consists of SEQ ID NO:
5, in which one or more (such as two, three, four, five, six,
seven, eight or nine, ten, eleven or twelve) amino acid residues
have been mutated selected from the following: Val5Leu, Ala14Pro,
Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp, and wherein the Glutamic acid at
position 1 has been changed into Aspartic acid, in preparing a
multivalent polypeptide. [3127] Aspect F-43: Use of a monovalent
construct according to aspects F-42, wherein the monovalent
construct essentially consists of SEQ ID NO: 5, in which following
amino acid residues have been mutated: Val5Leu, Ala14Pro, Ser19R,
Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54D, and wherein the Glutamic acid at
position 1 has been changed into Aspartic acid, in preparing a
multivalent polypeptide. [3128] Aspect F-44: Use of a monovalent
construct according to aspects F-42, wherein the monovalent
construct essentially consists of SEQ ID NO: 5, in which one or
more (such as two, three, four, five, six, seven or eight) amino
acid residues have been mutated selected from the following:
Ser19R, Ile20Leu, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln
and Gly54D, and wherein the Glutamic acid at position 1 has been
changed into Aspartic acid, in preparing a multivalent polypeptide.
[3129] Aspect F-45: Use of a monovalent construct according to
aspects F-42, wherein the monovalent construct essentially consists
of SEQ ID NO: 5, in which one or more (such as two, three, four, or
five) amino acid residues have been mutated selected from the
following: Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54D, and
wherein the Glutamic acid at position 1 has been changed into
Aspartic acid, in preparing a multivalent polypeptide.
[3130] Aspect F-46: Use of a monovalent construct according to
aspects P-42, wherein the monovalent construct essentially consists
of SEQ ID NO: 5, in which following amino acid residues have been
mutated: Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54D, and
wherein the Glutamic acid at position 1 has been changed into
Aspartic acid, in preparing a multivalent polypeptide. [3131]
Aspect F-47: Use of a monovalent construct according to any of
aspects F-5 to F-8, wherein the monovalent construct essentially
consists of SEQ ID NO: 5, in which one or more (such as two, three
or four) amino acid residues have been mutated selected from the
following: Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu, and wherein
the Glutamic acid at position 1 has been changed into Aspartic
acid, in preparing a multivalent polypeptide. [3132] Aspect F-48:
Use of a monovalent construct according to any of aspects F-5 to
F-8, wherein the monovalent construct essentially consists of SEQ
ID NO: 5, in which one or more (such as two, three, four, five,
six, seven, eight or nine, ten, eleven or twelve) amino acid
residues have been mutated selected from the following: Ala14Pro,
Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu,
and wherein the Glutamic acid at position 1 has been changed into
Aspartic acid, in preparing a multivalent polypeptide. [3133]
Aspect F-49: Use of a monovalent construct according to aspects
F-42, wherein the monovalent construct essentially consists of SEQ
ID NO: 5, in which following amino acid residues have been mutated:
[3134] Glu1Asp; [3135] Glu1Asp, Val5Leu, Ala14Pro, Glu44Gly,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu; [3136]
Glu1Asp, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu; [3137]
Glu1Asp, Gly78Leu, Ala83Arg, Asp85Glu and Arg105Gln; [3138]
Glu1Asp, Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp; [3139] Glu1Asp, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp; [3140] Glu1Asp,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54Asp; [3141]
Glu1Asp and Gly54Asp; [3142] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu
and Gln108Leu; Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and
Ala83Arg; [3143] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu
and Asp85Glu; [3144] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Arg105Gln; [3145] Glu1Asp, Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg and Asp85Glu; [3146] Glu1Asp,
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln;
[3147] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu
and Arg105Gln; or [3148] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg, Asp85Glu and [3149] Arg105Gln, [3150] in
preparing a multivalent construct. [3151] Aspect F-50: Use of two
monovalent constructs according to any of aspects F-1 to F-4 in
preparing a bivalent polypeptide. [3152] Aspect F-51: Use of two
monovalent constructs according to aspect F-50, in preparing a
bivalent construct that preferably exhibits intramolecular binding
compared to intermolecular binding. [3153] Aspect F-52: Use of two
monovalent constructs according to any of aspects F-50 to F-51, as
a binding domain or binding unit in preparing a bivalent
polypeptide, wherein the binding domains, or binding units are
linked via a linker such that the bivalent polypeptide preferably
exhibits intramolecular binding compared to intermolecular binding
and/or the bivalent polypeptide can simultaneously bind both
binding site on protein F of hRSV. [3154] Aspect F-53: Use of two
monovalent constructs according to any of aspects F-50 to F-52,
wherein the monovalent constructs are chosen from the following:
[3155] a) SEQ ID NO's: 60-76; [3156] b) amino acid sequences that
have no more than 3, preferably no more than 2, more preferably no
more than 1 amino acid difference with one of SEQ ID NO's: 60-76,
provided that: [3157] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105 (said position determined according to
Kabat numbering); and [3158] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference, [3159] in
preparing a bivalent polypeptide. [3160] Aspect F-54: Use of two
monovalent constructs according to aspect F-53, wherein the two
monovalent constructs are identical. [3161] Aspect F-55: Use of two
monovalent constructs according to aspects F-53 or F-54, wherein
the two monovalent constructs essentially consist of one of SEQ ID
NO's: 60-76. [3162] Aspect F-56: Use of two monovalent constructs
according to any of aspects F-50 to F-52, wherein the monovalent
constructs are chosen from the following: [3163] a) SEQ ID NO's:
62, 65, 67, 68, 75 and 76; [3164] b) amino acid sequences that have
no more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 62, 65, 67,
68, 75 and 76, provided that: [3165] i) the amino acid sequence has
a Glutamine (Gln, Q) at position 105, a Leucine (Leu, L) at
position 78 and/or a Arginine (Arg, R) at position 83 (said
positions determined according to Kabat numbering); and [3166] ii)
the amino acid sequence binds protein F of hRSV with the same,
about the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence without the 3, 2 or 1 amino
acid difference, [3167] in preparing a bivalent polypeptide. [3168]
Aspect F-57: Use of two monovalent constructs according to aspect
F-56, wherein the monovalent constructs are chosen from the
following: [3169] a) SEQ ID NO's: 62, 65, 67, 68, 75 and 76; [3170]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76, provided that:
[3171] i) the amino add sequence has a Glutamine (Gln, Q) at
position 105, a Leucine (Leu, L) at position 78 and an Arginine
(Arg, R) at position 83 (said positions determined according to
Kabat numbering); and [3172] ii) the amino acid sequence binds
protein F of hRSV with the same, about the same, or a higher
affinity (said affinity as measured by surface plasmon resonance)
and/or the amino acid sequence has the same, about the same, or a
higher potency (as defined herein) compared to the amino acid
sequence without the 3, 2 or 1 amino acid difference, [3173] in
preparing a bivalent polypeptide. [3174] Aspect F-58: Use of two
monovalent constructs according to aspects P-56 or F-57, wherein
the two monovalent constructs are identical. [3175] Aspect F-59:
Use of two monovalent constructs according to aspect F-58, wherein
the two monovalent constructs essentially consist of one of SEQ ID
NO's: 62, 65, 67, 68, 75 and 76. [3176] Aspect F-60: Use of two
monovalent constructs according to any of aspects F-50 to F-52,
wherein the monovalent constructs are chosen from the following:
[3177] a) SEQ ID NO's: 65 and 76; [3178] b) amino acid sequences
that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 65 and 76, provided that: [3179] i) the amino acid sequence
has an Aspartic acid (Asp, D) at position 54, a Glutamine (Gln, Q)
at position 105, a Leucine (Leu, L) at position 78 and/or an
Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [3180] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference, [3181]
in preparing a bivalent polypeptide. [3182] Aspect F-61: Use of two
monovalent constructs according to aspect F-60, wherein the
monovalent constructs are chosen from the following: [3183] a) SEQ
ID NO's: 65 and 76; [3184] b) amino acid sequences that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 65 and 76,
provided that: [3185] i) the amino acid sequence has an Aspartic
acid (Asp, D) at position 54, a Glutamine (Gln, Q) at position 105,
a Leucine (Leu, L) at position 78 and an Arginine (Arg, R) at
position 83 (said positions determined according to Kabat
numbering); and [3186] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference, [3187] in preparing a bivalent
polypeptide. [3188] Aspect F-62: Use of two monovalent constructs
according to aspects F-60 or F-61, wherein the two monovalent
constructs are identical. [3189] Aspect F-63: Use of two monovalent
constructs essentially consisting of SEQ ID NO: 62 in preparing a
bivalent polypeptide. [3190] Aspect F-64: Use of two monovalent
constructs essentially consisting of SEQ ID NO: 65 in preparing a
bivalent polypeptide. [3191] Aspect F-65: Use of two monovalent
constructs essentially consisting of SEQ ID NO: 76 in preparing a
bivalent polypeptide. [3192] Aspect F-66: Use of two monovalent
constructs according to any of aspects F-50 to F-52, wherein the
monovalent constructs are chosen from the following: [3193] a) SEQ
ID NO's: 146-153; [3194] b) amino acid sequences that have no more
than 3, preferably no more than 2, more preferably no more than 1
amino acid difference with one of SEQ ID NO's: 146-153, provided
that: [3195] i) the amino acid sequence has a Proline (Pro, P) at
position 14, Arginine (Arg, R) at position 19, Leucine (Leu, 1) at
position 20 and Leucine (Leu, L) at position 108 (said positions
determined according to Kabat numbering); and [3196] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference, [3197] in preparing a bivalent polypeptide. [3198]
Aspect F-67: Use of two monovalent constructs according to aspect
F-66, wherein the two monovalent constructs are identical. [3199]
Aspect F-68: Use of two monovalent constructs according to aspects
F-66 or F-67, wherein the two monovalent constructs essentially
consist of one of SEQ ID NO's: 146-153. [3200] Aspect F-69: Use of
two monovalent constructs according to any of aspects F-50 to F-52,
wherein the monovalent constructs are chosen from the following:
[3201] a) SEQ ID NO's: 146-149 and 151-153; [3202] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 146-149 and 151-153, provided that: [3203] i) the amino acid
sequence has a Proline (Pro, P) at position 14, Arginine (Arg, R)
at position 19, Leucine (Leu, L) at position 20 and Leucine (Leu,
L) at position 108 and in addition Arginine (Arg, R) at position
83, Glutamic acid (Glu, E) at position 85 and/or Glutamine (Gln, Q)
at position 105 (said positions determined according to Kabat
numbering); and [3204] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference, [3205] in preparing a bivalent
polypeptide. [3206] Aspect F-70: Use of two monovalent constructs
according to aspect F-69, wherein the monovalent constructs are
chosen from the following: [3207] a) SEQ ID NO's: 146-149 and
151-153; [3208] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 146-149 and 151-153,
provided that: [3209] i) the amino acid sequence has a Proline
(Pro, P) at position 14, Arginine (Arg, R) at position 19, Leucine
(Leu, L) at position 20 and Leucine (Leu, L) at position 108 and in
addition Arginine (Arg, R) at position 83, Glutamic acid (Glu, E)
at position 85 and/or Glutamine (Gln, Q) at position 105 so that
when the amino acid sequence has no more than 3, preferably no more
than 2, more preferably no more than 1 amino acid difference with:
[3210] SEQ ID NO: 146, the amino acid sequence preferably has
Glutamine (Gln, Q) at position 105; [3211] SEQ ID NO: 147, the
amino acid sequence preferably has Arginine (Arg, R) at position 83
and Glutamine (Gln, Q) at position 105; [3212] SEQ ID NO: 148, the
amino acid sequence preferably has Glutamic acid (Glu, E) at
position 85 and Glutamine (Gln, Q) at position 105; [3213] SEQ ID
NO: 149, the amino acid sequence preferably has Arginine (Arg, R)
at position 83, Glutamic acid (Glu, E) at position 85 and Glutamine
(Gln, Q) at position 105; [3214] SEQ ID NO: 151, the amino acid
sequence preferably has Arginine (Arg, R) at position 83; [3215]
SEQ ID NO: 152, the amino acid sequence preferably has Glutamic
acid (Glu, E) at position 85; [3216] SEQ ID NO: 153, the amino acid
sequence preferably has Arginine (Arg, R) at position 83 and
Glutamic acid (Glu, E) at position 85; [3217] (said positions
determined according to Kabat numbering); and [3218] ii) the amino
acid sequence binds protein F of hRSV with the same, about the
same, or a higher affinity (said affinity as measured by surface
plasmon resonance) and/or the amino acid sequence has the same,
about the same, or a higher potency (as defined herein) compared to
the amino acid sequence without the 3, 2 or 1 amino acid
difference, [3219] in preparing a bivalent polypeptide. [3220]
Aspect F-71: Use of two monovalent constructs according to aspects
F-69 or F-70, wherein the two monovalent constructs are identical.
[3221] Aspect F-72: Use of two monovalent constructs according to
aspect F-71, wherein the two monovalent constructs essentially
consist of one of SEQ ID NO's: 146-149 and 151-153. [3222] Aspect
F-73: Use of two monovalent constructs according to any of aspects
F-50 to F-52, wherein the monovalent construct essentially consists
of SEQ ID NO: 5, in which one or more (such as two, three, four,
five, six, seven, eight or nine, ten, eleven or twelve) amino acid
residues have been mutated selected from the following: Val5Leu,
Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp, in preparing a
bivalent polypeptide.
[3223] Aspect F-74: Use of two monovalent constructs according to
aspects F-73, wherein the monovalent construct essentially consists
of SEQ ID NO: 5, in which following amino acid residues have been
mutated: Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54D, in
preparing a bivalent polypeptide. [3224] Aspect F-75: Use of two
monovalent constructs according to aspects F-73, wherein the
monovalent construct essentially consists of SEQ ID NO: 5, in which
one or more (such as two, three, four, five, six, seven or eight)
amino acid residues have been mutated selected from the following:
Ser19R, Ile20Leu, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln
and Gly54D, in preparing a bivalent polypeptide. [3225] Aspect
F-76: Use of two monovalent constructs according to aspects F-73,
wherein the monovalent construct essentially consists of SEQ ID NO:
5, in which one or more (such as two, three, four or five) amino
acid residues have been mutated selected from the following:
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54D, in preparing a
bivalent polypeptide. [3226] Aspect F-77: Use of two monovalent
constructs according to aspects F-76, wherein the monovalent
construct essentially consists of SEQ ID NO: 5, in which following
amino add residues have been mutated: Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gly54D, in preparing a bivalent polypeptide. [3227]
Aspect F-78: Use of two monovalent constructs according to any of
aspects F-50 to F-52, wherein the monovalent construct essentially
consists of SEQ ID NO: 5, in which one or more (such as two, three
or four) amino acid residues have been mutated selected from the
following: Ala14Pro, Ser19Arg, Ile20Leu and Gln108Leu, in preparing
a bivalent polypeptide. [3228] Aspect F-79: Use of two monovalent
constructs according to any of aspects F-50 to F-52, wherein the
monovalent construct essentially consists of SEQ ID NO: 5, in which
one or more (such as two, three, four, five, six or seven) amino
acid residues have been mutated selected from the following:
Ala14Pro, Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu, in preparing a bivalent polypeptide. [3229] Aspect F-80:
Use of two monovalent constructs according to aspects F-73, wherein
the monovalent construct essentially consists of SEQ ID NO: 5, in
which following amino acid residues have been mutated: [3230]
Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gln108Leu; [3231] Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu; [3232] Gly78Leu, Ala83Arg, Asp85Glu and Arg105Gln;
[3233] Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp; [3234] Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp; [3235] Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gly54Asp; [3236] Gly54Asp; [3237] Ala14Pro,
Ser19Arg, Ile20Leu and Gln108Leu; [3238] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Ala83Arg; [3239] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Asp85Glu; [3240] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Arg105Gln; [3241] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg and Asp85Glu; [3242] Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln; [3243]
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and Arg105Gln; or
[3244] Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu
and Arg105Gln, [3245] in preparing a bivalent polypeptide. [3246]
Aspect F-81: Use of a monovalent constructs according to any of
aspects F-50 to F-52, wherein the monovalent construct is chosen
from the following: [3247] a) SEQ ID NO's: 138-141 and 154-157;
[3248] b) amino acid sequences that have no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with one of SEQ ID NO's: 138-141 and 154-157, provided
that: [3249] i) the amino acid sequence has a Aspartic acid (Asp,
D) at position 1 (said position determined according to Kabat
numbering); and [3250] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference, [3251] in preparing a bivalent
polypeptide. [3252] Aspect F-82: Use of a monovalent constructs
according to aspect F-81, wherein the monovalent construct
essentially consist of one of SEQ ID NO's: 138-141 and 154-157.
[3253] Aspect F-83: Use of a monovalent constructs according to any
of aspects F-50 to F-52, wherein the monovalent construct
essentially consists of SEQ ID NO: 5, in which the Glutamic acid at
position 1 has been changed into Aspartic acid, in preparing a
bivalent polypeptide. [3254] Aspect F-84: Use of a monovalent
constructs according to any of aspects F-50 to F-52, wherein the
monovalent construct essentially consists of SEQ ID NO: 62, in
which the Glutamic acid at position 1 has been changed into
Aspartic acid, in preparing a bivalent polypeptide. [3255] Aspect
F-85: Use of a monovalent constructs according to any of aspects
F-50 to F-52, wherein the monovalent construct essentially consists
of SEQ ID NO: 65, in which the Glutamic acid at position 1 has been
changed into Aspartic acid, in preparing a bivalent polypeptide.
[3256] Aspect F-86: Use of a monovalent constructs according to any
of aspects F-50 to F-52, wherein the monovalent construct
essentially consists of SEQ ID NO: 76, in which the Glutamic acid
at position 1 has been changed into Aspartic acid, in preparing a
bivalent polypeptide. [3257] Aspect F-87: Use of a monovalent
constructs according to any of aspects F-50 to F-52, wherein the
monovalent construct essentially consists of SEQ ID NO: 75, in
which the Glutamic acid at position 1 has been changed into
Aspartic acid, in preparing a bivalent polypeptide. [3258] Aspect
F-88: Use of a monovalent constructs according to any of aspects
F-50 to F-52, wherein the monovalent construct essentially consists
of SEQ ID NO: 147, in which the Glutamic acid at position 1 has
been changed into Aspartic acid, in preparing a bivalent
polypeptide. [3259] Aspect F-89: Use of a monovalent constructs
according to any of aspects F-50 to F-52, wherein the monovalent
construct essentially consists of SEQ ID NO: 149, in which the
Glutamic acid at position 1 has been changed into Aspartic acid, in
preparing a bivalent polypeptide. [3260] Aspect F-90: Use of a
monovalent constructs according to any of aspects F-50 to F-52,
wherein the monovalent construct essentially consists of SEQ ID NO:
153, in which the Glutamic acid at position 1 has been changed into
Aspartic acid, in preparing a bivalent polypeptide. [3261] Aspect
F-91: Use of a monovalent constructs according to any of aspects
F-50 to F-52, wherein the monovalent construct essentially consists
of SEQ ID NO: 5, in which one or more (such as two, three, four,
five, six, seven, eight or nine, ten, eleven or twelve) amino acid
residues have been mutated selected from the following: Val5Leu,
Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp, and wherein the
Glutamic acid at position 1 has been changed into Aspartic acid, in
preparing a bivalent polypeptide. [3262] Aspect F-92: Use of a
monovalent constructs according to aspects P-91, wherein the
monovalent construct essentially consists of SEQ ID NO: 5, in which
following amino acid residues have been mutated: Val5Leu, Ala14Pro,
Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54D, and wherein the Glutamic acid at
position 1 has been changed into Aspartic acid, in preparing a
bivalent polypeptide. [3263] Aspect F-93: Use of a monovalent
constructs according to aspects F-91, wherein the monovalent
construct essentially consists of SEQ ID NO: 5, in which one or
more (such as two, three, four, five, six, seven or eight) amino
acid residues have been mutated selected from the following:
Ser19R, Ile20Leu, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln
and Gly54D, and wherein the Glutamic acid at position 1 has been
changed into Aspartic acid, in preparing a bivalent polypeptide.
[3264] Aspect F-94: Use of a monovalent constructs according to
aspects F-91, wherein the monovalent construct essentially consists
of SEQ ID NO: 5, in which one or more (such as two, three, four or
five) amino acid residues have been mutated selected from the
following: Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54D, and
wherein the Glutamic acid at position 1 has been changed into
Aspartic acid, in preparing a bivalent polypeptide. [3265] Aspect
F-95: Use of a monovalent constructs according to aspects F-94,
wherein the monovalent construct essentially consists of SEQ ID NO:
5, in which following amino acid residues have been mutated:
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54D, and wherein the
Glutamic acid at position 1 has been changed into Aspartic acid, in
preparing a bivalent polypeptide. [3266] Aspect F-96: Use of a
monovalent constructs according to any of aspects F-50 to F-52,
wherein the monovalent construct essentially consists of SEQ ID NO:
5, in which one or more (such as two, three or four) amino acid
residues have been mutated selected from the following: Ala14Pro,
Ser19Arg, Ile20Leu and Gln108Leu, and wherein the Glutamic acid at
position 1 has been changed into Aspartic acid, in preparing a
bivalent polypeptide. [3267] Aspect F-97: Use of a monovalent
constructs according to any of aspects F-50 to F-52, wherein the
monovalent construct essentially consists of SEQ ID NO: 5, in which
one or more (such as two, three, four, five, six or seven) amino
acid residues have been mutated selected from the following:
Ala14Pro, Ser19Arg, Ile20Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu, and wherein the Glutamic acid at position 1 has been
changed into Aspartic acid, in preparing a bivalent polypeptide.
[3268] Aspect F-98: Use of a monovalent constructs according to
aspects F-91, wherein the monovalent construct essentially consists
of SEQ ID NO: 5, in which following amino acid residues have been
mutated: [3269] Glu1Asp; [3270] Glu1Asp, Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, [3271] Arg105Gln and
Gln108Leu; [3272] Glu1Asp, Ala83Arg, Asp85Glu, Arg105Gln and
Gln108Leu; [3273] Glu1Asp, Gly78Leu, Ala83Arg, Asp85Glu and
Arg105Gln; [3274] Glu1Asp, Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp; [3275]
Glu1Asp, Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp;
[3276] Glu1Asp, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and
Gly54Asp; [3277] Glu1Asp and Gly54Asp; [3278] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu and Gln108Leu; [3279] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu and Ala83Arg; [3280] Glu1Asp,
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and Asp85Glu; [3281]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu and Arg105Gln;
[3282] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg
and Asp85Glu; [3283] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg and Arg105Gln; [3284] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu, Arg105Gln; or [3285]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg,
Asp85Glu and Arg105Gln, [3286] in preparing a bivalent polypeptide.
[3287] Aspect F-99: Use of three monovalent constructs according to
any of aspects F-1 to F-4 in preparing a trivalent polypeptide.
[3288] Aspect F-100: Use of three monovalent constructs according
to aspect F-99, in preparing a trivalent construct that preferably
exhibits intramolecular binding compared to intermolecular binding.
[3289] Aspect F-101: Use of three monovalent construct according to
any of aspects F-99 to F-100, as a binding domain or binding unit
in preparing a trivalent polypeptide, wherein the binding domains
or binding units are linked via a linker such that the trivalent
polypeptide preferably exhibits intramolecular binding compared to
intermolecular binding and/or the trivalent polypeptide can
simultaneously bind all three binding site on protein F of hRSV.
[3290] Aspect F-102: Use of three monovalent constructs according
to any of aspects F-99 to F-101, wherein the monovalent constructs
are chosen from the following: [3291] a) SEQ ID NO's: 60-76; [3292]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 60-76, provided that: [3293] i) the amino
acid sequence has a Glutamine (Gln, Q) at position 105 (said
position determined according to Kabat numbering); and [3294] ii)
the amino acid sequence binds protein F of hRSV with the same,
about the same, or a higher affinity (said affinity as measured by
surface plasmon resonance) and/or the amino acid sequence has the
same, about the same, or a higher potency (as defined herein)
compared to the amino acid sequence without the 3, 2 or 1 amino
acid difference, [3295] in preparing a trivalent polypeptide.
[3296] Aspect F-103: Use of three monovalent constructs according
to aspect F-102, wherein the three monovalent constructs are
identical. [3297] Aspect F-104: Use of three monovalent constructs
according to aspects F-102 or F-103, wherein the three monovalent
constructs essentially consist of one of SEQ ID NO's: 60-76. [3298]
Aspect F-105: Use of three monovalent constructs according to any
of aspects F-99 to F-101, wherein the monovalent constructs are
chosen from the following: [3299] a) SEQ ID NO's: 62, 65, 67, 68,
75 and 76; [3300] b) amino acid sequences that have no more than 3,
preferably no more than 2, more preferably no more than 1 amino
acid difference with one of SEQ ID NO's: 62, 65, 67, 68, 75 and 76,
provided that: [3301] i) the amino acid sequence has a Glutamine
(Gln, Q) at position 105, a Leucine (Leu, L) at position 78 and/or
a Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [3302] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference, [3303]
in preparing a trivalent polypeptide. [3304] Aspect F-106: Use of
three monovalent constructs according to aspect F-105, wherein the
monovalent constructs are chosen from the following: [3305] a) SEQ
ID NO's: 62, 65, 67, 68, 75 and 76; [3306] b) amino acid sequences
that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 62, 65, 67, 68, 75 and 76, provided that: [3307] i) the amino
acid sequence has a Glutamine (Gln, Q) at position 105, a Leucine
(Leu, L) at position 78 and an Arginine (Arg, R) at position 83
(said positions determined according to Kabat numbering); and
[3308] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference, [3309] in preparing a trivalent
polypeptide. [3310] Aspect F-107: Use of three monovalent
constructs according to aspects F-105 or F-106, wherein the three
monovalent constructs are identical. [3311] Aspect F-108: Use of
three monovalent constructs according to aspect F-107, wherein the
three monovalent constructs essentially consist of one of SEQ ID
NO's: 62, 65, 67, 68, 75 and 76. [3312] Aspect F-109: Use of three
monovalent constructs according to any of aspects F-99 to F-101,
wherein the monovalent constructs are chosen from the following:
[3313] a) SEQ ID NO's: 65 and 76; [3314] b) amino acid sequences
that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 65 and 76, provided that: [3315] i) the amino acid sequence
has an Aspartic acid (Asp, D) at position 54, a Glutamine (Gln, Q)
at position 105, a Leucine (Leu, L) at position 78 and/or an
Arginine (Arg, R) at position 83 (said positions determined
according to Kabat numbering); and [3316] ii) the amino acid
sequence binds protein F of hRSV with the same, about the same, or
a higher affinity (said affinity as measured by surface plasmon
resonance) and/or the amino acid sequence has the same, about the
same, or a higher potency (as defined herein) compared to the amino
acid sequence without the 3, 2 or 1 amino acid difference, [3317]
in preparing a trivalent polypeptide. [3318] Aspect F-110: Use of
three monovalent constructs according to aspect F-109, wherein the
monovalent constructs are chosen from the following: [3319] a) SEQ
ID NO's: 65 and 76; [3320] b) amino acid sequences that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 65 and 76,
provided that: [3321] i) the amino acid sequence has an Aspartic
acid (Asp, D) at position 54, a Glutamine (Gln, Q) at position 105,
a Leucine (Leu, L) at position 78 and an Arginine (Arg, R) at
position 83 (said positions determined according to Kabat
numbering); and [3322] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference, [3323] in preparing a trivalent
polypeptide. [3324] Aspect F-111: Use of three monovalent
constructs according to aspects F-109 or F-110, wherein the three
monovalent constructs are identical. [3325] Aspect F-112: Use of
three monovalent constructs essentially consisting of SEQ ID NO: 62
in preparing a trivalent polypeptide. [3326] Aspect F-113: Use of
three monovalent constructs essentially consisting of SEQ ID NO: 65
in preparing a trivalent polypeptide. [3327] Aspect F-114: Use of
three monovalent constructs essentially consisting of SEQ ID NO: 76
in preparing a trivalent polypeptide. [3328] Aspect F-115: Use of
three monovalent constructs according to any of aspects F-99 to
F-101, wherein the monovalent constructs are chosen from the
following: [3329] a) SEQ ID NO's: 146-153; [3330] b) amino acid
sequences that have no more than 3, preferably no more than 2, more
preferably no more than 1 amino acid difference with one of SEQ ID
NO's: 146-153, provided that: [3331] i) the amino acid sequence has
a Praline (Pro, P) at position 14, Arginine (Arg, R) at position
19, Leucine (Leu, L) at position 20 and Leucine (Leu, L) at
position 108 (said positions determined according to Kabat
numbering); and [3332] ii) the amino acid sequence binds protein F
of hRSV with the same, about the same, or a higher affinity (said
affinity as measured by surface plasmon resonance) and/or the amino
acid sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference, [3333] in preparing a trivalent
polypeptide. [3334] Aspect F-116: Use of three monovalent
constructs according to aspect F-115, wherein the three monovalent
constructs are identical. [3335] Aspect F-117: Use of three
monovalent constructs according to aspects F-115 or F-116, wherein
the three monovalent constructs essentially consist of one of SEQ
ID NO's: 146-153. [3336] Aspect F-118: Use of three monovalent
constructs according to any of aspects F-99 to F-101, wherein the
monovalent constructs are chosen from the following: [3337] a) SEQ
ID NO's: 146-14.9 and 151-153; [3338] b) amino acid sequences that
have no more than 3, preferably no more than 2, more preferably no
more than 1 amino acid difference with one of SEQ ID NO's: 146-149
and 151-153, provided that: [3339] i) the amino acid sequence has a
Proline (Pro, P) at position 14, Arginine (Arg, R) at position 19,
Leucine (Leu, L) at position 20 and Leucine (Leu, L) at position
108 and in addition Arginine (Arg, R) at position 83, Glutamic acid
(Glu, E) at position 85 and/or Glutamine (Gln, Q) at position 105
(said positions determined according to Kabat numbering); and
[3340] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference, [3341] in preparing a trivalent
polypeptide. [3342] Aspect F-119: Use of three monovalent
constructs according to aspect F-118, wherein the monovalent
constructs are chosen from the following: [3343] a) SEQ ID NO's:
146-149 and 151-153; [3344] b) amino acid sequences that have no
more than 3, preferably no more than 2, more preferably no more
than 1 amino acid difference with one of SEQ ID NO's: 146-149 and
151-153, provided that: [3345] i) the amino acid sequence has a
Praline (Pro, P) at position 14, Arginine (Arg, R) at position 19,
Leucine (Leu, L) at position 20 and Leucine (Leu, L) at position
108 and in addition Arginine (Arg, R) at position 83, Glutamic acid
(Glu, E) at position 85 and/or Glutamine (Gln, Q) at position 105
so that when the amino acid sequence has no more than 3, preferably
no more than 2, more preferably no more than 1 amino acid
difference with: [3346] SEQ ID NO: 146, the amino acid sequence
preferably has Glutamine (Gln, Q) at position 105; [3347] SEQ ID
NO: 147, the amino acid sequence preferably has Arginine (Arg, R)
at position 83 and Glutamine (Gln, Q) at position 105; [3348] SEQ
ID NO: 148, the amino add sequence preferably has Glutamic acid
(Glu, E) at position 85 and Glutamine (Gln, Q) at position 105;
[3349] SEQ ID NO: 149, the amino acid sequence preferably has
Arginine (Arg, R) at position 83, Glutamic acid (Glu, E) at
position 85 and Glutamine (Gln, Q) at position 105; [3350] SEQ ID
NO: 151, the amino acid sequence preferably has Arginine (Arg, R)
at position 83; [3351] SEQ ID NO: 152, the amino acid sequence
preferably has Glutamic acid (Glu, E) at position 85; [3352] SEQ ID
NO: 153, the amino acid sequence preferably has Arginine (Arg, R)
at position 83 and Glutamic acid (Glu, E) at position 85; [3353]
(said positions determined according to Kabat numbering); and
[3354] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference, [3355] in preparing a trivalent
polypeptide. [3356] Aspect F-120: Use of three monovalent
constructs according to aspects F-118 or F-119, wherein the three
monovalent constructs are identical. [3357] Aspect F-121: Use of
three monovalent constructs according to aspect F-120, wherein the
three monovalent constructs essentially consist of one of SEQ ID
NO's: 146-449 and 151-153. [3358] Aspect F-122: Use of three
monovalent constructs according to any of aspects F-99 to F-101,
wherein the monovalent construct essentially consists of SEQ ID NO:
5, in which one or more (such as two, three, four, five, six,
seven, eight or nine, ten, eleven or twelve) amino acid residues
have been mutated selected from the following: Val5Leu, Ala14Pro,
Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp, in preparing a trivalent
polypeptide. [3359] Aspect F-123: Use of three monovalent
constructs according to aspects F-122, wherein the monovalent
construct essentially consists of SEQ ID NO: 5, in which following
amino acid residues have been mutated: Val5Leu, Ala14Pro, Ser19R,
Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54D, in preparing a trivalent
polypeptide. [3360] Aspect F-124: Use of three monovalent
constructs according to aspects F-122, wherein the monovalent
construct essentially consists of SEQ ID NO: 5, in which one or
more (such as two, three, four, five, six, seven or eight) amino
acid residues have been mutated selected from the following:
Ser19R, Ile20Leu, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln
and Gly54D, in preparing a trivalent polypeptide. [3361] Aspect
F-125: Use of three monovalent constructs according to aspects
F-122, wherein the monovalent construct essentially consists of SEQ
ID NO: 5, in which one or more (such as two, three, four or five)
amino acid residues have been mutated selected from the following:
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54D, in preparing a
trivalent polypeptide. [3362] Aspect F-126: Use of three monovalent
constructs according to aspects F-125, wherein the monovalent
construct essentially consists of SEQ ID NO: 5, in which following
amino acid residues have been mutated: Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gly54D, in preparing a trivalent
polypeptide. [3363] Aspect F-127: Use of three monovalent
constructs according to any of aspects F-99 to F-101, wherein the
monovalent construct essentially consists of SEQ ID NO: 5, in which
one or more (such as two, three or four) amino acid residues have
been mutated selected from the following: Ala14Pro, Ser19Arg,
Ile20Leu and Gln108Leu, in preparing a trivalent polypeptide.
[3364] Aspect F-128: Use of three monovalent constructs according
to any of aspects F-99 to F-101, wherein the monovalent construct
essentially consists of SEQ ID NO: 5, in which one or more (such as
two, three, four, five, six or seven) amino acid residues have been
mutated selected from the following: Ala14Pro, Ser19Arg, Ile20Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu, in preparing a
trivalent polypeptide. [3365] Aspect F-129: Use of three monovalent
constructs according to aspects F-122, wherein the monovalent
construct essentially consists of SEQ ID NO: 5, in which following
amino acid residues have been mutated: [3366] Val5Leu, Ala14Pro,
Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu;
[3367] Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu; [3368]
Gly78Leu, Ala83Arg, Asp85Glu and Arg105Gln; [3369] Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp; [3370] Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp; [3371] Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln and Gly54Asp; [3372] Gly54Asp; [3373] Ala14Pro, Ser19Arg,
Ile20Leu and Gln108Leu; [3374] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Ala83Arg; [3375] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Asp85Glu; [3376] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Arg105Gln; [3377] Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu, Ala83Arg and Asp85Glu; [3378] Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg and Arg105Gln; [3379] Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Asp85Glu and Arg105Gln; [3380]
Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu and
Arg105Gln, [3381] in preparing a trivalent polypeptide. [3382]
Aspect F-130: Use of an amino acid sequence with SEQ ID NO: 62 in
preparing a trivalent polypeptide with SEQ ID NO: 77, wherein an
amino acid sequence with SEQ ID NO: 62 is linked to at least two
further amino acid sequences with SEQ ID NO: 62, via a 15GS linker.
[3383] Aspect F-131: Use of an amino acid sequence with SEQ ID NO:
65 in preparing a trivalent polypeptide with SEQ ID NO: 78, wherein
an amino acid sequence with SEQ ID NO: 65 is linked to at least two
further amino acid sequences with SEQ ID NO: 65, via a 15GS linker.
[3384] Aspect F-132: Use of an amino acid sequence with SEQ ID NO:
76 in preparing a trivalent polypeptide with SEQ ID NO: 79, wherein
an amino acid sequence with SEQ ID NO: 76 is linked to at least two
further amino acid sequences with SEQ ID NO: 76, via a 15GS linker.
[3385] Aspect F-133: Use of an amino acid sequence with SEQ ID NO:
75 in preparing a trivalent polypeptide with SEQ ID NO: 158,
wherein an amino acid sequence with SEQ ID NO: 75 is linked to at
least two further amino acid sequences with SEQ ID NO: 75, via a
15GS linker. [3386] Aspect F-134: Use of an amino acid sequence
with SEQ ID NO: 147 in preparing a trivalent polypeptide with SEQ
ID NO: 159, wherein an amino acid sequence with SEQ ID NO: 147 is
linked to at least two further amino acid sequences with SEQ ID NO:
147, via a 15GS linker. [3387] Aspect F-135: Use of an amino acid
sequence with SEQ ID NO: 149 in preparing a trivalent polypeptide
with SEQ ID NO: 160, wherein an amino acid sequence with SEQ ID NO:
149 is linked to at least two further amino acid sequences with SEQ
ID NO: 149, via a 15GS linker. [3388] Aspect F-136: Use of an amino
acid sequence with SEQ ID NO: 153 in preparing a trivalent
polypeptide with SEQ ID NO: 161, wherein an amino acid sequence
with SEQ ID NO: 153 is linked to at least two further amino acid
sequences with SEQ ID NO: 153, via a 15GS linker. [3389] Aspect
F-137: Use of a monovalent constructs according to any of aspects
F-99 to F-101, wherein the monovalent constructs are chosen from
the following: [3390] a) SEQ ID NO's: 138-141 and 154-157; [3391]
b) amino acid sequences that have no more than 3, preferably no
more than 2, more preferably no more than 1 amino acid difference
with one of SEQ ID NO's: 138-141 and 154-157, provided that: [3392]
i) the amino acid sequence has a Aspartic acid (Asp, D) at position
1 (said position determined according to Kabat numbering); and
[3393] ii) the amino acid sequence binds protein F of hRSV with the
same, about the same, or a higher affinity (said affinity as
measured by surface plasmon resonance) and/or the amino acid
sequence has the same, about the same, or a higher potency (as
defined herein) compared to the amino acid sequence without the 3,
2 or 1 amino acid difference,
[3394] in preparing a trivalent polypeptide. [3395] Aspect F-138:
Use of a monovalent constructs according to aspect F-137, wherein
the monovalent construct essentially consist of one of SEQ ID NO's:
138-141 and 154-157. [3396] Aspect F-139: Use of a monovalent
construct according to any of aspects F-99 to F-101, wherein the
monovalent construct essentially consists of SEQ ID NO: 5, in which
the Glutamic acid at position 1 is changed into Aspartic acid, in
preparing a trivalent polypeptide. [3397] Aspect F-140: Use of a
monovalent construct according to any of aspects F-99 to F-101,
wherein the monovalent construct essentially consists of SEQ ID NO:
62, in which the Glutamic acid at position 1 is changed into
Aspartic acid, in preparing a trivalent polypeptide. [3398] Aspect
F-141: Use of a monovalent construct according to any of aspects
F-99 to F-101, wherein the monovalent construct essentially
consists of SEQ ID NO: 65, in which the Glutamic acid at position 1
is changed into Aspartic acid, in preparing a trivalent
polypeptide. [3399] Aspect F-142: Use of a monovalent construct
according to any of aspects F-99 to F-101, wherein the monovalent
construct essentially consists of SEQ ID NO: 76, in which the
Glutamic acid at position 1 is changed into Aspartic acid, in
preparing a trivalent polypeptide. [3400] Aspect F-143: Use of a
monovalent construct according to any of aspects F-99 to F-101,
wherein the monovalent construct essentially consists of SEQ ID NO:
75, in which the Glutamic acid at position 1 is changed into
Aspartic acid, in preparing a trivalent polypeptide. [3401] Aspect
F-144: Use of a monovalent construct according to any of aspects
F-99 to F-101, wherein the monovalent construct essentially
consists of SEQ ID NO: 147, in which the Glutamic acid at position
1 is changed into Aspartic acid, in preparing a trivalent
polypeptide. [3402] Aspect F-145: Use of a monovalent construct
according to any of aspects F-99 to F-101, wherein the monovalent
construct essentially consists of SEQ ID NO: 149, in which the
Glutamic acid at position 1 is changed into Aspartic acid, in
preparing a trivalent polypeptide. [3403] Aspect F-146: Use of a
monovalent construct according to any of aspects F-99 to F-101,
wherein the monovalent construct essentially consists of SEQ ID NO:
153, in which the Glutamic acid at position 1 is changed into
Aspartic acid, in preparing a trivalent polypeptide. [3404] Aspect
F-147: Use of a monovalent construct according to any of aspects
F-99 to F-101, wherein the monovalent construct essentially
consists of SEQ ID NO: 5, in which one or more (such as two, three,
four, five, six, seven, eight or nine, ten, eleven or twelve) amino
acid residues have been mutated selected from the following:
Val5Leu, Ala14Pro, Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln, Gln108Leu and Gly54Asp, and wherein
the Glutamic acid at position 1 is changed into Aspartic acid, in
preparing a trivalent polypeptide. [3405] Aspect F-248: Use of a
monovalent construct according to aspects F-147, wherein the
monovalent construct essentially consists of SEQ ID NO: 5, in which
following amino acid residues have been mutated: Val5Leu, Ala14Pro,
Ser19R, Ile20Leu, Glu44Gly, Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54D, and wherein the Glutamic acid at
position 1 is changed into Aspartic acid, in preparing a trivalent
construct. [3406] Aspect F-149: Use of a monovalent construct
according to aspects F-147, wherein the monovalent construct
essentially consists of SEQ ID NO: 5, in which one or more (such as
two, three, four, five, six, seven or eight) amino acid residues
have been mutated selected from the following: Ser19R, Ile20Leu,
Ala74Ser, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln and Gly54D, and
wherein the Glutamic acid at position 1 is changed into Aspartic
acid, in preparing a trivalent polypeptide. [3407] Aspect F-150:
Use of a monovalent construct according to aspects F-147, wherein
the monovalent construct essentially consists of SEQ ID NO: 5, in
which one or more (such as two, three, four or five) amino acid
residues have been mutated selected from the following: Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gly54D, and wherein the Glutamic
acid at position 1 is changed into Aspartic acid, in preparing a
trivalent polypeptide. [3408] Aspect F-151: Use of a monovalent
construct according to aspects F-150, wherein the monovalent
construct essentially consists of SEQ ID NO: 5, in which following
amino acid residues have been mutated: Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gly54D, and wherein the Glutamic acid at
position 1 is changed into Aspartic acid, in preparing a trivalent
polypeptide. [3409] Aspect F-152: Use of a monovalent construct
according to any of aspects F-99 to F-101, wherein the monovalent
construct essentially consists of SEQ ID NO: 5, in which one or
more (such as two, three or four) amino acid residues have been
mutated selected from the following: Ala14Pro, Ser19Arg, Ile20Leu
and Gln108Leu, and wherein the Glutamic acid at position 1 is
changed into Aspartic acid, in preparing a trivalent polypeptide.
[3410] Aspect F-153: Use of a monovalent construct according to any
of aspects F-99 to F-101, wherein the monovalent construct
essentially consists of SEQ ID NO: 5, in which one or more (such as
two, three, four, five, six or seven) amino acid residues have been
mutated selected from the following: Ala14Pro, Ser19Arg, Ile20Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gln108Leu, and wherein the
Glutamic acid at position 1 is changed into Aspartic acid, in
preparing a trivalent polypeptide. [3411] Aspect F-154: Use of a
monovalent construct according to aspects F-147, wherein the
monovalent construct essentially consists of SEQ ID NO: 5, in which
following amino acid residues have been mutated: [3412] Glu1Asp;
[3413] Glu1Asp, Val5Leu, Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg,
Asp85Glu, Arg105Gln and Gln108Leu; [3414] Glu1Asp, Ala83Arg,
Asp85Glu, Arg105Gln and Gln108Leu; [3415] Glu1Asp, Gly78Leu,
Ala83Arg, Asp85Glu and Arg105Gln; [3416] Glu1Asp, Val5Leu,
Ala14Pro, Glu44Gly, Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln,
Gln108Leu and Gly54Asp; [3417] Glu1Asp, Ala83Arg, Asp85Glu,
Arg105Gln, Gln108Leu and Gly54Asp; [3418] Glu1Asp, Gly78Leu,
Ala83Arg, Asp85Glu, Arg105Gln and Gly54Asp; [3419] Glu1Asp and
Gly54Asp; [3420] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu and
Gln108Leu; [3421] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu
and Ala83Arg; [3422] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu,
Gln108Leu and Asp85Glu; [3423] Glu1Asp, Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu and Arg105Gln; [3424] Glu1Asp, Ala14Pro,
Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and Asp85Glu; [3425]
Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu, Ala83Arg and
Arg105Gln; [3426] Glu1Asp, Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu,
Asp85Glu and Arg105Gln; or [3427] Glu1Asp, Ala14Pro, Ser19Arg,
Ile20Leu, Gln108Leu, Ala83Arg, Asp85Glu and Arg105Gln, [3428] in
preparing a trivalent construct. [3429] Aspect F-155: Use of an
amino acid sequence with SEQ ID NO: 138 in preparing a trivalent
polypeptide with SEQ ID NO: 142, wherein an amino acid sequence
with SEQ ID NO: 138 is linked to at least two further amino acid
sequences with SEQ ID NO: 5, via a 15GS linker. [3430] Aspect
F-156: Use of an amino acid sequence with SEQ ID NO: 139 in
preparing a trivalent polypeptide with SEQ ID NO: 143, wherein an
amino acid sequence with SEQ ID NO: 139 is linked to at least two
further amino acid sequences with SEQ ID NO: 62, via a 15GS linker.
[3431] Aspect F-157: Use of an amino acid sequence with SEQ ID NO:
140 in preparing a trivalent polypeptide with SEQ ID NO: 144,
wherein an amino acid sequence with SEQ ID NO: 140 is linked to at
least two further amino acid sequences with SEQ ID NO: 65, via a
15GS linker. [3432] Aspect F-158: Use of an amino acid sequence
with SEQ ID NO: 141 in preparing a trivalent polypeptide with SEQ
ID NO: 145, wherein an amino acid sequence with SEQ ID NO: 141 is
linked to at least two further amino acid sequences with SEQ ID NO:
76, via a 15GS linker. [3433] Aspect F-159: Use of an amino acid
sequence with SEQ ID NO: 154 in preparing a trivalent polypeptide
with SEQ ID NO: 162, wherein an amino acid sequence with SEQ ID NO:
154 is linked to at least two further amino acid sequences with SEQ
ID NO: 75, via a 15GS linker. [3434] Aspect F-160: Use of an amino
acid sequence with SEQ ID NO: 155 in preparing a trivalent
polypeptide with SEQ ID NO: 163, wherein an amino acid sequence
with SEQ ID NO: 155 is linked to at least two further amino acid
sequences with SEQ ID NO: 147, via a 15GS linker. [3435] Aspect
F-161: Use of an amino acid sequence with SEQ ID NO: 156 in
preparing a trivalent polypeptide with SEQ ID NO: 164, wherein an
amino acid sequence with SEQ ID NO: 156 is linked to at least two
further amino acid sequences with SEQ ID NO: 149, via a 15GS
linker. [3436] Aspect F-162: Use of an amino acid sequence with SEQ
ID NO: 157 in preparing a trivalent polypeptide with SEQ ID NO:
165, wherein an amino acid sequence with SEQ ID NO: 157 is linked
to at least two further amino acid sequences with SEQ ID NO: 153,
via a 15GS linker. [3437] Aspect E-262: Polypeptide according to
any of aspects E-1 to E-261, which has an increased half-life,
compared to the corresponding amino acid sequence according to any
of aspects A-1 to A-29, C-1 to C-38 and W-1 to W-38 per se or
Nanobody.RTM. according to any of aspects B-1 to B-18, D-1 to D-38
and X-1 to X-38 per se, respectively. [3438] Aspect E-263:
Polypeptide according to aspects E-262, in which one or more other
binding units provide the polypeptide with increased half-life,
compared to the corresponding amino acid sequence according to any
of aspects A-1 to A-29, C-1 to C-38 and W-1 to W-38 per se or
Nanobody.RTM. according to any of aspects B-1 to B-18, D-1 to D-38
and X-1 to X-38 per se, respectively. [3439] Aspect E-264:
Polypeptide according to aspects E-262 or E-263, in which said one
or more other binding units that provide the polypeptide with
increased half-life is chosen from the group consisting of serum
proteins or fragments thereof, binding units that can bind to serum
proteins, an Fc portion, and small proteins or peptides that can
bind to serum proteins. [3440] Aspect E-265: Polypeptide according
to any of aspects E-262 to E-264, in which said one or more other
binding units that provide the polypeptide with increased half-life
is chosen from the group consisting of human serum albumin or
fragments thereof. [3441] Aspect E-266: Polypeptide according to
any of aspects E-262 to E-265, in which said one or more other
binding units that provides the polypeptide with increased
half-life are chosen from the group consisting of binding units
that can bind to serum albumin (such as human serum albumin) or a
serum immunoglobulin (such as IgG). [3442] Aspect E-267:
Polypeptide according to any of aspects E-262 to E-266, in which
said one or more other binding units that provides the polypeptide
with increased half-life are chosen from the group consisting of
domain antibodies, amino acid sequences that are suitable for use
as a domain antibody, single domain antibodies, amino acid
sequences that are suitable for use as a single domain antibody,
"dAb's", amino acid sequences that are suitable for use as a dAb,
or Nanobodies.RTM. that can bind to serum albumin (such as human
serum albumin) or a serum immunoglobulin (such as IgG). [3443]
Aspect E-268: Polypeptide according to any of aspects E-262 to
E-267, in which said one or more other binding units that provides
the polypeptide with increased half-life is a Nanobody.RTM. that
can bind to serum albumin (such as human serum albumin) or a serum
immunoglobulin (such as IgG). [3444] Aspect E-269: Polypeptide
according to any of aspects E-262 to E-268, that has a serum
half-life that is at least 1.5 times, preferably at least 2 times,
such as at least 5 times, for example at least 10 times or more
than 20 times, greater than the half-life of the corresponding
amino acid sequence according to any of aspects A-1 to A-29, C-1 to
C-38 and W-1 to W-38 per se or Nanobody.RTM. according to any of
aspects B-1 to B-18, D-1 to D-38 and X-1 to X-38 per se,
respectively. [3445] Aspect E-270: Polypeptide according to any of
aspects E-262 to E-269, that has a serum half-life that is
increased with more than 1 hours, preferably more than 2 hours,
more preferably more than 6 hours, such as more than 12 hours, or
even more than 24, 48 or 72 hours, compared to the corresponding
amino acid sequence according to any of aspects A-1 to A-29, C-1 to
C-38 and W-1 to W-38 per se or Nanobody.RTM. according to any of
aspects B-1 to B-18, D-1 to D-38 and X-1 to X-38 per se,
respectively. [3446] Aspect E-271: Polypeptide according to any of
aspects E-262 to E-270, that has a serum half-life in human of at
least about 12 hours, preferably at least 24 hours, more preferably
at least 48 hours, even more preferably at least 72 hours or more;
for example, of at least 5 days (such as about 5 to 10 days),
preferably at least 9 days (such as about 9 to 14 days), more
preferably at least about 10 days (such as about 10 to 15 days), or
at least about 11 days (such as about 11 to 16 days), more
preferably at least about 12 days (such as about 12 to 18 days or
more), or more than 14 days (such as about 14 to 19 days). [3447]
Aspect G-1: Compound or construct, that comprises or essentially
consists of one or more amino acid sequences according to any of
aspects A-1 to A-29, C-1 to C-38 and W-1 to W-38 and/or one or more
Nanobodies.RTM.according to any of aspects B-1 to B-18, D-1 to D-38
and X-1 to X-38 and/or one or more polypeptides according to any of
aspects E-1 to E-271, and optionally further comprises one or more
other groups, residues, moieties or binding units, optionally
linked via one or more linkers. [3448] Aspect G-2: Compound or
construct according to aspect 0-1, in which said one or more other
groups, residues, moieties or binding units are amino acid
sequences. [3449] Aspect G-3: Compound or construct according to
any of aspects G-1 or G-2, in which said one or more linkers, if
present, are one or more amino acid sequences. [3450] Aspect G-4:
Compound or construct according to any of aspects G-1 to G-3, in
which said one or more other groups, residues, moieties or binding
units are immunoglobulin sequences. [3451] Aspect G-5: Compound or
construct according to any of aspects G-1 to G-4, in which said one
or more other groups, residues, moieties or binding units are
chosen from the group consisting of domain antibodies, amino acid
sequences that are suitable for use as a domain antibody, single
domain antibodies, amino acid sequences that are suitable for use
as a single domain antibody, "dAb's", amino acid sequences that are
suitable for use as a dAb, or Nanobodies.RTM.. [3452] Aspect G-6:
Compound or construct according to any of aspects G-1 to G-5, in
which said one or more amino acid sequences of the invention are
immunoglobulin sequences.
[3453] Aspect G-7: Compound or construct according to any of
aspects G-1 to G-6, in which said one or more amino acid sequences
of the invention are chosen from the group consisting of domain
antibodies, amino acid sequences that are suitable for use as a
domain antibody, single domain antibodies, amino acid sequences
that are suitable for use as a single domain antibody, "dAb's",
amino acid sequences that are suitable for use as a dAb, or
Nanobodies.RTM.. [3454] Aspect G-8: Compound or construct according
to any of aspects G-1 to G-7, that comprises or essentially
consists of one or more Nanobodies.RTM. according to any of aspects
B-1 to B-18, D-1 to D-38 and X-1 to X-38, and in which said one or
more other groups, residues, moieties or binding units are
Nanobodies.RTM.. [3455] Aspect G-9: Compound or construct according
to any of aspects G-1 to G-8, which is a multivalent construct.
[3456] Aspect G-10: Compound or construct according to any of
aspects G-1 to G-9, which is a multispecific construct. [3457]
Aspect G-11: Compound or construct according to any of aspects G-1
to G-10, which has an increased half-life, compared to the
corresponding amino acid sequence according to any of aspects A-1
to A-29, C-1 to C-38 and W-1 to W-38 per se or Nanobody.RTM.
according to any of aspects B-1 to 8-18, D-1 to D-38 and X-1 to
X-38 per se, or polypeptide according to any of aspects E-1 to
E-271 per se, respectively. [3458] Aspect G-12: Compound or
construct according to any of aspects G-1 to G-11, in which said
one or more other groups, residues, moieties or binding units
provide the compound or construct with increased half-life,
compared to the corresponding amino acid sequence according to any
of aspects A-1 to A-29, C-1 to C-38 and W-1 to W-38 per se or
Nanobody.RTM. according to any of aspects B-1 to 8-18, D-1 to D-38
and X-1 to X-38 per se, or polypeptide according to any of aspects
E-1 to E-271 per se, respectively. [3459] Aspect G-13: Compound or
construct according to aspect G-12, in which said one or more other
groups, residues, moieties or binding units that provide the
compound or construct with increased half-life is chosen from the
group consisting of serum proteins or fragments thereof, binding
units that can bind to serum proteins, an Fc portion, and small
proteins or peptides that can bind to serum proteins. [3460] Aspect
G-14: Compound or construct according to any of aspects G-12 or
G-13, in which said one or more other groups, residues, moieties or
binding units that provide the compound or construct with increased
half-life is chosen from the group consisting of human serum
albumin or fragments thereof. [3461] Aspect G-15: Compound or
construct according to any of aspects G-12 to G-14, in which said
one or more other groups, residues, moieties or binding units that
provide the compound or construct with increased half-life are
chosen from the group consisting of binding units that can bind to
serum albumin (such as human serum albumin) or a serum
immunoglobulin (such as IgG). [3462] Aspect G-16: Compound or
construct according to any of aspects G-12 to G-15, in which said
one or more other groups, residues, moieties or binding units that
provides the compound or construct with increased half-life are
chosen from the group consisting of domain antibodies, amino acid
sequences that are suitable for use as a domain antibody, single
domain antibodies, amino acid sequences that are suitable for use
as a single domain antibody, "dAb"'s, amino acid sequences that are
suitable for use as a dAb, or Nanobodies.RTM. that can bind to
serum albumin (such as human serum albumin) or a serum
immunoglobulin (such as IgG). [3463] Aspect G-17: Compound or
construct according to any of aspects G-12 to G-16, in which said
one or more other groups, residues, moieties or binding units that
provides the compound or construct with increased half-life is a
Nanobody.RTM. that can bind to serum albumin (such as human serum
albumin) or a serum immunoglobulin (such as IgG). [3464] Aspect
G-18: Compound or construct according to any of aspects G-11 to
G-17, that has a serum half-life that is at least 1.5 times,
preferably at least 2 times, such as at least 5 times, for example
at least 10 times or more than 20 times, greater than the half-life
of the corresponding amino acid sequence according to any of
aspects A-1 to A-29, C-1 to C-38 and W-1 to W-38 per se or
Nanobody.RTM. according to any of aspects B-1 to B-18, D-1 to D-30
and X-1 to X-38 per se, or polypeptide according to any of aspects
E-1 to E-271 per se, respectively. [3465] Aspect G-19: Compound or
construct according to any of aspects G-11 to G-18, that has a
serum half-life that is increased with more than 1 hours,
preferably more than 2 hours, more preferably more than 6 hours,
such as more than 12 hours, or even more than 24, 48 or 72 hours,
compared to the corresponding amino acid sequence according to any
of aspects A-1 to A-29, C-1 to C-38 and W-1 to W-38 per se or
Nanobody.RTM. according to any of aspects B-1 to B-18, D-1 to D-38
and X-1 to X-38 per se, or polypeptide according to any of aspects
E-1 to E-271 per se, respectively. [3466] Aspect G-20: Compound or
construct according to any of aspects G-11 to G-19, that has a
serum half-life in human of at least about 12 hours, preferably at
least 24 hours, more preferably at least 48 hours, even more
preferably at least 72 hours or more; for example, of at least 5
days (such as about 5 to 10 days), preferably at least 9 days (such
as about 9 to 14 days), more preferably at least about 10 days
(such as about 10 to 15 days), or at least about 11 days (such as
about 11 to 16 days), more preferably at least about 12 days (such
as about 12 to 18 days or more), or more than 14 days (such as
about 14 to 19 days). [3467] Aspect M-1: Nucleic acid or nucleotide
sequence, that encodes an amino acid sequence according to any of
aspects A-1 to A-29, C-1 to C-30 and W-1 to W-38, a Nanobody.RTM.
according to any of aspects B-1 to B-18, D-1 to D-30 and X-1 to
X-38, a polypeptide according to any of aspects E-1 to E-271, a
compound or construct according to any of aspects G-1 to G-20, that
is such that it can be obtained by expression of a nucleic acid or
nucleotide sequence encoding the same, or a monovalent construct
according to any of aspects F-1 to F-4. [3468] Aspect M-2: Nucleic
acid or nucleotide sequence according to aspect M-1, that is in the
form of a genetic construct. [3469] Aspect M-3: Use of a nucleic
acid or nucleotide sequence according to aspect M-1, that encodes a
monovalent construct according to any of aspects F-1 to F-4, for
the preparation of a genetic construct that encodes a multivalent
polypeptide according to any of aspects E-1 to E-271. [3470] Aspect
M-4: Use of a nucleic acid or nucleotide sequence according to
aspect M-2, wherein the genetic construct encodes a multivalent
(such as a bivalent) construct. [3471] Aspect N-1: Host or host
cell that expresses, or that under suitable circumstances is
capable of expressing, an amino acid sequence according to any of
aspects A-1 to A-29, C-1 to C-38 and W-1 to W-38, a Nanobody.RTM.
according to any of aspects B-1 to B-18, D-1 to D-38 and X-1 to
X-38, a polypeptide according to any of aspects E-1 to E-271, a
compound or construct according to any of aspects G-1 to G-20, that
is such that it can be obtained by expression of a nucleic acid or
nucleotide sequence encoding the same, or a monovalent construct
according to any of aspects F-1 to F-4; and/or that comprises a
nucleic acid or nucleotide sequence according to aspects M-1 or
M-2. [3472] Aspect O-1: Composition, comprising at least one amino
acid sequence according to any of aspects A-1 to A-29, C-1 to C-38
and W-1 to W-38, Nanobody.RTM. according to any of aspects B-1 to
B-18, D-1 to D-38 and X-1 to X-38, polypeptide according to any of
aspects E-1 to E-271, compound or construct according to any of
aspects G-1 to G-20, monovalent construct according to any of
aspects F-1 to F-4, or nucleic acid or nucleotide sequence
according to aspects M-1 or M-2. [3473] Aspect O-2: Composition
according to aspect O-1, which is a pharmaceutical composition.
[3474] Aspect O-3: Composition according to aspects O-1 or O-2,
which is a pharmaceutical composition, that further comprises at
least one pharmaceutically acceptable carrier, diluent or excipient
and/or adjuvant, and that optionally comprises one or more further
pharmaceutically active polypeptides and/or compounds. [3475]
Aspect P-1: Method for producing an amino acid sequence according
to any of aspects A-1 to A-29, C-1 to C-38 and W-1 to W-38, a
Nanobody.RTM. according to any of aspects B-1 to B-18, D-1 to D-38
and X-1 to X-38, a polypeptide according to any of aspects E-1 to
E-271, a compound or construct according to any of aspects G-1 to
G-20, that is such that it can be obtained by expression of a
nucleic acid or nucleotide sequence encoding the same, or a
monovalent construct according to any of aspects F-1 to F-4, or a
composition according to any of aspects O-1 to O-3, said method at
least comprising the steps of: [3476] a) expressing, in a suitable
host cell or host organism or in another suitable expression
system, a nucleic acid or nucleotide sequence according to aspects
M-1 or M-2, [3477] optionally followed by: [3478] b) isolating
and/or purifying the amino acid sequence according to any of
aspects A-1 to A-29, C-1 to C-38 and W-1 to W-38, the Nanobody.RTM.
according to any of aspects B-1 to 8-18, D-1 to D-38 and X-1 to
X-38, the polypeptide according to any of aspects E-1 to E-271, the
compound or construct according to any of aspects G-1 to G-20, that
is such that it can be obtained by expression of a nucleic acid or
nucleotide sequence encoding the same, or the monovalent construct
according to any of aspects F-1 to F-4, thus obtained. [3479]
Aspect P-2: Method for producing an amino acid sequence according
to any of aspects A-1 to A-29, C-1 to C-38 and W-1 to W-38, a
Nanobody.RTM. according to any of aspects B-1 to B-18, D-1 to D-38
and X-1 to X-38, a polypeptide according to any of aspects E-1 to
K-271, a compound or construct according to any of aspects G-1 to
G-20, that is such that it can be obtained by expression of a
nucleic acid or nucleotide sequence encoding the same, or a
monovalent construct according to any of aspects F-1 to F-4, or a
composition according to any of aspects O-1 to O-3, said method at
least comprising the steps of: [3480] a) cultivating and/or
maintaining a host or host cell according to aspect N-1 under
conditions that are such that said host or host cell expresses
and/or produces at least one amino acid sequence according to any
of aspects A-1 to A-29, C-1 to C-38 and W-1 to W-38, Nanobody.RTM.
according to any of aspects B-1 to 8-18, D-1 to D-38 and X-1 to
X-38, a polypeptide according to any of aspects E-1 to E-271,
compound or construct according to any of aspects G-1 to G-20, that
is such that it can be obtained by expression of a nucleic acid or
nucleotide sequence encoding the same, or monovalent construct
according to any of aspects F-1 to F-4, or composition according to
any of aspects O-1 to O-3, [3481] optionally followed by: [3482] b)
isolating and/or purifying the amino acid sequence according to any
of aspects A-1 to A-29, C-1 to C-38 and W-1 to W-38, the
Nanobody.RTM. according to any of aspects B-1 to B-18, D-1 to D-38
and X-1 to X-38, the polypeptide according to any of aspects E-1 to
E-271, the compound or construct according to any of aspects G-1 to
G-20, that is such that it can be obtained by expression of a
nucleic acid or nucleotide sequence encoding the same, or the
monovalent construct according to any of aspects F-1 to F-4, or the
composition according to aspects O-1 to O-3, thus obtained. [3483]
Aspect P-3: Method for preparing a bivalent or trivalent
polypeptide according to any of aspects E-7 to E-261, said method
comprising at least the steps of linking two or more monovalent
amino acid sequences or monovalent construct according to any of
aspects F-1 to F-4 and for example one or more linkers. [3484]
Aspect P-4: Method according to aspect P-3, comprising the steps
of: [3485] a) linking two or more nucleic acid sequences according
to aspect M-1, encoding a monovalent construct according to any of
aspects F-1 to F-4 (and also for example nucleic acids encoding one
or more linkers and further one or more further elements of genetic
constructs known per se) to obtain a genetic construct according to
aspect M-2; [3486] b) expressing, in a suitable host cell or host
organism or in another suitable expression system, the genetic
construct obtained in a) [3487] optionally followed by: [3488] c)
isolating and/or purifying the bivalent or trivalent polypeptide
according to any of aspects E-7 to E-261, thus obtained. [3489]
Aspect Q-1: Method for screening amino acid sequences directed
against protein F of hRSV, said method comprising at least the
steps of: [3490] a. providing a set, collection or library of
nucleic acid sequences encoding amino acid sequences; [3491] b.
screening said set, collection or library of nucleic acid sequences
for nucleic acid sequences that encode an amino acid sequence that
can bind to and/or has affinity for an envelope protein of a virus
and that is cross-blocked or is cross blocking a Nanobody.RTM. of
the invention, e.g. one of SEQ ID NO's: 60-76, 138-141 and 146-157
(Table A-4), or a polypeptide or construct comprising at least one
Nanobody.RTM. of the invention, e.g. a polypeptide or construct
comprising at least one of SEQ ID NO: 77-99, 142-145 and 158-165
(see Table A-5); and [3492] c. isolating said nucleic acid
sequence, followed by expressing said amino acid sequence. [3493]
Aspect R-1: Method for the prevention and/or treatment of hRSV
infection, said method comprising administering, to a subject in
need thereof, a pharmaceutically active amount of at least one
amino acid sequence according to any of aspects A-1 to A-29, C-1 to
C-30 and W-1 to W-38, Nanobody.RTM. according to any of aspects B-1
to B-18, D-1 to D-38 and X-1 to X-38, polypeptide according to any
of aspects E-1 to E-271, compound or construct according to any of
aspects G-1 to 6-20, monovalent construct according to any of
aspects F-1 to F-4 and/or composition according to aspects O-1 to
O-3. [3494] Aspect R-2: Method for the prevention and/or treatment
of at least one of respiratory illness, upper respiratory tract
infection, lower respiratory tract infection, bronchiolitis
(inflammation of the small airways in the lung), pneumonia,
dyspnea, cough, (recurrent) wheezing and asthma, said method
comprising administering, to a subject in need thereof, a
pharmaceutically active amount of at least one amino acid sequence
according to any of aspects A-1 to A-29, C-1 to C-38 and W-1 to
W-38, Nanobody.RTM. according to any of aspects B-1 to B-18, D-1 to
D-38 and X-1 to X-38, polypeptide according to any of aspects E-1
to E-271, compound or construct according to any of aspects G-1 to
6-20, monovalent construct according to any of aspects F-1 to F-4
and/or composition according to aspects O-1 to O-3.
[3495] Aspect R-3: Method for the prevention and/or treatment of at
least one disease or disorder that can be prevented and/or treated
by administering, to a subject in need thereof, an amino acid
sequence according to any of aspects A-1 to A-29, C-1 to C-38 and
W-1 to W-38, a Nanobody.RTM. according to any of aspects B-1 to
B-18, D-1 to D-38 and X-1 to X-38, a polypeptide according to any
of aspects E-1 to E-271, a compound or construct according to any
of aspects G-1 to 6-20, a monovalent construct according to any of
aspects F-1 to F-4 and/or a composition according to aspects O-1 to
O-3, said method comprising administering, to a subject in need
thereof, a pharmaceutically active amount of at least one amino
acid sequence according to any of aspects A-1 to A-29, C-1 to C-38
and W-1 to W-38, Nanobody.RTM. according to any of aspects B-1 to
B-18, D-1 to F-38 and X-1 to X-38, polypeptide according to any of
aspects E-1 to E-271, compound or construct according to any of
aspects G-1 to G-20, monovalent construct according to any of
aspects F-1 to F-4 and/or composition according to aspects O-1 to
O-3. [3496] Aspect R-4: Method for immunotherapy, said method
comprising administering, to a subject in need thereof, a
pharmaceutically active amount of at least one amino acid sequence
according to any of aspects A-1 to A-29, C-1 to C-38 and W-1 to
W-38, Nanobody.RTM. according to any of aspects B-1 to B-18, D-1 to
D-38 and X-1 to X-38, polypeptide according to any of aspects E-1
to E-271, compound or construct according to any of aspects G-1 to
G-20, monovalent construct according to any of aspects F-1 to F-4
and/or composition according to aspects O-1 to O-3. [3497] Aspect
R-5: Use of an amino acid sequence according to any of aspects A-1
to A-29, C-1 to C-38 and W-1 to W-38, a Nanobody.RTM. according to
any of aspects B-1 to B-18, D-1 to D-38 and X-1 to X-38, a
polypeptide according to any of aspects E-1 to E-271, a compound or
construct according to any of aspects G-1 to G-20, a monovalent
construct according to any of aspects F-1 to F-4 and/or composition
according to aspects O-1 to O-3 in the preparation of a
pharmaceutical composition for prevention and/or treatment of hRSV
infection; and/or for use in one or more of the methods according
to aspects R-1 to R-4. [3498] Aspect R-6: Amino acid sequence
according to any of aspects A-1 to A-29, C-1 to C-38 and W-1 to
W-38, Nanobody.RTM. according to any of aspects B-1 to B-18, D-1 to
D-38 and X-1 to X-38, polypeptide according to any of aspects E-1
to E-271, compound or construct according to any of aspects G-1 to
G-20, monovalent construct according to any of aspects F-1 to F-4
and/or composition according to aspects O-1 to O-3 for prevention
and/or treatment of at least one of respiratory illness, upper
respiratory tract infection, lower respiratory tract infection,
bronchiolitis (inflammation of the small airways in the lung),
pneumonia, dyspnea, cough, (recurrent) wheezing and asthma. [3499]
Aspect S-1: Part or fragment of an amino acid sequence according to
any of aspects A-1 to A-29, C-1 to C-38 and W-1 to W-38, a
Nanobody.RTM. according to any of aspects B-1 to B-18, D-1 to D-38
and X-1 to X-38, and/or a polypeptide according to any of aspects
E-1 to E-271. [3500] Aspect S-2: Part or fragment according to
aspect S-1, that can specifically bind to antigenic II on protein F
of hRSV and/or competes with Synagis.RTM. for binding protein F of
hRSV. [3501] Aspect S-3: Part of fragment according to any of
aspects S-1 to S-2, that can specifically bind to protein F of hRSV
with a dissociation constant (K.sub.D) of 1000 nM to 1 nM or less,
preferably 100 nM to 1 nM or less, more preferably 10 nM to 1 nM or
less. [3502] Aspect S-4: Part or fragment according to any of
aspects S-2 to S-3, that can specifically bind to protein F of hRSV
with a k.sub.on-rate of between 10.sup.4M.sup.-1s.sup.-1 to about
10.sup.7 M.sup.-1s.sup.-1, preferably between 10.sup.5
M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1, more preferably
about 10.sup.6 M.sup.-1s.sup.-1 or more. [3503] Aspect S-5: Part or
fragment according to any of aspects S-2 to S-4 that can
specifically bind to protein F of hRSV with a k.sub.off rate
between 10.sup.-2 s.sup.-1 (t.sub.1/2=0.69 s) and 10.sup.-4
s.sup.-1 (providing a near irreversible complex with a t.sub.1/2 of
multiple days, preferably between 10.sup.-3 s.sup.-1 and 10.sup.-4
s.sup.-1, or lower. [3504] Aspect S-6: Compound or construct, that
comprises or essentially consists of one or more parts or fragments
according to any of aspects S-1 to S-5, and optionally further
comprises one or more other groups, residues, moieties or binding
units, optionally linked via one or more linkers. [3505] Aspect
S-7: Compound or construct according to aspect S-6, in which said
one or more other groups, residues, moieties or binding units are
amino acid sequences. [3506] Aspect S-8: Compound or construct
according to aspects S-6 or S-7, in which said one or more linkers,
if present, are one or more amino acid sequences. [3507] Aspect
S-9: Nucleic acid or nucleotide sequence, that encodes a part or
fragment according to any of aspects S-1 to S-5 or a compound or
construct according to any of aspects S-6 to S-8. [3508] Aspect
S-10: Composition, comprising at least one part or fragment
according to any of aspects S-1 to S-5, compound or construct
according to any of aspects S-6 to S-8, or nucleic acid or
nucleotide sequence according to aspect S-9. [3509] Aspect T-1:
Derivative of an amino acid sequence according to any of aspects
A-1 to A-29, C-1 to C-38 and W-1 to W-38 or of a Nanobody.RTM.
according to any of aspects B-1 to B-18, D-1 to D-38 and X-1 to
X-38. [3510] Aspect T-2: Derivative according to aspect T-1, that
can specifically bind to antigenic site II on protein F of hRSV
and/or compete with Synagis.RTM. for binding protein F of hRSV.
[3511] Aspect T-3: Derivative according to any of aspects T-1 to
T-2, that can specifically bind to protein F of hRSV with a
k.sub.on-rate of between 10.sup.4 M.sup.-1s.sup.-1 to about
10.sup.7 M.sup.-1s.sup.-1, preferably between 10.sup.5
M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1, more preferably
about 10.sup.6 M.sup.-1s.sup.-1 or more. [3512] Aspect T-4:
Derivative according to any of aspects T-2 to T-3, that can
specifically bind to protein F of hRSV with a k.sub.off-rate of
between 10.sup.4 M.sup.-1s.sup.-1 to about 10.sup.7
M.sup.-1s.sup.-1, preferably between 10.sup.5 M.sup.-1s.sup.-1 and
10.sup.7 M.sup.-1s.sup.-1, more preferably about 10.sup.6
M.sup.-1s.sup.-1 or more. [3513] Aspect T-5: Derivative according
to any of aspects T-2 to T-4, that can specifically bind to protein
F of hRSV with a k.sub.off rate between 10.sup.-2 s.sup.-1
(t.sub.1/2=0.69 s) and 10.sup.-4 s.sup.-1 (providing a near
irreversible complex with a t.sub.1/2 of multiple days), preferably
between 10.sup.-3 s.sup.1 and 10.sup.-4 1, or lower. [3514] Aspect
T-6: Derivative of a compound or construct according to any of
aspects G-1 to G-20 or a polypeptide according to any of aspects
E-1 to E-271. [3515] Aspect T-7: Derivative according to aspect
T-6, that can specifically bind to antigenic site II on protein F
of hRSV and/or compete with Synagis.RTM. for binding protein F of
hRSV. [3516] Aspect T-8: Derivative according to any of aspects T-6
to T-7, that can specifically bind to protein F of hRSV with a
dissociation constant (K.sub.D) of 100 nM to 0.1 nM or less,
preferably 10 nM to 0.1 nM or less, more preferably 1 nM to 0.1 nM
or less. [3517] Aspect T-9: Derivative according to any of aspects
T-6 to T-8, that can specifically bind to protein F of hRSV with a
k.sub.on-rate of between 10.sup.4 M.sup.-1s.sup.-1 to about
10.sup.7 M.sup.-1s.sup.-1, preferably between 10.sup.5
M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1, more preferably
about 10.sup.6 M.sup.-1s.sup.-1 or more. [3518] Aspect T-10:
Derivative according to any of aspects T-6 to T-9, that can
specifically bind to protein F of hRSV with a k.sub.off rate
between 10.sup.-2 s.sup.-1 (t.sub.1/2=0.69 s) and 10.sup.-4
s.sup.-1 (providing a near irreversible complex with a t.sub.1/2 of
multiple days), preferably between 10.sup.-3 s.sup.-1 and 10.sup.-4
s.sup.-1, more preferably between 5.times.10.sup.-3 s.sup.-1 and
10.sup.-4 s.sup.-1, or lower. [3519] Aspect T-11: Derivative
according to any of aspects T-6 to T-10, that can neutralize hRSV,
e.g. in a microneutralization assay of RSV strain Long (such as
e.g. described in Example 6), with an IC50 value between 10 pM and
1000 pM, preferably between 10 pM and 250 pM, more preferably
between 50 pM and 200 pM or less. [3520] Aspect T-12: Derivative
according to any of aspects T-6 to T-11, that can neutralize hRSV,
e.g. in a microneutralization assay of RSV strain Long (such as
e.g. described in Example 6), with an IC50 value that is at least
the same and preferably better, at least ten times better,
preferably twenty times better, more preferably fifty times better,
even more preferably sixty, seventy, eighty or more times better
compared to the IC50 value obtained with Synagis.RTM.. [3521]
Aspect T-13: Derivative according to any of aspects T-1 to T-12,
that has a serum half-life that is at least 1.5 times, preferably
at least 2 times, such as at least 5 times, for example at least 10
times or more than 20 times, greater than the half-life of the
corresponding amino acid sequence according to any of aspects A-1
to A-29, C-1 to C-38 and W-1 to W-38 per se, Nanobody.RTM.
according to any of aspects B-1 to B-18, D-1 to D-38 and X-1 to
X-38 per se, polypeptide according to any of aspects E-1 to E-261,
compound or construct according to any of aspects G-1 to G-20 per
se, or monovalent construct according to any of aspects F-1 to F-4
per se, respectively. [3522] Aspect T-14: Derivative according to
any of aspects T-1 to T-13, that has a serum half-life that is
increased with more than 1 hours, preferably more than 2 hours,
more preferably more than 6 hours, such as more than 12 hours, or
even more than 24, 48 or 72 hours, compared to the corresponding
amino acid sequence according to any of aspects A-1 to A-29, C-1 to
C-38 and W-1 to W-38 per se, Nanobody.RTM. according to any of
aspects B-1 to B-18, D-1 to D-38 and X-1 to X-38 per se,
polypeptide according to any of aspects E-1 to E-261, compound or
construct according to any of aspects G-1 to G-20 per se, or
monovalent construct according to any of aspects F-1 to F-4 per se,
respectively. [3523] Aspect T-15: Derivative according to any of
aspects T-1 to T-14, that has a serum half-life in human of at
least about 12 hours, preferably at least 24 hours, more preferably
at least 48 hours, even more preferably at least 72 hours or more;
for example, at least 5 days (such as about 5 to 10 days),
preferably at least 9 days (such as about 9 to 14 days), more
preferably at least about 10 days (such as about 10 to 15 days), or
at least about 11 days (such as about 11 to 16 days), more
preferably at least about 12 days (such as about 12 to 18 days or
more), or more than 14 days (such as about 14 to 19 days). [3524]
Aspect T-16: Derivative according to any of aspects T-1 to T-15,
that is a pegylated derivative. [3525] Aspect T-17: Compound or
construct, that comprises or essentially consists of one or more
derivatives according to any of aspects T-1 to T-16, and optionally
further comprises one or more other groups, residues, moieties or
binding units, optionally linked via one or more linkers. [3526]
Aspect T-18: Compound or construct according to aspect T-17, in
which said one or more other groups, residues, moieties or binding
units are amino acid sequences. [3527] Aspect T-19: Compound or
construct according to aspects T-17 or T-18, in which said one or
more linkers, if present, are one or more amino acid sequences.
[3528] Aspect T-20: Nucleic acid or nucleotide sequence, that
encodes a derivative according to any of aspects T-1 to T-16 or a
compound or construct according to any of aspects T-17 to T-19.
[3529] Aspect T-21: Composition, comprising at least one derivative
according to any of aspects T-1 to T-16, compound or construct
according to any of aspects T-17 to T-19, or nucleic acid or
nucleotide sequence according to aspect T-20. [3530] Aspect U-1: A
method for administering an effective amount of an amino acid
sequence according to any of claims A-1 to A-29, C-1 to C-38 and
W-1 to W-38, a Nanobody.RTM. according to any of claims B-1 to
B-18, D-1 to D-38 and X-1 to X-38, a polypeptide according to any
of claims E-1 to E-271, a compound or construct according to any of
claims G-1 to G-20 and/or a monovalent construct according to any
of claims F-1 to F-4, and/or a composition comprising the same,
wherein said method comprises the step of administering the amino
acid sequence according to any of claims A-1 to A-29, C-1 to C-38
and W-1 to W-38, the Nanobody.RTM. according to any of claims B-1
to B-18, D-1 to D-38 and X-1 to X-38, the polypeptide according to
any of claims E-1 to E-271, the compound or construct according to
any of claims G-1 to G-20 and/or the monovalent construct according
to any of claims F-1 to F-4, and/or a composition comprising the
same to the pulmonary tissue. [3531] Aspect U-2: The method
according to aspect U-1, wherein the amino acid sequence according
to any of claims A-1 to A-29, C-1 to C-38 and W-1 to W-38, the
Nanobody.RTM. according to any of claims B-1 to B-18, D-1 to D-38
and X-1 to X-38, the polypeptide according to any of claims E-1 to
E-271, the compound or construct according to any of claims G-1 to
G-20 and/or the monovalent construct according to any of claims F-1
to F-4, and/or a composition comprising the same is administered by
use of an inhaler, intranasal delivery device or aerosol. [3532]
Aspect U-3: Method according to any of aspects U-1 or U-2, wherein
at least 5%, preferably at least 10%, 20%, 30%, 40%, more
preferably at least 50%, 60%, 70%, and even more preferably at
least 80% or more of the amino acid sequence according to any of
claims A-1 to A-29, C-1 to C-38 and W-1 to W-38, the Nanobody.RTM.
according to any of claims B-1 to B-18, D-1 to D-38 and X-1 to
X-38, the polypeptide according to any of claims E-1 to E-271, the
compound or construct according to any of claims G-1 to G-20 and/or
the monovalent construct according to any of claims F-1 to F-4,
and/or a composition comprising the same is stable in the pulmonary
tissue for at least 24 hours, preferably at least 48 hours more
preferably at least 72 hours. [3533] Aspect U-4: Method according
to any of aspects U-1 to U-3, wherein the amino acid sequence
according to any of claims A-1 to A-29, C-1 to C-38 and W-1 to
W-38, the Nanobody.RTM. according to any of claims B-1 to B-18, D-1
to D-38 and X-1 to X-38, the polypeptide according to any of claims
E-1 to E-271, the compound or construct according to any of claims
G-1 to G-20 and/or the monovalent construct according to any of
claims F-1 to F-4, and/or a composition comprising the same are
applied in pure form, i.e., when they are liquids or a dry
powder.
[3534] Aspect U-5: Method according to any of aspects U-1 to U-3,
wherein the amino acid sequence according to any of claims A-1 to
A-29, C-1 to C-38 and W-1 to W-38, the Nanobody.RTM. according to
any of claims B-1 to B-18, D-1 to D-38 and X-1 to X-38, the
polypeptide according to any of claims E-1 to E-271, the compound
or construct according to any of claims G-1 to G-20 and/or the
monovalent construct according to any of claims F-1 to F-4, and/or
a composition comprising the same are administered to the pulmonary
tissue as composition or formulation comprising an amino acid
sequence according to any of claims A-1 to A-29, C-1 to C-38 and
W-1 to W-38, a Nanobody.RTM. according to any of claims B-1 to
B-18, D-1 to D-38 and X-1 to X-38, a polypeptide according to any
of claims E-1 to E-271, a compound or construct according to any of
claims G-1 to G-20 and/or a monovalent construct according to any
of claims F-1 to F-4, and a carrier suitable for pulmonary
delivery. [3535] Aspect U-6; Pharmaceutical composition comprising
an amino add sequence according to any of claims A-1 to A-29, C-1
to C-38 and W-1 to W-38, a Nanobody.RTM. according to any of claims
B-1 to B-18, D-1 to D-38 and X-1 to X-38, a polypeptide according
to any of claims E-1 to E-271, a compound or construct according to
any of claims G-1 to G-20 and/or a monovalent construct according
to any of claims F-1 to F-4, and a carrier suitable for pulmonary
delivery. [3536] Aspect U-7: Pharmaceutical device suitable for the
pulmonary delivery of an amino acid sequence according to any of
claims A-1 to A-29, C-1 to C-38 and W-1 to W-38, a Nanobody.RTM.
according to any of claims B-1 to B-18, D-1 to D-38 and X-1 to
X-38, a polypeptide according to any of claims E-1 to E-271, a
compound or construct according to any of claims G-1 to G-20 and/or
a monovalent construct according to any of claims F-1 to F-4 and/or
suitable in the use of a composition comprising the same. [3537]
Aspect U-8: Pharmaceutical device according to aspect U-7 that is
an inhaler for liquids (e.g. a suspension of fine solid particles
or droplets) comprising an amino acid sequence according to any of
claims A-1 to A-29, C-1 to C-38 and W-1 to W-38, a Nanobody.RTM.
according to any of claims B-1 to B-18, D-1 to D-38 and X-1 to
X-38, a polypeptide according to any of claims E-1 to E-271, a
compound or construct according to any of claims G-1 to G-20 and/or
a monovalent construct according to any of claims F-1 to F-4.
[3538] Aspect U-9: Pharmaceutical device according to aspect U-7
that is an aerosol comprising an amino acid sequence according to
any of claims A-1 to A-29, C-1 to C-38 and W-1 to W-38, a
Nanobody.RTM. according to any of claims B-1 to B-18, D-1 to D-38
and X-1 to X-38, a polypeptide according to any of claims E-1 to
E-271, a compound or construct according to any of claims G-1 to
G-20 and/or a monovalent construct according to any of claims F-1
to F-4. [3539] Aspect U-10: Pharmaceutical device according to
aspect U-7 that is a dry powder inhaler comprising an amino acid
sequence according to any of claims A-1 to A-29, C-1 to C-38 and
W-1 to W-38, a Nanobody.RTM. according to any of claims B-1 to
B-18, D-1 to D-38 and X-1 to X-38, a polypeptide according to any
of claims E-1 to E-271, a compound or construct according to any of
claims G-1 to G-20 and/or a monovalent construct according to any
of claims F-1 to F-4 in the form of a dry powder. [3540] Aspect
U-11: Method for the prevention and/or treatment of hRSV infection,
said method comprising administering to the pulmonary tissue of a
subject in need thereof, a pharmaceutically active amount of an
amino acid sequence according to any of claims A-1 to A-29, C-1 to
C-38 and W-1 to W-38, a Nanobody.RTM. according to any of claims
B-1 to B-18, D-1 to D-38 and X-1 to X-38, a polypeptide according
to any of claims E-1 to E-271, a compound or construct according to
any of claims G-1 to G-20 and/or a monovalent construct according
to any of claims F-1 to F-4 and/or of a pharmaceutical composition
comprising the same. [3541] Aspect U-12: Method for the prevention
and/or treatment of respiratory illness, upper respiratory tract
infection, lower respiratory tract infection, bronchiolitis
(inflammation of the small airways in the lung), pneumonia,
dyspnea, cough, (recurrent) wheezing and asthma, said method
comprising administering to the pulmonary tissue of a subject in
need thereof, a pharmaceutically active amount of an amino acid
sequence according to any of claims A-1 to A-29, C-1 to C-38 and
W-1 to W-38, a Nanobody.RTM. according to any of claims B-1 to
B-18, D-1 to D-38 and X-1 to X-38, a polypeptide according to any
of claims E-1 to E-271, a compound or construct according to any of
claims G-1 to G-20 and/or a monovalent construct according to any
of claims F-1 to F-4, and/or of a pharmaceutical composition
comprising the same. [3542] Aspect V-1: Method for the prevention
and/or treatment of hRSV infection, said method comprising
administering, to a subject in need thereof, a pharmaceutically
active amount of a multivalent polypeptide according to any of
aspects E-7 to E-261, and/or of a pharmaceutical composition
comprising the same. [3543] Aspect V-2: Use of a multivalent
polypeptide according to any of aspects E-7 to E-261, and/or of a
pharmaceutical composition comprising the same for binding and/or
neutralization of hRSV. [3544] Aspect V-3: Use of a multivalent
polypeptide according to any of aspects E-7 to E-261, and/or of a
pharmaceutical composition comprising the same for binding and/or
neutralization of different strains of hRSV. [3545] Aspect V-4: Use
of a multivalent polypeptide according to any of aspects E-7 to
E-261, and/or of a pharmaceutical composition comprising the same
for binding and/or neutralization of one or more escape mutants of
a virus. [3546] Aspect V-5: Method or use according to any of
aspects V-1 to V-4, wherein the multivalent polypeptide is
bivalent. [3547] Aspect V-6: Method or use according to any of
aspects V-1 to V-4, wherein the multivalent polypeptide is
trivalent. [3548] Aspect V-7: Method or use according to any of
aspects V-1 to V-6, wherein said multivalent polypeptide is
administered according to any of the methods of claims U-1 to U-5
and/or U-11 to U-12. [3549] Aspect V-8: Method for the prevention
and/or treatment of infection by hRSV virus, said method comprising
administering, to a subject in need thereof, a pharmaceutically
active amount of a multivalent polypeptide according to any of
aspects E-7 to E-261 and/or of a pharmaceutical composition
comprising the same. [3550] Aspect V-9: Method according to aspect
V-8 wherein the multivalent compound or construct is selected from
Table A-5 (SEQ ID NO's: 77-99, 138-141 and 146-157). [3551] Aspect
V-10: Method according to any of aspects V-8 or V-9, wherein
infection by one or more RSV escape mutants is treated. [3552]
Aspect V-11: Method according to aspect V-10, wherein the escape
mutant is an escape mutant specific for antigenic site II. [3553]
Aspect V-12: Use of a multivalent compound or construct according
to any of aspects E-7 to E-261, and/or of a pharmaceutical
composition comprising the same for binding and/or neutralization
one or more different escape mutants of RSV. [3554] Aspect V-13:
Use according to claim V-12 wherein the escape mutant is an escape
mutant specific for antigenic site [3555] Aspect V-14: Method
according to any of aspects V-8 or V-9, wherein infection by one or
more strains of hRSV is treated. [3556] Aspect V-15: Method
according to aspect V-14, wherein the RSV strain is Long. [3557]
Aspect V-16: Method according to aspect V-14, wherein the RSV
strain is A-2. [3558] Aspect V-17: Method according to aspect V-14,
wherein the RSV strain is B-1. [3559] Aspect V-18: Method according
to aspect V-14, wherein the multivalent polypeptide binds and/or
neutralizes RSV strain Long and A-2. [3560] Aspect V-19: Method
according to aspect V-14, wherein the multivalent polypeptide binds
and/or neutralizes RSV strain Long and B-1. [3561] Aspect V-20:
Method according to aspect V-14, wherein the multivalent
polypeptide binds and/or neutralizes RSV strain B-1 and A-2. [3562]
Aspect V-21: Method according to aspect V-14, wherein the
multivalent polypeptide binds and/or neutralizes RSV strain Long,
A-2 and B-1. [3563] Aspect V-22: Use of a multivalent compound or
construct according to any of aspects E-7 to E-261, and/or of a
pharmaceutical composition comprising the same for binding and/or
neutralization different strains of hRSV. [3564] Aspect V-23: Use
according to aspect V-22, wherein the strains of RSV are Long and
A-2. [3565] Aspect V-24: Use according to aspect V-22, wherein the
strains of RSV are Long and B-1. [3566] Aspect V-25: Use according
to aspect V-22, wherein the strains of RSV are A-1 and B-1. Aspect
V-26: Use according to aspect V-22, wherein the strains of RSV are
Long, A-2 and B-1.
EXAMPLES
Example 1
Immunizations
[3567] Two llamas (156 and 157) were immunized according to
standard protocols with 6 boosts of hRSV F.sub.TM-(membrane
anchorless form of the fusion protein, 70 kDa; Corrall T. et al.
2007, BMC Biotechnol. 7: 17). Blood was collected from these
animals 7 days after boost 6 and 10 days after boost 6.
[3568] Two llamas (212 and 213) were immunized intramuscularly in
the neck with 1 mg of RNA-inactivated RSV strain long A (Hytest,
Turku Finland; #8RSV79), followed by 4 boosts of 0.5 mg RSV in a
biweekly regimen. Two llamas (206 and 207) were immunized
intramuscularly with 1 mg of RNA-inactivated RSV strain long A,
boosted with 0.25 mg of RSV after 2 weeks, followed by 3 boosts
with 50 .mu.g of recombinant hRSV F.sub.TM-NN (membrane anchorless
form of the fusion protein, 70 kDa: Corral et al. 2007; BMC
Biotechnol. 7: 17) in a biweekly regimen. For all immunizations the
antigens were prepared as oil-PBS emulsions with Stimune as
adjuvant. Blood was collected from these animals 4 days and 10 days
after the fourth immunization, while also a Lymph node biopsy was
taken 4 days after the fourth immunization. For the Nanoclone
procedure, 100 mL blood was collected 11 days after the final boost
from llamas 206 and 207.
Example 2
Library Construction
[3569] Peripheral blood mononuclear cells were prepared from blood
samples using Ficoll-Hypaque according to the manufacturer's
instructions. Next, total RNA was extracted from these cells as
well as from the lymph node bow cells and used as starting material
for RT-PCR to amplify Nanobody.RTM. encoding gene fragments. These
fragments were cloned into phagemid vector derived from pUC119
which contains the LacZ promoter, a coliphage pIII protein coding
sequence, a resistance gene for ampicillin or carbenicillin, a
multicloning site and the gen3 leader sequence. In frame with the
Nanobody.RTM. coding sequence, the vector codes for a C-terminal
c-myc tag and a (His)6 tag. Phage was prepared according to
standard methods and stored at 4.degree. C. for further use, making
phage libraries 156, 157, 206, 207, 212 and 213.
Example 3
Nanobody.RTM. Selection with the F-Protein of hRSV
[3570] To identify Nanobodies.RTM. recognizing the fusion protein
of RSV, libraries 156, 157, 206, 207, 212 and 213 were used for
selection on F.sub.TMNN (membrane anchorless form of the Long
fusion protein, 70 kDa; Corral T. et al. 2007, BMC Biotechnol. 7:
17). The F.sub.TM-protein (25 ng/well) was immobilized on Nunc
Maxisorp ELISA plates. A control was included with 0 .mu.g/ml
F.sub.TM-. Bound phages were eluted from the F.sub.TM-using trypsin
and Synagis.RTM. (Palivizumab, MedImmune, humanized monoclonal
antibody, described in Zhao and Sullender 2005, J. Virol. 79: 3962)
in the first and second round of selections. Remicade (Infliximab,
anti-TNF; Centocor) was used as a control for Synagis.RTM.. A 100
molar excess of Synagis.RTM. was used in order to identify
Nanobodies.RTM. binding specifically at the Synagis.RTM. binding
site on RSV. Outputs from the first round selections, eluted with
Synagis.RTM. were used for second round selections.
[3571] In addition, selections were done using inactivated hRSV
strain Long (Hytest #8RSV79). The F.sub.TM-NN protein (25 ng/well)
or RSV (5 to 50 .mu.g/well) was immobilized on Nunc Maxisorp ELISA
plates, next to a control with 0 .mu.g/ml antigen. Bound phages
were eluted from the F.sub.TM-NN using trypsin, Synagis.RTM.
(Palivizumab, humanized monoclonal antibody, described in Zhao and
Sullender 2005, J. Virol. 79: 396), or 101F Fab (WO 06/050280,
humanized monoclonal antibody) in the first round of selection.
Outputs from the first round selections eluted with Synagis.RTM. or
101F Fab were used for second round selections, using either Numax
Fab (Motavizumab or MEDI-524, a third-generation humanized
monoclonal antibody product evolved from palivizumab; WO
06/050166), Synagis.RTM. or 101F Fab for elution. Remicade
(Infliximab, anti-TNF, see also WO 09/068,625) was used as a
control for Synagis.RTM., while Omnitarg Fab (anti-Herz; in-house
produced) served as control for Numax Fab and 101F Fab. A 100 molar
excess of Synagis.RTM., Numax Fab or 101F Fab was used in order to
identify Nanobodies.RTM. binding specifically to antigenic sites II
or IV-VI epitopes on the RSV F-protein. To obtain Nanobodies.RTM.
specific for the antigenic site IV-VI, second round selections were
performed using two biotinylated peptides: at first, a peptide
comprising residues 422-436 of the F-protein (Long) (Abgent, San
Diego, Calif.) encompassing the 101E binding epitope (Wu et al.
2007, J. Gen. Virol. 88: 2719-2723), secondly, a peptide mimic of
the epitope of Mab19 (HWSISKPQ-PEG4-K-biotin)(Chargelegue et al.
1998, J. Virol. 72: 2040-2056).
[3572] Outputs of both rounds of selections were analyzed for
enrichment factor (phage present in eluate relative to controls).
Based on these parameters the best selections were chosen for
further analysis. Individual colonies were picked and grown in 96
deep well plates (1 mL volume) and induced by adding IPTG for
Nanobody.RTM. expression. Periplasmic extracts (volume: .about.80
.mu.l) were prepared according to standard methods.
[3573] For testing of selected clones in RSV neutralization assays,
periplasmatic extracts from 10 ml cultures were partially purified
by using IMAC PhyTips (Phynexus Inc, San Jose, Calif.). In here
.about.800 .mu.l of periplasmatic extracts was loaded onto PhyTips
200+ columns prepacked with immobilized metal affinity
chromatography resin, followed by elution of His-tagged
Nanobodies.RTM. in 30 .mu.l of 0.1M glycine-HCl/0.15M NaCl (pH3),
after which eluates were neutralized with 5 .mu.l of 0.5 M Tris-HCl
pH8.5.
Example 4
Nanobody.RTM. Selection with F.sub.TM-NN of RSV Using Nanoclone
Technology
[3574] Peripheral blood mononuclear cells (PBMCs) were prepared
from blood samples using Ficoll-Hypaque according to the
manufacturer's instructions. Antigen specific B-cells expressing
heavy chain antibodies on their surface were isolated from the
PBMCs via FACS sorting (for a description of the Nanoclone
technology reference is made to WO 06/079372). Thereto, F.sub.TM-NN
protein was labeled with Alexa Fluor 488 dye (Invitrogen, Carlsbad,
Calif.; cat. nr. A20000) and subsequently desalted to remove
residual non-conjugated Alexa Fluor 488 dye according to the
manufacturer's instructions.
[3575] Pre-immune (background control) and immune PBMC of a llama
were stained with fluorescent dye conjugated IgG1 (conventional
heavy+light chain immunoglobulins), IgG2- and IgG3 (heavy chain
immunoglobulin classes) specific mouse monoclonal antibodies,
fluorescently labeled DH59B antibody (CD172a) (VMRD, Inc. Pullman,
W A; Cat No. DH59B; Davis et al. 1987, Vet. Immunol. Immunopathol.
15: 337-376) and Alexa 488 labeled antigen. TOPRO3 was included as
a live/dead cell discriminator dye. IgG1+B-lymphocytes, monocytes,
neutrophils and dead cells were gated out and therefore rejected
from sorting. Antigen-specific (A488+) IgG2- or IgG3 positive B
cells were single cell sorted individually into separate PCR plate
wells containing RT-PCR buffer.
[3576] For llama 206, 1.9% antigen positive cells of the total
amount of IgG2/IgG3 positive living cells was obtained (1.0% in
pre-immune reference sample), for llama 207 4.2% positive cells
were obtained (0.7% in pre-immune reference sample). Heavy chain
variable region genes were amplified directly from these B-cells by
single-cell RT-PCR and nested PCR. PCR products were subsequently
cloned into a TOPO-adapted expression vector derived from pUC119
which contained the LacZ promoter, a resistance gene for ampicillin
or carbenicillin, a multicloning site and the gen3 leader sequence.
In frame with the Nanobody.RTM. coding sequence, the vector coded
for a C-terminal c-myc tag and a (His)6 tag. The cloned constructs
were transformed in TOP10 Escherichia coli cells via high
throughput electroporation. Single clones were grown in 96 deep
well plates (1 ml volume) and induced by adding IPTG for
Nanobody.RTM. expression. Periplasmic extracts (volume: .about.80
.mu.l) were prepared via osmotic shock and analyzed for binding to
F.sub.TM- in a binding ELISA.
[3577] In short, 2 .mu.g/ml of F.sub.TM-was immobilized directly on
Maxisorp microtiter plates (Nunc). Free binding sites were blocked
using 4% Marvel in PBS. Next, 10 .mu.l of periplasmic extract
containing Nanobody.RTM. of the different clones in 100 .mu.l 2%
Marvel PBST were allowed to bind to the immobilized antigen. After
incubation and a wash step, Nanobody.RTM. binding was revealed
using a rabbit-anti-VHH secondary antibody (for the periplasmic
fractions). After a wash step the Nanobodies.RTM. in the
periplasmic fractions were detected with a HRP-conjugated
goat-anti-rabbit antibody. Binding specificity was determined based
on OD values compared to controls having received no
Nanobody.RTM..
[3578] In total, 8 positive F.sub.TM-NN binders (4 from llama 206,
4 from llama 207) were obtained out of 52 cloned VHHs.
Example 5
Screening for Nanobodies.RTM. that Bind to Antigenic Site II or
IV-VI
[3579] Periplasmic extracts containing single Nanobodies.RTM. were
analyzed for binding to the antigen site II or IV-VI, using an
Alphascreen.RTM. assay (Perkin Elmer; Waltham,
Mass.)(Garcia-Barreno at al. 1989, J. Virol. 63: 925-932; Lopeze at
al. 1998, J. Virol. 72: 6922-6928). In this setup F.sub.TM-NN is
bound simultaneously by Fabs of Synagis.RTM. and 101F, allowing
detection of Nanobodies.RTM. that interfere with binding of each of
the respective antigenic sites II and IV-VI. In here, periplasmic
extracts were added to F.sub.TM-NN protein (0.3 nM) and incubated
for 15 minutes. Subsequently biotinylated Fab Synagis.RTM. (0.3 nM)
and Fab 101F conjugated acceptor beads (10 .mu.g/ml) were added and
this mixture was incubated for 1 hour, Finally streptavidin-coated
donor beads (10 .mu.g/ml) were added and after 1 hour incubation
the plate was read on the Envision microplate reader. Periplasmic
extracts were diluted 25-fold which corresponds roughly to a final
concentration of 40 nM. The assay was validated by titration of the
known competitors of Synagis.RTM., mabs 1882 (Argene, Varilhes,
France; 18042 N1902) and 2F7 (Abcam, Cambridge, UK; ab43812). Also
Synagis.RTM. Fab, Numax Fab, and 101F Fab were analyzed, with Numax
Fab having the lowest IC50 value (8.6 E-11 M) followed by
Synagis.RTM. Fab (5.97 E-10 M) and 101F Fab (1.12 E-9 M). For the
screening of periplasmatic extracts (at 1/25 dilution) both Numax
Fab (40 nM) and 101F Fab (40 nM) were used as positive controls,
while irrelevant periplasmatic extracts served as negative
controls. Clones that interfered with binding to F.sub.TM-NN
protein in the Alphascreen.RTM. more than 75% relative to the
negative controls were identified as hit. In total 341 hits were
identified out of 1856 clones, derived from all 6 llamas but the
majority coming from llamas 206 and 207. In addition, out of 8
clones obtained from Nanoclone selections 3 clones showed
competition.
[3580] The correct antigen site (II or IV-VI) of the competitors
was deconvoluted by means of a competition ELISA with biotinylated
Synagis.RTM. Fab (2 nM) or biotinylated 101F Fab (3 nM) for binding
to F.sub.TM-NN protein (1 .mu.g/ml). In short, the F.sub.TM-NN
protein was immobilized on Maxisorp microtiter plates (Nunc) and
free binding sites were blocked using 4% Marvel in PBS.
Periplasmatic extracts were diluted 1/10 and mixed with the
biotinylated Fab prior to binding to the immobilized F.sub.TM-NN
protein. Control periplasmic fractions selected against other viral
coat proteins were included. The competing antibody was allowed to
bind to the immobilized antigen with or without Nanobody.RTM..
After incubation and a wash step, detection occurred via
Extravidin-HRP conjugated secondary antibodies (Sigma-Aldrich, St.
Louis, Mo.; Cat. No. E2886). Binding specificity was determined
based on OD values compared to controls having received no
Nanobody.RTM..
[3581] All hits were subjected to sequence analysis and classified
into families according to their CDR3 sequences (see Table C-4 and
A-1 in PCT application PCT/EP2009/056975 entitled "Amino acid
sequences directed against envelope proteins of a virus and
polypeptides comprising the same for the treatment of viral
diseases" filed by Ablynx N.V on 5 Jun. 2009).
Example 6
Screening for RSV Neutralizing Nanobodies.RTM.
[3582] From all six hRSV libraries 163 unique sequences (160
identified from phage libraries, 3 derived from Nanoclone) were
analyzed for RSV Long neutralizing capacity in a
micro-neutralization assay as partially purified proteins. Hep2
cells were seeded at a concentration of 1.5.times.10.sup.4
cells/well into 96-well plates in DMEM medium containing 10% fetal
calf serum (FCS) supplemented with Penicillin and Streptomycin (100
U/ml and 100 .mu.g/ml, respectively) and incubated for 24 hours at
37.degree. C. in a 5% CO.sub.2 atmosphere. The virus stock used is
referred to as hRSV strain long, Long LM-2 and Long M2 (used
interchangeably) and is a virus stock derived from ATCC VR-26 of
which the sequence of the F protein corresponds to P12568 or
M22643. The virus stock has been passaged several times from the
ATCC stock. The sequence of the F-protein was confirmed to be
identical to P12568 (see example 9). A standard quantity of hRSV
strain Long LM-2 was pre-incubated with serial dilutions of a fixed
volume of Phytips purified Nanobodies.RTM. (20 .mu.l) in a total
volume of 50 .mu.l for 30 minutes at 37.degree. C. The medium of
the Hep2 cells was replaced with the premix to allow infection for
2 hours, after which 0.1 ml of assay medium was added. The assay
was performed in DMEM medium supplemented with 2.5% fetal calf
serum and Penicillin and Streptomycin (100 U/ml and 100 .mu.g/ml,
respectively). Cells were incubated for an additional 72 hours at
37.degree. C. in a 5% CO2 atmosphere, after which cells were washed
twice with 0.05% Tween-20 in PBS and once with PBS alone, after
which the cells were fixed with 80% cold acetone (Sigma-Aldrich,
St. Louis, Mo.) in PBS (100 .mu.l/well) for 20 minutes at 4.degree.
C. and left to dry completely. Next the presence of the F-protein
on the cell surface was detected in an ELISA type assay. Thereto,
fixed Hep2 cells were blocked with 2% Bovine Serum Albumin (BSA)
solution in PBS for 1 hour at room temperature, than incubated for
1 hour with Synagis.RTM. (2 .mu.g/ml). For detection goat
Anti-Human IgG, Fc.gamma. fragment specific-HRP (Jackson
ImmunoResearch, West Grove, Pa.) was used, after which the ELISA
was developed according to standard procedures.
[3583] In addition to the previously identified RSV neutralizing
Nanobodies.RTM. 191D3 (SEQ ID NO: 9) and 192C4 (SEQ ID NO: 11),
which were included as positive controls in the screening, 5
antigenic site II clones showed strong RSV Long neutralizing
activity: 1E4 (also referred to as 207D1; SEQ ID NO: 1), 7B2 (SEQ
ID NO: 2), NC23 (SEQ ID NO: 3), and two members of the same family
15H8 (SEQ ID NO: 4) and NC41 (SEQ ID NO: 5) (Table A-1). None of
the antigenic site IV-VI specific Nanobodies.RTM. showed more than
very weak neutralizing activity for hRSV Long LM-2 strain.
Example 7
Production of hRSV Nanobodies.RTM.
[3584] In addition to the previously identified RSV neutralizing
Nanobodies.RTM. 191D3 (SEQ ID NO: 9) and 191E4 (SEQ ID NO: 10),
which were included as positive controls in the screening, five new
neutralizing Nanobodies.RTM. selected from the screening described
above (1E4, 7B2, 15H8, NC23 and NC41) as well as 1 antigenic site
IV-VI Nanobodies.RTM. (15B3; SEQ ID ND: 7) were expressed, purified
and further characterised. Thereto the encoding sequences were
recloned in an expression vector derived from pUC119 which
contained the LacZ promoter, a resistance gene for kanamycin, a
multicloning site and the OmpA signal peptide sequence. In frame
with the Nanobody.RTM. coding sequence, the vector coded for a
C-terminal c-myc tag and a (His)6 tag.
[3585] Expression occurred in E. coli TG-1 cells as c-myc,
His6-tagged proteins in a culture volume of 1 L. Expression was
induced by addition of 1 mM IPTG and allowed to continue for 3
hours at 37.degree. C. After spinning the cell cultures,
periplasmic extracts were prepared by freeze-thawing the pellets
and resuspension in dPBS. These extracts were used as starting
material for immobilized metal affinity chromatography (IMAC) using
Histrap FF crude columns (GE healthcare, Uppsala, Sweden).
Nanobodies.RTM. were eluted from the column with 250 mM imidazole
and subsequently desalted towards dPBS.
Example 8
Characterization of hRSV Nanobodies.RTM.
Binding to F-Protein in ELISA
[3586] All purified Nanobodies.RTM. were shown to bind to the
F-protein in a binding ELISA to F.sub.TM-NN protein and to hRSV.
Results for hRSV binding are shown in Table B-1. In short, 1
.mu.g/ml of F.sub.TN-NN or 5 .mu.g/ml hRSV (Hytest Turku, Finland)
were immobilized directly on Maxisorp microtiter plates. Free
binding sites were blocked with 1% casein. Serial dilutions of
purified Nanobodies.RTM. were allowed to bind the antigen for 1
hour. Nanobody.RTM. binding was revealed using a rabbit-anti-VEIN
secondary antibody, and final detection with a HRP-conjugated
goat-anti-rabbit antibody. Binding specificity was determined based
on OD values compared to irrelevant Nanobody.RTM. controls.
Binding to F-Protein in Biacore
[3587] To determine the precise binding affinities of the purified
Nanobodies.RTM., a kinetic analysis was performed using Surface
Plasmon resonance analysis on the F.sub.TM-NN protein. For
preincubation of the Sensorchip CM5, 10 .mu.g/ml hRSV
F.sub.TM-protein was left on for 120 seconds. For immobilization by
amine coupling, EDC/NHS was used for activation and ethanolamine
HCl for deactivation (Biacore, amine coupling kit). 100 nM
Synagis.RTM. was added and then 100 nM of the Nanobodies.RTM..
Evaluation of the off-rates was performed by fitting a 1:1
interaction model (Langmuir binding model) by Biacore T100 software
v1.1. The off-rates and affinity constants are shown in Table
B-1.
Competition with Synagis.RTM.
[3588] The ability of purified Nanobodies.RTM. to compete with
Synagis.RTM. Mab or biotinylated Synagis.RTM. Fab for binding to
F.sub.TM-NN was determined in competition ELISA following the
procedure as essentially described in example 5. FIG. 1 shows a
representative example of a competition ELISA wherein purified
Nanobodies.RTM. compete with biotinylated Synagis.RTM. Fab for
binding to F.sub.TM-NN. EC50 values are summarized in Table
B-1.
Example 9
In Vitro Micro Neutralization of Distinct hRSV Strains
[3589] The potency of purified Nanobodies.RTM. in neutralization of
different type A and B RSV strains was tested by the in vitro micro
neutralization assay (see Example 6). Viral stocks of RSV Long LM-2
(Accession No. P12568; ATCC VR-26), RSV A-2 (ATCC VR-1540; lot nr.
3199840) and RSV B-1 (ATCC VR-1580; lot nr. 5271356) were prepared
into Hep2 cells and subsequently titrated to determine the optimal
infectious dose for use in the micro neutralization assay. Results
of neutralization potencies of the different purified
Nanobodies.RTM. are shown in Table B-1. While all six
Nanobodies.RTM. that recognize the Synagis.RTM. epitope could
efficiently neutralize type A strains Long and A-2, they failed to
neutralize infection with the B-1 strain or did so at
concentrations >1 .mu.M. The 101F competitors 15B3 and 191E4
showed very weak neutralization potency on the B-1 strain only when
administrated at .mu.M concentrations.
[3590] The sequences of the respective F-proteins of the different
RSV strains were verified by means of reverse-transcriptase PCR and
subsequent sequence analysis. Briefly, total RNA was isolated from
RSV-infected Hep2 cells using RNeasy mini kit (Qiagen, Venlo,
Netherlands), after which complementary DNA was prepared using
Superscript III reverse transcriptase kit (Invitrogen, Carlsbad,
Calif.). The F-protein of RSV A strains was amplified and sequenced
using the primers described in Kimura et al. 2004 (Antiviral
Research 61: 165-171). For amplification of the RSV B-1 strain
F-protein the following primers were used: FB1_outer_for:
cttagcagaaaaccgtga (SEQ ID NO: 13); FB1_outer_rev:
tgggttgatttgggattg (SEQ ID NO: 14); FB1_seq.sub.--1123-for:
ggactgatagaggatggta (SEQ ID NO: 15); FB1_seq.sub.--1526-rev:
gctgacttcacttggtaa (SEQ ID NO: 16). The sequence of RSV B-1 strain
corresponded to Accession nr P13843, with an additional point
mutation Ser540Leu. The sequence for the RSV Long M2 strain
corresponded completely to the reported sequence (Accession nr
M22643). The sequence for the strain RSV A-2 corresponded to
Accession M11486. See also Table A-2.
Example 10
Construction, Production and Characterization of Multivalent hRSV
Nanobodies.RTM.
[3591] Multivalent Nanobody.RTM. constructs connected by Gly-Ser
linkers of different lengths and composition were generated by
means of separate PCR reactions (1 for the N-terminal, I for the
middle (in case of trivalent) and 1 for the C-terminal
Nanobody.RTM. subunit) using different sets of primers encompassing
specific restriction sites. Similarly, multivalent constructs
connected by Ala-Ala-Ala linker were generated. All constructs were
cloned into an expression vector derived from pUC119 which
contained the LacZ promoter, a resistance gene for kanamycin, a
multicloning site and the OmpA signal peptide sequence. In frame
with the Nanobody.RTM. coding sequence, the vector coded for a
C-terminal c-myc tag and a (His)6 tag. In case a 35 Gly-Ser-linker
was present in the multivalent construct, an expression vector was
used derived from pUC119 which contained the LacZ promoter, a
resistance gene for kanamycin and the OmpA signal peptide sequence.
Directly downstream of the signal peptide a multiple cloning site
was present for Nanobody.RTM. insertion, followed by a 35Gly-Ser
linker encoding DNA sequence and a second multiple cloning site for
cloning of a second Nanobody.RTM. sequence. In frame with the
resulting Nanobody.RTM.-35Gly-Ser-Nanobody.RTM. coding sequence,
the vector coded for a C-terminal c-myc tag and a (His)6 tag. Table
B-2 lists the multivalent constructs generated with RSV-specific
Nanobodies.RTM.. The sequences of the multivalent constructs are
shown in Table A-3.
[3592] Multivalent RSV Nanobody.RTM. constructs were expressed,
purified and further characterized. Production was done in E. coli
TG1 cells, followed by purification from the periplasmic fraction
via the His-tag by IMAC and desalting, essentially as described in
Example 7. For certain trivalent constructs (e.g. RSV401, RSV404,
RSV406) production was done in P. pastoris followed by purification
from the medium fraction. All trivalent Nanobodies.RTM. were
subjected to gel filtration as a final step to remove possible
bivalent and monovalent degradation products.
[3593] Binding of purified multivalent Nanobodies.RTM. to the hRSV
F-protein was confirmed in ELISA on both F.sub.TM-protein and on
hRSV (see Example 8). For the majority of Nanobodies.RTM. the
formatting into bivalent and trivalent constructs resulted in a
clear but limited (up to 10-fold increase) avidity effect, with the
exception of multivalents of 7B2 and NC23 which showed similar EC50
values as their monovalent counterparts (as shown for 7B2 in FIG.
2).
Example 11
Potency of Bi- and Trivalent Constructs to Neutralize hRSV
[3594] The potency of the Nanobody.RTM. constructs was evaluated in
the RSV neutralization assay on different RSV strains (see examples
6 and 9). Bivalent Nanobodies.RTM. binding antigenic site II showed
marked increases in potencies of 100-to 1000-fold (i.e. much higher
than the increase in affinity) in neutralization of Long relative
to their monovalent counterparts, with IC50 values ranging from
50-380 pM, being better or similar to Numax Fab. On the RSV B-1
strains however, the potency increase was much less strong, and
none of the dimeric constructs was more potent than Synagis.RTM..
Surprisingly, this could be overcome by the generation of trivalent
constructs, as shown in FIG. 3. Trivalent constructs with three
Nanobodies.RTM. binding antigenic site II were at least 1000-fold
more potent neutralizers on RSV B-1 strains than their monovalent
counterparts.
Example 12
Reactivity of Monovalent Nanobodies.RTM. with Escape Mutants of the
Long Strain
[3595] A number of escape mutants, described in Lopez et al. 1998
(J. Viral. 72: 6922-6928), and specific for antigenic site II
(R47F/4, R47F/7, RAK13/4, R7C2/11, R7C2/1) or IV-VI (R7.936/1,
R7.936/4, R7.936/6, R7.432/1) or the combination of both (RRA3),
were selected for testing their reactivity with 10 monovalent
Nanobodies.RTM., including Nanobody.RTM. 19107 (SEQ ID NO: 8)
previously identified as not binding to antigenic sites II or
IV-VI.
[3596] This assay was performed according to Lopez et al. 1998 (J.
Viral. 72: 6922-6928). In brief, each Nanobody.RTM. was tested at
0.2 .mu.g/ml in ELISA using antigen extracts of HEp-2 cells
infected with the different escape mutants. Absorbance results were
normalized for reactivity on the reference virus strain (Long wild
type) strain as well as on the control Nanobody.RTM. 191C7. Results
are shown in Table B-3.
[3597] A reactivity of >75% is indicated as a filled black
square, dark hatched squares correspond to a reactivity between 75
and 50%, light hatched squares correspond to a reactivity of 25-50%
and less than 25% reactivity is indicated by a blank square. In
general Nanobodies.RTM. already identified as antigenic site II
binders previously (192C4, 191D3, 191F2, NC23, 15H8, 7B2 and NC41)
were found to be sensitive to typical mutations in antigenic site
II, while the other Nanobodies.RTM. already identified as antigenic
site IV-VI binders were indeed sensitive for mutations in these
sites.
Example 13
Reactivity of Multivalent Nanobodies.RTM. with Escape Mutants of
the Long Strain
[3598] Subsequently a number of multivalent constructs was analyzed
on a limited panel of escape viruses to assess binding. This assay
was performed according to Lopez et al. 1998 (J. Virol. 72:
6922-6928). In brief, each Nanobody.RTM. was tested at 0.1 .mu.g/ml
for monovalent Nanobodies.RTM. and at 0.05 .mu.g/ml for bi- and
trivalent Nanobodies.RTM. in ELISA using antigen extracts of HEp-2
cells infected with the different escape mutants. Absorbance
results were normalized for reactivity on the reference virus
strain (Long wild type) strain as well as on the control
Nanobody.RTM. (191E4; SEQ ID NO: 10, in this particular assay).
Results are shown in Table B-4.
[3599] A reactivity of >75% is indicated as a filled black
square, dark hatched squares correspond to a reactivity between 75
and 50%, light hatched squares correspond to a reactivity of 25-50%
and less than 25% reactivity is indicated by a blank square.
Remarkably, multivalent constructs showed improved binding compared
to their monovalent counterpart, to the mutant virus R7C2/11. In
addition the biparatopic construct RSV403 was not sensitive to any
of the mutants.
Example 14
Neutralization of Escape Mutants of the Long Strain by Multivalent
Nanobodies.RTM.
[3600] In examples 12 and 13, the binding of monovalent
Nanobodies.RTM. to typical antigenic site it and/or IV-VI RSV
escape mutants has been described. Binding of Nanobodies.RTM.
specifically recognizing these antigenic sites was almost lost or
significantly reduced. Formatting of these Nanobodies.RTM. into bi-
or trivalent constructs partially restored binding activity but not
for all three escape mutant viruses. Binding to the escape mutant
R7C2/1 (mutation K272E in antigenic site II) remained below the
level of 25% for any bi-or trivalent construct consisting solely of
antigenic site II binding Nanobodies.RTM.. The Nanobodies.RTM. 15B3
and 191E4, which are binding to antigenic site IV-VI, were the only
Nanobodies.RTM. (as such or in biparatopic constructs) able to bind
this mutant at a level of 75% or more.
[3601] More detailed analysis of the data indicated that binding
towards R7C2/1 slightly increased when the valency of the
Nanobody.RTM. was increased. The binding of 7B2 constructs was 0,
4.4 and 13% respectively for the monovalent, bivalent (RSV106) and
trivalent (RSV400) formats. Such a low level of residual binding is
expected to result in very high loss of potency to neutralize
RSV.
[3602] The neutralizing potency of Nanobodies.RTM. was assessed on
the same selected set of escape mutants as described in example 13.
For this purpose the monovalent Nanobodies.RTM. 7B2, 15H8 and NC41
were compared to their respective trivalent counterparts, RSV400,
RSV 404 and RSV 407. Of note, in example 13 only RSV400 was
assessed for binding these escape mutants. In addition also the
biparatopic trivalent molecule RSV403 (7B2-15B3-7B2) was analyzed
for its neutralizing capacity.
[3603] The hRSV micro neutralization assay was essentially
performed as described in example 6. In brief, Hep2 cells were
seeded at a concentration of 1.5.times.10.sup.4 cells/well into
96-well plates in DMEM medium containing 10% fetal calf serum (FCS)
supplemented with Penicillin and Streptomycin (100 U/ml and 100
.mu.g/ml, respectively) and incubated for 24 hours at 37.degree. C.
in a 5% CO.sub.2 atmosphere. Viral stocks of different viruses were
prepared into Hep2 cells and subsequently titrated to determine the
optimal infectious dose for use in the micro neutralization assay.
A standard quantity of the specific hRSV strain was pre-incubated
with serial dilutions of purified Nanobodies.RTM. in a total volume
of 50 .mu.l for 30 minutes at 37.degree. C. The medium of the Hep2
cells was replaced with the premix to allow infection for 2 hours,
after which 0.1 ml of assay medium was added. The assay was
performed in DMEM medium supplemented with 2.5% fetal calf serum
and Penicillin and Streptomycin (100 U/ml and 100 .mu.g/ml,
respectively). Cells were incubated for an additional 72 hours at
37.degree. C. in a 5% CO2 atmosphere, after which cells were washed
twice with 0.05% Tween-20 in PBS and once with PBS alone, after
which the cells were fixed with 80% cold acetone (Sigma-Aldrich,
St. Louis, Mo.) in PBS (100 .mu.l/well) for 20 minutes at 4.degree.
C. and left to dry completely. Next the presence of the F-protein
on the cell surface was detected in an ELISA type assay. Thereto,
fixed Hep2 cells were blocked with 5% Porcine Serum Albumin
solution in PBS for 1 hour at room temperature, than incubated for
1 hour with anti-F-protein polyclonal rabbit serum (Corral et al.
2007, BMC Biotechnol, 7: 17) or Synagis.RTM. (2 .mu.g/ml). For
detection goat Anti-rabbit-HRP conjugated antibodies or goat
Anti-Human IgG, Fc.gamma. fragment specific-HRP (Jackson
ImmunoResearch, West Grove, Pa.) was used, after which the ELISA
was developed according to standard procedures.
[3604] As shown in FIGS. 4A-C, the monovalent Nanobodies.RTM. had
almost no neutralizing potential towards the antigenic site II
escape mutant viruses R7C2/11 and R7C2/1. The potency to neutralize
the R7.936/4 antigenic site IV-VI variant was comparable to the
potency to neutralize the wild type Long strain. These data are in
line with the binding data of example 12 and the epitope mapping as
described for these Nanobodies.RTM. in example 5.
[3605] The trivalent Nanobody.RTM. constructs however, were
potently neutralizing all 3 escape mutants (FIGS. 4D-G). Maximal
inhibition was observed at concentrations as low as about 20 nM
while this level of inhibition was not observed for the monovalent
Nanobodies.RTM. at concentrations up to 2 .mu.M. The potent
neutralization of R7C2/1, almost equivalent to the neutralization
of R7C2/11, is most surprising since example 13 showed a very
significant loss of binding activity for the trivalent molecule
RSV400 which was expected to result in a very high loss of
neutralization potency. The bivalent IgG Synagis.RTM. Palivizumab,
also recognizing antigenic site II was not able to block
replication of R7C2/1 or R7C2/11 significantly at concentrations of
about 0.2 .mu.M. At this concentration an IC50 was not reached
while R7.936/4 and wild type Long virus were neutralized with an
IC50 of a few nM (data not shown).
Example 15
Analysis of Impact of Linker Length on Potency of NC41
Trivalents
[3606] To determine the impact of the linker length of trivalents
of NC41, different constructs with linkers ranging from 3Ala, 9GS,
15GS, to 20GS linkers (RSV408, RSV409, RSV407 and RSV410 resp.)
were generated. All four NC41 trivalents were able to completely
neutralize both RSV B-1 and Long strains (FIG. 5). No effect of
linker length was observed in neutralization of RSV Long, as all
constructs were equally potent. By contrast, the constructs with
9GS and 3Ala linkers had increased IC50 values on the B-1 strain,
indicating that a minimal linker length of 15GS is required for
maximal potency. This may be explained by the observation that
bivalent NC41 constructs already are very potent neutralizers on
Long, while on the B-1 strain the potency difference between
bivalent and trivalent NC41 is much larger (see Example 11). In
RSV408 and RSV409 the accessibility of the middle Nanobody.RTM. may
be less optimal.
Example 16
Humanization of Nanobody.RTM. NC41
[3607] The sequence of Nanobody.RTM. NC41 was aligned to the human
germline VH3-23 to allow selection of residues suitable for further
humanization of the Nanobody.RTM. sequence. In addition, in silico
analysis was done to identify residues that are potentially prone
to post-translational modifications, such as Asp isomerisation, and
to identify mutations that might improve the chemical stability.
The CDR regions and the so-called Hallmark residues, which are
known to be essential for the stability and potency of
Nanobodies.RTM. were excluded for modification.
[3608] For NC41 in total 11 positions were selected for mutation to
the corresponding human residue: Four mutations were simultaneous
introduced (Val5Leu, Ala14Pro, Glu44Gly, Gln108Leu), as these
residues were not expected to dramatically affect the Nanobody.RTM.
function (based on data from other Nanobodies.RTM.). In this basic
variant, seven residues of which it was unknown whether mutation to
the human counterpart was allowed (Ser19Arg, Ile20leu, Ala74Ser,
Gly78Leu, Ala83Arg, Asp85Glu, Arg105Gln) were mutated using a
library approach, allowing either the wildtype or the corresponding
human amino acid at each position. The resulting library, with a
theoretical diversity of 128, was generated by gene assembly using
overlapping oligonucleotide sequences containing degenerated codon
use, and subsequently cloned into an expression vector derived from
pUC119 which contained the LacZ promoter, a resistance gene for
kanamycin, a multicloning site and the OmpA leader sequence. In
frame with the Nanobody.RTM. coding sequence, the vector coded for
a C-terminal c-myc tag and a (His)6 tag. Nanobodies.RTM. were
produced in the periplasm of E. coli (see Example 7). Library
diversity was confirmed by sequence analysis.
[3609] Periplasmic extracts from 368 individual NC41 variants and
wildtype NC41 were generated and subjected to a functional
screening cascade to identify the best humanized NC41 variant, in
terms of both potency and stability. In a first step, RSV binding
of humanized NC41 variants to RSV Long was determined in ELISA
(Hytest, Turku Finland; #8RSV79)(see Example 8). Moreover, the
positive binders were analyzed for binding to Hep2 cells infected
with RSV B-1 strain. In here, Hep2 cells were seeded into 96-wells
plates and infected with RSV B-1 strain, essentially following the
procedure described for the neutralization assay (see Example 6).
Three days later cells were fixed with ice-cold acetone and plates
were used in an ELISA assay using periplasmic extracts at different
dilutions. Nanobody.RTM. binding to Hep2-B1 infected cells was
detected using anti-VHH rabbit polyclonal antibody, followed by
goat Anti-rabbit-HRP conjugated antibodies, after which the ELISA
was developed according to standard procedures.
[3610] Additionally, in order to verify if the introduced mutations
affected the temperature stability, periplasmatic extracts of all
binders were heated to 74.degree. C. for 2 hours, which is
5.degree. C. above the melting temperature of wildtype NC41. The
binding to RSV long before and after heating was analyzed in ELISA,
and the ratio of binding signal after vs. before heating was taken
as measure for temperature stability.
[3611] Finally, the kinetic off-rates of the variants were
determined in Biacore assay on the F.sub.tm-NN protein, as
described in Example 8.
All binders were sequenced and ranked according to their capacity
to bind the F-protein of RSV. When analyzing the sequences of the
strongest binders, a clear preference for Gln105 (human residue)
was observed in all cases. Whereas the Ile20Leu mutation appeared
underrepresented, for all other positions there was no clear
preference for either the wild type or the human sequence, with
variants containing up to 10 mutations compared to wildtype NC41.
Notably, in one variant an additional pointmutation (Gly54Asp)
within the CDR2 region was observed. This variant, NC41 variant 6,
showed the lowest off-rate of all variants and wildtype NC41,
resulting in affinity increase.
[3612] Based on the sequence and functional data, 18 variants
(Table A-4) were selected for further characterization as purified
proteins (FIGS. 6 and 7). All variants were produced and purified,
and potencies for neutralization of RSV Long and B-1 were
determined in the micro neutralizations assay. While most variants
showed very similar activity to wildtype NC41, several variants
showed increased potency on both Long (2-fold) and B-1 (6-fold),
with the strongest neutralizers being NC41 variants 6, 8, 9 17, and
18. Notably, variant 18 was maximally humanized at all 11
positions, with the additional introduction of Asp54 in the CDR2
region. Variant 10 and 11 were more potent in neutralizing B-1
strain than NC41, but not on Long strain.
[3613] For a select panel of NC41 variants the kinetic binding
parameters were determined in Biacore on F.sub.tm. NN protein
(Table B-5) as described in Example 8. No significant differences
in the calculated data were observed for NC41 and the humanized
NC41 variants 6, 8 and 17. It should be noted that the on-rates of
all NC41 variants were at the detection limit of the instrument,
but the off-rates could be ranked as v06<v17<NC41<v08. The
impact of the Gly to Asp mutation in CDR2 (position 54) could be
clearly demonstrated when comparing v17 and v18 as this is the only
difference in these maximally humanized variants. Neutralization
was tested for both the Long strain and the B-1 strain in two
independent assays in comparison to the NC41 wild type as shown in
table 8-5. In both assays NC41v18 was more potent than NC41 on both
viruses and in both assays NC41v18 was more potent than NC41v17 on
the Long strain. The improved neutralization of NC41v18 was also
observed for the B-1 strain in the second assay.
[3614] All NC41 variants were subjected to heat-induced unfolding
to assess the effect of the introduced mutations on the stability
of the protein. Thereto the melting temperature (Tm) was determined
by stepwise increase in temperature in presence of Sypro Orange, a
dye that binds to Trp residues that become exposed upon unfolding
of the protein. All variants showed to have increased Tm relative
to wildtype NC41 (69.degree. C.), up to 9.degree. C. for variant
18.
Example 17
Further Sequence Optimization of NC41 for Expression
[3615] The sequence of Nanobody.RTM. NC41 was further analyzed with
the aim to optimise expression in Pichia pastoris. NC41 variants
19-26 were designed by combining humanized positions that were
shown to be permitted without loss in potency in the
micro-neutralization assay (Example 16). Four mutations were
simultaneous introduced (Ala14Pro, Ser19Arg, Ile20Leu, Gln108Leu),
while three mutations were both individually and in each possible
combination examined (Ala83Arg, Asp85Glu, Arg105Gln)(see Table
A-4). All constructs were cloned into an expression vector and
introduced into the Pichia pastoris strain XL-33, after which the
number of incorporations in the Pichia genome was assessed by
quantitative real-time PCR. From each construct one clone with 1-2
copies and one with four or more copies were selected for small
scale productions, and expression yield of NC41 variants relative
to wild type was estimated by gel electrophoresis on SDS-PAGE gels.
NC41 variants 20, 22, 24, 25 and 26 showed the highest expression,
with similar expression levels as wild type NC41 already at low
copy number.
[3616] NC41 variants 22 and 26 were recloned in an expression
vector for E. coli for production and purification of
Myc-His-tagged Nanobodies (see example 7). The potency of both
variants for neutralization of RSV Long was tested in the micro
neutralization assay, as described in example 6. Both variants were
equally potent as wild type NC41 (IC50 of 126 and 310 nM for v22
and v26, respectively).
Example 18
Sequence Optimization of RSV407 for Chemical Stability
[3617] During the production of the Nanobodies and polypeptides of
the invention, pyro glutamate
[3618] (pGlu) on the amino terminus was observed (via RP-HPLC).
Levels of more than 15% pGlu were detected following fermentation
and the level of pGlu was steadily increasing upon storage during
stability studies. Therefore, the N-terminal Glutamate (E) was
changed into an Aspartate (D). This would eliminate the possibility
of pGlu post-translational modification of the N-terminus and hence
lead to increased product stability.
[3619] The amino acid sequence of the sequence optimized
Nanobody.RTM. variant is given in Table A-5 (RSV434; SEQ ID NO:
142) respectively. For the production of this Nanobody.RTM. a
Pichia expression system was developed based on the commercially
available system from Invitrogen using X-33 as a host strain. The
system makes use of the AOX1 promoter to drive the production of
the Nanobody.RTM. and uses the alpha mating secretion peptide for
secretion of the Nanobody.RTM. into the medium.
[3620] The sequence optimized RSV434 was analyzed for expression
levels, via RP-HPLC, SE-HPLC and compared to the parental molecule
(RSV407) with respect to RSV neutralization.
[3621] There was no significant difference in expression level
compared to RSV407 and both the low and high copy number clones
were producing more than 1 g/L clarified medium (cell free).
[3622] One ml samples were captured on a 1 ml MEP Hypercel column,
eluted and analyzed via SE-HPLC and RP-HPLC. SE-HPLC analysis
showed monomeric material, whereas RP-HPLC analysis, as expected,
clearly showed the absence of the pGlu post peak.
[3623] RSV434 was further purified from the medium, captured on MEP
HyperCell and polished via anion exchange chromatography.
[3624] Rn hRSV micro neutralization assay was essentially performed
as described in example 6. FIG. 9 shows the neutralization on both
RSV Long and B-1 strains by both RSV407 and its sequence optimized
variant RSV434.
Example 19
Preparation of Multivalent Constructs of Humanized and/or Sequence
Optimized NC41 Nanobody.RTM.
[3625] NC41 humanized variants of Example 16 were formatted as
trivalent constructs using 15GS linkers (sequences are shown in
Table A-5). The trivalents were produced and purified as described
in Example 10. FIG. 8A shows the neutralization on both RSV Long
and B-1 strains of two of the trivalent humanized NC41 variants
with their corresponding monovalent Nanobodies.RTM.. FIG. 8B shows
the neutralization on both RSV Long and B-1 strains of the
trivalent NC41 variants. IC50 values for neutralization of RSV Long
and B-1 strains by the trivalent NC41 variants are shown in Table
B-7. Similar as to parental NC41 trivalent (RSV407), trivalents of
the humanized NC41 variants were around 60 times more potent
neutralizers of Long than Synagis.RTM.. On the B-1 strain
trivalents were more potent neutralizers than Synagis, but here
also slightly enhanced compared to the trivalent of parental NC41
RSV407 in following order RSV427>RSV426>RSV414. The increased
potency of monovalent variants for B-1 thus appeared to have
resulted in slightly improved trivalents.
[3626] Based on further sequence optimization shown in Examples 17
and 18, a number of additional trivalent constructs (Table B-6)
were generated. All constructs were cloned in a Pichia pastoris
expression vector, transformed into Pichia and subjected to
fermentation to test expression levels, stability and potency. Both
in small scale shake flask expressions and fermentation RSV440
(variant 26) and RSV441 (variant 22) showed high expression
levels.
Example 20
In Vitro Efficacy of the Multivalent Constructs
[3627] The neutralizing capacity of Nanobody RSV434 and Synagis was
evaluated in a plaque reduction assay against 31 RSV/A and 30 RSV/B
clinical isolates. Both anti-RSV compounds as well as Synagis were
tested at a single concentration of 40 .mu.g/ml.
[3628] Synagis and RSV434 both performed efficiently with
respectively 87% and 97% of the strains being reduced in virus
titers by at least 100-fold compared to PBS control (Table B-8). In
addition, RSV434 showed greater neutralizing capacity compared to
Synagis. The majority of the RSV strains (84%) were completely
inhibited by RSV434 while significantly fewer strains (20%) were
completely inhibited by Synagis (Table B-8).
Example 21
In Vivo Efficacy of the Multivalent Constructs
[3629] The cotton rat model is the golden standard model for RSV.
In this model, the cotton rats are infected with the RSV/Tracy
strain (day 0) and 4 days after infection, viral titers and viral
RNA are assessed in lung lavages and nasal washes. In a
prophylactic set-up, a significant and dose-dependent decrease in
viral load was observed upon intranasal administration of RSV407,
24 hours before RSV infection (FIG. 10).
[3630] In addition, a therapeutic approach was explored in which
infected cotton rats were treated with the Nanobodies after 24 h or
48 h of infection thereby mimicking the situation of RSV infected
humans. In both cases significant inhibition of viral replication
was observed (Table 8-9 and FIG. 11).
[3631] In all studies performed to date, the Nanobody was delivered
intranasally as a mimic for pulmonary delivery. Using this route of
administration 9-41% of Nanobody was available in the lungs as
assessed by ELISA on bronchial lavage taken shortly after
administration.
[3632] In an attempt to overcome the possible interference of
residual Nanobody in the lung lavages, the viral detection was
delayed to day 7 post inoculation. A separate pharmacokinetic study
performed in Sprague Dawley rats allowed to estimate the half life
of the Nanobody in the lung to be about 10.8. At day 7 which is S-6
days after the last administration, the Nanobody is sufficiently
cleared from the lung to no longer interfere in the assay. The
viral load of positive control animals dropped from 10E5 to 10E2
pfu/ml. Nevertheless it was still possible to show a reduction of
about 0.6 log by treatment with RSV407 (Table B-9).
[3633] As an alternative approach a quantitative PCR was developed
to detect viral RNA. Both in prophylactic and therapeutic
experiments a significant reduction in RSV RNA was observed (Table
B-9).
Example 22
Generation of RSV Escape Mutants
[3634] In order to identify the critical contact residues with the
F-protein, the generation of RSV Long escape mutants was analyzed
after culturing RSV Long in presence of Nanobodies at about their
respective IC90 concentrations. Both monovalent NC41 (at 5
.mu.g/ml) and its trivalent RSV407 (at 2.5 ng/ml) were used, as
well as the bispecific trivalent RSV413 (NC41-15B3-NC41) to verify
if a construct that recognizes two different epitopes would affect
the time frame of viral escape onset. After 12 passages of
successive incubation of Long on Hep2 cells in presence of
Nanobodies, viral out growth was observed for the conditions with
monovalent NC41 but surprisingly not with the trivalent Nanobodies.
Single virus stocks were purified from plaques for repetitive
rounds, after which the sequence of the F-protein of the potential
escape variant could be determined. Two distinct escape variants
were identified for NC41, NC41/13 with the mutation of N262Y, and
NC41/17 containing mutation N276Y.
Tables
TABLE-US-00001 [3635] TABLE A4 Sequences of monovalent Nanobodies
.RTM. that bind RSV F protein Nanobody .RTM. SEQ ID NO: Sequence
1E4 1 EVQLVESGGGLVQAGGSLRLSCEASGRTFSSYGMGWERQAPGKEREF 207D1
VAAVSRLSGPRTVYADSVKGRFTISRDNAENTVYLQMNSLKPEDTAV
YTCAAELTNRNPGAYYYTWAYDYWGQGTQVTVSS 7B2 2
EVQLVESGGGLVQAGDSLRLSCAASGRTFSSYAMGWFRQAPGKEREF
VAAISWSDGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVY
YCAADLTSTNPGSYIYIWAYDYWGQGTQVTVSS NC23 3
EVQLVESGGGLVQPGGSLRLSCAASGRTFSSIAMGWFRQAPGKEREF
VAAISWSRGRTFYADSVKGRFIISRDDAANTAYLQMNSLKPEDTAVY
YCAVDTASWNSGSFIYDWAYDHWGQGTQVTVSS 15H8 4
EVQLVESGGGLVQAGGSLRLSCAASGRSFSNYVLGWERQAPGKEREF 19C4
VAAISFRGDSAIGAPSVEGRFTISRDNAKNTGYLQMNSLVPDDTAVY
YCGAGTPLNPGAYIYDWSYDYWGRGTQVTVSS NC41 5
EVQLVESGGGLVQAGGSLSISCAASGGSLSNYVLGWFRQAPGKEREF
VAAINWRGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLAPDDTAVY
YCGAGTPLNPGAYIYDWSYDYWGRGTQVTVSS NC39 6
EVQLVESGGGWVQAGGSLRLSCAASGRAFSSYAMGWIRQAPGKEREF
VAGIDQSGESTAYGASASGRFIISRDNAKNTVHLLMNSLQSDDTAVY
YCVADGVLATTLNWDYWGQGTQVTVSS 15B3 7
EVQLVESGGGLVQPGGSLRLSCAASGLTLDYYALGWFRQAPGKEREG
VSCISSSDHSTTYTDSVKGRFTISWDNAKNTLYLQMNSLKPGDTAVY
YCAADPALGCYSGSYYPRYDYWGQGTQVTVSS 191C7 8
EVQLVESGGGLVQAGGSLRLSCAASGSSGVINAMAWHRQAPGKEREL
VAHISSGGSTYYGDFVKGRFTISRDNAKDTVYLQMNSLKPEDTAVYY
CHVPWMDYNRRDYWGQGTQVTVSS 191D3 9
EVQLVESGGGLVQAGGSLRLSCEASGRTYSRYGMGWFRQAPGKEREF 1G3
VAAVSRLSGPRTVYADSVKGRFTISRDNAENTVYLQMNSLKPEDTAV
YTCAAELTNRNSGAYYYAWAYDYWGQGTQVTVSS 191E4 10
EVQLVESGGGLVQAGGSLRLSCAASGPTFSADTMGWFRQAPGKEREF 1B2
VATIPWSGGIAYYSDSVKGRFTMSRDNAKNTVDLQMNSLKPEDTALY
YCAGSSRIYIYSDSLSERSYDYWGQGTQVTVSS 192C4 11
EVQLVESGGGLVQAGGSLRLSCEASGRTFSSYAMVGWFRQAPGKERE
FVAAVTRWSGARTVYADSVKGRFTISRDNAENTVYLQMNSLKPEDTA
VYTCAADSTNRNSGAVYYSWAYDYWGQGTQVTVSS 192F2 12
EVQLVESGGGLVQAGGSLRLSCEASGRTFSPIAMGWFRQAPGKEREF
VAVVTRWSGARTVYADSVKGRFTISRDNAENTVYLQMNSLKPEDTAV
YTCAADSTNRNSGAIYYTWAYDYWGQGTQVTVSS
TABLE-US-00002 TABLE A-2 F-protein sequences F-protein SEQ ID NO:
Sequence RSV LONG 17 MELPILKANAITTILAAVTFCFASSQNITEEFYQSTCSAVSKG
M-2 YLSALRIGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKY
KNAVTFLQLLMQSTFAANNRARRELPRFMNYTLNNTKKTNVTL
SKKRKRRFLGFLLGVGSATASGTAVSKVLHLEGEVNKIKSALL
SINKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCRIS
NIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELL
SLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVV
QLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCD
NAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIF
NPKYDCHIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRG
IIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSZYVKGEP
IINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHHV
NAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTL SKDQLSGINNIAFSN RSV A-2
118 MELLILKANAITTILTAVTFCFASGQNITEEFYQSICSAVSKG
YLSALRTGWYTSVITIELSNIKHNKONGTDAKVKLIKQELDKY
KNAVTELTLLMQSTQATNNRARRELPRFMNYTLNNAKKTNVIL
SNKRKRRFLGFLLGVGSATASGVAVSKVLHLEGEVNKIKSALL
STNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSIS
NIETVIEFQQKNNRLLEITREFSVNAGVITPVSTYMLINSELL
SLINDMPITNDQKKLMSNNVQIVRQQSYSTMSIIKEEVLAYVV
QLPLYGVIDTPOWKLHISPLOTTNTKEGSNICLTRIDRGWYCD
NAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLONVDIF
NPKYDCKIMISKTDVSSSVITSLGAIVSCYGKTKCIASNKNRG
IIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEP
IINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNV
NAGKSTTNIMITTIIIVIIVILLSLTAVGLLLYCKARSTPVTL SKDQLSGINNIAFSN RSV B-1
19 MELLIHRSSAIFLTLAVNALYLISSQNITEEFYQSTCSAVSRGY
FSALRIGWYTSVITIELSNIKETKCNGTDTKVKLIKQELDKYKN
AVIELQLLMQNTPAANNRARREAPQYMNYTINTYKNLNVSISKK
RKRRFLGFLLGVGSAILSGIAVSKVLHLEGEVNKTKNALLSTNK
AVVSLSNGVSVLTSKVLDLKNYINNALLPIVNQQSCRISNIETV
IEFQQMNSRLLEITREFSVNAGVTTPLSTYMLTNSELLSLINDM
PITNDOKKLMSSNVQIVRQQSYSIMSIIKEEVLAYVVQLPIYGV
IDTPCWKLHISPLCTTNIKEGSNICLIRTDRGWYCDNAGSVSFF
PQADTCKVQSNRVFCDTMNSLILPSEVSLONTDIFNSKYDCKIM
TSKTDISSSVITSLGAIVSCYGKIKCIASNKNRGIIKTFSNGCD
YVSKKGVDTVSVGNTLYYVNKLEGKNLYVKGEPIINYYDPLVEP
SDEFDASISQVNEKINQSLAFIRRSDELLHNVNTGKSTINTMIT
TIIIVIIVVLLLLIAIGLLLYCKAKNTPVTLSNDQLSGINNTAF SK
TABLE-US-00003 TABLE A-3 Amino add sequences of multivalent
constructs that bind hRSV Construct SEQ ID NO: Sequence RSV101 20
EVQLVESGGGLVQAGGSLRLSCEASGRTYSRYGMGWFRQAPGKEREFVAA
VSRLSGPRTVYADSVKGRFTISRDNAENTVYLQMNSLKPEDTAVYTCAAE
LTNRNSGAYYYAWAYDYWGQGTQVTVSSGGGGSGGGGSGGGGSEVQLVES
GGGLVQAGGSLRLSCEASGRTYSRYGMGWFRQAPGKEREFVAAVSRLSGP
RTVYADSVKGRFTISRDNAENTVYLQMNSLKPEDTAVYTCAAELTNRNSG
AYYYAWAYDYWGQGTQVTVSS RSV102 21
EVQLVESGGGLVQAGGSLRLSCEASGRTYSRYGMGWFRQAPGKEREFVAA
VSRLSGPRTVYADSVKGRFTISRDNAENTVYLQMNSLKPEDTAVYTCAAE
LTNRNSGAYYYAWAYDYWGQGTQVTVSSGGGGSGGGGSGGGGSGGGGSGG
GGSEVQLVESGGGLVQAGGSLRLSCEASGRTYSRYGMGWFRQAPGKEREF
VAAVSRLSGPRTVYADSVKGRFTISRDNAENTVYLQMNSLKPEDTAVYTC
AAELTNRNSGAYYYAWAYDYWGQGTQVTVSS RSV103 22
EVQLVESGGGLVQAGGSLRLSCEASGRTYSRYGMGWFRQAPGKEREFVAA
VSRLSGPRTVYADSVKGRFTISRDNAENTVYLQMNSLKPEDTAVYTCAAE
LTNRNSGAYYYAWAYDYWGQGTQVTVSSGOGGSGGGGSGGGGSGGGGSGG
GGSGGGGSGGGGSEVQLVESGGGLVQAGGSLRLSCEASGRTYSRYGMSWF
RQAPGKEREFVAAVSRLSGPRTVYADSVKGRFTISRDNAENTVTLQMNSL
KPEDTAVYTCAAELTNRNSGAYYYRWAYDYWGQGTQVTVSS RSV104 23
EVQLVESGGGLVQAGGSLRLSCEASGRTYSRYGMGWFRQAPGKEREFVAA
VSRLSGPRTVYADSVKGRFTISRDNAENTVYLQMNSLKPEDTAVYTCAAE
LTNRNSGAYYYAWAYDYWGQGTQVTVSSGGGGSGGGSEVQLVESGGGLVQ
AGGSLRLSCEASGRTYSRYGMGWFRQAPGKEREFVAAVSRLSGPRTVYAD
SVKGRFTISRDNAENTVYLQMNSLKPEDTAVYTCAAELTNRNSGAYYYAW AYDYWGQCTQVTVSS
RSV105 24 EVQLVESGGGLVQAGDSLRLSCAASGRTESSYAMGWFRQAPGKEREFVAA
ISWSDGSTYYADSVNGRFTISRDNARNTVYLQMNSLKPEDIAVYYCAADL
TSINPGSYYYTWAYDYWGQGTQVTVSSGGGGSGGGSEVQLVESGGGLVQA
GDSLRLSCAASGRTFSSYAMGWFRQAPGKEREFVAAISKSDGSTYYADSV
KGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADLTSTNPGSYIYIWAY DYWGQGTQVTVSS
RSV106 25 EVQLVESGGGLVQAGDSLRLSCAASGRTFSSYAMGWFRQAPGKEREFVAA
ISWSDGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADL
TSTNPGSYIYIWAYDYWGQGTQVTVSSGGGGSGGGGSGGGGSEVQLVESG
GGLVQAGDSLRLSCARSGRTFSSYAMGWFRQAPGKEREFVAAISWSDGST
YYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADLTSTNPGSY
IIYIWAYDYWGQGTQVTVSS RSV107 26
EVQLVESGGGLVQAGGSLRLSCAASGRSFSNYVLGWFRQAPGKEREFVAA
ISFRGDSAIGAPSVEGRFTISRDNAKNTGYLQMNSLVPDDTAVYYCGAGT
PLNPGAYIYDWSYDYWGRGTQVTVSSGGGGSGGGSEVQLVESGGGLVQAG
GSLRLSCAASGRSFSNYVLGWFRQAPGKEREFVAIISFRGDSAIGAPSVE
GRFTISRDNAKNTGYLQMNSLVPDDTAVYYCGAGTPLNPGAYIYDWSYDY WGRGTQVTVSS
RSV108 27 EVQLVESGGGLVQAGGSLRLSCAASGRSFSNYVLGWFRQAPGKEREFVAA
ISFRGDSAIGAPSVEGRFTISRDNAKNTGYLQMNSLVPDDTAVYYCGAGT
PLNPGRYIYDWSYDYWGRGTQVTVSSGGGGSGGGGSGGGGSEVQLVESGG
GLVQAGGSLRLSCAASGRSFSNYVLGWFRQAPGKEREFVAAISFRGDSAI
GAPSVEGRFTISRDNAKNTGYLQMNSLVPDDTAVYYCGAGTPLNPGAYIY
DWSYDYWGRGTQVTVSS RSV109 28
EVQLVESGGGLVQAGGSLRLSCAASGRSFSNYVLGWFRQAPGKEREFVAA
ISWSRGRTFYADSVKGRFIISRDDAANTAYLQMNSLKPEDTAVYYCAVDT
ASWNSGSFIYDWAYDHWGQGTQVTVSSGGGGSGGGSEVOLVESGGGLVQP
GGSLRLSCAASGRTFSSIAMGWFRQAPGKEREFVAAISWSRGRTFYADSV
KGRFIISRDDAANTAYLQMNSLKPEOTAVYYCAVDTASWNSGSFIYDWAY DHWGQGTQVTVSS
RSV110 29 EVQLVESGGGLVQPGGSLRLSCAASGRTFSSIAMGWFRQAPGKEREFVAA
ISWSRGRTFYRDSVKGRFIISRDDAANTAYLOMNSLKPEDTAVYYCAVDT
ASWNSGSFIYDWAYDEWGQGTQVTVSSGGGGSGGGGSGGGGSEVQLVESG
GGLVQPGGSLRLSCAASGRTFSSIANGWFRQAPGKEREFVAAISWSRGRT
FYADSVKGRFIISRDDRANTAYLQMNSLKPEDTAVYYCAVDTASWNSGSF
IYDWAYDIIWGQGTQVTVSS RSV113 30
EVQLVESGGGLVQPGGSLRLSCAASGLTLDYYALGWFROAPGKEREGVSC
ISSSDHSTTYTDSVKGRFTISWDNAKNTLYLQMNSLKPGDTAVYYCAADP
ALGOYSGSYYPRYDYWGQGTQVTVSSGGGGSGGGGSGGGGSEVOLVESGG
GLVQPGGSLRLSCAASGLTLDYYALGWFRQAPGKEREGVSCISSSDHSTT
YTDSVKGRFTISWDNAKNTLYLQMNSLKPGDTAVYYCAADPALGCYSGSY
YPRYDYWGQGTQVTVSS RSV114 31
EVOLVESCGGWVQAGGSLRLSCAASGRAFSSYAMGWIRQAPGKERESVAG
TDOSGESTAYGASASGRFIISRDNAKNTVHLLMNSLQSDETAVYYCVADG
VLATTLNWDYWGQGTQVTVSSGGGGSGGGGSGGGGSGGGGSEVQLVESGG
GWVOAGGSLRLSCRASGRAFSSYAMGWIROAPGKEREFVAGIDOSGESTA
YGASASGRFITSRDNAKNTVHLLMNSLQSDDTAVYYCVADGVLATTLNWD YWGOGTQVTVSS
RSV115 32 EVQLVESGGGLVQAGGSLRLSCAASGPTFSADTMGWFRQAPGKEREFVAT
IPWSGGIAYYSDSVKGRFTMSRDNAKNTVDDOMNSLKPEDTALYYCAGSS
RIYIYSDSLSERSYDYWGQGTQVTVSSGGGGSGGGGSGGGGCGGSEVOLV
ESSGGLVQAGGSLRLSCAASGPTFSADTMGWFRQAPGKEREEVATIPWSG
GIAYYSDSVKGRFTMSRDNAHNTVDLOMNSLKPEDTALYYOLGSSRIYIY
SDSLSERSYDYWGQGTQVTVSS RSV116 33
EVQLVESGGGLVORGGSLSISCALSGGSLSNYVLGWFRQAPGKEREFVAA
INWRGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLAPDDTAVYYCGAGT
PLNPGAITYDWSYDYWGRGTOVTVSSGGGGSGGGGSGGGGSEVQLVESCG
GLVQAGGSLSISCAASGGSLSNYVLGWFRQAPGKEREFVAAINWRGDITT
GPPNVEGRFTISRDNAKNTGYLQMNSLAPDDTAVYYCGAGTPLNPGAYIY
DWSYDYWGRGTQVTVSS RSV201 34
EVQLVESGGGLVQAGGSLRLSCEASGRTYSRYGMGWFROAPGKEREFVAA
VSRLSGPRTVYADSVKGRFTTSRDNAENTVYLQMNSLKPEDTAVYTCAAE
LTNRNSGAYYYAWAYDYWCQGTQVTVSSGGGGSGGGSEVQLVESGGGLVQ
AGGSLRLSCPASGPTFSADTMGWFROAPGKEREFVATIPWSGGIAYYSDS
VKGRFTMSRDNAHNTVDLQMNSLKPEDTALTYCAGSSRIYIYSDSLSERS YDYWCQGTQVTVSS
RSV202 35 EVQLVESGGGLVAAGGSLRLSCEASGRTYSRYGMGWFROAPGKEREFVAA
VSRLSGPRTVYADSVKGRFTISRDNAENTVYLQMNSLKPEDTAVYTCAAE
LTNRNSGAYYYAWAYDYWGQGTQVTVSSGGGCSGGGGSGGGGSEVQLVES
GGGLVQAGGSLRLSCAASGPTFSADTMGWFRQAPGHEREFVATIPWSGGI
AYYSDSVKGRFTMSRDNAKNTVDLQMNSLKPEDTALYYCAGSSRIYIYSD
SLSERSYDYWGQGTQVTVSS RSV203 36
EVQLVESGGGLVQAGGSLRLSCEASGRTYSRYGMGWERQAPGKEREFVAA
VSRLSGPRTVYADSVNGRFTISRDNRENTVYLQMNSLKPEDTAVYTCAAE
LTNRNSGAYYYAWAYDYWGQGTQVTVSSGGGGSGGGGSGGGGSGGGGSGG
GGSEVQLVESGGGLVQAGGSLRLSCAASGPTFSADTMGWFRQAPGKEREF
VATIPWSGGIAYYSDSVKGRFTMSRDNAKNTVDLQMNSLKPEDTALYYCA
GSSRIYIYSDSLSERSYDYWGQGTQVTVSS RSV204 37
EVQLVESGGGLVQAGDSLRLSCAASGRTFSSYAMGWFRQAPGREREFVAA
ISWSDGSTYYRDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADL
TSTNPGSYIYIWAYDYWGQGTQVTVSSGGGGSGGGGSGGGGSEVQLVESG
GGLVQRGGSLRLSCAASGRSFSNYVLGWFRQAPGKEREFVAAISFRGDSA
IGAPSVEGRFTISRDNAENTGYLQMNSLVPDDTAVYYCGAGTPLNPGAYI
YDWSYDYWGRGTQVTVSS RSV205 38
EVQLVESGGGLVQAGDSLRLSCAASGRTFSSYAMGWFRQAPGKEREF
VAAISWSDGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVY
YCAADLTSTNPGSYIYIWAYDYWGQGTQVTVSSGGGGSGGGGSGGGG
SEVQLVESGGGLVQPGGSLRLSCALSGLTLDYYALGWFRQAPGKERE
GVSCISSSDHSTTYTDSVKGRFTISWDNAKNTLYLQMNSLKPGDTAV
YYCAADPALGCYSGSYYPRYDYWGQGTQVTVSS RSV206 39
EVQLVESGGGLVQAGGSLRLSCAASGRSFSNYVLGWFRQAPGKEREF
VAAISFRGDSAIGAPSVEGRFTISRDNAKNTGYLQMNSLVPDDTAVY
YCGAGTPLNPGAYIYDWSYDYWGRGTQVTVSSGGGGSGGGGSGGGGS
EVQLVESGGGLVQAGDSLRLSCAASGRTFSSYAMGWFRQAPGKEREF
VAAISWSDGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVY
YCAADLTSTNPGSYIYIWAYDYWGQGTQVTVSS RSV207 40
EVQLVESGGGLVQAGGSLRLSCAASGRSFSNYVLGWFRQAPGKERET
VAAISFRGDSAIGAPSVEGRFTISRDNAKNTGYLQMNSTVPDDTAVY
YCGAGTPLNPGAYIYDWSYDYWGRGTQVIVSSGGGGSGGGGSGGGGS
EVQLVESGGGLVQAGDSLRLSCAASGRTFSSYAMGWFRQAPGKEREF
VAAISWSDGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVY
YCAADLTSINPGSYIYIWAYDYWGOGTQVTVSS RSV301 41
EVQLVESGGGINQAGGSLRLSCAASGPTFSADTMGWFRQAPGKEREF
VATIPWSGGIAYYSDSVKGRFTMSRDNAKNTVDLQMNSLKPEDTALY
YCAGSSRIYIYSDSLSERSYDYWGQGTQVTVSSGGGGSGGGSEVQLV
ESGGGLVQAGGSLRLSCEASGRTYSRYGMGWFRQAPGKEREFVAAVS
RLSGPRTVYADSVKGRFTISRDNAENTVYLQMNSLKPEDTAVYTCAA
ELTNRNSGAYYYAWAYDYWGQGTQVTVSS RSV302 42
EVQLVESGGGLVQAGGSLRLSCAASGPTFSLDTMGWFRQAPGKEREF
VATSPWSGGIAYYSDSVKGRFTMSRDNAKNTVDLQMNSLKPEDTALY
YCAGSSRIYIYSDSLSERSYDYWGQGTQVTVSSGGGGSGGGGSGGGG
SEVQLVESGGGLVQAGGSLRLSCEASGRTYSRYGMGWFRQAPGKERE
FVAAVSRLSGPRTVYADSVKGRFTISRDNAENTVYLQMNSLKPEDTA
VYTCAAELTNRNSGAYYYAWAYDYWGQGTQVTVSS RSV303 43
EVQLVESGGGLVQAGGSLRLSCAASGPTFSADTMGWFRQAPGKEREF
VATIPWSGGIAYYSDSVKGRFTMSRDNAKNTVDLQMNSLKPEDTALY
YCAGSSRIYIYSDSLSERSYDYWGQGTQVTVSSGGGGSGGGGSGGGG
SGGGGSGGGGSEVQLVESGGGLVQAGGSLRLSCEASGRTYSRYGMGW
FRQAPGKEREFVAAVSRLSGPRTVYADSVKGRFTISRDNAENTVYLQ
MNSLKPEDTAVYTCAAELTNRNSGAYYYAWAYDYWGQGTQVTVSS RSV305 44
EVQLVESGGGLVQPGGSLRLSCAASGLTLDYYALGWFRQAPGKEREG
VSCISSSDHSTTYTDSVKGRFTISWDNAKNTLYLQMNSLKPGDTAVY
YCAADPALGCYSGSYYPRYDYWGQGTQVTVSSGGGCSGGGGSGGGGS
EVQLVESGGGLVQAGDSLRLSCAASGRTFSSYAMGWFRQAPGKEREF
VAAISWSDGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVY
YCAADLTSTNPGSYIYIWAYDYWGQGTQVIVSS RSV306 45
EVQLVESGGGLVQPGGSLRLSCAASGLTLDYYALGWFRQAPGKEREG
VSCISSSDHSTTYTDSVKGRFTISWDNAKNTLYLQMNSIKPGDTAVY
YCAADPALGCYSGSYYPRYDYWGQGTQVTVSSGGGGSGGGGSGGGGS
EVQLVESGGGLVQAGGSLRLSCAASGRSFSNYVIGWFRQAPGKEREF
VAAISFRGDSAIGRPSVEGRFTISRDNAKNTGYLQMNSLVPDDTAVY
YCGAGTPLNPGAYIYDWSYDYWGRGTQVTVSS RSV400 46
EVQLVESGGGLVQAGDSLRLSCAASGRTFSSYAMGWFRQAPGKEREFV
AAISWSDGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYC
AADLTSTNPGSYIYIWAYDYWGQGTQVTVSSGGGGSGGGGSGGGGSEV
QLVESGGGLVQAGOSLRLSCAASGETESSYANGWFRQAPGKEREFVAA
SWSDGSTYILDSVKGRFTISRDNPLKNTVYLQMNSLKPEDTAVYYCAA
DLTSTNPGSYIYIWAYDYWGQGTQVTVSSGGGGSGGGGSGGGGSEVQL
VESGGGLVQAGDSLRLSCAASGRTESSYAMGWFRQAPGKEREFVAATS
WSDGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADL
TSTNPGSYIYTWAYDYWGQGTQVTVSS RSV401 47
EVQLVESGGGLVQAGDSLRLSCAASGRTESSYAMGWERQAPGKEREFV
AAISWSDOSTYYADSVKGRFTISRDNAKNTVYLOMNSLKPEDTAVYYC
RADLTSTNPGSYIYIWAYDYWGQGTQVTVSSGGGGSGGGGSGGGGSEV
QLVESCGGLVOAGDSLRLSCAASGRTESSYAMCWFRQAPGKEREFVAA
ISWSDGSTYYADSVKGRETISRDNAKNTVYLQMNSLKPEDTAVYYCAA
DLTSTNPGSYIYIWAYDYWGQGTQVTVSSGGGGSGGGGSGGSGSEVQL
VEEGGGLVQPGGSLRLSCAASGLTLDYYALGWFRQAPGKEREGVSCIS
SSDHSTTYTDSVKGRFTISWDNAKNTLYLQMNSLKPGETAVYYCAADP
ALGCYSGSYYPRYDYWGQCTQVTVSS RSV402 48
EVQLVESGGGLVQPGGSLRLSCAASGLTLDYYALGWERQAPGKFREGV
SCISSSDHSTTYTDSVKGRETTSWDNAKNTLYLQMNSLKPGDTAVYYC
AADPALGCYSGSYYPRYDYWGQGTQVTVSSGGGGSGGGGSGGGGSEVQ
LVESGGGLVQAGDSLRLSCAASGRTFSSYAMGWERQAPGKEREEVART
SWSDGSTYYADSVKGRETISRDNAKNTVYLQMNSLKPEDTAVYYCAAD
LTSTNPGSYIYIWAYDYWGQGTQVTVSSGGGGSGGGGSGGGGSEVQLV
ESGGGLVQAGDSLRLSCAASCRTFSSYAMGWFRQAPGKEREFVAAISW
SDGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADLT
STNPGSYIYIWAYDYWGQGTQVTVSS RSV403 49
EVQLVESGGGLVQAGDSLRLSCRASGRTESSYAMGWERQAPGKEREFV
AAISWSDGSTYYADSVKGRETISRDNAKNTVYLQMNSLKPEDTAVYYC
AADLTSTNEGSYIYTWAYDYWGQGTQVTVSSGGGGSGGGGSGGGGSEV
QLVESGGGLVQPGGSLRLSCAASGLTLDYYALGWERQAPGKEREGVSC
ISSSDHSTTYTDSVKGRFTISWDNAHNTLYLQMNSLKPGDTAVYYCAA
DPALGOYSGSYYPRYDYWGQGTQVTVSSGGGGSGGGGSGGGGSEVQLV
ESGGGLVQAGDSLRLSCAASGRTESSYAMGWERQAPGKEREFVAAISW
SDGSTYYADSVKGRETISRONAHNTVYLQMNSLKPEDTAVYYCAADLT
STNPGSYIYIWAYDYWGQGTQVTVSS RSV404 50
EVQLVESGGGLVQAGGSLRLSCAASGRSFSNYVLGWERQAPGKEREFV
AAISFRGDSAIGAPSVEGRFTISRDNAHNTGYLQMNSLVPDDTAVYYC
GAGTPLNPGAYIYDWSYDYWGRGTQVTVSSGGGGSGGGGSGGGCSEVQ
LVESGGGLVQAGGSLRLSCAASGRSFSNYVLGWFRQAPGKEREFVAAI
SFRGDSAIGAPSVEGRETTSRDNAKNTGYLQMNSLVPDDTAVYYCGAG
TPLNPGAYIYDWSYDYWGRCTQVTVSSGGGGSGGGGSGGGGSEVQLVE
SGGGLVQAGGSLRLSCAASGRSFSNYVLGWFRQAPGKEREFVAATSFR
GDSAIGAPSVEGRFTISRDNAKNTGYLQHNSLVPDDTAVYYCGAGTPL
NPGAYIYDWSYDYWGRGTQVTVSS RSV405 51
EVQLVESGGGLVQAGGSLRISCEASGRTYSRYGMGWERQAPGKEREFV
AAVSRLSGPRTVYADSVKGRETISRDNAENTVYLQMNSLKPEDTAVYT
CAAELTNRNSGAYYYAWAYDYWGQGTQVTVSSGGGGSGOGGSGGGCSE
VQLVESGGGLVQAGGSLRLSCEASGRTYSRYGMGWERQAPGKEREFVA
AVSRLSGPRTVYADSVKGRFTISRDNAENTVYLQMNSLKPEDTAVYTO
AAELTNRNSGAYYYLWAYDYWGQGTQVTVSSGGGGSGGGGSGGGGSEV
QLVESGGGLVQAGGSLRLSCEASCRTYSRYGMGWERQAPGKEREEVAA
VSRLSGPRTVYADSVKGRETISRDNAENTVYLQMNSLKPEDTAVYTCA
AELTNRNSGAYYYAWAYDYWGQGTQVTVSS RSV406 52
EVQLVESGGGLVQPGGSLRLSCAASGRTFSSIAMGWFRQAPGKEREFV
AAISWSRGRTFYADSVKGRFTISRDDAANTAYLQMNSLKPFDTAVYYC
AVDTASWNSGSFIYDWAYDHWGQGTQVTVSSGGGGSGGGGSGGGGSEV
QLVESGGGLVQPGGSLRLSCAASGRTFSSIAMGWERQAPGKEREFVAA
ISWSRGRTFYADSVKGRETISRDDAANTAYLQMNSLKPEDTAVYYCAV
DTASWNSGSFIYDWAYDHWGQGTQVTVSSGGGGSGGGGSGGGGSEVQL
VESGGGLVQPGGSLRLSCARSGRTESSIAMGWERQAPGKEREFVAAIS
WSRGRTFYADSVKGRFITSRDDAANTAYLQMNSLKPFDTAVYYCAVDT
ASWNSGSFIYDWAYDHWGQGTQVTVSS RSV407 53
EVQLVESCGGLVQAGGSLSISCAASGGSLSNYVLGWERQAPCKEREEV
AAINWRGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLAPDDTAVYYC
GAGTFLNPGAYIYDWSYDYWCRGTQVTVSSGGSGSGGGGSGGGGSEVQ
LVESGGGLVQAGGSLSISCAASGGSLSNYVLGWFRQAPGKEREFVAAI
NWRGDITIGPPNVEGRFTISRENAKNTGYLQMNSLAFDDTAVYYCGAG
TPLNPGAYIYDWSYDYWGRGTQVTVSSGGCGSGGGGSGGGGSFVQLVE
SGGGLVQAGGSLSISCAASGGSLSNYVLGWFRQAPGKEREFVAAINWR
GDITIGPPNVEGRETISRDNAKNTGYLQMNSLAPDDTAVYYCGAGTPL
NPGAYIYDWSYDYWGRGTQVTVSS RSV408 54
EVQLVESGGGLVQAGGSLSISCAASGGSLSNYVLGWFRQAPGKERFFV
AAINWRGDITIGFPNVEGRFTISRDNAKNTGYLQMNSLAPDDTAVYYC
GAGTPLNPGAYIYDWSYDYWGRGTQVTVSSAAAEVOLVISGGGLVOAG
GSLSISCAASGGSLSNYVLGWERQAPGKEREFVARINWRGDITIGPPN
VEGRFTISRDNAKNTGYLQMNSLAPOOTAVYYCGAGTELNPGAYIYDW
SYDYWGRGTQVTVSSAAAFVQLVESGGGLVQAGGSLSISCAASGGSLS
NYVLGWERQAPGKEREFVAATNWRGDITTGPPNVEGRFTISRENAKNT
GYLQMNSLAIDDTAVYYCGAGTPLNPGAYIYDWSYDYWGRGTQVTVSS RSV409 55
EVQLVESGGGLVQAGGSLSISCAASGGSLSNYVEGWFRQAPGKERFFV
AAINWRGDITIGPPNVEGRETISRDNAKNTGYLQMNSLAPDDTAVYYC
GAGTPLNPGAYIYDWSYDYWGRGTQVTVSSGGGGSGGGSEVQLVESGG
GLVQAGGSLSISCAASGGSLSNYVLGWFRQAFGKEREFVAAINWRGDT
TIGPPNVEGRFTISRDNAKNTGYLQMNSLAPDDTAVYYCGAGTPLNPG
AYIYDWSYDYWGRGTQVTVSSGGGGSGGGSEVQLVESGGGLVQAGGSL
SISCAASGGSLSNYVLGWFRQAPGKEREFVRAINWRGDITIGPPNVEG
RFTISRDNANNTGYLQMNSLAPDDTAVYYCGAGTPLNPGAYTYDWSYD YWGRGTQVTVSS
RSV410 56 EVQLVESGGGIVQAGGSLSISCAASGGSLSNYVLGWFRQAPGKERFFV
AAINWRGDITIGFPNVEGRFTISRDNAKNTGYLQMNSLAPDDTAVYYC
GAGTPLNPGAYTYDWSYDYWGRGTQVTVSSGGGGSGGGGSGGGGSGGG
GSEVQLVESGGGLVQAGGSLSISCAASGGSLSNYVLCWFRQAPGKERE
EVAAINWRCDITIGPPNVEGRFTISRDNAKNTGYLQMNSLAPDDTAVY
YCGAGTPLNPGAYTYDWSYDYWGRGTQVTVSSGGGGSGGGGSGGGGSG
GGGSEVQLVESGGGLVQAGGSLSISCAASGGSLSNYVLGWFRQAPGKE
REFVAAINWRGDITIGPPNVEGRETISRDNAKNTGYLQMNSLARDDTA
VYYCGAGTPLNPGAYIYDWSYDYWGRGTQVTVSS RSV411 57
EVQLVESGGGLVQAGGSLSISCAASGGSLSNYVLGWFRQAPGKEREFVAA
INWRGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLAPDDTAVYYCGAGT
PLNPGAYTYDWSYDYWGRGTQVTVSSGGGGSGGGGSGOGGSEVQLVESGG
GLVQAGGSLSISCALSGGSLSNYVLGWTRQAPGKEREFVAAINWRGDITI
GPPNVEGRFTISRDNAKNTGYLQMNSLAPDDTAVYYCGAGTPLNPGAYTI
DWSYDYWGRGTQVTVSSGGGSSGSGGSGGGGSEVQLVESGGCLVQPGGSL
RLSCAASGLTLDYYALGWETQAPGKEREGVSCISSSDHSTTYTDSVKGRF
TISWDNAKNTLYLQMNSLKPGDTAVYYCAADPALGCYSGSYYPRYDYWGQ GTQVTVSS RSV412
58 EVQLVESGGGLVQPGGSLRLSCAASGLTLDYYALGWFRQAPGKEREGVSC
ISSSDHSTTYTDSVKGRFTISYMNAKNTLYLQMNSLKPGDTAVYYCAADP
ALGCYSGSYYPRYDYWGQGTQVTVSSGGGGSGGGGSGGGGSEVQLVESGG
GLVQAGGSLSISCAASGGSLSNYVLGWFRQAPGKEREFVAAINWRGDITI
GPPNVEGRFTISRDNAKNTGYLQMNSLAPDDTAVYYCGAGTPLNPGAYIY
DWSYDYWGRGTQVTVSSGGGCSGGGGSGGGGSEVQLVESSGGLVQAGGSL
SISCAASGGSLSNYVLGWFRQAPGKEREFVAAINWRGDITIGPPNVEGRE
TISRDNAKNTGYLQMNSLAPDDTAVYYCGAGTPLNPGAYIYDWSYDYWGR GTQVTVSS RSV413
59 EVQLVESGGGLVQAGGSLSISCAASGGSLSNYVLGWFRQAPGKEREFVAA
INWRGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLAPDDTAVYYCGAGT
PLNPGAYIYDWSYDYWGRGTQVTVSSGGGGSGGGGSGGGGSEVQLVESGG
GLVQPGGSLRLSCAASGLTLDYYALGWFRQAPGKEREGVSCISSSDHSTT
YTDSVKGRFTISWDNAKNTLYLQMNSLKPGDTAVYYCAALPALGCYSGSY
YPRYDYWGQGTQVTVSSGGGGSGGGGSGGGGSEVQLVESGGGLVQAGGSL
SISCAASGGSLSNYVLGWFRQAPGKEREFVAAINWRGDITIGPPNVEGRF
TISRDNAKNTGYLQMNSLAPDDTAVYYCGAGTPLNPGAYIYDWSYDYWGR GTQVTVSS
TABLE-US-00004 TABLE A-4 Sequences of humanized and/or sequence
optimized NC41 variants Nanobody .RTM. SEQ ID Sequence N041v01 60
EVQLLESGGGLVQPGGSLRLSCALSGGELSNYVLGWFRQAPGKGREFVA
AINWRGDITIGPPNVEGRFTISRDNAKNTLYLQMNSLAPEDTAVYYCGA
GTPLNPGAYIYDWSYDYWGQGTLVTVSS NC41v02 61
EVQLLESGGGLVQPGGSLRISCAASGGSLSNYVLGWFRQAPGKGREFVA
AINWRGDITIGPPNVEGRFTISRDNSKNTLYLQMNSLAFEDTAVYYCGA
GTPLNPGAYIYDWSYDYWGQGTLVTVSS NC41v03 62
EVQLLESGGGLVQPGGSLRISCAASGGSLSNYVLGWFRQAPGKGREFVA
AINWRGOITIG2PNVEGRFTISRDNSKNT0YLQMNSLRPEDTAVYYCGA
GTPLNPGAYTYDWSYDYWGQGTLVTVSS NC41v04 63
EVQLLESGGGLVQPGGSLSISCAASGGSLSNYVLGWFRQAPGKGREFTA
AINWRGDITIGPPNVEGRFTISRDNSKNTLYLQMNSLRPDDTAVYYCGA
GTPLNPGAYTYDWSYDYNGQGTLVTVSS NC41v05 64
EVQLLESGGGLVQPGGSLSISCRASGGSLSNYVLGWFRQAPGKGRETVA
AINWRGDITIGPPNVEGRFTISRDNSKNTLYLQMNSLAPLDTAVYYCGA
GTPLNPGAYIYDWSYDYWGQCTLVTVSS NC41v06 65
EVQLLESGGGLVQPGGSLSISCAASGGSLSNYVLGWFRQAPGKGREFVA
AINWRDDITIGETNVEGRFTISRONAKNTLYLQMNSLRPEDTLVYYGGA
GTPLNPGAYIYDWSYDYNGQGTINTVSS NC41v07 66
EVQLLESGGGLVQPGGSLSISCAASGGSLSNYVLGWFRQAPGKGREFVA
AINWRGDITIGPPNVEGRFTISRDNAKNTLYLQMNSLAPDDTAVYYCGA
GTPLNPGAYIYDWSYDYWCQGTLVTVSS NC41v08 67
EVQLLESGGGLVQPGGSLSTSCAASGGSLSNYVLGWFRQAPGKGREEVA
ATNWRGDITIGTPNVEGRFTISRDNAKNTLYLQMNSLRPEDTAVYYCGA
GTPLNPGAYIYDWSYDYWGQGTLVTVSS NC41v09 68
EVQLLESGGGLVQPGGSLSISCAASGGSLSNYVLGWFRQAPGKGRETVA
AINWRCDITIGPPNVEGRFTISRDNSKNTLYLQMNSLRPDDTAVYYCGA
GTPLNPGAYIYDWSYDYWGQGTLVTVSS NC41v10 69
EVQLLESGGGLVQPGGSLSISCAASGGSLSNYVLGWFRQAPGKGREFVA
AINWRGDITIGFPNVEGRFTISRDNLKNTGYLQMNSLAPDDTAVYYCGA
GTPLNPGAYIYDWSYDYWGQGTLVTVSS NC47v11 70
EVQLLESGGCLVQAGGSLSISCAASGGSLSNYVLGWFRQAPGKGREFVA
AINWRGDITIGPPNVEGRFTTSRDNAKNTGYLQMNSLAPDDTAVYYCGA
GTPLNPGAYIYDWSYDYWGQGTINTVSS NC41v17 71
EVOLLESGOGLVQPGGSLSISCAASGGSLSNYVLGWFRQAPGKEREFVA
AINWRGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLAPDDTAVYYCGA
GTPLNPGAYIYDWSYDYWGQGTLVTVSS NC41v13 72
EVQLLESGGGLVQPGGSLRLSCALSGGSLSNYVLGWFRQAPGKGREFVA
AINWRGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLAPEDTAVYYCGA
GTPLNPCAYIYDWSYDYWGQGTLVTVSS NC41v14 73
EVQLLESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGKGREFVA
AINWRGDITIGPPNVEGRFTTSRDNSKNTLYLQMNSLAPEDTAVYYCGA
GTPLNPGLYIYOWSYDYWGQGTLVTVSS NC41v15 74
EVQLLESGGGLVQAGGSLRLSCAASGGSLSNYVLGWFRQAPGKGREFVA
AINWRGDITIGPPNVEGRFTISRONLKNTLYLQMNSLAPEDTAVYYCGA
GTPLNPGAYIYDWSYDYWGQGTLVTVSS NC41v17 75
EVQLLESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGKGREFVA
AINWRGDITIGPPNVEGRFTISRDNAKNTLYLQMNSLRPEDTAVYYCGA
GTPLNPGAYIYDWSYDYWGQGTLVTVSS NC41v16 76
EVQLLESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGKGREFVA
AINWRDDITIGPPNVEGRFTISRDNSKNTLYLQMNSLRPEDTAVYYCGA
GTPLNPGAYIYDWSYDYWGQGTLVTVSS NC41v19 146
EVQLVESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGKEREFVA
AINWRGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLAPDDTAVYYCGA
GTPLNPGAYIYDWSYDYWCQGTLVTVSS NC41v20 147
EVQLVESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGKEREFVA
AINWRGDITIGFPNVEGRFTISRDNAKNTGYLQMNSLRPDDTAVYYCGA
GTPLNPGAYIYDWSYDYWCQGTLVTVSS NC41v21 148
EVQLVESGGGLVDPGGSLRLSCAASGGSLSNYVLGWFRQAPGKEREFVA
AINWRGDITIGPFNVEGRFTISRDNAKNTGYLQMNSLAPEDTAVYYCGA
GTPLNPGAYIYDWSYDYWGQGTLVTVSS NC41v22 149
EVQLVESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFROAPGKEREFVA
AINWRGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLRPEDTAVYYCGA
GTPLNPGAYIYDWSYDYWGQGTLVTVSS NC41v23 150
EVQLVESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGKEREFVA
AINWRGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLRPEDTAVYYCGA
GTPLNPGAYIYDWSYDYWGRGTINTVSS NC41v24 151
EVQLVESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGKEREFVA
AINWRGDITIGPPNVEGRFTISRDNAKNTGYLOMNSLRPDDTAVYYCGA
GTPLNPGAYIYDWSYDYWGRGTLVTVSS NC41v25 152
EVQLVESGGGLVOTGGSLRLSCAASGGSLSNYVLGWFROAPGKEREFVA
AINWRGDITIGETNVEGRFTISRDNAKNTGYLQMNSLAPEDTAVYYCGA
GTPLNPGAYIYDWSYDYWGRGTLVTVSS NC41v26 153
EVQLVESGGGINQPGGSLRLSCAASGGSLSNYVLGWERQAPGKEREFVA
AINWRGDITIGPPNVEGRFTISRDNAKNTCYLQMNSLRPEDTAVYYCGA
GTPLNPGAYIYDWSYDYWGRGTLVTVSS NC41 E1D 138
DVQLVESGGGLVQAGGSLSISCAASGGSLSNYVLGWFRQAPCKEREFVL
AINWRGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLAPDDTAVYYCGA
GTPLNPGAYTYOWSYDYWGRGTQVTVSS NC41v03 E1D 139
DVQLLESGGGLVQPGGSLRISCAASGGSLSNYVLGWFRQAPGKGREFVAA
INWRGDITIGPPNVEGRFTISRDNSKNTLYLQMNSLRPEDTAVYYCGAGT
FINPGAYIYDWSYDYWGQGTLVTVSS NC41v06 315 140
DVQLLESGGGLVUGGSLRLSCARSGGSLSNYVLGWFROAPGKGRETVAAI
NWRDDITIGPPNVEGRFTISRONAKNTLYLQMNSLRPEDTAVYYCGAGTP
LNPGAYIYDWSYDYWGQGTLVTVSS NC41v18 315 141
DVQLLESGGGLVOGGSLRLSCAASGGSLSNYVLGWFRQAPGKGREFVAA
INWRDDITIGFPNVEGRFTISRDNSKNTLYLWNSLRPEDTAVYYCGAGT
PLNPGAYIYDWSYDYWGQGTLVTVSS NC41v17 ElD 154
DVQLLESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGKGREFVA
AINWRGDITIGPPNVEGRETISRDNSKNTLYLQMNSLRPEDTAVYYCGA
GTPLNPGAYIYDWSYDYWGQGTLVTVSS NC41v21 E1D 155
DVQLVESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGKEREFVA
AINWRGDITIGFPNVEGRFTISRDNAKNTGYLQMNSLAPEDTAVYYCGA
GTPLNPGAYIYDWSYDYTGQGTLVTVSS NC41v22 E1D 156
DVQLVESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGKEREFVA
AINWRGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLRPEDTAVYYCGA
GTPLNPGAYIYDWSYDYWGQGTLVTVSS NC41v26 315 157
DVQLVESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGKEREFVA
AINWRGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLRPEDTAVYYCGA
GTPLNPGATIYDWSYDYWGRGIIVTVSS
TABLE-US-00005 TABLE A-5 Amino acid sequence of multivalent
humanized and/or sequence optimized constructs that bind hRSV
Nanobody .RTM. SEQ ID NO Sequence RSV414 77
EVQLLESGGGLVQPGGSLRISCAASGGSLSNYVLGWFRQPPGNGREFVAAI
NWRGDITTGPPNVEGRFTISRDNSKNTLYLQMNSLRPEDTAVYYCGAGTPL
NPGRYIYDWSYDYWGQGTLVTVSSGGGGSGSGGSGGGSSEVQLLESGGGLV
QPGGSLRISCALSGGSLSNYVLSWFRQAPGKGREFVAAINWRGDITIGPPN
VEGRPTISRDNSKNTLYLQMNSLRPEDTAVYYCGAGTPLNPGAYIYDWSYD
YWGQGTLVTVSSGGGGSGGGGSGGGCSEVQLLESGGGLVqPGGSLRISCAA
SGGSLSNYVLGWFRQAPGKGREFVAAINWRGDITIGPPNVEGRFTISRDNS
KNTLYLQMNSLRPEDTAVYYCGAGTPLNPGAYIYDWSYDYWGQGTLVTVSS RSV426 78
EVQLLESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGKGREFVAAI
NWRDDITIGPPNVEGRFTISRDNAKNTLYLQMNSLRPEDTAVYYCGAGTPL
NPGAYTYDWSYDYWGQGTLVTVSSGGGGSGGGGSGGSGSEVTLLESGGGLV
QPGGSLRLSORRSSCSLSNYVLGWFRQAPGKGREFVAAINWRDDITIGFPN
VEGRFTISRDNAKNTLYLQMNSLRPEDTAVYYCGAGTPLNPGAYIYDWSYD
YWGQGTLVTVSSGGGGSGGGGSGGGGSEVQLLESGGGLVQPGGSLRLSCAA
SGGSLSNYVLGWFRQAPOKGREFVAAINWRDDITIGPPNVEGRFTISRDNA
KNTLYLQMNSLRPEDTAVYYCGAGTPLNPGAYIYDWSYDYWGQGTLVTVSS RSV427 79
EVQLLESGGGLVQPGGELRLSCAASGGSLSNYVLSWFRQAPGKGREFVAAI
NWRDDITIGPPNVEGRFTISRDNSKNTLYLOMNSLRPEDTAVYYCGAGTPL
NPGAYIYDWSYDYWGQGTLVTVSSGGGGSGGGGSGGGGSEVQLLESGGGLV
QPGGSLRLSCAASGGSLSNYVLGWFRQAPGKGREFVAAINWRDDITIGPPN
VEGRFTISRDNSKNTLYLQMNSLRPEDTAVYYCGAGTPLNPGAYIYDWSYD
YWGQGTLVTVSSGGGSSGGGGSGGGGSEVQLLESGGGLVQPGGSLRLSCAA
SGGSLSNYVLSWFRQAPGKGREFVAAINWRDDITIGPPNVEGRFTISRDNS
KNTLYLQMNSLRPEDTAVYYCGAGTPLNPGAYIYDWSYDYWGQGTLVTVSS RSV442 158
EVQLLESGGGLVQPGGSLRLSCARSGGSLSNYVLGWFRQAPGKGREFVAAI
NWRGDITIGPPNVEGRFTISRDNSKNTLYLQMNSLRFEDTAVYYCGACTPL
NPGAYTYDWSYDYWGQGTLVTVSSGGGGSGGGGSGGGGSEVQLLESGGGLV
QPGGSLRLSCAASGGSLSNYVLGWFRQAPGKGREFVAAINWRGDITIGPPN
VEGRFTISRDNSKNTLYLWINSLRPEDTAVYYCGAGTPLNPGAYIYDWSYD
YWGQGTLVTVSSGGGGSGGGGSGGGGSZVQLLESGGGLVQPGGSLRLSCAA
SGGSLSNYVLSWFRQAPGKGREEVAAINWRGDITIGPPNVEGRFTISRDNS
KNTLYLQMNSLRPEDTAVYYCGASTPLNPGAYIYOWSYDYWGQGTLVTVSS RSV436 159
EVQLVESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGKEREFVAAI
NWRGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLRPDDTAVYYCGAGTPL
NPGAYIYDWSYDYWGQGTLVTVSSSGGCSGGGGSGGGGSEVQLVESGGGLV
QPGGSLRLSCAASGGSLSNYVLGWFRQAPGKGREFVAAINWRGDITIGPPN
VEGRFTISRDNAKNTGYLQMNSLRPDDTAVYYCGAGTPLNPGAYIYDWSYD
YWGQGTLVTVSSGGGGSGGGGSGGGGSEVQLLESGGGLVQPGGSLRLSCAA
SGGSLSNYVLGWFRQAPGKEREFVAAINWRGDITIGPPNVEGRFTISRDNA
KNTGYLQMNSLRPDDTAVYYCGAGTPLNPGAYIYDWSYDYWGQGTLVTVSS RSV438 160
EVQLVESGSGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGKEREFVAAI
NWRGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLRPEDTAVYYCGAGTPL
NPGAYIYDWSYDYWGQGTLVTVSSGGGGSGGGGSGGGGSEVQLVESGGGLV
QPGGSLRLSCAASGGSLSNYVLGWFRQAPGKEREFVAAINWRGDITIGPPN
VEGRFTISRDNAKNTGYLQMNSLRPEDTAVYYCGAGTPLNPGAYTYDWSYD
YWGQGTLVTVSSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAA
SGGSLSNYVLGWFRQAPGKERETVAAINWRGDITIGPPNVEGRFTISRDNA
KNTGYLQMNSLRPEDTAVYYCGAGTPLNPGAYIYDWSYDYWGQGTLVTVSS RSV439 161
EVQLVESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGKEREFVAAINW
RGDITIGPPNVEGRFTISRDNSKNTLYLQMNSLRPEDTAVYYCGAGTPLNPGA
YIYDWSYDYWGRGTLVTVSSGGGGSGGGGSGGGGSEVQLVESGGGINQPGGSL
RLSCAASGGSLSNYVLGWFRQAPGKEREFVAAINWRGDITIGPPNVEGRFTIS
RDNAKNTGYLQMNSLRPEDTAVYYCGAGTPLNPGAYIYDWSYDYWGRGTLVTV
SSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGGSLSNYVLGW
FRQAPGKEREFVAAINWRGDITIGPPNVEGRFTISRDNAHNTGYLQMNSLRPE
DTAVYYCGAGTPLNPGAYIYDWSYDYWGRGTLVTVSS RSV434 142
DVQLVESGGCLVQAGGSLSISCAASGGSLSNYVLGWFRQAPGKEREFVAAINW
RGDTTIGFPNVEGRFTISRDNAKNTGYLOMNSLAEDDTAVYYCGAGTPLNPGA
YIYDWSYDYWGRCTQVTVSSGGGGSGGGGSOGGCSEVQLVESGGGLVQAGGSL
SISCAASGGSLSNYVLGWFRQAPGHEREFVAAINWRGDITIGPPNVEGRFTIS
RDNAKNTGYLWINSLAPDDTAVYYCGAGTPLNPGAYIYDWSYDYWORGTQVTV
SSGGGGSGGGGSGGGGSEVQLVESGGGLVQAGGSLSISCAASGGSLSNYVLGW
FRQAPGKEREFVkAINWRGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLAPD
DTAVYYCGAGTPLNPGLYIYDWSYDYWGRGTQVTVSS RSV443 143
DVQLLESGGGLVQPGGSLRISCAASGGSLSNYVLGWFRQAPGKGREFVAAINW
RGDITIGPPNVEGRFTISRDNSKNTLYLQMNSLRPEDTAVYYCGAGTPLNPGA
YIYDWSYDYWGQGTLVTVSSGGGGSGGGGSGGGGSEVQLLESGGGLVQPGGSL
RLSCAASGGSLSNYVLGWFRQAPGKGREFVAAINWRGDITIGPPNVEGRFTIS
RDNSKNTLYLQMNSLRPEDTLVYYCGAGTPLNPGAYTYDWSYDYWGQGTLVTV
SSGGGGSGGGGSGGGGSEVaLLESGGGLVQPGGSLRISCAASGGSLSNYVLGW
FRQAPGKGREFVAAINWRGDITIGPPNVEGRFTISRDNSKNTLYLQMNSLRPE
DTAVYYCGAGTPLNPGAYIYDWSYDYWGQGTTNTVSS RSV444 144
DVQLLESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGKGREFVAAINW
RDDITIGPPNVEGRFTISRDNAKNTLYLQMNSLRPEDTAVYYCGAGTPLNPGA
YTYDWSYDYWGQGTLVTVSSGGGGSGGGGSGGGCSEVQLLESGGGLVQPGGSL
RLSCAASGGSLSNYVLGWFRQAPGKGREFVRAINWRDDITIGPPNVEGRFTIS
RDNAKNTLYLQMNSLRPEDTAVYYCGAGTPLNPGAYTYDWSYDYWGQGTLVTV
SSGGGGSGGGGSGGGGSEVQLLESGGGLVQPGGSLRLSCAASGGSLSNYVLGW
FRQAPGKGREFVAAINWRGDITIGPPNVEGRFTISRDNSKNTLYLQMNSLRPE
DTAVYYCGAGTPLNPGAYIYDWSYDYWGQGTLVTVSS RSV445 145
DVQLLESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGKGREFVAAINW
RDDITIGPPNVEGRFTTSRDNSKNTLYLQMNSLRPEDTAVYYCGAGTPLNPGA
YIYDWSYDYWGQGTLVTVSSGGGCSGGGGSGGGGSEVQLLESGGGLVQPGGSL
RLSCAASGGSLSNYVLGWFRQAPGKGREFVAAINWRDDITIGPPNVEGRFTIS
RDNSKNTLYLQMNSLRPEDTAVYYCGAGTPLNPGAYIYDWSYDYWGQGTLVTV
SSGGGGSGGGGSGGGGSEVQLLESGGGLVQPGGSLRLSCAASGGSLSNYVLGW
FRQAPGKGREFVAAINWRDDITIGPPNVEGRFTISRDNSKNTLYLQMNSLRPE
DTAVYYCGAGTPLNPGAYIYDWSYDYWGQGTLVTVSS RSV435 162
DVQLLESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGHGREFVAAINW
RGDITTGPPNVEGRFTISRDNSNNTLYLQMNSLRPEDTAVYYCGAGTPLNPGA
YIYDWSYDYWGQCTLVTVSSGGGGSGGGGSGGGGSEVQLLESGGGLVQPGGSL
RLSCAASGGSLSNYVLGWFRQAPGKGREFVAAINWRGDITIGPPNVEGRFTIS
RDNSKNTLYLQMNSLRPEDTPNYYCGAGTPLNPGAYIYDWSYDYWGQGTLVTV
SSOGGGSGGGGSGGGGSEVQLLESGGGLVQPGGSLRLSCARSGGSLSNYVLGW
FRQAPGKGREFVAAINWRGDITTGPPNVEGRFTISRDNSKNTLYLQMNSLRPE
DTAVYYCGAGTPLNPGAYIYDWSYDYWGQGTLVTVSS RSV437 163
DVQLVESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGKEREFVAAINW
RGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLRPDDTAVYYCGAGTPLNPGA
YIYDWSYDYWGQGTLVTVSSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL
RLSCAASGGSLSNYVLGWFRQAPGKEREFVAAINWRGDITIGPPNVEGRFTIS
RDNAKNTGYLQMNSLRPDDTAVYYCGAGTPLNPGAYIYDWSYDYWGQGTLVTV
SSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGGSLSNYVLGW
FRQAPGKEREFVAAINWRGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLRPD
DTAVYYCGAGTPLNPGAYIYDWSYDYWGQGTLVTVSS RSV441 164
DVQLVESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGREREFVAAINW
RGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLRPEDTAVYYCGAGTPLNPGA
YIYDWSYDYWGQGTLVTVSSGGGGSGGGGSGGGGSEVQLVESGGGINQPGGSL
RLSCAASGGSLSNYVLGWFRQAPGKEREFVAAINWRGDITIGPPNVEGRFTIS
RDNAKNTGYLQMNSLRPEDTAVYYCGAGTPLNPGAYIYDWSYDYWGQGTLVTV
SSOGGGSGGGGSGGGGSEVQLVESGGGIVQPGGSLRLSCAASGGSLSNYVLGW
FRQAPGKEREFVAAINWRGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLRPE
DTAVYYCGAGTPLNPGAYIYDWSYDYWGQGTLVTVSS RSV440 165
DVQLVESGGGLVQPGGSLRLSCAASGGSLSNYVLGWFRQAPGKEREFVAAINW
RGDITIGPPNVEGRFTISRDNANNTGYLQMNSLRPEDTAVYYCGAGTPLNPGA
YIYDWSYDYWGRGTLVTVSSGGGGSGGGSSGGGGSEVQLVESGGGLVQPGGSL
RLSCAASGGSLSNYVLGWFRQAPGKEREFVAAINWRGDITIGPPNVEGRITIS
RDNAKNTGYLQMNSLRPEDTAVYYCGAGTPLNPGAYIYDWSYDYWGRGTLVTV
SSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGGSLSNYVLGW
FRQAPGKEREFVAAINWRGDITIGPPNVEGRFTISRDNAKNTGYLQMNSLRPE
DTAVYYCGAGTPLNPGAYIYDWSYDYWGRGTLVTVSS
TABLE-US-00006 TABLE A-6 Preferred combinations of CDR sequences
Nano- SEQ SEQ SEQ SEQ body .RTM. ID FR1 ID CDR 1 ID FR2 ID CDR 2
NC41 5 EVQLVESGGGLVQAGG 80 NYVLG 98 WERQAPG 99 ATNWRGDITI
SLSISCAASGGSLS KEREFvA GPPNVEG NC41v01 60 evqllesggglvgpgg 81 NYVLG
98 wfrqapg 100 AINWRGDITI slrlscaasggsls kgrefva GPPNVEG NC41v02 61
evqllesggglvqpgg 82 NYVLG 98 wfrqapg 100 AINWRGDITI slriscaasggsls
kgrefva GPPNVEG NC41v03 62 evqllesqgqlvqpgg 83 NYVLG 98 wfrqapg 100
AINWRGDITI slriscaasggsls kgrefva GPPNVEG NC41v04 63
evqllesggglvgpgg 84 NYVLG 98 wfrqapg 100 AINWRGDITI slsiscaasggsls
kgrefva GPPNVEG NC41v05 64 evqllesggglvqpgg 85 NYVLG 98 wfrgapg 100
AINWRGDITI slsiscaasggsls kgrefva GPPNVEG NC41v06 65
evgllesggglvqpgg 86 NYVLG 98 wfrqapg 100 AINWRDDITI slrlscaasggsls
kgrefva GPPNVEG NC41v07 66 evqllesggglvqpgg 87 NYVLG 98 wfrqapg 100
AINWRGNITI slsiscaasggsls kgretva GPPNVEG NC41v08 67
evqllesggglvqpgg 88 NYVLG 98 wfrqapg 100 AINWRGDITI slsiscaasggsls
kgrefva GPPNVEG NC41v09 68 evqllesggglvqpgg 89 NYVLG 98 wfrqapg 100
AINWRGDITI slsiscaasggsls kgrefva GPPNVEG WC41v10 69
evqllesgqglvqpgg 90 NYVLG 98 wfrqapg 100 AINWRGDITI slsiscaasggsls
kgrefva GPPNVEG NC41v11 70 evq1lesqggavgagg 91 NYVLG 98 wfrgapg 100
AINWRGDITT slsiscaasggsls kgrefva GPPNVEG NC41v12 71
evqllesggglvqpgg 92 NYVLG 98 wfrqapg 99 AINWRGDITT slsiscaasggsls
kgrefva GPPNVEG NC41v13 72 evqllesggglvqpgg 93 NYVLG 98 wfrqapg 100
AINWRGDIT1 slrlscaasggsls kgrefva GPPNVEG NC41v14 73
evqllesggglvqpgg 94 NYVLG 98 wfrqapg 100 AINWRGDITT slrlscaasggsls
kgrefva GPPNVEG NC41v15 74 evq1lesgqglvgagg 95 NYVLG 98 wfrgapg 100
AINWRGDITT slrlscaasggsls kgrefva GPPNVEG NC41v17 75
evgllesggglvqpgg 96 NYVLG 98 wfrqapg 100 AINWRGDITT slrlscaasggsls
kgrefva GPPNVEG NC41v18 76 evqllesggglvqpgg 97 NYVLG 98 wfrqapg 100
AINWRDDITI slrlscaasggsls kgrefva GPPNVEG NC41v19 146
EVQLVESGGGLVQPGG 166 NYVLG 98 WFRQAPG 99 AINWRGDITI SLRLSCAASGGSLS
KEREFVA GPPNVEG NC41v20 147 EVQINESGGGLVQPGG 166 NYVLG 98 WFRQAPG
99 AINWRGDITI SLRLSCAASGGSLS KEREFVA GPPNVEG NC41v21 148
EVQLVESGGGLVQPGG 166 NYVLG 98 WFPQAPG 99 AINWRGDITI SLRLSCAASGGSLS
NEREDIA GPPNVEG NC41v22 149 EVQLVESGGGLVQPGG 166 NYVLG 98 WFRQAPG
99 AINWRGDITI SLRLSCAASCGSLS KEREFVA GPPNVEG NC41v23 150
EVQLVESGGGLVQPGG 166 NYVLG 98 WFRQAPG 99 AINPRGDITI SLRLSCAASGGSLS
KEREFVA GPPNVEG NC41v24 151 EVQLVESGGGLVQPGG 166 NYVLG 98 WFRQAPG
99 AINWRGDITI SLRLSCAASGGSLS NEREFVA GPPNVEG NC41v25 152
EVQLVESGGGLVQPGG 166 NYVLG 98 WFRQAPG 99 AINWRGDITI SLRLSCAASGGSLS
NEREEVA GPPNVEG NC41v26 153 EVQLVESGGGLVQPGG 166 NYVLG 98 WFRQAPG
99 AINWRGDITI SLRLSCAASGGSLS KEREFVA GPPNVEG Nano- SEQ SEQ SEQ SEQ
body .RTM. ID FR3 ID CDR 3 ID FR4 ID NC41 101 RFTISRDNAKNTGYLQ 103
GTPLNPGAYI 121 WGRGTDVTVSS 122 MNSLAPDDTAVYYCGA YDWSYDY NC41v01 101
rftisrdnakntlylq 104 GTPLNPGAYI 121 wgggtlvtvss 123
mnslapedtavyycga YDWSYDY NC41v02 101 rftisrdnskntlylq 105
GTPLNPGAYI 121 wgqgtlvtvss 123 mnslapedtavyycga YDWSYDY NC41v03 101
rftisrdnskntlyiq 106 GTPLNPGAYI 121 wgqgtlvtvss 123
mpslrpedtavyycga YDWSYDY NC41v04 101 rftisrdnskntlylq 107
GTPLNPGAYI 121 wgqgtlvtvss 123 mnslrpddtavyycga YDWSYDY NC41v05 101
rftisrdnskntlylq 108 GTPLNPGAYI 121 wgqgtlvtvss 123
mnslapedtavyycga YDWSYDY NC41v06 102 rftisrdnakntlylq 109
GTPLNPGAYI 121 wgqgtlvtvss 123 mnsirpedtavyycga YDWSYDY NC41v07 101
rftisrdnakntlylq 110 GTPLNPGAYI 121 wgggtlvtvss 123
mnslapddtavyycga YDWSYDY NC41v08 101 rftisrdnakntlylq 111
GTPLNPGAYI 121 wgqgtlvtvss 123 mnslrpedtavyycga YDWSYDY NC41v09 10
rftisrdnskntlylq 112 GTPLNPGAYI 121 wgqgtlvtvss 123
mnslrpddtavyycga YDWSYDY WC41v10 101 rftisrdnakntgylq 113
GTPLNPGAYI 121 wgqgtlvtvss 123 mnslapddtavyycga YDWSYDY NC41v11 101
rftisrdnakntgylq 114 GTPLNPGAYI 121 wgqgtlvtvss 123
mnslapddtavyycga YDWSYDY NC41v12 101 rftisrdnakntgylq 115
GTPLPPGAYT 121 wgqgtlvtvss 123 mnslapddtavyycga YDWSYDY NC41v13 101
rftisrdnakntgylq 116 GTPLNPGAYI 121 wgqgtlvtvss 123
mnslapedtavyycga YDWSYDY 8C41v14 101 rftisrdnskntlylq 117
GTPENPGAYI 121 wgqgtlvtvss 123 mnslapedtavyycga YDWSYDY NC41v15 101
rftisrdnakntlylq 118 GTPLNPGAYI 121 wgggtlvtvss 123
mnslapedtavyycga YDWSYDY NC41v17 101 rftisrdnskntlylq 119
GTPLNPGAYI 121 wgggtlvtvss 123 mnslrpedtavyycga YDWSYDY NC41v18 102
rftisrdnskntlylq 120 GTPLNPGAYI 121 wgqgtlvtvss 123
mnslrpedtavyycga YDWSYDY NC41v19 101 RFTISPDNAKETGYLQ 103
GTPLNPGAYI 121 WGQGTLVTVSS 123 MNSLAPDDTAVYYCGA YDWSYDY NC41v20 101
RFTISRDNAKNTGYLQ 167 GTPIMPGAYI 121 WGQGTLVTVSS 123
MNSLRPDDTAVYYCGA YDWSYDY NC41v21 101 RFTISRDNAKNTGYLQ 116
GTPLNPGAYI 121 WGQGTLVTVSS 123 MNSLAPEDTAVYYCGA YDWSYDY NC41v22 101
RFTISPDNAKNTGYLQ 166 GTPLNPGAYI 121 WGQGTLVTVSS 123
MNSLRPEDTAVYYCGA YDWSYDY NC41v23 101 RFTISPDNAKNTGYLQ 103
GTPLNPGAYI 121 WGRGTLVTVSS 169 MNSLAPDDTAVYYCGA YDWSYDY NC41v24 101
RFTISRDNAKNTGYLQ 167 GTPLNPGAYI 121 WGRGTLVTVSS 169
MNSLPPDDTAVYYCGA YDWSYDY NC41v25 101 RFTISRDNAKNTGYLQ 116
GTPLNPGAYI 121 WGRGTLVTVSS 169 MNSLAPEDTAVYYCGA YDWSYDY NC41v26 101
RFTISPDNAKNTGYLQ 168 GTPLNPGAYI 121 WGRGTLVTVS 169 MNSLRPEDTAVYYCGA
YDWSYDY
TABLE-US-00007 TABLE A-7 Linker sequences Linker SEQ ID NO:
Sequences SGS 124 GGGGS 7GS 125 SGGSGGS 9GS 126 GGGGSGGGS 10GS 127
GGGGSGGGGS 15GS 128 GGGGSGGGGSGGGGS 18GS 129 GGGGSGGGGSGGGGGGGS
20GS 130 GGGGSGGGGSGGGGSGGGGS 25GS 131 GGGGSGGGGSGGGGSGGGGSGGGGS
30GS 132 GGGGSGGGGSGGGGSGGGGSGGGGSGGGGS 35GS 133
GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGCS G1 hinge 134 EPKSCDKTHTCPPCP
9GS-G1 135 GGGGSGGGSEPKSCDKTHTCPPCP hinge G3 hinge 136
ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCP EPKSCDTPPPCPRCP
3Ala 137 AAA
TABLE-US-00008 TABLE B-1 Characteristics of Nanobodies .RTM. that
bind hRSV F-protein Competition Binding Synagis .RTM. RSV
neutralization hRSV Fab kinetic analysis IC50 (nM)(n = 2) Clone
Family Epitope EC50 EC50 ka (1/Ms) kd (1/s) KD Long A-2 B1 191D3 LG
3sub2 II 1.5E-10 5.9E-09 1.5E+06 2.8E-03 1.9E-09 253 227 -- 1E4 LG
3sub2 II 6.6E-11 4.5E-09 8.0E+05 1.3E-03 1.6E-09 380 298 ND 7B2 16
II 9.0E-11 1.9E-09 5.7E+05 6.5E-04 1.1E-09 91 177 2690 NC23 34 II
1.0E-10 2.3E-09 8.0E+05 7.4E-04 9.2E-10 144 109 -- 15H8 29 II
8.3E-10 3.9E-08 1.2E+06 2.1E-02 1.6E-08 200 218 2340 NC41 29 II
4.1E-10 3.2E-08 8.2E+05 6.7E-03 8.1E-09 58 26 4000 15B3 4sub1 IV-VI
5.8E-11 -- 4.1E+05 2.7E-04 6.7E-10 -- -- 1274 191E4 LG 21 IV-VI
8.3E-11 -- 5.7E+05 1.5E-04 2.7E-10 -- -- 4327 Synagis .RTM. II
2.8E+05 1.8E-04 6.4E-10 4 2.5 1.7
TABLE-US-00009 TABLE B-2 Nomenclature for multivalent Nanobody
.RTM. constructs directed against hRSV F-protein Type Name
Construct SEQ ID NO Bivalent RSV101 191D3-15GS-191D3 20 RSV102
191D3-25GS-191D3 21 RSV103 191D3-35GS-191D3 22 RSV104
191D3-9GS-191D3 23 RSV105 7B2-9GS-7B2 24 RSV106 7B2-15GS-7B2 25
RSV107 15H8-9GS-15H8 26 RSV108 15H8-15GS-15H8 27 RSV109
NC23-9GS-NC23 28 RSV110 NC23-15GS-NC23 29 RSV113 15B3-15GS-15B3 30
RSV114 NC39-20GS-NC39 31 RSV115 191E4-18GS-191E4 32 RSV116
NC41-15GS-NC41 33 Biparatope RSV201 191D3-9GS-191E4 34 RSV202
191D3-15GS-191E4 35 RSV203 191D3-25GS-191E4 36 RSV204 7B2-15GS-15H8
37 RSV205 7B2-15GS-15B3 38 RSV206 15H8-15GS-15B3 39 RSV207
15H8-15GS-7B2 40 RSV301 191E4-9GS-191D3 41 RSV302 191E4-15GS-191D3
42 RSV303 191E4-25GS-191D3 43 RSV305 15B3-15GS-7B2 44 RSV306
15B3-15GS-15H8 45 Trivalent RSV400 7B2-15GS-7B2-15GS-7B2 46 RSV401
7B2-15GS-7B2-15GS-15B3 47 RSV402 15B3-15GS-7B2-15GS-7B2 48 RSV403
7B2-15GS-15B3-15GS-7B2 49 RSV404 15H8-15GS-15H8-15GS-15H8 50 RSV405
191D3-15GS-191D3-15GS-191D3 51 RSV406 NC23-15GS-NC23-15GS-NC23 52
RSV407 NC41-15GS-NC41-15GS-NC41 53 RSV408 NC41-AAA-NC41-AAA-NC41 54
RSV409 NC41-9GS-NC41-9GS-NC41 55 RSV410 NC41-20GS-NC41-20GS-NC41 56
RSV411 NC41-15GS-NC41-15GS-15B3 57 RSV412 15B3-15GS-NC41-15GS-NC41
58 RSV413 NC41-15GS-15B3-15GS-NC41 59
TABLE-US-00010 TABLE B-3 Reactivity of monovalent Nanbodies.RTM.
with antigen extracts of HEp-2 cells infected with different escape
mutants of the Long strain ##STR00001##
TABLE-US-00011 TABLE B-4 Reactivity of monovalent and bivalent
Nanobodies.RTM. with antigen extracts of HEp-2 cells infected with
different escape mutants of the Long strain ##STR00002##
TABLE-US-00012 TABLE B-5 Neutralization and kinetic binding
parameters in Biacore on F.sub.tm-NN protein for selected NC41
variants Neutralization IC50 (nM) Biacore (F.sub.tm-NN) Name Long
B-1 Long B-1 ka (1/Ms) kd (1/s) KD (M) NC41 202 4707 122 3291
1.7E+06 6.70E-03 4.00E-09 NC41v03 255 1507 nd nd nd nd nd NC41v06
111 806 nd nd 2.0E+06 4.80E-03 2.50E-09 NC41v17 249 677 149 346
1.9E+06 5.90E-03 3.20E-09 NC41v18 116 728 98 194 nd nd nd Synagis
7.3 2.1 6.0 2.9
TABLE-US-00013 TABLE B-6 Trivalent humanized and/or sequence
optimized variants of NC41 Name Construct SEQ ID NO RSV414
NC41v03-15GS-NC41v03-15GS-NC41v03 77 RSV426
NC41v06-15GS-NC41v06-15GS-NC41v06 78 RSV427
NC41v18-15GS-NC41v18-15GS-NC41v18 79 RSV434
NC41.sup.E1D-15GS-NC41-15GS-NC41 142 RSV435
NC41v17.sup.E1D-15GS-NC41v17-15GS-NC41v17 162 RSV436
NC41v20-15GS-NC41v20-15GS-NC41v20 159 RSV437
NC41v20.sup.E1D-15GS-NC41v20-15GS-NC41v20 163 RSV438
NC41v22-15GS-NC41v22-15GS-NC41v22 160 RSV439
NC41v26-15GS-NC41v26-15GS-NC41v26 161 RSV440
NC41v26.sup.E1D-15GS-NC41v26-15GS-NC41v26 165 RSV441
NC41v22.sup.E1D-15GS-NC41v22-15GS-NC41v22 164 RSV442
NC41v17-15GS-NC41v17-15GS-NC41v17 158 RSV443
NC41v03.sup.E1D-15GS-NC41v03-15GS-NC41v03 143 RSV444
NC41v06.sup.E1D-15GS-NC41v06-15GS-NC41v06 144 RSV445
NC41v18.sup.E1D-15GS-NC41v18-15GS-NC41v18 145
TABLE-US-00014 TABLE B-7 Neutralization of Long and B-1 by
trivalent NC41 variants Long B-1 Ratio Ratio to ID Trivalent IC50
[M] to Synagis IC50 [M] Synagis Experimental Series 1 RSV407 NC41
9.41E-11 59 6.6E-10 3 RSV414 NC41v03 7.81E-11 72 1.61E-10 11 RSV426
NC41v06 8.98E-11 63 9.32E-11 20 RSV427 NC41v18 9.13E-11 62 4.61E-11
40 Experimental Series 2 RSV407 NC41 13.06E-11 111 51E-11 11 RSV434
NC41 (E1D) 15E-11 107 56E-11 9 RSV441 NC41v22 7.94.sup.E-11 209
(E1D)
TABLE-US-00015 TABLE B-8 Neutralization capacity of RSV434 and
Synagis in plaque assay against various clinical isolates
Comparison Comparison Number with 100-fold between Number with
complete virus between RSV reduction or greater (%) study drugs
inhibition (%) study drugs group Synagis RSV434 P value Synagis
RSV434 P value RSV/A 27/31 (87.1%) 31/31 (100%) 0.11 1/31 (3.2%)
29/31 (93.5%) <0.0001 RSV/B 26/30 (86.7%) 28/30 (93.3%) 0.67
11/30 (36.7%) 22/30 (73.3%) 0.009 Total 53/61 (86.9%) 59/61 (96.7%)
0.09 12/61 (19.7) 51/61 (83.6%) <0.0001
TABLE-US-00016 TABLE B-9 Overview table of all cotton rat
experiments performed showing both the detection of replication
competent virus and viral RNA at day 4 post inoculation (in
experiment 3 detection at day 7 was also performed) Viral load
difference Fold versus reduction control viral Nanobody (log.sub.10
RNA dose Treatment regimen pfu) (2.sup..DELTA.CT) Exp 1 RSV407 5
mg/kg Prophylactic day -1 -2.59* 286.7* Therapeutic day +1, 2, +3
-2.88* 4.4* Therapeutic day +2, +3 -2.83* 4.6* Exp 2 RSV407 5 mg/kg
Prophylactic day -1 -3.01* 79.2* 1 mg/kg -2.37* 61.3* 0.2 mg/kg
-1.43* 28.1* 0.04 mg/kg -0.37 11.7* Exp 3 RSV407 5 mg/kg
Therapeutic day +1 -2.04* 2.9* (Read out at day 7) (0.63*) (1.8)
Therapeutic day +1, +2 -2.47* 2.5* (Read out at day 7) (0.57)
(4.5*) Exp 4 RVS407 0.2 mg/kg Prophylactic day -1 -0.75* 29.8*
RSV503 1 mg/kg -1.27* 31.4* 0.2 mg/kg -0.71* 30.4* 0.04 mg/kg
-0.22* 15.5* Exp 5 RSV434 20 mg/kg Therapeutic day +2, +3 -2.89*
10.2* 4 mg/kg -1.76* 1.9 2 mg/kg -1.81* 5.5* 1 mg/kg -1.66* 3.9*
Exp 6 RSV434 5 mg/ml Therapeutic day +2, +3 -3.15* 10* 20 mg/ml
-2.64* 2.4* 80 mg/ml -3.30* 4.3* *p < 0.05
Sequence CWU 1
1
1691128PRTArtificial SequenceNanobody sequence 1Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu
Ser Cys Glu Ala Ser Gly Arg Thr Phe Ser Ser Tyr 20 25 30Gly Met Gly
Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala
Val Ser Arg Leu Ser Gly Pro Arg Thr Val Tyr Ala Asp Ser 50 55 60Val
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Glu Asn Thr Val65 70 75
80Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Thr
85 90 95Cys Ala Ala Glu Leu Thr Asn Arg Asn Pro Gly Ala Tyr Tyr Tyr
Thr 100 105 110Trp Ala Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr
Val Ser Ser 115 120 1252127PRTArtificial SequenceNanobody sequence
2Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Asp1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Ser
Tyr 20 25 30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Phe Val 35 40 45Ala Ala Ile Ser Trp Ser Asp Gly Ser Thr Tyr Tyr Ala
Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Asp Leu Thr Ser Thr Asn Pro
Gly Ser Tyr Ile Tyr Ile Trp 100 105 110Ala Tyr Asp Tyr Trp Gly Gln
Gly Thr Gln Val Thr Val Ser Ser 115 120 1253127PRTArtificial
SequenceNanobody sequence 3Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Arg Thr Phe Ser Ser Ile 20 25 30Ala Met Gly Trp Phe Arg Gln Ala
Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Ser Trp Ser Arg
Gly Arg Thr Phe Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Ile Ile
Ser Arg Asp Asp Ala Ala Asn Thr Ala Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Val Asp
Thr Ala Ser Trp Asn Ser Gly Ser Phe Ile Tyr Asp Trp 100 105 110Ala
Tyr Asp His Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120
1254126PRTArtificial SequenceNanobody sequence 4Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Arg Ser Phe Ser Asn Tyr 20 25 30Val Leu Gly
Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala
Ile Ser Phe Arg Gly Asp Ser Ala Ile Gly Ala Pro Ser Val 50 55 60Glu
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr65 70 75
80Leu Gln Met Asn Ser Leu Val Pro Asp Asp Thr Ala Val Tyr Tyr Cys
85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp
Ser 100 105 110Tyr Asp Tyr Trp Gly Arg Gly Thr Gln Val Thr Val Ser
Ser 115 120 1255126PRTArtificial SequenceNanobody sequence 5Glu Val
Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser
Leu Ser Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr 20 25
30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn
Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr
Gly Tyr65 70 75 80Leu Gln Met Asn Ser Leu Ala Pro Asp Asp Thr Ala
Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr
Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Arg Gly Thr Gln
Val Thr Val Ser Ser 115 120 1256121PRTArtificial SequenceNanobody
sequence 6Glu Val Gln Leu Val Glu Ser Gly Gly Gly Trp Val Gln Ala
Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Ala Phe
Ser Ser Tyr 20 25 30Ala Met Gly Trp Ile Arg Gln Ala Pro Gly Lys Glu
Arg Glu Phe Val 35 40 45Ala Gly Ile Asp Gln Ser Gly Glu Ser Thr Ala
Tyr Gly Ala Ser Ala 50 55 60Ser Gly Arg Phe Ile Ile Ser Arg Asp Asn
Ala Lys Asn Thr Val His65 70 75 80Leu Leu Met Asn Ser Leu Gln Ser
Asp Asp Thr Ala Val Tyr Tyr Cys 85 90 95Val Ala Asp Gly Val Leu Ala
Thr Thr Leu Asn Trp Asp Tyr Trp Gly 100 105 110Gln Gly Thr Gln Val
Thr Val Ser Ser 115 1207126PRTArtificial SequenceNanobody sequence
7Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Leu Thr Leu Asp Tyr
Tyr 20 25 30Ala Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Gly Val 35 40 45Ser Cys Ile Ser Ser Ser Asp His Ser Thr Thr Tyr Thr
Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Trp Asp Asn Ala Lys
Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Gly Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Asp Pro Ala Leu Gly Cys Tyr
Ser Gly Ser Tyr Tyr Pro Arg 100 105 110Tyr Asp Tyr Trp Gly Gln Gly
Thr Gln Val Thr Val Ser Ser 115 120 1258118PRTArtificial
SequenceNanobody sequence 8Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Ser Ser Gly Val Ile Asn 20 25 30Ala Met Ala Trp His Arg Gln Ala
Pro Gly Lys Glu Arg Glu Leu Val 35 40 45Ala His Ile Ser Ser Gly Gly
Ser Thr Tyr Tyr Gly Asp Phe Val Lys 50 55 60Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ala Lys Asp Thr Val Tyr Leu65 70 75 80Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys His 85 90 95Val Pro Trp
Met Asp Tyr Asn Arg Arg Asp Tyr Trp Gly Gln Gly Thr 100 105 110Gln
Val Thr Val Ser Ser 1159128PRTArtificial SequenceNanobody sequence
9Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Glu Ala Ser Gly Arg Thr Tyr Ser Arg
Tyr 20 25 30Gly Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Phe Val 35 40 45Ala Ala Val Ser Arg Leu Ser Gly Pro Arg Thr Val Tyr
Ala Asp Ser 50 55 60Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala
Glu Asn Thr Val65 70 75 80Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu
Asp Thr Ala Val Tyr Thr 85 90 95Cys Ala Ala Glu Leu Thr Asn Arg Asn
Ser Gly Ala Tyr Tyr Tyr Ala 100 105 110Trp Ala Tyr Asp Tyr Trp Gly
Gln Gly Thr Gln Val Thr Val Ser Ser 115 120 12510127PRTArtificial
SequenceNanobody sequence 10Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Pro Thr Phe Ser Ala Asp 20 25 30Thr Met Gly Trp Phe Arg Gln Ala
Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Thr Ile Pro Trp Ser Gly
Gly Ile Ala Tyr Tyr Ser Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Met
Ser Arg Asp Asn Ala Lys Asn Thr Val Asp65 70 75 80Leu Gln Met Asn
Ser Leu Lys Pro Glu Asp Thr Ala Leu Tyr Tyr Cys 85 90 95Ala Gly Ser
Ser Arg Ile Tyr Ile Tyr Ser Asp Ser Leu Ser Glu Arg 100 105 110Ser
Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120
12511129PRTArtificial SequenceNanobody sequence 11Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Glu Ala Ser Gly Arg Thr Phe Ser Ser Tyr 20 25 30Ala Met
Val Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe 35 40 45Val
Ala Ala Val Thr Arg Trp Ser Gly Ala Arg Thr Val Tyr Ala Asp 50 55
60Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Glu Asn Thr65
70 75 80Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val
Tyr 85 90 95Thr Cys Ala Ala Asp Ser Thr Asn Arg Asn Ser Gly Ala Val
Tyr Tyr 100 105 110Ser Trp Ala Tyr Asp Tyr Trp Gly Gln Gly Thr Gln
Val Thr Val Ser 115 120 125Ser12128PRTArtificial SequenceNanobody
sequence 12Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala
Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Glu Ala Ser Gly Arg Thr Phe
Ser Pro Ile 20 25 30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu
Arg Glu Phe Val 35 40 45Ala Val Val Thr Arg Trp Ser Gly Ala Arg Thr
Val Tyr Ala Asp Ser 50 55 60Val Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asn Ala Glu Asn Thr Val65 70 75 80Tyr Leu Gln Met Asn Ser Leu Lys
Pro Glu Asp Thr Ala Val Tyr Thr 85 90 95Cys Ala Ala Asp Ser Thr Asn
Arg Asn Ser Gly Ala Ile Tyr Tyr Thr 100 105 110Trp Ala Tyr Asp Tyr
Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120
1251318DNAArtificial SequencePrimer sequence 13cttagcagaa aaccgtga
181418DNAArtificial SequencePrimer sequence 14tgggttgatt tgggattg
181519DNAArtificial SequencePrimer sequence 15ggactgatag aggatggta
191618DNAArtificial SequencePrimer sequence 16gctgacttca cttggtaa
1817271PRTArtificial SequenceNanobody sequence 17Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Glu Ala Ser Gly Arg Thr Tyr Ser Arg Tyr 20 25 30Gly Met
Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala
Ala Val Ser Arg Leu Ser Gly Pro Arg Thr Val Tyr Ala Asp Ser 50 55
60Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Glu Asn Thr Val65
70 75 80Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr
Thr 85 90 95Cys Ala Ala Glu Leu Thr Asn Arg Asn Ser Gly Ala Tyr Tyr
Tyr Ala 100 105 110Trp Ala Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val
Thr Val Ser Ser 115 120 125Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Glu 130 135 140Val Gln Leu Val Glu Ser Gly Gly
Gly Leu Val Gln Ala Gly Gly Ser145 150 155 160Leu Arg Leu Ser Cys
Glu Ala Ser Gly Arg Thr Tyr Ser Arg Tyr Gly 165 170 175Met Gly Trp
Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala 180 185 190Ala
Val Ser Arg Leu Ser Gly Pro Arg Thr Val Tyr Ala Asp Ser Val 195 200
205Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Glu Asn Thr Val Tyr
210 215 220Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr
Thr Cys225 230 235 240Ala Ala Glu Leu Thr Asn Arg Asn Ser Gly Ala
Tyr Tyr Tyr Ala Trp 245 250 255Ala Tyr Asp Tyr Trp Gly Gln Gly Thr
Gln Val Thr Val Ser Ser 260 265 27018280PRTArtificial
SequenceNanobody sequence 18Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Ala Gly Gly Ser1 5 10 15Leu Arg Leu Ser Cys Glu Ala Ser Gly
Arg Thr Tyr Ser Arg Tyr Gly 20 25 30Met Gly Trp Phe Arg Gln Ala Pro
Gly Lys Glu Arg Glu Phe Val Ala 35 40 45Ala Val Ser Arg Leu Ser Gly
Pro Arg Thr Val Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Glu Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Thr Cys 85 90 95Ala Ala Glu
Leu Thr Asn Arg Asn Ser Gly Ala Tyr Tyr Tyr Ala Trp 100 105 110Ala
Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
130 135 140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu
Ser Gly145 150 155 160Gly Gly Leu Val Gln Ala Gly Gly Ser Leu Arg
Leu Ser Cys Glu Ala 165 170 175Ser Gly Arg Thr Tyr Ser Arg Tyr Gly
Met Gly Trp Phe Arg Gln Ala 180 185 190Pro Gly Lys Glu Arg Glu Phe
Val Ala Ala Val Ser Arg Leu Ser Gly 195 200 205Pro Arg Thr Val Tyr
Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser 210 215 220Arg Asp Asn
Ala Glu Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Lys225 230 235
240Pro Glu Asp Thr Ala Val Tyr Thr Cys Ala Ala Glu Leu Thr Asn Arg
245 250 255Asn Ser Gly Ala Tyr Tyr Tyr Ala Trp Ala Tyr Asp Tyr Trp
Gly Gln 260 265 270Gly Thr Gln Val Thr Val Ser Ser 275
28019291PRTArtificial SequenceNanobody sequence 19Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Glu Ala Ser Gly Arg Thr Tyr Ser Arg Tyr 20 25 30Gly Met
Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala
Ala Val Ser Arg Leu Ser Gly Pro Arg Thr Val Tyr Ala Asp Ser 50 55
60Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Glu Asn Thr Val65
70 75 80Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr
Thr 85 90 95Cys Ala Ala Glu Leu Thr Asn Arg Asn Ser Gly Ala Tyr Tyr
Tyr Ala 100 105 110Trp Ala Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val
Thr Val Ser Ser 115 120 125Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly 130 135 140Gly Gly Gly Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Gly Gly145 150 155 160Gly Gly Ser Glu Val
Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 165 170 175Ala Gly Gly
Ser Leu Arg Leu Ser Cys Glu Ala Ser Gly Arg Thr Tyr 180 185 190Ser
Arg Tyr Gly Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg 195 200
205Glu Phe Val Ala Ala Val Ser Arg Leu Ser Gly Pro Arg Thr Val Tyr
210 215 220Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn
Ala Glu225 230 235 240Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Lys
Pro Glu Asp Thr Ala
245 250 255Val Tyr Thr Cys Ala Ala Glu Leu Thr Asn Arg Asn Ser Gly
Ala Tyr 260 265 270Tyr Tyr Ala Trp Ala Tyr Asp Tyr Trp Gly Gln Gly
Thr Gln Val Thr 275 280 285Val Ser Ser 29020265PRTArtificial
SequenceNanobody sequence 20Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Glu Ala Ser
Gly Arg Thr Tyr Ser Arg Tyr 20 25 30Gly Met Gly Trp Phe Arg Gln Ala
Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Val Ser Arg Leu Ser
Gly Pro Arg Thr Val Tyr Ala Asp Ser 50 55 60Val Lys Gly Arg Phe Thr
Ile Ser Arg Asp Asn Ala Glu Asn Thr Val65 70 75 80Tyr Leu Gln Met
Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Thr 85 90 95Cys Ala Ala
Glu Leu Thr Asn Arg Asn Ser Gly Ala Tyr Tyr Tyr Ala 100 105 110Trp
Ala Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120
125Gly Gly Gly Gly Ser Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser
130 135 140Gly Gly Gly Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser
Cys Glu145 150 155 160Ala Ser Gly Arg Thr Tyr Ser Arg Tyr Gly Met
Gly Trp Phe Arg Gln 165 170 175Ala Pro Gly Lys Glu Arg Glu Phe Val
Ala Ala Val Ser Arg Leu Ser 180 185 190Gly Pro Arg Thr Val Tyr Ala
Asp Ser Val Lys Gly Arg Phe Thr Ile 195 200 205Ser Arg Asp Asn Ala
Glu Asn Thr Val Tyr Leu Gln Met Asn Ser Leu 210 215 220Lys Pro Glu
Asp Thr Ala Val Tyr Thr Cys Ala Ala Glu Leu Thr Asn225 230 235
240Arg Asn Ser Gly Ala Tyr Tyr Tyr Ala Trp Ala Tyr Asp Tyr Trp Gly
245 250 255Gln Gly Thr Gln Val Thr Val Ser Ser 260
26521263PRTArtificial SequenceNanobody sequence 21Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Asp1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Ser Tyr 20 25 30Ala Met
Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala
Ala Ile Ser Trp Ser Asp Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65
70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Ala Ala Asp Leu Thr Ser Thr Asn Pro Gly Ser Tyr Ile Tyr
Ile Trp 100 105 110Ala Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr
Val Ser Ser Gly 115 120 125Gly Gly Gly Ser Gly Gly Gly Ser Glu Val
Gln Leu Val Glu Ser Gly 130 135 140Gly Gly Leu Val Gln Ala Gly Asp
Ser Leu Arg Leu Ser Cys Ala Ala145 150 155 160Ser Gly Arg Thr Phe
Ser Ser Tyr Ala Met Gly Trp Phe Arg Gln Ala 165 170 175Pro Gly Lys
Glu Arg Glu Phe Val Ala Ala Ile Ser Trp Ser Asp Gly 180 185 190Ser
Thr Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg 195 200
205Asp Asn Ala Lys Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Lys Pro
210 215 220Glu Asp Thr Ala Val Tyr Tyr Cys Ala Ala Asp Leu Thr Ser
Thr Asn225 230 235 240Pro Gly Ser Tyr Ile Tyr Ile Trp Ala Tyr Asp
Tyr Trp Gly Gln Gly 245 250 255Thr Gln Val Thr Val Ser Ser
26022269PRTArtificial SequenceNanobody sequence 22Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Asp1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Ser Tyr 20 25 30Ala Met
Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala
Ala Ile Ser Trp Ser Asp Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65
70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Ala Ala Asp Leu Thr Ser Thr Asn Pro Gly Ser Tyr Ile Tyr
Ile Trp 100 105 110Ala Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr
Val Ser Ser Gly 115 120 125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Glu Val 130 135 140Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Ala Gly Asp Ser Leu145 150 155 160Arg Leu Ser Cys Ala
Ala Ser Gly Arg Thr Phe Ser Ser Tyr Ala Met 165 170 175Gly Trp Phe
Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala 180 185 190Ile
Ser Trp Ser Asp Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys Gly 195 200
205Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr Leu Gln
210 215 220Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys
Ala Ala225 230 235 240Asp Leu Thr Ser Thr Asn Pro Gly Ser Tyr Ile
Tyr Ile Trp Ala Tyr 245 250 255Asp Tyr Trp Gly Gln Gly Thr Gln Val
Thr Val Ser Ser 260 26523261PRTArtificial SequenceNanobody sequence
23Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Ser Phe Ser Asn
Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Phe Val 35 40 45Ala Ala Ile Ser Phe Arg Gly Asp Ser Ala Ile Gly Ala
Pro Ser Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Gly Tyr65 70 75 80Leu Gln Met Asn Ser Leu Val Pro Asp Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly
Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Arg Gly
Thr Gln Val Thr Val Ser Ser Gly Gly 115 120 125Gly Gly Ser Gly Gly
Gly Ser Glu Val Gln Leu Val Glu Ser Gly Gly 130 135 140Gly Leu Val
Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser145 150 155
160Gly Arg Ser Phe Ser Asn Tyr Val Leu Gly Trp Phe Arg Gln Ala Pro
165 170 175Gly Lys Glu Arg Glu Phe Val Ala Ala Ile Ser Phe Arg Gly
Asp Ser 180 185 190Ala Ile Gly Ala Pro Ser Val Glu Gly Arg Phe Thr
Ile Ser Arg Asp 195 200 205Asn Ala Lys Asn Thr Gly Tyr Leu Gln Met
Asn Ser Leu Val Pro Asp 210 215 220Asp Thr Ala Val Tyr Tyr Cys Gly
Ala Gly Thr Pro Leu Asn Pro Gly225 230 235 240Ala Tyr Ile Tyr Asp
Trp Ser Tyr Asp Tyr Trp Gly Arg Gly Thr Gln 245 250 255Val Thr Val
Ser Ser 26024267PRTArtificial SequenceNanobody sequence 24Glu Val
Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser
Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Ser Phe Ser Asn Tyr 20 25
30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Ala Ile Ser Phe Arg Gly Asp Ser Ala Ile Gly Ala Pro Ser
Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr
Gly Tyr65 70 75 80Leu Gln Met Asn Ser Leu Val Pro Asp Asp Thr Ala
Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr
Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Arg Gly Thr Gln
Val Thr Val Ser Ser Gly Gly 115 120 125Gly Gly Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Glu Val Gln 130 135 140Leu Val Glu Ser Gly
Gly Gly Leu Val Gln Ala Gly Gly Ser Leu Arg145 150 155 160Leu Ser
Cys Ala Ala Ser Gly Arg Ser Phe Ser Asn Tyr Val Leu Gly 165 170
175Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Ile
180 185 190Ser Phe Arg Gly Asp Ser Ala Ile Gly Ala Pro Ser Val Glu
Gly Arg 195 200 205Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly
Tyr Leu Gln Met 210 215 220Asn Ser Leu Val Pro Asp Asp Thr Ala Val
Tyr Tyr Cys Gly Ala Gly225 230 235 240Thr Pro Leu Asn Pro Gly Ala
Tyr Ile Tyr Asp Trp Ser Tyr Asp Tyr 245 250 255Trp Gly Arg Gly Thr
Gln Val Thr Val Ser Ser 260 26525263PRTArtificial SequenceNanobody
sequence 25Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro
Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe
Ser Ser Ile 20 25 30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu
Arg Glu Phe Val 35 40 45Ala Ala Ile Ser Trp Ser Arg Gly Arg Thr Phe
Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Ile Ile Ser Arg Asp Asp
Ala Ala Asn Thr Ala Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro
Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Val Asp Thr Ala Ser Trp
Asn Ser Gly Ser Phe Ile Tyr Asp Trp 100 105 110Ala Tyr Asp His Trp
Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly 115 120 125Gly Gly Gly
Ser Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly 130 135 140Gly
Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala145 150
155 160Ser Gly Arg Thr Phe Ser Ser Ile Ala Met Gly Trp Phe Arg Gln
Ala 165 170 175Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Ile Ser Trp
Ser Arg Gly 180 185 190Arg Thr Phe Tyr Ala Asp Ser Val Lys Gly Arg
Phe Ile Ile Ser Arg 195 200 205Asp Asp Ala Ala Asn Thr Ala Tyr Leu
Gln Met Asn Ser Leu Lys Pro 210 215 220Glu Asp Thr Ala Val Tyr Tyr
Cys Ala Val Asp Thr Ala Ser Trp Asn225 230 235 240Ser Gly Ser Phe
Ile Tyr Asp Trp Ala Tyr Asp His Trp Gly Gln Gly 245 250 255Thr Gln
Val Thr Val Ser Ser 26026269PRTArtificial SequenceNanobody sequence
26Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Ser
Ile 20 25 30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Phe Val 35 40 45Ala Ala Ile Ser Trp Ser Arg Gly Arg Thr Phe Tyr Ala
Asp Ser Val 50 55 60Lys Gly Arg Phe Ile Ile Ser Arg Asp Asp Ala Ala
Asn Thr Ala Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Val Asp Thr Ala Ser Trp Asn Ser
Gly Ser Phe Ile Tyr Asp Trp 100 105 110Ala Tyr Asp His Trp Gly Gln
Gly Thr Gln Val Thr Val Ser Ser Gly 115 120 125Gly Gly Gly Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val 130 135 140Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu145 150 155
160Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Ser Ile Ala Met
165 170 175Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
Ala Ala 180 185 190Ile Ser Trp Ser Arg Gly Arg Thr Phe Tyr Ala Asp
Ser Val Lys Gly 195 200 205Arg Phe Ile Ile Ser Arg Asp Asp Ala Ala
Asn Thr Ala Tyr Leu Gln 210 215 220Met Asn Ser Leu Lys Pro Glu Asp
Thr Ala Val Tyr Tyr Cys Ala Val225 230 235 240Asp Thr Ala Ser Trp
Asn Ser Gly Ser Phe Ile Tyr Asp Trp Ala Tyr 245 250 255Asp His Trp
Gly Gln Gly Thr Gln Val Thr Val Ser Ser 260 26527267PRTArtificial
SequenceNanobody sequence 27Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Leu Thr Leu Asp Tyr Tyr 20 25 30Ala Leu Gly Trp Phe Arg Gln Ala
Pro Gly Lys Glu Arg Glu Gly Val 35 40 45Ser Cys Ile Ser Ser Ser Asp
His Ser Thr Thr Tyr Thr Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Trp Asp Asn Ala Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Lys Pro Gly Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Asp
Pro Ala Leu Gly Cys Tyr Ser Gly Ser Tyr Tyr Pro Arg 100 105 110Tyr
Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly Gly 115 120
125Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln
130 135 140Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser
Leu Arg145 150 155 160Leu Ser Cys Ala Ala Ser Gly Leu Thr Leu Asp
Tyr Tyr Ala Leu Gly 165 170 175Trp Phe Arg Gln Ala Pro Gly Lys Glu
Arg Glu Gly Val Ser Cys Ile 180 185 190Ser Ser Ser Asp His Ser Thr
Thr Tyr Thr Asp Ser Val Lys Gly Arg 195 200 205Phe Thr Ile Ser Trp
Asp Asn Ala Lys Asn Thr Leu Tyr Leu Gln Met 210 215 220Asn Ser Leu
Lys Pro Gly Asp Thr Ala Val Tyr Tyr Cys Ala Ala Asp225 230 235
240Pro Ala Leu Gly Cys Tyr Ser Gly Ser Tyr Tyr Pro Arg Tyr Asp Tyr
245 250 255Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 260
26528262PRTArtificial SequenceNanobody sequence 28Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Trp Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Arg Ala Phe Ser Ser Tyr 20 25 30Ala Met
Gly Trp Ile Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala
Gly Ile Asp Gln Ser Gly Glu Ser Thr Ala Tyr Gly Ala Ser Ala 50 55
60Ser Gly Arg Phe Ile Ile Ser Arg Asp Asn Ala Lys Asn Thr Val His65
70 75 80Leu Leu Met Asn Ser Leu Gln Ser Asp Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Val Ala Asp Gly Val Leu Ala Thr Thr Leu Asn Trp Asp Tyr
Trp Gly 100 105 110Gln Gly Thr Gln Val Thr Val Ser Ser Gly Gly Gly
Gly Ser Gly Gly 115 120 125Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln 130 135 140Leu Val Glu Ser Gly Gly Gly Trp
Val Gln Ala Gly Gly Ser Leu Arg145 150 155 160Leu Ser Cys Ala Ala
Ser Gly Arg Ala Phe Ser Ser Tyr Ala Met Gly 165 170 175Trp Ile Arg
Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Gly Ile 180 185 190Asp
Gln Ser Gly Glu Ser Thr Ala Tyr Gly Ala Ser Ala Ser Gly Arg 195 200
205Phe Ile Ile Ser Arg Asp Asn Ala Lys Asn Thr Val His Leu Leu Met
210 215 220Asn Ser Leu Gln Ser Asp Asp Thr Ala Val Tyr Tyr Cys Val
Ala Asp225 230 235 240Gly Val Leu Ala Thr Thr Leu Asn Trp Asp Tyr
Trp Gly Gln Gly Thr
245 250 255Gln Val Thr Val Ser Ser 26029272PRTArtificial
SequenceNanobody sequence 29Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Pro Thr Phe Ser Ala Asp 20 25 30Thr Met Gly Trp Phe Arg Gln Ala
Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Thr Ile Pro Trp Ser Gly
Gly Ile Ala Tyr Tyr Ser Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Met
Ser Arg Asp Asn Ala Lys Asn Thr Val Asp65 70 75 80Leu Gln Met Asn
Ser Leu Lys Pro Glu Asp Thr Ala Leu Tyr Tyr Cys 85 90 95Ala Gly Ser
Ser Arg Ile Tyr Ile Tyr Ser Asp Ser Leu Ser Glu Arg 100 105 110Ser
Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Gly Gly Gly
130 135 140Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln
Ala Gly145 150 155 160Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Pro Thr Phe Ser Ala 165 170 175Asp Thr Met Gly Trp Phe Arg Gln Ala
Pro Gly Lys Glu Arg Glu Phe 180 185 190Val Ala Thr Ile Pro Trp Ser
Gly Gly Ile Ala Tyr Tyr Ser Asp Ser 195 200 205Val Lys Gly Arg Phe
Thr Met Ser Arg Asp Asn Ala Lys Asn Thr Val 210 215 220Asp Leu Gln
Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Leu Tyr Tyr225 230 235
240Cys Ala Gly Ser Ser Arg Ile Tyr Ile Tyr Ser Asp Ser Leu Ser Glu
245 250 255Arg Ser Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val
Ser Ser 260 265 27030267PRTArtificial SequenceNanobody sequence
30Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1
5 10 15Ser Leu Ser Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn
Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro
Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Gly Tyr65 70 75 80Leu Gln Met Asn Ser Leu Ala Pro Asp Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly
Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Arg Gly
Thr Gln Val Thr Val Ser Ser Gly Gly 115 120 125Gly Gly Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln 130 135 140Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Ala Gly Gly Ser Leu Ser145 150 155
160Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly
165 170 175Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala
Ala Ile 180 185 190Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn
Val Glu Gly Arg 195 200 205Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn
Thr Gly Tyr Leu Gln Met 210 215 220Asn Ser Leu Ala Pro Asp Asp Thr
Ala Val Tyr Tyr Cys Gly Ala Gly225 230 235 240Thr Pro Leu Asn Pro
Gly Ala Tyr Ile Tyr Asp Trp Ser Tyr Asp Tyr 245 250 255Trp Gly Arg
Gly Thr Gln Val Thr Val Ser Ser 260 26531264PRTArtificial
SequenceNanobody sequence 31Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Glu Ala Ser
Gly Arg Thr Tyr Ser Arg Tyr 20 25 30Gly Met Gly Trp Phe Arg Gln Ala
Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Val Ser Arg Leu Ser
Gly Pro Arg Thr Val Tyr Ala Asp Ser 50 55 60Val Lys Gly Arg Phe Thr
Ile Ser Arg Asp Asn Ala Glu Asn Thr Val65 70 75 80Tyr Leu Gln Met
Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Thr 85 90 95Cys Ala Ala
Glu Leu Thr Asn Arg Asn Ser Gly Ala Tyr Tyr Tyr Ala 100 105 110Trp
Ala Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120
125Gly Gly Gly Gly Ser Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser
130 135 140Gly Gly Gly Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser
Cys Ala145 150 155 160Ala Ser Gly Pro Thr Phe Ser Ala Asp Thr Met
Gly Trp Phe Arg Gln 165 170 175Ala Pro Gly Lys Glu Arg Glu Phe Val
Ala Thr Ile Pro Trp Ser Gly 180 185 190Gly Ile Ala Tyr Tyr Ser Asp
Ser Val Lys Gly Arg Phe Thr Met Ser 195 200 205Arg Asp Asn Ala Lys
Asn Thr Val Asp Leu Gln Met Asn Ser Leu Lys 210 215 220Pro Glu Asp
Thr Ala Leu Tyr Tyr Cys Ala Gly Ser Ser Arg Ile Tyr225 230 235
240Ile Tyr Ser Asp Ser Leu Ser Glu Arg Ser Tyr Asp Tyr Trp Gly Gln
245 250 255Gly Thr Gln Val Thr Val Ser Ser 26032270PRTArtificial
SequenceNanobody sequence 32Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Glu Ala Ser
Gly Arg Thr Tyr Ser Arg Tyr 20 25 30Gly Met Gly Trp Phe Arg Gln Ala
Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Val Ser Arg Leu Ser
Gly Pro Arg Thr Val Tyr Ala Asp Ser 50 55 60Val Lys Gly Arg Phe Thr
Ile Ser Arg Asp Asn Ala Glu Asn Thr Val65 70 75 80Tyr Leu Gln Met
Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Thr 85 90 95Cys Ala Ala
Glu Leu Thr Asn Arg Asn Ser Gly Ala Tyr Tyr Tyr Ala 100 105 110Trp
Ala Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120
125Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu
130 135 140Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly
Gly Ser145 150 155 160Leu Arg Leu Ser Cys Ala Ala Ser Gly Pro Thr
Phe Ser Ala Asp Thr 165 170 175Met Gly Trp Phe Arg Gln Ala Pro Gly
Lys Glu Arg Glu Phe Val Ala 180 185 190Thr Ile Pro Trp Ser Gly Gly
Ile Ala Tyr Tyr Ser Asp Ser Val Lys 195 200 205Gly Arg Phe Thr Met
Ser Arg Asp Asn Ala Lys Asn Thr Val Asp Leu 210 215 220Gln Met Asn
Ser Leu Lys Pro Glu Asp Thr Ala Leu Tyr Tyr Cys Ala225 230 235
240Gly Ser Ser Arg Ile Tyr Ile Tyr Ser Asp Ser Leu Ser Glu Arg Ser
245 250 255Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser
260 265 27033280PRTArtificial SequenceNanobody sequence 33Glu Val
Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser
Leu Arg Leu Ser Cys Glu Ala Ser Gly Arg Thr Tyr Ser Arg Tyr 20 25
30Gly Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Ala Val Ser Arg Leu Ser Gly Pro Arg Thr Val Tyr Ala Asp
Ser 50 55 60Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Glu Asn
Thr Val65 70 75 80Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr
Ala Val Tyr Thr 85 90 95Cys Ala Ala Glu Leu Thr Asn Arg Asn Ser Gly
Ala Tyr Tyr Tyr Ala 100 105 110Trp Ala Tyr Asp Tyr Trp Gly Gln Gly
Thr Gln Val Thr Val Ser Ser 115 120 125Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Gly 130 135 140Gly Gly Gly Ser Gly
Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser145 150 155 160Gly Gly
Gly Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala 165 170
175Ala Ser Gly Pro Thr Phe Ser Ala Asp Thr Met Gly Trp Phe Arg Gln
180 185 190Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Thr Ile Pro Trp
Ser Gly 195 200 205Gly Ile Ala Tyr Tyr Ser Asp Ser Val Lys Gly Arg
Phe Thr Met Ser 210 215 220Arg Asp Asn Ala Lys Asn Thr Val Asp Leu
Gln Met Asn Ser Leu Lys225 230 235 240Pro Glu Asp Thr Ala Leu Tyr
Tyr Cys Ala Gly Ser Ser Arg Ile Tyr 245 250 255Ile Tyr Ser Asp Ser
Leu Ser Glu Arg Ser Tyr Asp Tyr Trp Gly Gln 260 265 270Gly Thr Gln
Val Thr Val Ser Ser 275 28034268PRTArtificial SequenceNanobody
sequence 34Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala
Gly Asp1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe
Ser Ser Tyr 20 25 30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu
Arg Glu Phe Val 35 40 45Ala Ala Ile Ser Trp Ser Asp Gly Ser Thr Tyr
Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn
Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro
Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Asp Leu Thr Ser Thr
Asn Pro Gly Ser Tyr Ile Tyr Ile Trp 100 105 110Ala Tyr Asp Tyr Trp
Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly 115 120 125Gly Gly Gly
Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val 130 135 140Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly Ser Leu145 150
155 160Arg Leu Ser Cys Ala Ala Ser Gly Arg Ser Phe Ser Asn Tyr Val
Leu 165 170 175Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe
Val Ala Ala 180 185 190Ile Ser Phe Arg Gly Asp Ser Ala Ile Gly Ala
Pro Ser Val Glu Gly 195 200 205Arg Phe Thr Ile Ser Arg Asp Asn Ala
Lys Asn Thr Gly Tyr Leu Gln 210 215 220Met Asn Ser Leu Val Pro Asp
Asp Thr Ala Val Tyr Tyr Cys Gly Ala225 230 235 240Gly Thr Pro Leu
Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser Tyr Asp 245 250 255Tyr Trp
Gly Arg Gly Thr Gln Val Thr Val Ser Ser 260 26535268PRTArtificial
SequenceNanobody sequence 35Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Ala Gly Asp1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Arg Thr Phe Ser Ser Tyr 20 25 30Ala Met Gly Trp Phe Arg Gln Ala
Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Ser Trp Ser Asp
Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Asp
Leu Thr Ser Thr Asn Pro Gly Ser Tyr Ile Tyr Ile Trp 100 105 110Ala
Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val
130 135 140Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
Ser Leu145 150 155 160Arg Leu Ser Cys Ala Ala Ser Gly Leu Thr Leu
Asp Tyr Tyr Ala Leu 165 170 175Gly Trp Phe Arg Gln Ala Pro Gly Lys
Glu Arg Glu Gly Val Ser Cys 180 185 190Ile Ser Ser Ser Asp His Ser
Thr Thr Tyr Thr Asp Ser Val Lys Gly 195 200 205Arg Phe Thr Ile Ser
Trp Asp Asn Ala Lys Asn Thr Leu Tyr Leu Gln 210 215 220Met Asn Ser
Leu Lys Pro Gly Asp Thr Ala Val Tyr Tyr Cys Ala Ala225 230 235
240Asp Pro Ala Leu Gly Cys Tyr Ser Gly Ser Tyr Tyr Pro Arg Tyr Asp
245 250 255Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 260
26536268PRTArtificial SequenceNanobody sequence 36Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Arg Ser Phe Ser Asn Tyr 20 25 30Val Leu
Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala
Ala Ile Ser Phe Arg Gly Asp Ser Ala Ile Gly Ala Pro Ser Val 50 55
60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr65
70 75 80Leu Gln Met Asn Ser Leu Val Pro Asp Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Arg Gly Thr Gln Val Thr Val
Ser Ser Gly Gly 115 120 125Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln 130 135 140Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Ala Gly Asp Ser Leu Arg145 150 155 160Leu Ser Cys Ala Ala
Ser Gly Arg Thr Phe Ser Ser Tyr Ala Met Gly 165 170 175Trp Phe Arg
Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Ile 180 185 190Ser
Trp Ser Asp Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys Gly Arg 195 200
205Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr Leu Gln Met
210 215 220Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala
Ala Asp225 230 235 240Leu Thr Ser Thr Asn Pro Gly Ser Tyr Ile Tyr
Ile Trp Ala Tyr Asp 245 250 255Tyr Trp Gly Gln Gly Thr Gln Val Thr
Val Ser Ser 260 26537268PRTArtificial SequenceNanobody sequence
37Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Ser Phe Ser Asn
Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Phe Val 35 40 45Ala Ala Ile Ser Phe Arg Gly Asp Ser Ala Ile Gly Ala
Pro Ser Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Gly Tyr65 70 75 80Leu Gln Met Asn Ser Leu Val Pro Asp Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly
Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Arg Gly
Thr Gln Val Thr Val Ser Ser Gly Gly 115 120 125Gly Gly Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln 130 135 140Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Ala Gly Asp Ser Leu Arg145 150 155
160Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Ser Tyr Ala Met Gly
165 170 175Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala
Ala Ile 180 185 190Ser Trp Ser Asp Gly Ser Thr Tyr Tyr Ala Asp Ser
Val Lys Gly Arg 195 200 205Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn
Thr Val Tyr Leu Gln Met 210 215 220Asn Ser Leu Lys Pro Glu Asp Thr
Ala Val Tyr Tyr Cys Ala Ala Asp225 230 235 240Leu Thr Ser Thr Asn
Pro Gly Ser Tyr Ile Tyr Ile Trp Ala Tyr Asp
245 250 255Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 260
26538264PRTArtificial SequenceNanobody sequence 38Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Pro Thr Phe Ser Ala Asp 20 25 30Thr Met
Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala
Thr Ile Pro Trp Ser Gly Gly Ile Ala Tyr Tyr Ser Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Met Ser Arg Asp Asn Ala Lys Asn Thr Val Asp65
70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Leu Tyr Tyr
Cys 85 90 95Ala Gly Ser Ser Arg Ile Tyr Ile Tyr Ser Asp Ser Leu Ser
Glu Arg 100 105 110Ser Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr
Val Ser Ser Gly 115 120 125Gly Gly Gly Ser Gly Gly Gly Ser Glu Val
Gln Leu Val Glu Ser Gly 130 135 140Gly Gly Leu Val Gln Ala Gly Gly
Ser Leu Arg Leu Ser Cys Glu Ala145 150 155 160Ser Gly Arg Thr Tyr
Ser Arg Tyr Gly Met Gly Trp Phe Arg Gln Ala 165 170 175Pro Gly Lys
Glu Arg Glu Phe Val Ala Ala Val Ser Arg Leu Ser Gly 180 185 190Pro
Arg Thr Val Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser 195 200
205Arg Asp Asn Ala Glu Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Lys
210 215 220Pro Glu Asp Thr Ala Val Tyr Thr Cys Ala Ala Glu Leu Thr
Asn Arg225 230 235 240Asn Ser Gly Ala Tyr Tyr Tyr Ala Trp Ala Tyr
Asp Tyr Trp Gly Gln 245 250 255Gly Thr Gln Val Thr Val Ser Ser
26039270PRTArtificial SequenceNanobody sequence 39Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Pro Thr Phe Ser Ala Asp 20 25 30Thr Met
Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala
Thr Ile Pro Trp Ser Gly Gly Ile Ala Tyr Tyr Ser Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Met Ser Arg Asp Asn Ala Lys Asn Thr Val Asp65
70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Leu Tyr Tyr
Cys 85 90 95Ala Gly Ser Ser Arg Ile Tyr Ile Tyr Ser Asp Ser Leu Ser
Glu Arg 100 105 110Ser Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr
Val Ser Ser Gly 115 120 125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Glu Val 130 135 140Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Ala Gly Gly Ser Leu145 150 155 160Arg Leu Ser Cys Glu
Ala Ser Gly Arg Thr Tyr Ser Arg Tyr Gly Met 165 170 175Gly Trp Phe
Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala 180 185 190Val
Ser Arg Leu Ser Gly Pro Arg Thr Val Tyr Ala Asp Ser Val Lys 195 200
205Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Glu Asn Thr Val Tyr Leu
210 215 220Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Thr
Cys Ala225 230 235 240Ala Glu Leu Thr Asn Arg Asn Ser Gly Ala Tyr
Tyr Tyr Ala Trp Ala 245 250 255Tyr Asp Tyr Trp Gly Gln Gly Thr Gln
Val Thr Val Ser Ser 260 265 27040280PRTArtificial SequenceNanobody
sequence 40Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala
Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Pro Thr Phe
Ser Ala Asp 20 25 30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu
Arg Glu Phe Val 35 40 45Ala Thr Ile Pro Trp Ser Gly Gly Ile Ala Tyr
Tyr Ser Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Met Ser Arg Asp Asn
Ala Lys Asn Thr Val Asp65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro
Glu Asp Thr Ala Leu Tyr Tyr Cys 85 90 95Ala Gly Ser Ser Arg Ile Tyr
Ile Tyr Ser Asp Ser Leu Ser Glu Arg 100 105 110Ser Tyr Asp Tyr Trp
Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly 115 120 125Gly Gly Gly
Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135 140Gly
Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly145 150
155 160Gly Gly Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Glu
Ala 165 170 175Ser Gly Arg Thr Tyr Ser Arg Tyr Gly Met Gly Trp Phe
Arg Gln Ala 180 185 190Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Val
Ser Arg Leu Ser Gly 195 200 205Pro Arg Thr Val Tyr Ala Asp Ser Val
Lys Gly Arg Phe Thr Ile Ser 210 215 220Arg Asp Asn Ala Glu Asn Thr
Val Tyr Leu Gln Met Asn Ser Leu Lys225 230 235 240Pro Glu Asp Thr
Ala Val Tyr Thr Cys Ala Ala Glu Leu Thr Asn Arg 245 250 255Asn Ser
Gly Ala Tyr Tyr Tyr Ala Trp Ala Tyr Asp Tyr Trp Gly Gln 260 265
270Gly Thr Gln Val Thr Val Ser Ser 275 28041268PRTArtificial
SequenceNanobody sequence 41Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Leu Thr Leu Asp Tyr Tyr 20 25 30Ala Leu Gly Trp Phe Arg Gln Ala
Pro Gly Lys Glu Arg Glu Gly Val 35 40 45Ser Cys Ile Ser Ser Ser Asp
His Ser Thr Thr Tyr Thr Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Trp Asp Asn Ala Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Lys Pro Gly Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Asp
Pro Ala Leu Gly Cys Tyr Ser Gly Ser Tyr Tyr Pro Arg 100 105 110Tyr
Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly Gly 115 120
125Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln
130 135 140Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Asp Ser
Leu Arg145 150 155 160Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser
Ser Tyr Ala Met Gly 165 170 175Trp Phe Arg Gln Ala Pro Gly Lys Glu
Arg Glu Phe Val Ala Ala Ile 180 185 190Ser Trp Ser Asp Gly Ser Thr
Tyr Tyr Ala Asp Ser Val Lys Gly Arg 195 200 205Phe Thr Ile Ser Arg
Asp Asn Ala Lys Asn Thr Val Tyr Leu Gln Met 210 215 220Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala Ala Asp225 230 235
240Leu Thr Ser Thr Asn Pro Gly Ser Tyr Ile Tyr Ile Trp Ala Tyr Asp
245 250 255Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 260
26542267PRTArtificial SequenceNanobody sequence 42Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Leu Thr Leu Asp Tyr Tyr 20 25 30Ala Leu
Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Gly Val 35 40 45Ser
Cys Ile Ser Ser Ser Asp His Ser Thr Thr Tyr Thr Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Trp Asp Asn Ala Lys Asn Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser Leu Lys Pro Gly Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Ala Ala Asp Pro Ala Leu Gly Cys Tyr Ser Gly Ser Tyr Tyr
Pro Arg 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val
Ser Ser Gly Gly 115 120 125Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln 130 135 140Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Ala Gly Gly Ser Leu Arg145 150 155 160Leu Ser Cys Ala Ala
Ser Gly Arg Ser Phe Ser Asn Tyr Val Leu Gly 165 170 175Trp Phe Arg
Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Ile 180 185 190Ser
Phe Arg Gly Asp Ser Ala Ile Gly Ala Pro Ser Val Glu Gly Arg 195 200
205Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr Leu Gln Met
210 215 220Asn Ser Leu Val Pro Asp Asp Thr Ala Val Tyr Tyr Cys Gly
Ala Gly225 230 235 240Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser Tyr Asp Tyr 245 250 255Trp Gly Arg Gly Thr Gln Val Thr Val
Ser Ser 260 26543411PRTArtificial SequenceNanobody sequence 43Glu
Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Asp1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Ser Tyr
20 25 30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe
Val 35 40 45Ala Ala Ile Ser Trp Ser Asp Gly Ser Thr Tyr Tyr Ala Asp
Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn
Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90 95Ala Ala Asp Leu Thr Ser Thr Asn Pro Gly
Ser Tyr Ile Tyr Ile Trp 100 105 110Ala Tyr Asp Tyr Trp Gly Gln Gly
Thr Gln Val Thr Val Ser Ser Gly 115 120 125Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Glu Val 130 135 140Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Ala Gly Asp Ser Leu145 150 155 160Arg
Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Ser Tyr Ala Met 165 170
175Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala
180 185 190Ile Ser Trp Ser Asp Gly Ser Thr Tyr Tyr Ala Asp Ser Val
Lys Gly 195 200 205Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr
Val Tyr Leu Gln 210 215 220Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Ala Ala225 230 235 240Asp Leu Thr Ser Thr Asn Pro
Gly Ser Tyr Ile Tyr Ile Trp Ala Tyr 245 250 255Asp Tyr Trp Gly Gln
Gly Thr Gln Val Thr Val Ser Ser Gly Gly Gly 260 265 270Gly Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu 275 280 285Val
Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Asp Ser Leu Arg Leu 290 295
300Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Ser Tyr Ala Met Gly
Trp305 310 315 320Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
Ala Ala Ile Ser 325 330 335Trp Ser Asp Gly Ser Thr Tyr Tyr Ala Asp
Ser Val Lys Gly Arg Phe 340 345 350Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Val Tyr Leu Gln Met Asn 355 360 365Ser Leu Lys Pro Glu Asp
Thr Ala Val Tyr Tyr Cys Ala Ala Asp Leu 370 375 380Thr Ser Thr Asn
Pro Gly Ser Tyr Ile Tyr Ile Trp Ala Tyr Asp Tyr385 390 395 400Trp
Gly Gln Gly Thr Gln Val Thr Val Ser Ser 405 41044410PRTArtificial
SequenceNanobody sequence 44Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Ala Gly Asp1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Arg Thr Phe Ser Ser Tyr 20 25 30Ala Met Gly Trp Phe Arg Gln Ala
Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Ser Trp Ser Asp
Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Asp
Leu Thr Ser Thr Asn Pro Gly Ser Tyr Ile Tyr Ile Trp 100 105 110Ala
Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val
130 135 140Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Asp
Ser Leu145 150 155 160Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe
Ser Ser Tyr Ala Met 165 170 175Gly Trp Phe Arg Gln Ala Pro Gly Lys
Glu Arg Glu Phe Val Ala Ala 180 185 190Ile Ser Trp Ser Asp Gly Ser
Thr Tyr Tyr Ala Asp Ser Val Lys Gly 195 200 205Arg Phe Thr Ile Ser
Arg Asp Asn Ala Lys Asn Thr Val Tyr Leu Gln 210 215 220Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala Ala225 230 235
240Asp Leu Thr Ser Thr Asn Pro Gly Ser Tyr Ile Tyr Ile Trp Ala Tyr
245 250 255Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly
Gly Gly 260 265 270Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Glu Val Gln Leu 275 280 285Val Glu Ser Gly Gly Gly Leu Val Gln Pro
Gly Gly Ser Leu Arg Leu 290 295 300Ser Cys Ala Ala Ser Gly Leu Thr
Leu Asp Tyr Tyr Ala Leu Gly Trp305 310 315 320Phe Arg Gln Ala Pro
Gly Lys Glu Arg Glu Gly Val Ser Cys Ile Ser 325 330 335Ser Ser Asp
His Ser Thr Thr Tyr Thr Asp Ser Val Lys Gly Arg Phe 340 345 350Thr
Ile Ser Trp Asp Asn Ala Lys Asn Thr Leu Tyr Leu Gln Met Asn 355 360
365Ser Leu Lys Pro Gly Asp Thr Ala Val Tyr Tyr Cys Ala Ala Asp Pro
370 375 380Ala Leu Gly Cys Tyr Ser Gly Ser Tyr Tyr Pro Arg Tyr Asp
Tyr Trp385 390 395 400Gly Gln Gly Thr Gln Val Thr Val Ser Ser 405
41045410PRTArtificial SequenceNanobody sequence 45Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Leu Thr Leu Asp Tyr Tyr 20 25 30Ala Leu
Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Gly Val 35 40 45Ser
Cys Ile Ser Ser Ser Asp His Ser Thr Thr Tyr Thr Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Trp Asp Asn Ala Lys Asn Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser Leu Lys Pro Gly Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Ala Ala Asp Pro Ala Leu Gly Cys Tyr Ser Gly Ser Tyr Tyr
Pro Arg 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val
Ser Ser Gly Gly 115 120 125Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln 130 135 140Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Ala Gly Asp Ser Leu Arg145 150 155 160Leu Ser Cys Ala Ala
Ser Gly Arg Thr Phe Ser Ser Tyr Ala Met Gly 165 170 175Trp Phe Arg
Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Ile 180 185 190Ser
Trp Ser Asp Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys Gly Arg 195 200
205Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr Leu Gln Met
210 215 220Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala
Ala Asp225 230
235 240Leu Thr Ser Thr Asn Pro Gly Ser Tyr Ile Tyr Ile Trp Ala Tyr
Asp 245 250 255Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly
Gly Gly Gly 260 265 270Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Glu Val Gln Leu Val 275 280 285Glu Ser Gly Gly Gly Leu Val Gln Ala
Gly Asp Ser Leu Arg Leu Ser 290 295 300Cys Ala Ala Ser Gly Arg Thr
Phe Ser Ser Tyr Ala Met Gly Trp Phe305 310 315 320Arg Gln Ala Pro
Gly Lys Glu Arg Glu Phe Val Ala Ala Ile Ser Trp 325 330 335Ser Asp
Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr 340 345
350Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr Leu Gln Met Asn Ser
355 360 365Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala Ala Asp
Leu Thr 370 375 380Ser Thr Asn Pro Gly Ser Tyr Ile Tyr Ile Trp Ala
Tyr Asp Tyr Trp385 390 395 400Gly Gln Gly Thr Gln Val Thr Val Ser
Ser 405 41046410PRTArtificial SequenceNanobody sequence 46Glu Val
Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Asp1 5 10 15Ser
Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Ser Tyr 20 25
30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Ala Ile Ser Trp Ser Asp Gly Ser Thr Tyr Tyr Ala Asp Ser
Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr
Val Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Tyr Cys 85 90 95Ala Ala Asp Leu Thr Ser Thr Asn Pro Gly Ser
Tyr Ile Tyr Ile Trp 100 105 110Ala Tyr Asp Tyr Trp Gly Gln Gly Thr
Gln Val Thr Val Ser Ser Gly 115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Glu Val 130 135 140Gln Leu Val Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu145 150 155 160Arg Leu
Ser Cys Ala Ala Ser Gly Leu Thr Leu Asp Tyr Tyr Ala Leu 165 170
175Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Gly Val Ser Cys
180 185 190Ile Ser Ser Ser Asp His Ser Thr Thr Tyr Thr Asp Ser Val
Lys Gly 195 200 205Arg Phe Thr Ile Ser Trp Asp Asn Ala Lys Asn Thr
Leu Tyr Leu Gln 210 215 220Met Asn Ser Leu Lys Pro Gly Asp Thr Ala
Val Tyr Tyr Cys Ala Ala225 230 235 240Asp Pro Ala Leu Gly Cys Tyr
Ser Gly Ser Tyr Tyr Pro Arg Tyr Asp 245 250 255Tyr Trp Gly Gln Gly
Thr Gln Val Thr Val Ser Ser Gly Gly Gly Gly 260 265 270Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val 275 280 285Glu
Ser Gly Gly Gly Leu Val Gln Ala Gly Asp Ser Leu Arg Leu Ser 290 295
300Cys Ala Ala Ser Gly Arg Thr Phe Ser Ser Tyr Ala Met Gly Trp
Phe305 310 315 320Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala
Ala Ile Ser Trp 325 330 335Ser Asp Gly Ser Thr Tyr Tyr Ala Asp Ser
Val Lys Gly Arg Phe Thr 340 345 350Ile Ser Arg Asp Asn Ala Lys Asn
Thr Val Tyr Leu Gln Met Asn Ser 355 360 365Leu Lys Pro Glu Asp Thr
Ala Val Tyr Tyr Cys Ala Ala Asp Leu Thr 370 375 380Ser Thr Asn Pro
Gly Ser Tyr Ile Tyr Ile Trp Ala Tyr Asp Tyr Trp385 390 395 400Gly
Gln Gly Thr Gln Val Thr Val Ser Ser 405 41047408PRTArtificial
SequenceNanobody sequence 47Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Arg Ser Phe Ser Asn Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala
Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Ser Phe Arg Gly
Asp Ser Ala Ile Gly Ala Pro Ser Val 50 55 60Glu Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Val Pro Asp Asp Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly
Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr
Asp Tyr Trp Gly Arg Gly Thr Gln Val Thr Val Ser Ser Gly Gly 115 120
125Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln
130 135 140Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly Ser
Leu Arg145 150 155 160Leu Ser Cys Ala Ala Ser Gly Arg Ser Phe Ser
Asn Tyr Val Leu Gly 165 170 175Trp Phe Arg Gln Ala Pro Gly Lys Glu
Arg Glu Phe Val Ala Ala Ile 180 185 190Ser Phe Arg Gly Asp Ser Ala
Ile Gly Ala Pro Ser Val Glu Gly Arg 195 200 205Phe Thr Ile Ser Arg
Asp Asn Ala Lys Asn Thr Gly Tyr Leu Gln Met 210 215 220Asn Ser Leu
Val Pro Asp Asp Thr Ala Val Tyr Tyr Cys Gly Ala Gly225 230 235
240Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser Tyr Asp Tyr
245 250 255Trp Gly Arg Gly Thr Gln Val Thr Val Ser Ser Gly Gly Gly
Gly Ser 260 265 270Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val
Gln Leu Val Glu 275 280 285Ser Gly Gly Gly Leu Val Gln Ala Gly Gly
Ser Leu Arg Leu Ser Cys 290 295 300Ala Ala Ser Gly Arg Ser Phe Ser
Asn Tyr Val Leu Gly Trp Phe Arg305 310 315 320Gln Ala Pro Gly Lys
Glu Arg Glu Phe Val Ala Ala Ile Ser Phe Arg 325 330 335Gly Asp Ser
Ala Ile Gly Ala Pro Ser Val Glu Gly Arg Phe Thr Ile 340 345 350Ser
Arg Asp Asn Ala Lys Asn Thr Gly Tyr Leu Gln Met Asn Ser Leu 355 360
365Val Pro Asp Asp Thr Ala Val Tyr Tyr Cys Gly Ala Gly Thr Pro Leu
370 375 380Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser Tyr Asp Tyr Trp
Gly Arg385 390 395 400Gly Thr Gln Val Thr Val Ser Ser
40548414PRTArtificial SequenceNanobody sequence 48Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Glu Ala Ser Gly Arg Thr Tyr Ser Arg Tyr 20 25 30Gly Met
Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala
Ala Val Ser Arg Leu Ser Gly Pro Arg Thr Val Tyr Ala Asp Ser 50 55
60Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Glu Asn Thr Val65
70 75 80Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr
Thr 85 90 95Cys Ala Ala Glu Leu Thr Asn Arg Asn Ser Gly Ala Tyr Tyr
Tyr Ala 100 105 110Trp Ala Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val
Thr Val Ser Ser 115 120 125Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Glu 130 135 140Val Gln Leu Val Glu Ser Gly Gly
Gly Leu Val Gln Ala Gly Gly Ser145 150 155 160Leu Arg Leu Ser Cys
Glu Ala Ser Gly Arg Thr Tyr Ser Arg Tyr Gly 165 170 175Met Gly Trp
Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala 180 185 190Ala
Val Ser Arg Leu Ser Gly Pro Arg Thr Val Tyr Ala Asp Ser Val 195 200
205Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Glu Asn Thr Val Tyr
210 215 220Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr
Thr Cys225 230 235 240Ala Ala Glu Leu Thr Asn Arg Asn Ser Gly Ala
Tyr Tyr Tyr Ala Trp 245 250 255Ala Tyr Asp Tyr Trp Gly Gln Gly Thr
Gln Val Thr Val Ser Ser Gly 260 265 270Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Glu Val 275 280 285Gln Leu Val Glu Ser
Gly Gly Gly Leu Val Gln Ala Gly Gly Ser Leu 290 295 300Arg Leu Ser
Cys Glu Ala Ser Gly Arg Thr Tyr Ser Arg Tyr Gly Met305 310 315
320Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala
325 330 335Val Ser Arg Leu Ser Gly Pro Arg Thr Val Tyr Ala Asp Ser
Val Lys 340 345 350Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Glu Asn
Thr Val Tyr Leu 355 360 365Gln Met Asn Ser Leu Lys Pro Glu Asp Thr
Ala Val Tyr Thr Cys Ala 370 375 380Ala Glu Leu Thr Asn Arg Asn Ser
Gly Ala Tyr Tyr Tyr Ala Trp Ala385 390 395 400Tyr Asp Tyr Trp Gly
Gln Gly Thr Gln Val Thr Val Ser Ser 405 41049411PRTArtificial
SequenceNanobody sequence 49Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Arg Thr Phe Ser Ser Ile 20 25 30Ala Met Gly Trp Phe Arg Gln Ala
Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Ser Trp Ser Arg
Gly Arg Thr Phe Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Ile Ile
Ser Arg Asp Asp Ala Ala Asn Thr Ala Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Val Asp
Thr Ala Ser Trp Asn Ser Gly Ser Phe Ile Tyr Asp Trp 100 105 110Ala
Tyr Asp His Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val
130 135 140Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
Ser Leu145 150 155 160Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe
Ser Ser Ile Ala Met 165 170 175Gly Trp Phe Arg Gln Ala Pro Gly Lys
Glu Arg Glu Phe Val Ala Ala 180 185 190Ile Ser Trp Ser Arg Gly Arg
Thr Phe Tyr Ala Asp Ser Val Lys Gly 195 200 205Arg Phe Ile Ile Ser
Arg Asp Asp Ala Ala Asn Thr Ala Tyr Leu Gln 210 215 220Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala Val225 230 235
240Asp Thr Ala Ser Trp Asn Ser Gly Ser Phe Ile Tyr Asp Trp Ala Tyr
245 250 255Asp His Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly
Gly Gly 260 265 270Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Glu Val Gln Leu 275 280 285Val Glu Ser Gly Gly Gly Leu Val Gln Pro
Gly Gly Ser Leu Arg Leu 290 295 300Ser Cys Ala Ala Ser Gly Arg Thr
Phe Ser Ser Ile Ala Met Gly Trp305 310 315 320Phe Arg Gln Ala Pro
Gly Lys Glu Arg Glu Phe Val Ala Ala Ile Ser 325 330 335Trp Ser Arg
Gly Arg Thr Phe Tyr Ala Asp Ser Val Lys Gly Arg Phe 340 345 350Ile
Ile Ser Arg Asp Asp Ala Ala Asn Thr Ala Tyr Leu Gln Met Asn 355 360
365Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala Val Asp Thr
370 375 380Ala Ser Trp Asn Ser Gly Ser Phe Ile Tyr Asp Trp Ala Tyr
Asp His385 390 395 400Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser
405 41050408PRTArtificial SequenceNanobody sequence 50Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu
Ser Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val
Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val
50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly
Tyr65 70 75 80Leu Gln Met Asn Ser Leu Ala Pro Asp Asp Thr Ala Val
Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile
Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Arg Gly Thr Gln Val
Thr Val Ser Ser Gly Gly 115 120 125Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Glu Val Gln 130 135 140Leu Val Glu Ser Gly Gly
Gly Leu Val Gln Ala Gly Gly Ser Leu Ser145 150 155 160Ile Ser Cys
Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly 165 170 175Trp
Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Ile 180 185
190Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val Glu Gly Arg
195 200 205Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr Leu
Gln Met 210 215 220Asn Ser Leu Ala Pro Asp Asp Thr Ala Val Tyr Tyr
Cys Gly Ala Gly225 230 235 240Thr Pro Leu Asn Pro Gly Ala Tyr Ile
Tyr Asp Trp Ser Tyr Asp Tyr 245 250 255Trp Gly Arg Gly Thr Gln Val
Thr Val Ser Ser Gly Gly Gly Gly Ser 260 265 270Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu 275 280 285Ser Gly Gly
Gly Leu Val Gln Ala Gly Gly Ser Leu Ser Ile Ser Cys 290 295 300Ala
Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly Trp Phe Arg305 310
315 320Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Ile Asn Trp
Arg 325 330 335Gly Asp Ile Thr Ile Gly Pro Pro Asn Val Glu Gly Arg
Phe Thr Ile 340 345 350Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr Leu
Gln Met Asn Ser Leu 355 360 365Ala Pro Asp Asp Thr Ala Val Tyr Tyr
Cys Gly Ala Gly Thr Pro Leu 370 375 380Asn Pro Gly Ala Tyr Ile Tyr
Asp Trp Ser Tyr Asp Tyr Trp Gly Arg385 390 395 400Gly Thr Gln Val
Thr Val Ser Ser 40551384PRTArtificial SequenceNanobody sequence
51Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1
5 10 15Ser Leu Ser Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn
Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro
Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Gly Tyr65 70 75 80Leu Gln Met Asn Ser Leu Ala Pro Asp Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly
Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Arg Gly
Thr Gln Val Thr Val Ser Ser Ala Ala 115 120 125Ala Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly 130 135 140Gly Ser Leu
Ser Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn145 150 155
160Tyr Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe
165 170 175Val Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro
Pro Asn 180 185 190Val Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala
Lys Asn Thr Gly 195 200 205Tyr Leu Gln Met
Asn Ser Leu Ala Pro Asp Asp Thr Ala Val Tyr Tyr 210 215 220Cys Gly
Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp225 230 235
240Ser Tyr Asp Tyr Trp Gly Arg Gly Thr Gln Val Thr Val Ser Ser Ala
245 250 255Ala Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val
Gln Ala 260 265 270Gly Gly Ser Leu Ser Ile Ser Cys Ala Ala Ser Gly
Gly Ser Leu Ser 275 280 285Asn Tyr Val Leu Gly Trp Phe Arg Gln Ala
Pro Gly Lys Glu Arg Glu 290 295 300Phe Val Ala Ala Ile Asn Trp Arg
Gly Asp Ile Thr Ile Gly Pro Pro305 310 315 320Asn Val Glu Gly Arg
Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr 325 330 335Gly Tyr Leu
Gln Met Asn Ser Leu Ala Pro Asp Asp Thr Ala Val Tyr 340 345 350Tyr
Cys Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp 355 360
365Trp Ser Tyr Asp Tyr Trp Gly Arg Gly Thr Gln Val Thr Val Ser Ser
370 375 38052396PRTArtificial SequenceNanobody sequence 52Glu Val
Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser
Leu Ser Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr 20 25
30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn
Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr
Gly Tyr65 70 75 80Leu Gln Met Asn Ser Leu Ala Pro Asp Asp Thr Ala
Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr
Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Arg Gly Thr Gln
Val Thr Val Ser Ser Gly Gly 115 120 125Gly Gly Ser Gly Gly Gly Ser
Glu Val Gln Leu Val Glu Ser Gly Gly 130 135 140Gly Leu Val Gln Ala
Gly Gly Ser Leu Ser Ile Ser Cys Ala Ala Ser145 150 155 160Gly Gly
Ser Leu Ser Asn Tyr Val Leu Gly Trp Phe Arg Gln Ala Pro 165 170
175Gly Lys Glu Arg Glu Phe Val Ala Ala Ile Asn Trp Arg Gly Asp Ile
180 185 190Thr Ile Gly Pro Pro Asn Val Glu Gly Arg Phe Thr Ile Ser
Arg Asp 195 200 205Asn Ala Lys Asn Thr Gly Tyr Leu Gln Met Asn Ser
Leu Ala Pro Asp 210 215 220Asp Thr Ala Val Tyr Tyr Cys Gly Ala Gly
Thr Pro Leu Asn Pro Gly225 230 235 240Ala Tyr Ile Tyr Asp Trp Ser
Tyr Asp Tyr Trp Gly Arg Gly Thr Gln 245 250 255Val Thr Val Ser Ser
Gly Gly Gly Gly Ser Gly Gly Gly Ser Glu Val 260 265 270Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly Ser Leu 275 280 285Ser
Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu 290 295
300Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala
Ala305 310 315 320Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro
Asn Val Glu Gly 325 330 335Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Gly Tyr Leu Gln 340 345 350Met Asn Ser Leu Ala Pro Asp Asp
Thr Ala Val Tyr Tyr Cys Gly Ala 355 360 365Gly Thr Pro Leu Asn Pro
Gly Ala Tyr Ile Tyr Asp Trp Ser Tyr Asp 370 375 380Tyr Trp Gly Arg
Gly Thr Gln Val Thr Val Ser Ser385 390 39553418PRTArtificial
SequenceNanobody sequence 53Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Ser Ile Ser Cys Ala Ala Ser
Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala
Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly
Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Ala Pro Asp Asp Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly
Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr
Asp Tyr Trp Gly Arg Gly Thr Gln Val Thr Val Ser Ser Gly Gly 115 120
125Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly
130 135 140Gly Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val
Gln Ala145 150 155 160Gly Gly Ser Leu Ser Ile Ser Cys Ala Ala Ser
Gly Gly Ser Leu Ser 165 170 175Asn Tyr Val Leu Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu 180 185 190Phe Val Ala Ala Ile Asn Trp
Arg Gly Asp Ile Thr Ile Gly Pro Pro 195 200 205Asn Val Glu Gly Arg
Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr 210 215 220Gly Tyr Leu
Gln Met Asn Ser Leu Ala Pro Asp Asp Thr Ala Val Tyr225 230 235
240Tyr Cys Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
245 250 255Trp Ser Tyr Asp Tyr Trp Gly Arg Gly Thr Gln Val Thr Val
Ser Ser 260 265 270Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly 275 280 285Gly Gly Gly Ser Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val 290 295 300Gln Ala Gly Gly Ser Leu Ser Ile
Ser Cys Ala Ala Ser Gly Gly Ser305 310 315 320Leu Ser Asn Tyr Val
Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu 325 330 335Arg Glu Phe
Val Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly 340 345 350Pro
Pro Asn Val Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys 355 360
365Asn Thr Gly Tyr Leu Gln Met Asn Ser Leu Ala Pro Asp Asp Thr Ala
370 375 380Val Tyr Tyr Cys Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala
Tyr Ile385 390 395 400Tyr Asp Trp Ser Tyr Asp Tyr Trp Gly Arg Gly
Thr Gln Val Thr Val 405 410 415Ser Ser54408PRTArtificial
SequenceNanobody sequence 54Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Ser Ile Ser Cys Ala Ala Ser
Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala
Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly
Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Ala Pro Asp Asp Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly
Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr
Asp Tyr Trp Gly Arg Gly Thr Gln Val Thr Val Ser Ser Gly Gly 115 120
125Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln
130 135 140Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly Ser
Leu Ser145 150 155 160Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser
Asn Tyr Val Leu Gly 165 170 175Trp Phe Arg Gln Ala Pro Gly Lys Glu
Arg Glu Phe Val Ala Ala Ile 180 185 190Asn Trp Arg Gly Asp Ile Thr
Ile Gly Pro Pro Asn Val Glu Gly Arg 195 200 205Phe Thr Ile Ser Arg
Asp Asn Ala Lys Asn Thr Gly Tyr Leu Gln Met 210 215 220Asn Ser Leu
Ala Pro Asp Asp Thr Ala Val Tyr Tyr Cys Gly Ala Gly225 230 235
240Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser Tyr Asp Tyr
245 250 255Trp Gly Arg Gly Thr Gln Val Thr Val Ser Ser Gly Gly Gly
Gly Ser 260 265 270Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val
Gln Leu Val Glu 275 280 285Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
Ser Leu Arg Leu Ser Cys 290 295 300Ala Ala Ser Gly Leu Thr Leu Asp
Tyr Tyr Ala Leu Gly Trp Phe Arg305 310 315 320Gln Ala Pro Gly Lys
Glu Arg Glu Gly Val Ser Cys Ile Ser Ser Ser 325 330 335Asp His Ser
Thr Thr Tyr Thr Asp Ser Val Lys Gly Arg Phe Thr Ile 340 345 350Ser
Trp Asp Asn Ala Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu 355 360
365Lys Pro Gly Asp Thr Ala Val Tyr Tyr Cys Ala Ala Asp Pro Ala Leu
370 375 380Gly Cys Tyr Ser Gly Ser Tyr Tyr Pro Arg Tyr Asp Tyr Trp
Gly Gln385 390 395 400Gly Thr Gln Val Thr Val Ser Ser
40555408PRTArtificial SequenceNanobody sequence 55Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Leu Thr Leu Asp Tyr Tyr 20 25 30Ala Leu
Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Gly Val 35 40 45Ser
Cys Ile Ser Ser Ser Asp His Ser Thr Thr Tyr Thr Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Trp Asp Asn Ala Lys Asn Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser Leu Lys Pro Gly Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Ala Ala Asp Pro Ala Leu Gly Cys Tyr Ser Gly Ser Tyr Tyr
Pro Arg 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val
Ser Ser Gly Gly 115 120 125Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln 130 135 140Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Ala Gly Gly Ser Leu Ser145 150 155 160Ile Ser Cys Ala Ala
Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly 165 170 175Trp Phe Arg
Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Ile 180 185 190Asn
Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val Glu Gly Arg 195 200
205Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr Leu Gln Met
210 215 220Asn Ser Leu Ala Pro Asp Asp Thr Ala Val Tyr Tyr Cys Gly
Ala Gly225 230 235 240Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser Tyr Asp Tyr 245 250 255Trp Gly Arg Gly Thr Gln Val Thr Val
Ser Ser Gly Gly Gly Gly Ser 260 265 270Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln Leu Val Glu 275 280 285Ser Gly Gly Gly Leu
Val Gln Ala Gly Gly Ser Leu Ser Ile Ser Cys 290 295 300Ala Ala Ser
Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly Trp Phe Arg305 310 315
320Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Ile Asn Trp Arg
325 330 335Gly Asp Ile Thr Ile Gly Pro Pro Asn Val Glu Gly Arg Phe
Thr Ile 340 345 350Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr Leu Gln
Met Asn Ser Leu 355 360 365Ala Pro Asp Asp Thr Ala Val Tyr Tyr Cys
Gly Ala Gly Thr Pro Leu 370 375 380Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser Tyr Asp Tyr Trp Gly Arg385 390 395 400Gly Thr Gln Val Thr
Val Ser Ser 40556408PRTArtificial SequenceNanobody sequence 56Glu
Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10
15Ser Leu Ser Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr
20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe
Val 35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro
Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn
Thr Gly Tyr65 70 75 80Leu Gln Met Asn Ser Leu Ala Pro Asp Asp Thr
Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala
Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Arg Gly Thr
Gln Val Thr Val Ser Ser Gly Gly 115 120 125Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Glu Val Gln 130 135 140Leu Val Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg145 150 155 160Leu
Ser Cys Ala Ala Ser Gly Leu Thr Leu Asp Tyr Tyr Ala Leu Gly 165 170
175Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Gly Val Ser Cys Ile
180 185 190Ser Ser Ser Asp His Ser Thr Thr Tyr Thr Asp Ser Val Lys
Gly Arg 195 200 205Phe Thr Ile Ser Trp Asp Asn Ala Lys Asn Thr Leu
Tyr Leu Gln Met 210 215 220Asn Ser Leu Lys Pro Gly Asp Thr Ala Val
Tyr Tyr Cys Ala Ala Asp225 230 235 240Pro Ala Leu Gly Cys Tyr Ser
Gly Ser Tyr Tyr Pro Arg Tyr Asp Tyr 245 250 255Trp Gly Gln Gly Thr
Gln Val Thr Val Ser Ser Gly Gly Gly Gly Ser 260 265 270Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu 275 280 285Ser
Gly Gly Gly Leu Val Gln Ala Gly Gly Ser Leu Ser Ile Ser Cys 290 295
300Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly Trp Phe
Arg305 310 315 320Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala
Ile Asn Trp Arg 325 330 335Gly Asp Ile Thr Ile Gly Pro Pro Asn Val
Glu Gly Arg Phe Thr Ile 340 345 350Ser Arg Asp Asn Ala Lys Asn Thr
Gly Tyr Leu Gln Met Asn Ser Leu 355 360 365Ala Pro Asp Asp Thr Ala
Val Tyr Tyr Cys Gly Ala Gly Thr Pro Leu 370 375 380Asn Pro Gly Ala
Tyr Ile Tyr Asp Trp Ser Tyr Asp Tyr Trp Gly Arg385 390 395 400Gly
Thr Gln Val Thr Val Ser Ser 40557126PRTArtificial SequenceNanobody
sequence 57Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro
Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu
Ser Asn Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly
Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile
Gly Pro Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn
Ala Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Ala Pro
Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn
Pro Gly Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly
Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 12558126PRTArtificial
SequenceNanobody sequence 58Glu Val Gln Leu Leu Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Ile Ser Cys Ala Ala Ser
Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala
Pro Gly Lys Gly Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly
Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Ala Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala
Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser 100 105
110Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120
12559126PRTArtificial SequenceNanobody sequence 59Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg
Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu
Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu Phe Val 35 40 45Ala
Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55
60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser 115 120 12560126PRTArtificial SequenceNanobody sequence
60Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Ser Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn
Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu
Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro
Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys
Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Pro Asp Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly
Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Gln Gly
Thr Leu Val Thr Val Ser Ser 115 120 12561126PRTArtificial
SequenceNanobody sequence 61Glu Val Gln Leu Leu Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Ser Ile Ser Cys Ala Ala Ser
Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala
Pro Gly Lys Gly Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly
Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Ala Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly
Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr
Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120
12562126PRTArtificial SequenceNanobody sequence 62Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu
Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu Phe Val 35 40 45Ala
Ala Ile Asn Trp Arg Asp Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55
60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser 115 120 12563126PRTArtificial SequenceNanobody sequence
63Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Ser Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn
Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu
Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro
Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Ala Pro Asp Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly
Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Gln Gly
Thr Leu Val Thr Val Ser Ser 115 120 12564126PRTArtificial
SequenceNanobody sequence 64Glu Val Gln Leu Leu Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Ser Ile Ser Cys Ala Ala Ser
Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala
Pro Gly Lys Gly Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly
Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly
Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr
Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120
12565126PRTArtificial SequenceNanobody sequence 65Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Ser
Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu
Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu Phe Val 35 40 45Ala
Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55
60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser Leu Arg Pro Asp Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser 115 120 12566126PRTArtificial SequenceNanobody sequence
66Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Ser Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn
Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu
Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro
Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Gly Tyr65 70 75 80Leu Gln Met Asn Ser Leu Ala Pro Asp Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly
Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Gln Gly
Thr Leu Val Thr Val Ser Ser 115 120 12567126PRTArtificial
SequenceNanobody sequence 67Glu Val Gln Leu Leu Glu Ser Gly Gly Gly
Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Ser Ile Ser Cys Ala Ala Ser
Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala
Pro Gly Lys Gly Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly
Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Ala Pro Asp Asp Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly
Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr
Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120
12568126PRTArtificial SequenceNanobody sequence 68Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Ser
Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu
Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala
Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55
60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr65
70 75 80Leu Gln Met Asn Ser Leu Ala Pro Asp Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser 115 120 12569126PRTArtificial SequenceNanobody sequence
69Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn
Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu
Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro
Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Gly Tyr65 70 75 80Leu Gln Met Asn Ser Leu Ala Pro Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly
Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Gln Gly
Thr Leu Val Thr Val Ser Ser 115 120 12570126PRTArtificial
SequenceNanobody sequence 70Glu Val Gln Leu Leu Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala
Pro Gly Lys Gly Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly
Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Ala Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly
Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr
Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120
12571126PRTArtificial SequenceNanobody sequence 71Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu
Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu Phe Val 35 40 45Ala
Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55
60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser Leu Ala Pro Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser 115 120 12572126PRTArtificial SequenceNanobody sequence
72Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn
Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu
Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro
Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys
Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly
Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Gln Gly
Thr Leu Val Thr Val Ser Ser 115 120 12573126PRTArtificial
SequenceNanobody sequence 73Glu Val Gln Leu Leu Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala
Pro Gly Lys Gly Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Asp
Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly
Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr
Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120
12574408PRTArtificial SequenceNanobody sequence 74Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg
Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu
Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu Phe Val 35 40 45Ala
Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55
60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser Gly Gly 115 120 125Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln 130 135 140Leu Leu Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly Ser Leu Arg145 150 155 160Ile Ser Cys Ala Ala
Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly 165 170 175Trp Phe Arg
Gln Ala Pro Gly Lys Gly Arg Glu Phe Val Ala Ala Ile 180 185 190Asn
Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val Glu Gly Arg 195 200
205Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln Met
210 215 220Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly
Ala Gly225 230 235 240Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser Tyr Asp Tyr 245 250 255Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser 260 265 270Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln Leu Leu Glu 275 280 285Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly Ser Leu Arg Ile Ser Cys 290 295 300Ala Ala Ser
Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly Trp Phe Arg305 310 315
320Gln Ala Pro Gly Lys Gly Arg Glu Phe Val Ala Ala Ile Asn Trp Arg
325 330 335Gly Asp Ile Thr Ile Gly Pro Pro Asn Val Glu Gly Arg Phe
Thr Ile 340 345 350Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln
Met Asn Ser Leu 355 360 365Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys
Gly Ala Gly Thr Pro Leu 370 375 380Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser Tyr Asp Tyr Trp Gly Gln385 390 395 400Gly Thr Leu Val Thr
Val Ser Ser 40575407PRTArtificial SequenceNanobody sequence 75Glu
Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser1 5 10
15Leu Arg Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val
20
25 30Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu Phe Val
Ala 35 40 45Ala Ile Asn Trp Arg Asp Asp Ile Thr Ile Gly Pro Pro Asn
Val Glu 50 55 60Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr
Leu Tyr Leu65 70 75 80Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Gly 85 90 95Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr
Ile Tyr Asp Trp Ser Tyr 100 105 110Asp Tyr Trp Gly Gln Gly Thr Leu
Val Thr Val Ser Ser Gly Gly Gly 115 120 125Gly Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Glu Val Gln Leu 130 135 140Leu Glu Ser Gly
Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu145 150 155 160Ser
Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly Trp 165 170
175Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu Phe Val Ala Ala Ile Asn
180 185 190Trp Arg Asp Asp Ile Thr Ile Gly Pro Pro Asn Val Glu Gly
Arg Phe 195 200 205Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr
Leu Gln Met Asn 210 215 220Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr
Tyr Cys Gly Ala Gly Thr225 230 235 240Pro Leu Asn Pro Gly Ala Tyr
Ile Tyr Asp Trp Ser Tyr Asp Tyr Trp 245 250 255Gly Gln Gly Thr Leu
Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly 260 265 270Gly Gly Gly
Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Leu Glu Ser 275 280 285Gly
Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala 290 295
300Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly Trp Phe Arg
Gln305 310 315 320Ala Pro Gly Lys Gly Arg Glu Phe Val Ala Ala Ile
Asn Trp Arg Asp 325 330 335Asp Ile Thr Ile Gly Pro Pro Asn Val Glu
Gly Arg Phe Thr Ile Ser 340 345 350Arg Asp Asn Ala Lys Asn Thr Leu
Tyr Leu Gln Met Asn Ser Leu Arg 355 360 365Pro Glu Asp Thr Ala Val
Tyr Tyr Cys Gly Ala Gly Thr Pro Leu Asn 370 375 380Pro Gly Ala Tyr
Ile Tyr Asp Trp Ser Tyr Asp Tyr Trp Gly Gln Gly385 390 395 400Thr
Leu Val Thr Val Ser Ser 40576408PRTArtificial SequenceNanobody
sequence 76Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro
Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu
Ser Asn Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly
Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Asp Asp Ile Thr Ile
Gly Pro Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn
Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Pro
Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn
Pro Gly Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly
Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly 115 120 125Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln 130 135 140Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg145 150
155 160Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu
Gly 165 170 175Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu Phe Val
Ala Ala Ile 180 185 190Asn Trp Arg Asp Asp Ile Thr Ile Gly Pro Pro
Asn Val Glu Gly Arg 195 200 205Phe Thr Ile Ser Arg Asp Asn Ser Lys
Asn Thr Leu Tyr Leu Gln Met 210 215 220Asn Ser Leu Arg Pro Glu Asp
Thr Ala Val Tyr Tyr Cys Gly Ala Gly225 230 235 240Thr Pro Leu Asn
Pro Gly Ala Tyr Ile Tyr Asp Trp Ser Tyr Asp Tyr 245 250 255Trp Gly
Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser 260 265
270Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Leu Glu
275 280 285Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu
Ser Cys 290 295 300Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu
Gly Trp Phe Arg305 310 315 320Gln Ala Pro Gly Lys Gly Arg Glu Phe
Val Ala Ala Ile Asn Trp Arg 325 330 335Asp Asp Ile Thr Ile Gly Pro
Pro Asn Val Glu Gly Arg Phe Thr Ile 340 345 350Ser Arg Asp Asn Ser
Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu 355 360 365Arg Pro Glu
Asp Thr Ala Val Tyr Tyr Cys Gly Ala Gly Thr Pro Leu 370 375 380Asn
Pro Gly Ala Tyr Ile Tyr Asp Trp Ser Tyr Asp Tyr Trp Gly Gln385 390
395 400Gly Thr Leu Val Thr Val Ser Ser 4057730PRTArtificial
SequenceFramework 1 sequence 77Glu Val Gln Leu Val Glu Ser Gly Gly
Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Ser Ile Ser Cys Ala Ala
Ser Gly Gly Ser Leu Ser 20 25 307830PRTArtificial SequenceFramework
1 sequence 78Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln
Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Gly Ser
Leu Ser 20 25 307930PRTArtificial SequenceFramework 1 sequence
79Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser 20
25 308030PRTArtificial SequenceFramework 1 sequence 80Glu Val Gln
Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu
Arg Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser 20 25
308130PRTArtificial SequenceFramework 1 sequence 81Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Ser
Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser 20 25
308230PRTArtificial SequenceFramework 1 sequence 82Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Ser
Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser 20 25
308330PRTArtificial SequenceFramework 1 sequence 83Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser 20 25
308430PRTArtificial SequenceFramework 1 sequence 84Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Ser
Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser 20 25
308530PRTArtificial SequenceFramework 1 sequence 85Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Ser
Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser 20 25
308630PRTArtificial SequenceFramework 1 sequence 86Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Ser
Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser 20 25
308730PRTArtificial SequenceFramework 1 sequence 87Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Ser
Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser 20 25
308830PRTArtificial SequenceFramework 1 sequence 88Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Ser
Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser 20 25
308930PRTArtificial SequenceFramework 1 sequence 89Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Ser
Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser 20 25
309030PRTArtificial SequenceFramework 1 sequence 90Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser 20 25
309130PRTArtificial SequenceFramework 1 sequence 91Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser 20 25
309230PRTArtificial SequenceFramework 1 sequence 92Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser 20 25
309330PRTArtificial SequenceFramework 1 sequence 93Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser 20 25
309430PRTArtificial SequenceFramework 1 sequence 94Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser 20 25
30955PRTArtificial SequenceCDR sequence 95Asn Tyr Val Leu Gly1
59614PRTArtificial SequenceFramework 2 sequence 96Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val Ala1 5 109714PRTArtificial
SequenceFramework 2 sequence 97Trp Phe Arg Gln Ala Pro Gly Lys Gly
Arg Glu Phe Val Ala1 5 109817PRTArtificial SequenceCDR sequence
98Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val Glu1
5 10 15Gly9917PRTArtificial SequenceCDR sequence 99Ala Ile Asn Trp
Arg Asp Asp Ile Thr Ile Gly Pro Pro Asn Val Glu1 5 10
15Gly10032PRTArtificial SequenceFramework 3 sequence 100Arg Phe Thr
Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr Leu Gln1 5 10 15Met Asn
Ser Leu Ala Pro Asp Asp Thr Ala Val Tyr Tyr Cys Gly Ala 20 25
3010132PRTArtificial SequenceFramework 3 sequence 101Arg Phe Thr
Ile Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr Leu Gln1 5 10 15Met Asn
Ser Leu Ala Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly Ala 20 25
3010232PRTArtificial SequenceFramework 3 sequence 102Arg Phe Thr
Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln1 5 10 15Met Asn
Ser Leu Ala Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly Ala 20 25
3010332PRTArtificial SequenceFramework 3 sequence 103Arg Phe Thr
Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln1 5 10 15Met Asn
Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly Ala 20 25
3010432PRTArtificial SequenceFramework 3 sequence 104Arg Phe Thr
Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln1 5 10 15Met Asn
Ser Leu Arg Pro Asp Asp Thr Ala Val Tyr Tyr Cys Gly Ala 20 25
3010532PRTArtificial SequenceFramework 3 sequence 105Arg Phe Thr
Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln1 5 10 15Met Asn
Ser Leu Ala Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly Ala 20 25
3010632PRTArtificial SequenceFramework 3 sequence 106Arg Phe Thr
Ile Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr Leu Gln1 5 10 15Met Asn
Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly Ala 20 25
3010732PRTArtificial SequenceFramework 3 sequence 107Arg Phe Thr
Ile Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr Leu Gln1 5 10 15Met Asn
Ser Leu Ala Pro Asp Asp Thr Ala Val Tyr Tyr Cys Gly Ala 20 25
3010832PRTArtificial SequenceFramework 3 sequence 108Arg Phe Thr
Ile Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr Leu Gln1 5 10 15Met Asn
Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly Ala 20 25
3010932PRTArtificial SequenceFramework 3 sequence 109Arg Phe Thr
Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln1 5 10 15Met Asn
Ser Leu Arg Pro Asp Asp Thr Ala Val Tyr Tyr Cys Gly Ala 20 25
3011032PRTArtificial SequenceFramework 3 sequence 110Arg Phe Thr
Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr Leu Gln1 5 10 15Met Asn
Ser Leu Ala Pro Asp Asp Thr Ala Val Tyr Tyr Cys Gly Ala 20 25
3011132PRTArtificial SequenceFramework 3 sequence 111Arg Phe Thr
Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr Leu Gln1 5 10 15Met Asn
Ser Leu Ala Pro Asp Asp Thr Ala Val Tyr Tyr Cys Gly Ala 20 25
3011232PRTArtificial SequenceFramework 3 sequence 112Arg Phe Thr
Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr Leu Gln1 5 10 15Met Asn
Ser Leu Ala Pro Asp Asp Thr Ala Val Tyr Tyr Cys Gly Ala 20 25
3011332PRTArtificial SequenceFramework 3 sequence 113Arg Phe Thr
Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr Leu Gln1 5 10 15Met Asn
Ser Leu Ala Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly Ala 20 25
3011432PRTArtificial SequenceFramework 3 sequence 114Arg Phe Thr
Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln1 5 10 15Met Asn
Ser Leu Ala Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly Ala 20 25
3011532PRTArtificial SequenceFramework 3 sequence 115Arg Phe Thr
Ile Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr Leu Gln1 5 10 15Met Asn
Ser Leu Ala Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly Ala 20 25
3011632PRTArtificial SequenceFramework 3 sequence 116Arg Phe Thr
Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln1 5 10 15Met Asn
Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly Ala 20 25
3011732PRTArtificial SequenceFramework 3 sequence 117Arg Phe Thr
Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln1 5 10 15Met Asn
Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly Ala 20 25
3011817PRTArtificial SequenceCDR sequence 118Gly Thr Pro Leu Asn
Pro Gly Ala Tyr Ile Tyr Asp Trp Ser Tyr Asp1 5 10
15Tyr11911PRTArtificial SequenceFramework 4 sequence 119Trp Gly Arg
Gly Thr Gln Val Thr Val Ser Ser1 5 1012011PRTArtificial
SequenceFramework 4 sequence 120Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser1 5 101215PRTArtificial SequenceLinker sequence 121Gly Gly
Gly Gly Ser1 51227PRTArtificial SequenceLinker sequence 122Ser Gly
Gly Ser Gly Gly Ser1 51239PRTArtificial SequenceLinker sequence
123Gly Gly Gly Gly Ser Gly Gly Gly Ser1 512410PRTArtificial
SequenceLinker sequence 124Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser1
5 1012515PRTArtificial SequenceLinker sequence 125Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser1 5 10
1512618PRTArtificial SequenceLinker sequence 126Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly Gly Gly1 5 10 15Gly
Ser12720PRTArtificial SequenceLinker sequence 127Gly Gly Gly
Gly
Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly1 5 10 15Gly Gly Gly
Ser 2012825PRTArtificial SequenceLinker sequence 128Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly1 5 10 15Gly Gly Gly
Ser Gly Gly Gly Gly Ser 20 2512930PRTArtificial SequenceLinker
sequence 129Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
Ser Gly1 5 10 15Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
Ser 20 25 3013035PRTArtificial SequenceLinker sequence 130Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly1 5 10 15Gly
Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 20 25
30Gly Gly Ser 3513115PRTArtificial SequenceLinker sequence 131Glu
Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro1 5 10
1513224PRTArtificial SequenceLinker sequence 132Gly Gly Gly Gly Ser
Gly Gly Gly Ser Glu Pro Lys Ser Cys Asp Lys1 5 10 15Thr His Thr Cys
Pro Pro Cys Pro 2013362PRTArtificial SequenceLinker sequence 133Glu
Leu Lys Thr Pro Leu Gly Asp Thr Thr His Thr Cys Pro Arg Cys1 5 10
15Pro Glu Pro Lys Ser Cys Asp Thr Pro Pro Pro Cys Pro Arg Cys Pro
20 25 30Glu Pro Lys Ser Cys Asp Thr Pro Pro Pro Cys Pro Arg Cys Pro
Glu 35 40 45Pro Lys Ser Cys Asp Thr Pro Pro Pro Cys Pro Arg Cys Pro
50 55 601343PRTArtificial SequenceLinker sequence 134Ala Ala
Ala1135126PRTArtificial SequenceNanobody sequence 135Asp Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu
Ser Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val
Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val
50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly
Tyr65 70 75 80Leu Gln Met Asn Ser Leu Ala Pro Asp Asp Thr Ala Val
Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile
Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Arg Gly Thr Gln Val
Thr Val Ser Ser 115 120 125136126PRTArtificial SequenceNanobody
sequence 136Asp Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro
Gly Gly1 5 10 15Ser Leu Arg Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu
Ser Asn Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly
Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile
Gly Pro Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn
Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Pro
Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn
Pro Gly Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly
Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 125137125PRTArtificial
SequenceNanobody sequence 137Asp Gln Leu Leu Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly Ser1 5 10 15Leu Arg Leu Ser Cys Ala Ala Ser
Gly Gly Ser Leu Ser Asn Tyr Val 20 25 30Leu Gly Trp Phe Arg Gln Ala
Pro Gly Lys Gly Arg Glu Phe Val Ala 35 40 45Ala Ile Asn Trp Arg Asp
Asp Ile Thr Ile Gly Pro Pro Asn Val Glu 50 55 60Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr Leu65 70 75 80Gln Met Asn
Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly 85 90 95Ala Gly
Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser Tyr 100 105
110Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120
125138126PRTArtificial SequenceNanobody sequence 138Asp Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu
Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu Phe Val 35 40 45Ala
Ala Ile Asn Trp Arg Asp Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55
60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser 115 120 125139408PRTArtificial SequenceNanobody sequence
139Asp Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1
5 10 15Ser Leu Ser Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn
Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro
Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Gly Tyr65 70 75 80Leu Gln Met Asn Ser Leu Ala Pro Asp Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly
Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Arg Gly
Thr Gln Val Thr Val Ser Ser Gly Gly 115 120 125Gly Gly Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln 130 135 140Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Ala Gly Gly Ser Leu Ser145 150 155
160Ile Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly
165 170 175Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala
Ala Ile 180 185 190Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn
Val Glu Gly Arg 195 200 205Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn
Thr Gly Tyr Leu Gln Met 210 215 220Asn Ser Leu Ala Pro Asp Asp Thr
Ala Val Tyr Tyr Cys Gly Ala Gly225 230 235 240Thr Pro Leu Asn Pro
Gly Ala Tyr Ile Tyr Asp Trp Ser Tyr Asp Tyr 245 250 255Trp Gly Arg
Gly Thr Gln Val Thr Val Ser Ser Gly Gly Gly Gly Ser 260 265 270Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu 275 280
285Ser Gly Gly Gly Leu Val Gln Ala Gly Gly Ser Leu Ser Ile Ser Cys
290 295 300Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly Trp
Phe Arg305 310 315 320Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala
Ala Ile Asn Trp Arg 325 330 335Gly Asp Ile Thr Ile Gly Pro Pro Asn
Val Glu Gly Arg Phe Thr Ile 340 345 350Ser Arg Asp Asn Ala Lys Asn
Thr Gly Tyr Leu Gln Met Asn Ser Leu 355 360 365Ala Pro Asp Asp Thr
Ala Val Tyr Tyr Cys Gly Ala Gly Thr Pro Leu 370 375 380Asn Pro Gly
Ala Tyr Ile Tyr Asp Trp Ser Tyr Asp Tyr Trp Gly Arg385 390 395
400Gly Thr Gln Val Thr Val Ser Ser 405140408PRTArtificial
SequenceNanobody sequence 140Asp Val Gln Leu Leu Glu Ser Gly Gly
Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Ile Ser Cys Ala Ala
Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln
Ala Pro Gly Lys Gly Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Arg
Gly Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55 60Glu Gly Arg Phe Thr
Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met
Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala
Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser 100 105
110Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly
115 120 125Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu
Val Gln 130 135 140Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly Ser Leu Arg145 150 155 160Ile Ser Cys Ala Ala Ser Gly Gly Ser
Leu Ser Asn Tyr Val Leu Gly 165 170 175Trp Phe Arg Gln Ala Pro Gly
Lys Gly Arg Glu Phe Val Ala Ala Ile 180 185 190Asn Trp Arg Gly Asp
Ile Thr Ile Gly Pro Pro Asn Val Glu Gly Arg 195 200 205Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln Met 210 215 220Asn
Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly Ala Gly225 230
235 240Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser Tyr Asp
Tyr 245 250 255Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly
Gly Gly Ser 260 265 270Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu
Val Gln Leu Leu Glu 275 280 285Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly Ser Leu Arg Ile Ser Cys 290 295 300Ala Ala Ser Gly Gly Ser Leu
Ser Asn Tyr Val Leu Gly Trp Phe Arg305 310 315 320Gln Ala Pro Gly
Lys Gly Arg Glu Phe Val Ala Ala Ile Asn Trp Arg 325 330 335Gly Asp
Ile Thr Ile Gly Pro Pro Asn Val Glu Gly Arg Phe Thr Ile 340 345
350Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu
355 360 365Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly Ala Gly Thr
Pro Leu 370 375 380Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser Tyr Asp
Tyr Trp Gly Gln385 390 395 400Gly Thr Leu Val Thr Val Ser Ser
405141407PRTArtificial SequenceNanobody sequence 141Asp Gln Leu Leu
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser1 5 10 15Leu Arg Leu
Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val 20 25 30Leu Gly
Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu Phe Val Ala 35 40 45Ala
Ile Asn Trp Arg Asp Asp Ile Thr Ile Gly Pro Pro Asn Val Glu 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr Leu65
70 75 80Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys
Gly 85 90 95Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp
Ser Tyr 100 105 110Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser
Ser Gly Gly Gly 115 120 125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly
Gly Ser Glu Val Gln Leu 130 135 140Leu Glu Ser Gly Gly Gly Leu Val
Gln Pro Gly Gly Ser Leu Arg Leu145 150 155 160Ser Cys Ala Ala Ser
Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly Trp 165 170 175Phe Arg Gln
Ala Pro Gly Lys Gly Arg Glu Phe Val Ala Ala Ile Asn 180 185 190Trp
Arg Asp Asp Ile Thr Ile Gly Pro Pro Asn Val Glu Gly Arg Phe 195 200
205Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr Leu Gln Met Asn
210 215 220Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly Ala
Gly Thr225 230 235 240Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp
Ser Tyr Asp Tyr Trp 245 250 255Gly Gln Gly Thr Leu Val Thr Val Ser
Ser Gly Gly Gly Gly Ser Gly 260 265 270Gly Gly Gly Ser Gly Gly Gly
Gly Ser Glu Val Gln Leu Leu Glu Ser 275 280 285Gly Gly Gly Leu Val
Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala 290 295 300Ala Ser Gly
Gly Ser Leu Ser Asn Tyr Val Leu Gly Trp Phe Arg Gln305 310 315
320Ala Pro Gly Lys Gly Arg Glu Phe Val Ala Ala Ile Asn Trp Arg Asp
325 330 335Asp Ile Thr Ile Gly Pro Pro Asn Val Glu Gly Arg Phe Thr
Ile Ser 340 345 350Arg Asp Asn Ala Lys Asn Thr Leu Tyr Leu Gln Met
Asn Ser Leu Arg 355 360 365Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly
Ala Gly Thr Pro Leu Asn 370 375 380Pro Gly Ala Tyr Ile Tyr Asp Trp
Ser Tyr Asp Tyr Trp Gly Gln Gly385 390 395 400Thr Leu Val Thr Val
Ser Ser 405142408PRTArtificial SequenceNanobody sequence 142Asp Val
Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser
Leu Arg Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr 20 25
30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu Phe Val
35 40 45Ala Ala Ile Asn Trp Arg Asp Asp Ile Thr Ile Gly Pro Pro Asn
Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr
Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala
Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr
Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Leu
Val Thr Val Ser Ser Gly Gly 115 120 125Gly Gly Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Glu Val Gln 130 135 140Leu Leu Glu Ser Gly
Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg145 150 155 160Leu Ser
Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly 165 170
175Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu Phe Val Ala Ala Ile
180 185 190Asn Trp Arg Asp Asp Ile Thr Ile Gly Pro Pro Asn Val Glu
Gly Arg 195 200 205Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu
Tyr Leu Gln Met 210 215 220Asn Ser Leu Arg Pro Glu Asp Thr Ala Val
Tyr Tyr Cys Gly Ala Gly225 230 235 240Thr Pro Leu Asn Pro Gly Ala
Tyr Ile Tyr Asp Trp Ser Tyr Asp Tyr 245 250 255Trp Gly Gln Gly Thr
Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser 260 265 270Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Leu Glu 275 280 285Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys 290 295
300Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly Trp Phe
Arg305 310 315 320Gln Ala Pro Gly Lys Gly Arg Glu Phe Val Ala Ala
Ile Asn Trp Arg 325 330 335Asp Asp Ile Thr Ile Gly Pro Pro Asn Val
Glu Gly Arg Phe Thr Ile 340 345 350Ser Arg Asp Asn Ser Lys Asn Thr
Leu Tyr Leu Gln Met Asn Ser Leu 355 360 365Arg Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Gly Ala Gly Thr Pro Leu 370 375 380Asn Pro Gly Ala
Tyr Ile Tyr Asp Trp Ser Tyr Asp Tyr Trp Gly Gln385 390 395 400Gly
Thr Leu Val Thr Val Ser Ser 405143126PRTArtificial SequenceNanobody
sequence 143Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro
Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Gly
Ser Leu Ser Asn Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly
Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile
Thr Ile Gly Pro Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg
Asp Asn Ala Lys Asn Thr Gly Tyr65 70 75 80Leu Gln Met Asn Ser Leu
Ala Pro Asp Asp Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro
Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120
125144126PRTArtificial SequenceNanobody sequence 144Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu
Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala
Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55
60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr65
70 75 80Leu Gln Met Asn Ser Leu Arg Pro Asp Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser 115 120 125145126PRTArtificial SequenceNanobody sequence
145Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn
Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro
Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Gly Tyr65 70 75 80Leu Gln Met Asn Ser Leu Ala Pro Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly
Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Gln Gly
Thr Leu Val Thr Val Ser Ser 115 120 125146126PRTArtificial
SequenceNanobody sequence 146Glu Val Gln Leu Val Glu Ser Gly Gly
Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Arg
Gly Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55 60Glu Gly Arg Phe Thr
Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr65 70 75 80Leu Gln Met
Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala
Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser 100 105
110Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120
125147126PRTArtificial SequenceNanobody sequence 147Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu
Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala
Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55
60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr65
70 75 80Leu Gln Met Asn Ser Leu Ala Pro Asp Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Arg Gly Thr Leu Val Thr Val
Ser Ser 115 120 125148126PRTArtificial SequenceNanobody sequence
148Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn
Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro
Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Gly Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Pro Asp Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly
Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Arg Gly
Thr Leu Val Thr Val Ser Ser 115 120 125149126PRTArtificial
SequenceNanobody sequence 149Glu Val Gln Leu Val Glu Ser Gly Gly
Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Arg
Gly Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55 60Glu Gly Arg Phe Thr
Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr65 70 75 80Leu Gln Met
Asn Ser Leu Ala Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala
Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser 100 105
110Tyr Asp Tyr Trp Gly Arg Gly Thr Leu Val Thr Val Ser Ser 115 120
125150126PRTArtificial SequenceNanobody sequence 150Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu
Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala
Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55
60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr65
70 75 80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Arg Gly Thr Leu Val Thr Val
Ser Ser 115 120 125151126PRTArtificial SequenceNanobody sequence
151Asp Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn
Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu
Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro
Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys
Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly
Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Gln Gly
Thr Leu Val Thr Val Ser Ser 115 120 125152126PRTArtificial
SequenceNanobody sequence 152Asp Val Gln Leu Val Glu Ser Gly Gly
Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Arg
Gly Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55 60Glu Gly Arg Phe Thr
Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr65 70 75 80Leu Gln Met
Asn Ser Leu Ala Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala
Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser 100 105
110Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120
125153126PRTArtificial SequenceNanobody sequence 153Asp Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu
Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala
Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55
60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr65
70 75 80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser 115 120 125154126PRTArtificial SequenceNanobody sequence
154Asp Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn
Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro
Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Gly Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly
Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Arg Gly
Thr Leu Val Thr Val Ser Ser 115 120 125155408PRTArtificial
SequenceNanobody sequence 155Glu Val Gln Leu Leu Glu Ser Gly Gly
Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln
Ala Pro Gly Lys Gly Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Arg
Gly Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55 60Glu Gly Arg Phe Thr
Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met
Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala
Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser 100 105
110Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly
115 120 125Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu
Val Gln 130 135 140Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly Ser Leu Arg145 150 155 160Leu Ser Cys Ala Ala Ser Gly Gly Ser
Leu Ser Asn Tyr Val Leu Gly 165 170 175Trp Phe Arg Gln Ala Pro Gly
Lys Gly Arg Glu Phe Val Ala Ala Ile 180 185 190Asn Trp Arg Gly Asp
Ile Thr Ile Gly Pro Pro Asn Val Glu Gly Arg 195 200 205Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln Met 210 215 220Asn
Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly Ala Gly225 230
235 240Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser Tyr Asp
Tyr 245 250 255Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly
Gly Gly Ser 260 265 270Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu
Val Gln Leu Leu Glu 275 280 285Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly Ser Leu Arg Leu Ser Cys 290 295 300Ala Ala Ser Gly Gly Ser Leu
Ser Asn Tyr Val Leu Gly Trp Phe Arg305 310 315 320Gln Ala Pro Gly
Lys Gly Arg Glu Phe Val Ala Ala Ile Asn Trp Arg 325 330 335Gly Asp
Ile Thr Ile Gly Pro Pro Asn Val Glu Gly Arg Phe Thr Ile 340 345
350Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu
355 360 365Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly Ala Gly Thr
Pro Leu 370 375 380Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser Tyr Asp
Tyr Trp Gly Gln385 390 395 400Gly Thr Leu Val Thr Val Ser Ser
405156408PRTArtificial SequenceNanobody sequence 156Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu
Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala
Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55
60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr65
70 75 80Leu Gln Met Asn Ser Leu Arg Pro Asp Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser Gly Gly 115 120 125Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln 130 135 140Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly Ser Leu Arg145 150 155 160Leu Ser Cys Ala Ala
Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly 165 170 175Trp Phe Arg
Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Ile 180 185 190Asn
Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val Glu Gly Arg 195 200
205Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr Leu Gln Met
210 215 220Asn Ser Leu Arg Pro Asp Asp Thr Ala Val Tyr Tyr Cys Gly
Ala Gly225 230 235 240Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser Tyr Asp Tyr 245 250 255Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser 260 265 270Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln Leu Val Glu 275 280 285Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys 290 295 300Ala Ala Ser
Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly Trp Phe Arg305 310 315
320Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Ile Asn Trp Arg
325 330 335Gly Asp Ile Thr Ile Gly Pro Pro Asn Val Glu Gly Arg Phe
Thr Ile 340 345 350Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr Leu Gln
Met Asn Ser Leu 355 360 365Arg Pro Asp Asp Thr Ala Val Tyr Tyr Cys
Gly Ala Gly Thr Pro Leu 370 375 380Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser Tyr Asp Tyr Trp Gly Gln385 390 395 400Gly Thr Leu Val Thr
Val Ser Ser 405157408PRTArtificial SequenceNanobody sequence 157Glu
Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr
20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe
Val 35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro
Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn
Thr Gly Tyr65
70 75 80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser Gly Gly 115 120 125Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln 130 135 140Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly Ser Leu Arg145 150 155 160Leu Ser Cys Ala Ala
Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly 165 170 175Trp Phe Arg
Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Ile 180 185 190Asn
Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val Glu Gly Arg 195 200
205Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr Leu Gln Met
210 215 220Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly
Ala Gly225 230 235 240Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser Tyr Asp Tyr 245 250 255Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser 260 265 270Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln Leu Val Glu 275 280 285Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys 290 295 300Ala Ala Ser
Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly Trp Phe Arg305 310 315
320Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Ile Asn Trp Arg
325 330 335Gly Asp Ile Thr Ile Gly Pro Pro Asn Val Glu Gly Arg Phe
Thr Ile 340 345 350Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr Leu Gln
Met Asn Ser Leu 355 360 365Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys
Gly Ala Gly Thr Pro Leu 370 375 380Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser Tyr Asp Tyr Trp Gly Gln385 390 395 400Gly Thr Leu Val Thr
Val Ser Ser 405158408PRTArtificial SequenceNanobody sequence 158Glu
Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr
20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe
Val 35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro
Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn
Thr Gly Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala
Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Arg Gly Thr
Leu Val Thr Val Ser Ser Gly Gly 115 120 125Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Glu Val Gln 130 135 140Leu Val Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg145 150 155 160Leu
Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly 165 170
175Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Ile
180 185 190Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val Glu
Gly Arg 195 200 205Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly
Tyr Leu Gln Met 210 215 220Asn Ser Leu Arg Pro Glu Asp Thr Ala Val
Tyr Tyr Cys Gly Ala Gly225 230 235 240Thr Pro Leu Asn Pro Gly Ala
Tyr Ile Tyr Asp Trp Ser Tyr Asp Tyr 245 250 255Trp Gly Arg Gly Thr
Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser 260 265 270Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu 275 280 285Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys 290 295
300Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly Trp Phe
Arg305 310 315 320Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala
Ile Asn Trp Arg 325 330 335Gly Asp Ile Thr Ile Gly Pro Pro Asn Val
Glu Gly Arg Phe Thr Ile 340 345 350Ser Arg Asp Asn Ala Lys Asn Thr
Gly Tyr Leu Gln Met Asn Ser Leu 355 360 365Arg Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Gly Ala Gly Thr Pro Leu 370 375 380Asn Pro Gly Ala
Tyr Ile Tyr Asp Trp Ser Tyr Asp Tyr Trp Gly Arg385 390 395 400Gly
Thr Leu Val Thr Val Ser Ser 405159408PRTArtificial SequenceNanobody
sequence 159Asp Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro
Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu
Ser Asn Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly
Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile
Gly Pro Pro Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn
Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Pro
Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn
Pro Gly Ala Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly
Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly 115 120 125Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln 130 135 140Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg145 150
155 160Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu
Gly 165 170 175Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu Phe Val
Ala Ala Ile 180 185 190Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro
Asn Val Glu Gly Arg 195 200 205Phe Thr Ile Ser Arg Asp Asn Ser Lys
Asn Thr Leu Tyr Leu Gln Met 210 215 220Asn Ser Leu Arg Pro Glu Asp
Thr Ala Val Tyr Tyr Cys Gly Ala Gly225 230 235 240Thr Pro Leu Asn
Pro Gly Ala Tyr Ile Tyr Asp Trp Ser Tyr Asp Tyr 245 250 255Trp Gly
Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser 260 265
270Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Leu Glu
275 280 285Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu
Ser Cys 290 295 300Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu
Gly Trp Phe Arg305 310 315 320Gln Ala Pro Gly Lys Gly Arg Glu Phe
Val Ala Ala Ile Asn Trp Arg 325 330 335Gly Asp Ile Thr Ile Gly Pro
Pro Asn Val Glu Gly Arg Phe Thr Ile 340 345 350Ser Arg Asp Asn Ser
Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu 355 360 365Arg Pro Glu
Asp Thr Ala Val Tyr Tyr Cys Gly Ala Gly Thr Pro Leu 370 375 380Asn
Pro Gly Ala Tyr Ile Tyr Asp Trp Ser Tyr Asp Tyr Trp Gly Gln385 390
395 400Gly Thr Leu Val Thr Val Ser Ser 405160408PRTArtificial
SequenceNanobody sequence 160Asp Val Gln Leu Val Glu Ser Gly Gly
Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Arg
Gly Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55 60Glu Gly Arg Phe Thr
Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr65 70 75 80Leu Gln Met
Asn Ser Leu Arg Pro Asp Asp Thr Ala Val Tyr Tyr Cys 85 90 95Gly Ala
Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser 100 105
110Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly
115 120 125Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu
Val Gln 130 135 140Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly Ser Leu Arg145 150 155 160Leu Ser Cys Ala Ala Ser Gly Gly Ser
Leu Ser Asn Tyr Val Leu Gly 165 170 175Trp Phe Arg Gln Ala Pro Gly
Lys Glu Arg Glu Phe Val Ala Ala Ile 180 185 190Asn Trp Arg Gly Asp
Ile Thr Ile Gly Pro Pro Asn Val Glu Gly Arg 195 200 205Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr Leu Gln Met 210 215 220Asn
Ser Leu Arg Pro Asp Asp Thr Ala Val Tyr Tyr Cys Gly Ala Gly225 230
235 240Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser Tyr Asp
Tyr 245 250 255Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly
Gly Gly Ser 260 265 270Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu
Val Gln Leu Val Glu 275 280 285Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly Ser Leu Arg Leu Ser Cys 290 295 300Ala Ala Ser Gly Gly Ser Leu
Ser Asn Tyr Val Leu Gly Trp Phe Arg305 310 315 320Gln Ala Pro Gly
Lys Glu Arg Glu Phe Val Ala Ala Ile Asn Trp Arg 325 330 335Gly Asp
Ile Thr Ile Gly Pro Pro Asn Val Glu Gly Arg Phe Thr Ile 340 345
350Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr Leu Gln Met Asn Ser Leu
355 360 365Arg Pro Asp Asp Thr Ala Val Tyr Tyr Cys Gly Ala Gly Thr
Pro Leu 370 375 380Asn Pro Gly Ala Tyr Ile Tyr Asp Trp Ser Tyr Asp
Tyr Trp Gly Gln385 390 395 400Gly Thr Leu Val Thr Val Ser Ser
405161408PRTArtificial SequenceNanobody sequence 161Asp Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr 20 25 30Val Leu
Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala
Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val 50 55
60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr65
70 75 80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser Gly Gly 115 120 125Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln 130 135 140Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly Ser Leu Arg145 150 155 160Leu Ser Cys Ala Ala
Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly 165 170 175Trp Phe Arg
Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Ile 180 185 190Asn
Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val Glu Gly Arg 195 200
205Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr Leu Gln Met
210 215 220Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys Gly
Ala Gly225 230 235 240Thr Pro Leu Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser Tyr Asp Tyr 245 250 255Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser 260 265 270Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln Leu Val Glu 275 280 285Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys 290 295 300Ala Ala Ser
Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly Trp Phe Arg305 310 315
320Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Ile Asn Trp Arg
325 330 335Gly Asp Ile Thr Ile Gly Pro Pro Asn Val Glu Gly Arg Phe
Thr Ile 340 345 350Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr Leu Gln
Met Asn Ser Leu 355 360 365Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys
Gly Ala Gly Thr Pro Leu 370 375 380Asn Pro Gly Ala Tyr Ile Tyr Asp
Trp Ser Tyr Asp Tyr Trp Gly Gln385 390 395 400Gly Thr Leu Val Thr
Val Ser Ser 405162408PRTArtificial SequenceNanobody sequence 162Asp
Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr
20 25 30Val Leu Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe
Val 35 40 45Ala Ala Ile Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro
Asn Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn
Thr Gly Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90 95Gly Ala Gly Thr Pro Leu Asn Pro Gly Ala
Tyr Ile Tyr Asp Trp Ser 100 105 110Tyr Asp Tyr Trp Gly Arg Gly Thr
Leu Val Thr Val Ser Ser Gly Gly 115 120 125Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Glu Val Gln 130 135 140Leu Val Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg145 150 155 160Leu
Ser Cys Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly 165 170
175Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Ile
180 185 190Asn Trp Arg Gly Asp Ile Thr Ile Gly Pro Pro Asn Val Glu
Gly Arg 195 200 205Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly
Tyr Leu Gln Met 210 215 220Asn Ser Leu Arg Pro Glu Asp Thr Ala Val
Tyr Tyr Cys Gly Ala Gly225 230 235 240Thr Pro Leu Asn Pro Gly Ala
Tyr Ile Tyr Asp Trp Ser Tyr Asp Tyr 245 250 255Trp Gly Arg Gly Thr
Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser 260 265 270Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu 275 280 285Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys 290 295
300Ala Ala Ser Gly Gly Ser Leu Ser Asn Tyr Val Leu Gly Trp Phe
Arg305 310 315 320Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala
Ile Asn Trp Arg 325 330 335Gly Asp Ile Thr Ile Gly Pro Pro Asn Val
Glu Gly Arg Phe Thr Ile 340 345 350Ser Arg Asp Asn Ala Lys Asn Thr
Gly Tyr Leu Gln Met Asn Ser Leu 355 360 365Arg Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Gly Ala Gly Thr Pro Leu 370 375 380Asn Pro Gly Ala
Tyr Ile Tyr Asp Trp Ser Tyr Asp Tyr Trp Gly Arg385 390 395 400Gly
Thr Leu Val Thr Val Ser Ser 40516330PRTArtificial SequenceFramework
1 sequence 163Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln
Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Gly Ser
Leu Ser 20 25 3016432PRTArtificial SequenceFramework 3 sequence
164Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr Leu Gln1
5 10 15Met Asn Ser Leu Arg Pro Asp Asp Thr Ala Val
Tyr Tyr Cys Gly Ala 20 25 3016532PRTArtificial SequenceFramework 3
sequence 165Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Gly Tyr
Leu Gln1 5 10 15Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr
Cys Gly Ala 20 25 3016611PRTArtificial SequenceFramework 4 sequence
166Trp Gly Arg Gly Thr Leu Val Thr Val Ser Ser1 5
10167574PRTrespiratory syncytial virus 167Met Glu Leu Pro Ile Leu
Lys Ala Asn Ala Ile Thr Thr Ile Leu Ala1 5 10 15Ala Val Thr Phe Cys
Phe Ala Ser Ser Gln Asn Ile Thr Glu Glu Phe 20 25 30Tyr Gln Ser Thr
Cys Ser Ala Val Ser Lys Gly Tyr Leu Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50 55 60Lys Glu
Asn Lys Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala Ala Asn Asn Arg Ala Arg Arg Glu Leu
Pro 100 105 110Arg Phe Met Asn Tyr Thr Leu Asn Asn Thr Lys Lys Thr
Asn Val Thr 115 120 125Leu Ser Lys Lys Arg Lys Arg Arg Phe Leu Gly
Phe Leu Leu Gly Val 130 135 140Gly Ser Ala Ile Ala Ser Gly Thr Ala
Val Ser Lys Val Leu His Leu145 150 155 160Glu Gly Glu Val Asn Lys
Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys 165 170 175Ala Val Val Ser
Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val 180 185 190Leu Asp
Leu Lys Asn Tyr Ile Asp Lys Gln Leu Leu Pro Ile Val Asn 195 200
205Lys Gln Ser Cys Arg Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln
210 215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr Arg Glu Phe Ser
Val Asn225 230 235 240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met
Leu Thr Asn Ser Glu 245 250 255Leu Leu Ser Leu Ile Asn Asp Met Pro
Ile Thr Asn Asp Gln Lys Lys 260 265 270Leu Met Ser Asn Asn Val Gln
Ile Val Arg Gln Gln Ser Tyr Ser Ile 275 280 285Met Ser Ile Ile Lys
Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290 295 300Leu Tyr Gly
Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro305 310 315
320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg
325 330 335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser
Phe Phe 340 345 350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn Arg
Val Phe Cys Asp 355 360 365Thr Met Asn Ser Leu Thr Leu Pro Ser Glu
Val Asn Leu Cys Asn Val 370 375 380Asp Ile Phe Asn Pro Lys Tyr Asp
Cys Lys Ile Met Thr Ser Lys Thr385 390 395 400Asp Val Ser Ser Ser
Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys 405 410 415Tyr Gly Lys
Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile 420 425 430Lys
Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp 435 440
445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly
450 455 460Lys Ser Leu Tyr Val Lys Gly Glu Pro Ile Ile Asn Phe Tyr
Asp Pro465 470 475 480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser
Ile Ser Gln Val Asn 485 490 495Glu Lys Ile Asn Gln Ser Leu Ala Phe
Ile Arg Lys Ser Asp Glu Leu 500 505 510Leu His His Val Asn Ala Gly
Lys Ser Thr Thr Asn Ile Met Ile Thr 515 520 525Thr Ile Ile Ile Val
Ile Ile Val Ile Leu Leu Ser Leu Ile Ala Val 530 535 540Gly Leu Leu
Leu Tyr Cys Lys Ala Arg Ser Thr Pro Val Thr Leu Ser545 550 555
560Lys Asp Gln Leu Ser Gly Ile Asn Asn Ile Ala Phe Ser Asn 565
570168574PRTrespiratory syncytial virus 168Met Glu Leu Leu Ile Leu
Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1 5 10 15Ala Val Thr Phe Cys
Phe Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25 30Tyr Gln Ser Thr
Cys Ser Ala Val Ser Lys Gly Tyr Leu Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50 55 60Lys Lys
Asn Lys Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Gln Ala Thr Asn Asn Arg Ala Arg Arg Glu Leu
Pro 100 105 110Arg Phe Met Asn Tyr Thr Leu Asn Asn Ala Lys Lys Thr
Asn Val Thr 115 120 125Leu Ser Lys Lys Arg Lys Arg Arg Phe Leu Gly
Phe Leu Leu Gly Val 130 135 140Gly Ser Ala Ile Ala Ser Gly Val Ala
Val Ser Lys Val Leu His Leu145 150 155 160Glu Gly Glu Val Asn Lys
Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys 165 170 175Ala Val Val Ser
Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val 180 185 190Leu Asp
Leu Lys Asn Tyr Ile Asp Lys Gln Leu Leu Pro Ile Val Asn 195 200
205Lys Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln
210 215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr Arg Glu Phe Ser
Val Asn225 230 235 240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met
Leu Thr Asn Ser Glu 245 250 255Leu Leu Ser Leu Ile Asn Asp Met Pro
Ile Thr Asn Asp Gln Lys Lys 260 265 270Leu Met Ser Asn Asn Val Gln
Ile Val Arg Gln Gln Ser Tyr Ser Ile 275 280 285Met Ser Ile Ile Lys
Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290 295 300Leu Tyr Gly
Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro305 310 315
320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg
325 330 335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser
Phe Phe 340 345 350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn Arg
Val Phe Cys Asp 355 360 365Thr Met Asn Ser Leu Thr Leu Pro Ser Glu
Val Asn Leu Cys Asn Val 370 375 380Asp Ile Phe Asn Pro Lys Tyr Asp
Cys Lys Ile Met Thr Ser Lys Thr385 390 395 400Asp Val Ser Ser Ser
Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys 405 410 415Tyr Gly Lys
Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile 420 425 430Lys
Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp 435 440
445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly
450 455 460Lys Ser Leu Tyr Val Lys Gly Glu Pro Ile Ile Asn Phe Tyr
Asp Pro465 470 475 480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser
Ile Ser Gln Val Asn 485 490 495Glu Lys Ile Asn Gln Ser Leu Ala Phe
Ile Arg Lys Ser Asp Glu Leu 500 505 510Leu His Asn Val Asn Ala Gly
Lys Ser Thr Thr Asn Ile Met Ile Thr 515 520 525Thr Ile Ile Ile Val
Ile Ile Val Ile Leu Leu Ser Leu Ile Ala Val 530 535 540Gly Leu Leu
Leu Tyr Cys Lys Ala Arg Ser Thr Pro Val Thr Leu Ser545 550 555
560Lys Asp Gln Leu Ser Gly Ile Asn Asn Ile Ala Phe Ser Asn 565
570169574PRTrespiratory syncytial virus 169Met Glu Leu Leu Ile His
Arg Ser Ser Ala Ile Phe Leu Thr Leu Ala1 5 10 15Val Asn Ala Leu Tyr
Leu Thr Ser Ser Gln Asn Ile Thr Glu Glu Phe 20 25 30Tyr Gln Ser Thr
Cys Ser Ala Val Ser Arg Gly Tyr Phe Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50 55 60Lys Glu
Thr Lys Cys Asn Gly Thr Asp Thr Lys Val Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Asn Thr Pro Ala Ala Asn Asn Arg Ala Arg Arg Glu Ala
Pro 100 105 110Gln Tyr Met Asn Tyr Thr Ile Asn Thr Thr Lys Asn Leu
Asn Val Ser 115 120 125Ile Ser Lys Lys Arg Lys Arg Arg Phe Leu Gly
Phe Leu Leu Gly Val 130 135 140Gly Ser Ala Ile Ala Ser Gly Ile Ala
Val Ser Lys Val Leu His Leu145 150 155 160Glu Gly Glu Val Asn Lys
Ile Lys Asn Ala Leu Leu Ser Thr Asn Lys 165 170 175Ala Val Val Ser
Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val 180 185 190Leu Asp
Leu Lys Asn Tyr Ile Asn Asn Arg Leu Leu Pro Ile Val Asn 195 200
205Gln Gln Ser Cys Arg Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln
210 215 220Gln Met Asn Ser Arg Leu Leu Glu Ile Thr Arg Glu Phe Ser
Val Asn225 230 235 240Ala Gly Val Thr Thr Pro Leu Ser Thr Tyr Met
Leu Thr Asn Ser Glu 245 250 255Leu Leu Ser Leu Ile Asn Asp Met Pro
Ile Thr Asn Asp Gln Lys Lys 260 265 270Leu Met Ser Ser Asn Val Gln
Ile Val Arg Gln Gln Ser Tyr Ser Ile 275 280 285Met Ser Ile Ile Lys
Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290 295 300Ile Tyr Gly
Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro305 310 315
320Leu Cys Thr Thr Asn Ile Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg
325 330 335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser
Phe Phe 340 345 350Pro Gln Ala Asp Thr Cys Lys Val Gln Ser Asn Arg
Val Phe Cys Asp 355 360 365Thr Met Asn Ser Leu Thr Leu Pro Ser Glu
Val Ser Leu Cys Asn Thr 370 375 380Asp Ile Phe Asn Ser Lys Tyr Asp
Cys Lys Ile Met Thr Ser Lys Thr385 390 395 400Asp Ile Ser Ser Ser
Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys 405 410 415Tyr Gly Lys
Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile 420 425 430Lys
Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp 435 440
445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn Lys Leu Glu Gly
450 455 460Lys Asn Leu Tyr Val Lys Gly Glu Pro Ile Ile Asn Tyr Tyr
Asp Pro465 470 475 480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser
Ile Ser Gln Val Asn 485 490 495Glu Lys Ile Asn Gln Ser Leu Ala Phe
Ile Arg Arg Ser Asp Glu Leu 500 505 510Leu His Asn Val Asn Thr Gly
Lys Ser Thr Thr Asn Ile Met Ile Thr 515 520 525Thr Ile Ile Ile Val
Ile Ile Val Val Leu Leu Leu Leu Ile Ala Ile 530 535 540Gly Leu Leu
Leu Tyr Cys Lys Ala Lys Asn Thr Pro Val Thr Leu Ser545 550 555
560Lys Asp Gln Leu Ser Gly Ile Asn Asn Ile Ala Phe Ser Lys 565
570
* * * * *