U.S. patent application number 12/596063 was filed with the patent office on 2012-02-09 for mammalian-type glycosylation in plants by expression of non-mammalian glycosyltransferases.
This patent application is currently assigned to Stichting Dienst Landbouwkundig Onderzoek. Invention is credited to Hendrik Jan Bosch, Dionisius Elisabeth Antonius Florack, Gerard Johan Adolph Rouwendal.
Application Number | 20120036596 12/596063 |
Document ID | / |
Family ID | 38441415 |
Filed Date | 2012-02-09 |
United States Patent
Application |
20120036596 |
Kind Code |
A9 |
Rouwendal; Gerard Johan Adolph ;
et al. |
February 9, 2012 |
MAMMALIAN-TYPE GLYCOSYLATION IN PLANTS BY EXPRESSION OF
NON-MAMMALIAN GLYCOSYLTRANSFERASES
Abstract
The present invention relates to non-mammalian
.beta.-1,4-galactosyltransferases that can be used in their
wild-type or in modified forms. The invention further relates to
transformed plants and plant cells expressing non-mammalian
.beta.-1,4-galacto-syltransferase and methods to produce
glycoproteins with altered and preferably mammalian-type
glycosylation. The invention additionally provides nucleic acid
molecules and expression vectors of non-mammalian
.beta.-1,4-galactosyltransferases.
Inventors: |
Rouwendal; Gerard Johan Adolph;
(Heteren, NL) ; Florack; Dionisius Elisabeth
Antonius; (Wageningen, NL) ; Bosch; Hendrik Jan;
(Wageningen, NL) |
Assignee: |
Stichting Dienst Landbouwkundig
Onderzoek
Wageningen
NL
|
Prior
Publication: |
|
Document Identifier |
Publication Date |
|
US 20110067146 A1 |
March 17, 2011 |
|
|
Family ID: |
38441415 |
Appl. No.: |
12/596063 |
Filed: |
April 17, 2008 |
PCT Filed: |
April 17, 2008 |
PCT NO: |
PCT/IB08/00944 PCKC 00 |
371 Date: |
October 15, 2009 |
Current U.S.
Class: |
800/288; 435/419;
435/468; 435/69.1; 435/69.4; 435/69.6; 536/23.2; 800/298 |
Current CPC
Class: |
C12P 21/005 20130101;
C12N 15/8257 20130101; C12N 15/8245 20130101; C07K 2319/00
20130101; C12N 15/8246 20130101; C12N 9/1051 20130101 |
Class at
Publication: |
800/288; 435/468;
800/298; 435/419; 435/69.1; 435/69.6; 435/69.4; 536/23.2 |
International
Class: |
C12N 15/82 20060101
C12N015/82; A01H 5/10 20060101 A01H005/10; C07H 21/00 20060101
C07H021/00; A01H 5/06 20060101 A01H005/06; C12N 5/10 20060101
C12N005/10; C12P 21/00 20060101 C12P021/00; A01H 5/00 20060101
A01H005/00; A01H 5/12 20060101 A01H005/12 |
Foreign Application Data
Date |
Code |
Application Number |
Apr 17, 2007 |
EP |
07 106 337.4 |
Claims
1. A method of producing a transgenic plant or a transgenic plant
cell which is capable of adding galactose residues in
.beta.1,4-linkage to N-linked glycans, comprising: (a) inserting a
nucleic acid molecule that is at least 85% identical to chicken
.beta.1,4-galactosyltransferase nucleic acid sequence (SEQ ID NO:1)
into a plant or a plant cell; and (b) selecting a transgenic plant
or transgenic plant cell that has taken up the nucleic acid
molecule of (a) and expresses the nucleic acid molecule, thereby
producing a transgenic plant or transgenic plant cell capable of
adding galactose residues in .beta.1,4-linkage to N-linked
glycans.
2. (canceled)
3. The method of claim 1, wherein the chicken
.beta.1,4-galactosyltransferase comprises SEQ ID NO: 2.
4. (canceled)
5. The method of claim 1, wherein the chicken
.beta.1,4-galactosyltransferase is extended at the N-terminus with
an amino acid sequence of about 10-20 amino acids in length
corresponding to the N-terminal amino acid sequence of a mammalian
.beta.1,4-galactosyltransferase 1.
6. The method of claim 5, wherein the N-terminal amino acid
sequence comprises at least the sequence [K/R]-X-[K/R] in the first
10 N-terminal amino acids, wherein [K/R] represents either a lysine
or arginine residue and X can be any amino acid.
7. The method of claim 6, wherein the amino acid sequence is
MRLREPLLSGSAA (SEQ ID NO: 21).
8. The method of claim 1, wherein the
cytoplasmic-transmembrane-stem region (CTS) of the chicken
.beta.1,4-galactosyltransferase is replaced by the CTS of a
mammalian sialyltransferase.
9-11. (canceled)
12. The method of claim 1, wherein the
cytoplasmic-transmembrane-stem region (CTS) of the chicken
.beta.1,4-galactosyltransferase is replaced by the CTS of a plant
Golgi-localized protein.
13-37. (canceled)
38. The method of claim 1, wherein the transgenic plant or
transgenic plant cell produces a glycoprotein comprising
hybrid-type N-linked glycans lacking both .beta.1,2-xylose and
.alpha.1,3-fucose residues.
39. The method of claim 38, wherein the amount of hybrid-type
N-linked glycans lacking both .beta.1,2-xylose and
.alpha.1,3-fucose residues produced is at least twice the amount
produced by a plant cell or plant expressing wild-type human
.beta.1,4-galactosyltransferase.
40-44. (canceled)
45. A transgenic plant produced according to the method of claim 1
or part of such a plant.
46. The transgenic plant of claim 45, wherein the plant is a part
of a plant selected from the group consisting of seeds, embryos,
callus tissue, leaves, roots, shoots, pollen, and microspores.
47. A transgenic plant cell produced according to the method of
claim 1.
48. The transgenic plant cell of claim 47, wherein the plant cell
is grown in suspension culture.
49-63. (canceled)
64. The transgenic plant cell of claim 48, wherein the plant cell
grown in suspension culture is selected from a group consisting of
N. tabacum BY2, Daucus carota and Arabidopsis thaliana cell
suspension.
65. The transgenic plant cell of claim 48, wherein the plant cell
is part of a moss selected from a group consisting of Bryophytaea,
Physcomitrella patens, Funaria hygrornetrica, and Ceratodon
purpureus.
66-127. (canceled)
128. A method of producing a heterologous glycoprotein comprising
one or more hybrid-type galactosylated N-linked glycans,
comprising: (a) inserting into a plant or plant cell a nucleic acid
molecule encoding a chicken .beta.1,4-galactosyltransferase and a
nucleic acid molecule encoding a heterologous glycoprotein, thereby
producing a transgenic plant or a transgenic plant cell; and (b)
maintaining the transgenic plant or a transgenic plant cell under
conditions appropriate for expression of the nucleic acid
molecules, whereby a heterologous glycoprotein comprising one or
more hybrid-type galactosylated N-linked glycans is produced.
129. The method of claim 128, wherein the chicken
.beta.1,4-galactosyltransferase is extended at the N-terminus with
an amino acid sequence of about 10-20 amino acids in length
corresponding to the N-terminal amino acid sequence of a mammalian
.beta.1,4-galactosyltransferase.
130. The method of claim 128, wherein the N-glycans of said
glycoprotein are devoid of xylose and of fucose residues.
131. The method of claim 128, wherein the nucleic acid molecule
encoding a heterologous glycoprotein encodes a hormone; a cytokine,
a vaccine; an adhesion molecule, an antibody or a functional
antibody fragment.
132. A nucleic acid encoding a polypeptide comprising: (a) an amino
acid sequence of a non-mammalian .beta.1,4-galactosyltransferase,
wherein the amino acid sequence of the enzymatically active domain
of the non-mammalian .beta.1,4-galactosyltransferase is at least
90% identical to that of the chicken
.beta.1,4-galactosyltransferase 1 (SEQ ID NO:2) and (b) an
extension at the N-terminus thereof, wherein the extension is (i)
an amino acid sequence of about 10-20 amino acids in length
corresponding to the N-terminal amino acid sequence of a mammalian
.beta.1,4-galactosyltransferase 1, and (ii) comprises at least the
sequence [K/R]-X-[K/R] in the first 10 N-terminal amino acids,
wherein [K/R] represents either a lysine or arginine residue and X
can be any amino acid.
133. A transgenic plant or a transgenic plant cell which is capable
of producing a glycoprotein having hybrid-type N-linked glycans
lacking both .beta.1,2-xylose and .alpha.1,3-fucose residues, the
plant or plant cell comprising a nucleic acid molecule that is at
least 85% identical to chicken .beta.1,4-galactosyltransferase
nucleic acid sequence (SEQ ID NO:1), wherein the amount of
hybrid-type N-linked glycans lacking both .beta.1,2-xylose and
.alpha.1,3-fucose residues on a glycoprotein produced is at least
twice the amount produced by a plant cell or plant expressing
wild-type human .beta.1,4-galactosyltransferase.
Description
FIELD OF THE INVENTION
[0001] The invention relates to the field of glycoprotein
processing in transgenic plants, in particular in such plants as
used for the production of recombinant biopharmaceutical
proteins.
BACKGROUND OF THE INVENTION
[0002] Recombinant protein production constitutes an important
application of transgenic plants. In addition to the yield and the
favorable cost of the field production of recombinant proteins,
transgenic plants present certain advantages over other production
systems, such as bacteria, yeasts, and animal cells. Indeed, they
are devoid of agents infectious to humans, and can accumulate the
proteins of interest in storage tissues, such as seeds or tubers.
This facilitates their handling, their transportation and their
storage at ambient temperature, while affording the possibility of
subsequent extraction. Moreover, the transgenic plant, or some of
its parts, can be utilized as vector of medicaments or of
vaccines.
[0003] Although the advantages of plants as factories of
proteinaceous substances are explained mostly in the light of
biopharmaceuticals, plants are also useful for production of other
proteins, e.g., industrial enzymes and the like, because of their
capability of glycosylation leading e. g. to higher stability.
Today, the utilization of plants for the production of heterologous
glycoproteins for therapeutic and other use is investigated in soy,
tobacco, potato, rice and rapeseed, and the glycoproteins produced
therein include monoclonal antibodies, hormones, vaccine antigens,
enzymes and blood proteins. Some of these proteins have already
proven their efficacy in humans.
[0004] A drawback of glycoprotein production in plants relates to
the glycosylation pattern of the glycoproteins produced in plants.
Like other heterologous expression systems, plants exhibit a
different glycosylation profile compared to mammals. In contrast to
bacteria, having no N-linked glycans, and yeast, having only
N-linked glycans of the high mannose type, plants are able to
produce proteins with N-linked glycans of the complex type.
However, plant glycoproteins have complex N-linked glycans
containing .beta.1,2-xylose and .alpha.1,3-fucose residues not
found in mammals. Moreover, plant glycoproteins lack the
characteristic galactose-containing complex N-glycans found in
mammals.
[0005] In short, analyses of glycoproteins from plants have
indicated that, although similarities exist, several steps in the
glycosylation pathways of plants and mammals are different,
particularly in the synthesis of complex glycans. The complex
glycans of plants are generally much smaller and contain beta-1,2
xylose or alpha-1,3 fucose residues attached to the
Man.sub.3(GlcNAc).sub.2 core. Such residues on glycoprotein are
known to be immunogenic, which causes problems for certain
applications of recombinant proteins carrying these sugars.
SUMMARY OF THE INVENTION
[0006] Although some plant-based systems for the production of
glycoproteins have been proposed or are in use there is a need for
improved plant-based systems for the production of humanized
proteins. In certain embodiments, the present invention provides
such improved plant-based systems.
[0007] Previously proposed plant-based systems, such as described
in e.g., WO01/31045 (the entire contents is incorporated herein),
utilized mammalian .beta.1,4-galactosyltransferase for the
production of humanized proteins.
[0008] It has now been discovered that certain, previously
uncharacterized glycosyltransferases such as those derived from the
non-mammals, chicken and zebrafish, exhibiting homology to certain
parts of characterized mammalian .beta.1,4-galactosyltransferases,
show unexpected improvements over previous methods in the
production of humanized proteins.
[0009] According to one aspect of the invention, methods of
producing a transgenic plant or a transgenic plant cell which is
capable of adding galactose residues in .beta.-1,4-linkage to
N-linked glycans are provided. These methods comprise inserting a
nucleic acid molecule coding for a non-mammalian
.beta.-1,4-galactosyltransferase into a plant or a plant cell and
selecting a transgenic plant or transgenic plant cell that has
taken up the nucleic acid molecule coding for a non-mammalian
.beta.-1,4-galactosyltransferase and expresses the nucleic acid
molecule, thereby producing a transgenic plant or transgenic plant
cell capable of adding galactose residues in .beta.-1,4-linkage to
N-linked glycans. In certain embodiments the non-mammalian
.beta.-1,4-galactosyltransferase comprises either chicken or
zebrafish .beta.-1,4-galactosyltransferase 1. In certain
embodiments the chicken .beta.-1,4-galactosyltransferase 1
comprises SEQ ID NO:2, whereas the zebrafish
.beta.-1,4-galactosyltransferase 1 comprises SEQ ID NO:14. In some
embodiments the non-mammalian .beta.-1,4-galactosyltransferase of
chicken or zebrafish is extended with an amino acid sequence
capable of directing localisation of the non-mammalian
.beta.-1,4-galactosyltransferase in the Golgi apparatus. In some
embodiments the non-mammalian .beta.-1,4-galactosyltransferase is
extended at the N-terminus with an amino acid sequence
corresponding to the N-terminal amino acid sequence of a mammalian
.beta.1,4-galactosyltransferase 1. In certain embodiments the
N-terminal amino acid sequence comprises at least the sequence
[K/R]-X-[K/R] in the first 10 N-terminal amino acids, wherein [K/R]
represents either a lysine or arginine residue and X can be any
amino acid. In certain embodiments the N-terminal amino acid
sequence is MRLREPLLSGSAA (SEQ ID NO: 21). In some embodiments the
cytoplasmic-transmembrane-stem region (CTS) of the non-mammalian
.beta.-1,4-galactosyltransferase is replaced by the CTS of another
Golgi-localized protein. In some embodiments the CTS is derived
from a mammalian or plant Golgi-localized protein. In some
embodiments the CTS is derived from a mammalian sialyltransferase.
In certain embodiments the CTS is derived from rat
.alpha.2,6-sialyltransferase.
[0010] According to another aspect of the invention, methods of
producing a heterologous glycoprotein comprising one or more
galactosylated N-linked glycans are provided, comprising inserting
into a plant or plant cell a nucleic acid molecule encoding a
non-mammalian .beta.-1,4-galactosyltransferase and a nucleic acid
molecule encoding a heterologous glycoprotein, thereby producing a
transgenic plant or a transgenic plant cell and maintaining the
transgenic plant or a transgenic plant cell under conditions
appropriate for expression of the nucleic acid molecules, whereby a
heterologous glycoprotein comprising one or more galactosylated
N-linked glycans is produced.
[0011] In certain embodiments the non-mammalian
.beta.-1,4-galactosyltransferase is chicken
.beta.-1,4-galactosyltransferase or zebrafish
.beta.-1,4-galactosyltransferase. In certain embodiments the
chicken .beta.-1,4-galactosyltransferase or zebrafish
.beta.-1,4-galactosyltransferase is extended at the N-terminus with
an amino acid sequence corresponding to the N-terminal amino acid
sequence of a mammalian .beta.-1,4-galactosyltransferase 1. In
certain embodiments the CTS of the chicken
.beta.-1,4-galactosyltransferase or zebrafish
.beta.-1,4-galactosyltransferase is replaced by the CTS of another
Golgi-localized protein.
[0012] In certain embodiments the methods further comprise at least
partially isolating the heterologous glycoprotein from the
transgenic plant or transgenic plant cell. In certain embodiments
the glycoprotein comprises one or more galactose residues on one or
more N-glycans. In some embodiments the N-glycans of the
glycoprotein are essentially devoid of xylose, fucose, or both
xylose and fucose residues. In certain embodiments the nucleic acid
molecule encoding a heterologous glycoprotein encodes a hormone; a
cytokine, a vaccine; an adhesion molecule, or an antibody or a
functional fragment thereof.
[0013] In certain embodiments the plant or plant cell additionally
comprises a nucleic acid molecule encoding at least one selection
marker expressible in a plant or a plant cell. In certain
embodiments the plant or plant cell is or is derived from Nicotiana
ssp. In some embodiments the nucleic acid molecules are inserted
via microinjection, PEG transformation, Agrobacterium mediated
transformation, electroporation, ballistic particle bombardment,
direct gene transfer, liposome fusion, in planta transformation,
calcium phosphate precipitation, agrofiltration, or virus
infection.
[0014] According to another aspect of the invention, methods of
producing a transgenic plant or a transgenic plant cell which is
capable of adding galactose residues in .beta.-1,4-linkage to
N-linked glycans are provided, wherein the non-mammalian
.beta.-1,4-galactosyltransferase is encoded by a nucleic acid that
is at least 85% identical to chicken
.beta.1,4-galactosyltransferase nucleic acid sequence (SEQ ID NO:1)
or zebrafish .beta.1,4-galactosyltransferase nucleic acid sequence
(SEQ ID NO:13). In other embodiments the nucleic acid is at least
90%, 95%, or 98% identical to either chicken
.beta.1,4-galactosyltransferase nucleic acid sequence (SEQ ID NO:1)
or zebrafish .beta.1,4-galactosyltransferase nucleic acid sequence
(SEQ ID NO:13).
[0015] According to another aspect of the invention, methods of
producing a transgenic plant or a transgenic plant cell which is
capable of adding galactose residues in .beta.-1,4-linkage to
N-linked glycans are provided, wherein the amino acid sequence of
the enzymatically active domain of the non-mammalian
.beta.-1,4-galactosyltransferase is at least 85% identical to that
of the chicken .beta.1,4-galactosyltransferase amino acid sequence
(SEQ ID NO:2) or to that of zebrafish
.beta.1,4-galactosyltransferase amino acid sequence (SEQ ID NO:14).
In other embodiments the amino acid sequence of the enzymatically
active domain of the non-mammalian .beta.-1,4-galactosyltransferase
is at least 90%, 95%, or 98% identical to that of the chicken
.beta.1,4-galactosyltransferase amino acid sequence (SEQ ID NO:2)
or to that of zebrafish .beta.1,4-galactosyltransferase amino acid
sequence (SEQ ID NO:14). In certain embodiments the amino acid
sequence of non-mammalian .beta.-1,4-galactosyltransferase
additionally comprises a mammalian extension. In some embodiments
the mammalian extension is MRLREPLLSGSAA (SEQ ID NO:21). In certain
embodiments the CTS of non-mammalian
.beta.-1,4-galactosyltransferase is replaced with the CTS from
another Golgi-localized protein, and wherein the amino acid
sequence of the enzymatically active domain of non-mammalian
.beta.-1,4-galactosyltransferase is at least 85% identical to
chicken .beta.1,4-galactosyltransferase amino acid sequence (SEQ ID
NO:2) or to that of zebrafish .beta.1,4-galactosyltransferase amino
acid sequence (SEQ ID NO:14). In other embodiments the amino acid
sequence of the enzymatically active domain of non-mammalian
.beta.-1,4-galactosyltransferase is at least 90%, 95%, or 98%
identical to chicken .beta.1,4-galactosyltransferase amino acid
sequence (SEQ ID NO:2) or to that of zebrafish
.beta.1,4-galactosyltransferase amino acid sequence (SEQ ID NO:14).
In certain embodiments the CTS from another Golgi-localized protein
is the CTS from rat .alpha.2,6-sialyltransferase.
[0016] According to yet another aspect of the invention, methods of
producing a transgenic plant or a transgenic plant cell which is
capable of adding galactose residues in .beta.-1,4-linkage to
N-linked glycans are provided, wherein the plant or plant cell
produces a glycoprotein comprising hybrid-type N-linked glycans
lacking both .beta.1,2-xylose and .alpha.1,3-fucose residues. In
certain embodiments the amount of hybrid-type N-linked glycans
lacking both .beta.1,2-xylose and .alpha.1,3-fucose residues
produced is twice the amount produced by a plant cell or plant
expressing wild-type human .beta.1,4-galactosyltransferase. In
other embodiments the amount of hybrid-type N-linked glycans
lacking both .beta.1,2-xylose and .alpha.1,3-fucose residues
produced is five times, ten times, or fifty times the amount
produced by a plant cell or plant expressing wild-type human
.beta.1,4-galactosyltransferase. In certain embodiments the plant
or plant cell produces a glycoprotein comprising bi-antennary
N-glycans comprising at least one galactosylated GlcNAc residue. In
those embodiments the amount of bi-antennary N-glycans comprising
at least one galactosylated GlcNAc residue produced is two times,
five times, ten times, or fifty times the amount produced by a
plant cell or plant expressing wild-type human
.beta.1,4-galactosyltransferase.
[0017] According to yet another aspect of the invention,
glycoproteins produced according to the methods described herein
are provided.
[0018] According to another aspect of the invention, plants
produced according to the method described herein, or parts of such
plants, are provided. In certain embodiments the plant is a part of
a plant selected from the group consisting of seeds, embryos,
callus tissue, leaves, roots, shoots, pollen, and microspores.
[0019] According to another aspect of the invention, plant cells
produced according to the methods described herein are provided. In
certain embodiments the plant cells are grown in suspension
culture. In certain embodiments the plant cells grown in suspension
culture are selected from a group consisting of N. tabacum BY2,
Daucus carota and Arabidopsis thaliana cell suspension. In certain
embodiments the plant cells are part of a moss selected from a
group consisting of Bryophytaea, Physcomitrella patens, Funaria
hygrometrica, and Ceratodon purpureus.
[0020] According to another aspect of the invention, nucleic acids
are provided, encoding a polypeptide comprising the amino acid
sequence of chicken .beta.-1,4-galactosyltransferase 1 (SEQ ID
NO:2) or zebrafish .beta.-1,4-galactosyltransferase 1 (SEQ ID
NO:14) and an extension at the N-terminus thereof, wherein the
extension is an amino acid sequence corresponding to the N-terminal
amino acid sequence of a mammalian .beta.1,4-galactosyltransferase
1, wherein the N-terminal amino acid sequence comprises at least
the sequence [K/R]-X-[K/R] in the first 10 N-terminal amino acids,
wherein [K/R] represents either a lysine or arginine residue and X
can be any amino acid. In certain embodiments the amino acid
sequence is MRLREPLLSGSAA (SEQ ID NO: 21). In certain embodiments
the amino acid sequence comprises SEQ ID NO: 8 or SEQ ID NO:15. In
certain embodiments the nucleic acid encoding a polypeptide
comprising the amino acid sequence of chicken
.beta.-1,4-galactosyltransferase 1 (SEQ ID NO:2) or zebrafish
.beta.-1,4-galactosyltransferase 1 (SEQ ID NO:14), wherein the CTS
of the chicken .beta.-1,4-galactosyltransferase or zebrafish
.beta.-1,4-galactosyltransferase is replaced by the CTS of another
Golgi-localized protein. In certain embodiments the CTS is derived
from a mammalian or plant Golgi-localized protein. In certain
embodiments the CTS is derived from a mammalian sialyltransferase.
In certain embodiments the CTS is derived from rat
.alpha.2,6-sialyltransferase. In certain embodiments the amino acid
sequence comprises SEQ ID NO: 11 or SEQ ID NO:18.
[0021] According to yet another aspect of the invention, nucleic
acids are provided, encoding a polypeptide comprising an amino acid
sequence of a non-mammalian .beta.-1,4-galactosyltransferase,
wherein the amino acid sequence of the enzymatically active domain
of the non-mammalian .beta.-1,4-galactosyltransferase is at least
90% identical to that of the chicken
.beta.-1,4-galactosyltransferase 1 (SEQ ID NO:2) or zebrafish
.beta.-1,4-galactosyltransferase 1 (SEQ ID NO:14) and an extension
at the N-terminus thereof, wherein the extension is an amino acid
sequence corresponding to the N-terminal amino acid sequence of a
mammalian .beta.1,4-galactosyltransferase 1, wherein the N-terminal
amino acid sequence comprises at least the sequence [K/R]-X-[K/R]
in the first 10 N-terminal amino acids, wherein [K/R] represents
either a lysine or arginine residue and X can be any amino acid. In
other embodiments the sequence identity is at least 95% or 98%.
[0022] According to yet another aspect of the invention, expression
vectors comprising nucleic acid molecules described herein are
provided. In some embodiments the nucleic acid molecules are linked
to regulatory elements sufficient for transcription of the nucleic
acid molecule in eukaryotic or prokaryotic cells.
[0023] According to another aspect of the invention, host cells are
provided comprising nucleic acid molecules described herein which
are linked to heterologous regulatory elements sufficient for
transcription in plant cells or comprising vectors described
herein.
LEGENDS TO THE DRAWINGS
[0024] FIG. 1 depicts sequence alignments (Clustal W) of
.beta.1,4-galactosyltransferases of various mammalian (human,
mouse, bovine) and non-mammalian (chicken, zebrafish, frog)
origins. "Mammalian extension" is an amino-terminal region specific
to mammals not found in non-mammalian orthologs of
.beta.1,4-galactosyltransferase (boxed, solid lines). "TM" marks
the transmembrane region (boxed, dashed lines).
[0025] FIG. 2 depicts results from Maldi-TOF analyses of N-glycans
purified from transgenic plants expressing the chicken gene. From
top to bottom, normal chicken gene (chicken GalT), 13 amino acid
N-terminus human GalT-chicken GalT, and SialT-CTS-chicken GalT.
[0026] FIG. 3 depicts results from Maldi-TOF analyses of N-glycans
purified from transgenic plants expressing zebrafish GalT gene
sequences. From top to bottom, normal zebrafish gene (zebrafish
GalT, 2 plants), 13 amino acid N-terminus human GalT-zebrafish
GalT, and SialT-CTS-zebrafish GalT.
[0027] FIG. 4 depicts bar graphs summarizing results from human,
zebrafish and chicken GalTs with respect to bi-antennary "wildtype"
plant N-glycan (GlcNAc2-Man3-Xyl-Fuc-GlcNAc2-Asn), hybrid type
N-glycans with one galactose (and lacking xylose and fucose) and
bi-antennary with two galactoses (from top to bottom).
[0028] FIG. 5 depicts an amino acid sequence comparison of Dgal
(SEQ Dgal, SEQ ID NO:14) with putative zebrafish .beta.1,4-GalT1 as
published (Machingo et al., Dev Biol 297, 471-82, 2006;
NM.sub.--001017730).
DETAILED DESCRIPTION OF THE INVENTION
[0029] The Golgi apparatus is an organelle where complex glycan
formation takes place and is the site of the glycosylation
machinery. The key mediators of glycosylation are the
glycosyltransferases. One of the best studied Golgi-associated
glycosyltransferase is .beta.1,4-galactosyltransferase 1 (GalT).
.beta.1,4-galactosyltransferase 1 consists of a cytosolic tail, a
transmembrane domain (TMD) and a catalytic domain. Numerous genes
of glycosyl transferases of mammals have already been cloned. The
ease of transformation of plant systems, allowed researchers to
"complement" the Golgi apparatus of plants by glycosyltransferases
from mammals in order to "humanize" or "mammalize" the glycans of
the glycoproteins they produce.
[0030] The use of non-mammalian .beta.1,4-galactosyltransferases
(GalT) has hitherto not been reported for the production of
mammalized or humanized glycoproteins in plants.
[0031] It has now been discovered that certain, previously
uncharacterized non-mammalian .beta.1,4-galactosyltransferases,
such as those derived from chicken and zebrafish, can be utilized
for terminal galactosylation of N-linked glycoproteins in plants,
and that these non-mammalian .beta.1,4-galactosyltransferases show
unexpected improvements over previous methods in the production of
humanized proteins. For example chicken
.beta.1,4-galactosyltransferase produces mostly hybrid-type
N-linked glycans lacking both .beta.1,2-xylose and
.alpha.1,3-fucose residues.
[0032] It was further found that non-mammalian
.beta.1,4-galactosyltransferases from chicken and zebrafish are
shorter than mammalian .beta.-1,4-galatosyltransferases and lack an
amino-terminal region present in mammalian
.beta.1,4-galactosyltransferases. These non-mammalian
.beta.-1,4-galatosyltransferases can be extended at the
amino-terminus with an amino acid sequence corresponding to the
amino-terminus of a mammalian .beta.1,4-galactosyltransferase, the
"mammalian extension." These modified versions of the non-mammalian
.beta.1,4-galactosyltransferases produce certain N-linked glycans
to a higher degree compared to human
.beta.1,4-galactosyltransferase. For example, zebrafish GalT having
substituted its amino-terminal for the CTS region of rat
sialyltransferase, produces mainly biantennary, double
galactosylated N-glycans.
[0033] The invention, in some embodiments, provides unmodified or
modified non-mammalian GalTs from chicken and fish that are used to
produce mammalized glycoproteins in plants. Mammalized
glycoproteins produced in plants or plant cells expressing such
non-mammalian .beta.1,4-galactosyltransferases are also provided in
certain embodiments.
[0034] Definitions
[0035] The term "nucleic acid" as used herein, includes reference
to a deoxyribonucleotide or ribonucleotide polymer, i.e., a
polynucleotide, in either single-or double-stranded form, and
unless otherwise limited, encompasses known analogues having the
essential nature of natural nucleotides in that they hybridize to
single-stranded nucleic acids in a manner similar to naturally
occurring nucleotides (e. g., peptide nucleic acids). A
polynucleotide can be full-length or a subsequence of a native or
heterologous structural or regulatory gene. Unless otherwise
indicated, the term includes reference to the specified sequence as
well as the complementary sequence thereof. Thus, DNAs or RNAs with
backbones modified for stability or for other reasons are
"polynucleotides" as that term is intended herein. Moreover, DNAs
or RNAs comprising unusual bases, such as inosine, or modified
bases, such as tritylated bases, to name just two examples, are
polynucleotides as the term is used herein. It will be appreciated
that a great variety of modifications have been made to DNA and RNA
that serve many useful purposes known to those of skill in the art.
The term polynucleotide as it is employed herein embraces such
chemically, enzymatically or metabolically modified forms of
polynucleotides, as well as the chemical forms of DNA and RNA
characteristic of viruses and cells, including among other things,
simple and complex cells.
[0036] "Nucleic acid molecules coding for" or "nucleic acid
molecules encoding" as used herein are not limited to individual or
separate molecules, for example nucleic acid molecules as separate
entities, wherein each entity comprises one nucleic acid molecules,
it also encompasses that one or more nucleic acid molecules may be
linked in one contiguous sequence, which may be separated by any
intervening sequence. The order and orientation of the nucleic acid
molecules in one contiguous sequence is not limited to any specific
configuration, e.g. the nucleic acid molecules may be linked to the
same promoter, or a different promoter, may be mono- or
bidirectional, and may be directly adjacent or separated by
intervening sequence. Various such configurations are known in the
art. Additional nucleic acid molecules may be combined in one
contiguous sequence, or may be provided as separate entities. For
example, in certain embodiments plants or plant cells are provided
comprising nucleic acid molecules comprising a non-mammalian
.beta.-1,4-galactosyltransferase, a heterologous glycoprotein and
one or more selection markers. These nucleic acid molecules may be
provided in the form of one, two, three, or more vectors, as
described herein.
[0037] The terms "polypeptide," "peptide" and "protein" are used
interchangeably herein to refer to a polymer of amino acid
residues. The terms apply to amino acid polymers in which one or
more amino acid residue is an artificial chemical analogue of a
corresponding naturally occurring amino acid, as well as to
naturally occurring amino acid polymers. The essential nature of
such analogues of naturally occurring amino acids is that, when
incorporated into a protein, that protein is specifically reactive
to antibodies elicited to the same protein but consisting entirely
of naturally occurring amino acids. The terms "polypeptide,"
"peptide" and "protein" are also inclusive of modifications
including, but not limited to, glycosylation, lipid attachment,
sulfation, gamma-carboxylation of glutamic acid residues,
hydroxylation and ADP-ribosylation.
[0038] A "coding" or "encoding" sequence is the part of a gene that
codes for the amino acid sequence of a protein, or for a functional
RNA such as a tRNA or rRNA and specifically refers to the fact that
the nucleic acid sequence comprises the information for translation
into the specified protein. A nucleic acid encoding a protein may
comprise non-translated sequences (e. g., introns) within
translated regions of the nucleic acid, or may lack such
intervening non-translated sequences (e. g., as in cDNA). The
information by which a protein is encoded is specified by the use
of codons. Typically, the amino acid sequence is encoded by the
nucleic acid using the "universal" genetic code. However, variants
of the universal code, such as are present in some plant, animal,
and fungal mitochondria, the bacterium Mycoplasma capricolum, or
the ciliate Macronucleus, may be used when the nucleic acid is
expressed therein. When the nucleic acid is prepared or altered
synthetically, advantage can be taken of known codon preferences of
the intended host where the nucleic acid is to be expressed. For
example, although nucleic acid sequences of the present invention
may be expressed in both monocotyledonous and dicotyledonous plant
species, sequences can be modified to account for the specific
codon preferences and GC content preferences of monocotyledons or
dicotyledons as these preferences have been shown to differ.
[0039] "Expression" refers to the transcription of a gene into
structural RNA (rRNA, tRNA) or messenger RNA (mRNA) with subsequent
translation into a protein.
[0040] The term "non-mammalian" in relation to a protein or nucleic
acid refers to such compounds derived from a non-mammal, including,
e.g., a non-mammalian vertebrate, such as a bird (e.g., a chicken
or duck) or a fish, and a non-mammalian invertebrate. Very suitable
sources of non-mammalian .beta.-1,4-galactosyltransferases (and
coding sequences) are chicken and fish.
[0041] The term "mammalian" in relation to a protein or nucleic
acid refers to such compounds derived from a mammal, e.g., a human,
a non-human primate, a mouse, pig, cow, goat, cat, rabbit, rat,
guinea pig, hamster, horse, monkey, sheep, wallaby, platypus or
other non-human mammal.
[0042] The term ".beta.-1,4-galactosyltransferase," refers to the
glycosyltransferase EC 2.4.1.38 (.beta.-1,4-GalT1) that is required
for the biosynthesis of the backbone structure from type 2 chain
(Gal.beta.1.fwdarw.4GlcNAc), which appears widely on N-linked
glycans, i.e., which enzyme has galactosylating activity on i.a.
N-linked glycans. The type 2 chain is particularly important in the
synthesis of sialyl lewis x and SSEA-1, which play a role in the
immune system and early embryogenesis, respectively. Mammalian
.beta.-1,4-galactosyltransferase are provided herein (e.g., from
human, mouse, rat), as well as orthologs of
.beta.-1,4-galactosyltransferase from non-mammalian species, such
as chicken and fish.
[0043] The term "sequence identity" as used herein denotes the
presence of identity between two or more polynucleotides or between
two or more polypeptides. Polynucleotides or polypeptides have
"identical" sequences if the sequence of nucleotides or amino
acids, respectively, of one polynucleotide or polypeptide is the
same when aligned for maximum correspondence to another
polynucleotide or polypeptide. Sequence comparison between two or
more polynucleotides or polypeptides is generally performed by
comparing portions of two sequences over a comparison window to
identify and compare local regions of sequence similarity. The
comparison window is generally from about 20 to 200 contiguous
nucleotides or from about 7 to 70 contiguous amino acids. The
"percentage of sequence identity" for polynucleotides or
polypeptides, such as 50, 60, 70, 80, 90, 95, 98, 99 or 100 percent
sequence identity may be determined by comparing two optimally
aligned sequences over a comparison window, wherein the portion of
the polynucleotide or polypetide sequence in the comparison window
may include additions or deletions (i.e., gaps) as compared to the
reference sequence (which does not comprise additions or deletions)
for optimal alignment of the two sequences. The percentage is
calculated by: (a) determining the number of positions at which the
identical nucleic acid base or amino acid residue occurs in both
sequences to yield the number of matched positions; (b) dividing
the number of matched positions by the total number of positions in
the window of comparison; and (c) multiplying the result by 100 to
yield the percentage of sequence homology. Optimal alignment of
sequences for comparison may be conducted by computerized
implementations of known algorithms, or by inspection. Algorithms
and software suitable for use in aligning sequences for comparison
and calculation of sequence homology or identity will be known to
those skilled in the art. Significant examples of such tools are
the Pearson and Lipman search based FASTA and BLAST programs,
details of these may be found in Altschul et al (1997), Nucleic
Acid Res. 25:3389-3402; Altschul et al (1990), J. Mol. Biol. 215:
403-10; Pearson and Lipman (1988), Proc. Natl. Acad. Sci. USA
85:2444-8; Lipman and Pearson (1985), Science 227:1435-41). Other
suitable programs include the PILEUP, LINEUP, GAP, BESTFIT and
FASTA programs in the GCG.RTM. Wisconsin Package.RTM. of the
University of Wisconsin Genetics Computer Group, Madison, Wis.,
USA, now offered through Accelrys Inc. Details of the above
programs are available on the internet through
"http://www.ncbi.nlm.nih.gov/BLAST` or mirror sites and
"http://www.accelrys.com/products/gcg_wisconsin_package." Thus such
homology and identity percentages can be ascertained using publicly
or commercially available software packages or by computer servers
on the internet. By the term "identity" is meant that the stated
percentage of the claimed amino acid sequence or nucleic acid
sequence is to be found in the reference sequence in the same
relative positions when the sequences are optimally aligned,
notwithstanding the fact that the sequences may have deletions or
additions in certain positions requiring introduction of gaps to
allow alignment of the highest percentage of amino acids or bases.
Preferably the sequence are aligned by using 10 or less gaps, i.e.,
the total number of gaps introduced into the two sequences when
added together is 10 or less. The length of such gaps is not of
particular importance but generally will be no more than 10, and
preferably no more than 5 amino acids, or 30 and preferably no more
than 15 bases.
[0044] The term "degeneracy of the genetic code" refers to the fact
that a large number of functionally identical nucleic acids encode
any given protein. For instance, the codons GCA, GCC, GCG and GCU
all encode the amino acid alanine. Thus, at every position where an
alanine is specified by a codon, the codon can be altered to any of
the corresponding codons described without altering the encoded
polypeptide. Such nucleic acid variations are "silent variations."
Every nucleic acid sequence herein that encodes a polypeptide also,
by reference to the genetic code, describes every possible silent
variation of the nucleic acid.
[0045] The term "complementary" in "complementary strand" means
that the nucleic acid strand has a sequence of nucleotides which
forms a hydrogen-bonded duplex with another sequence of nucleotides
according to Watson-Crick base-paring rules. For example, the
complementary base sequence for 5'-AAGGCT-3' is 3'-TTCCGA-5'.
[0046] The term "galactosylated N-linked glycan" refers to the
common core of an N-linked oligosaccharide unit in glycoproteins
that consists of a chitobiose core with at least three mannoses and
at least one N-acetylglucosamine residue and that is further
extended with at least one galactose residue on a
N-acetylglucosamine at the nonreducing end.
[0047] The term "antibody" includes reference to antigen binding
forms of antibodies (e.g., Fab, F(ab)2). The term "antibody"
frequently refers to a polypeptide substantially encoded by an
immunoglobulin gene or immunoglobulin genes, or fragments thereof
which specifically bind and recognize an analyte (antigen).
However, while various antibody fragments can be defined in terms
of the digestion of an intact antibody, one of skill will
appreciate that such fragments may be synthesized de novo either
chemically or by utilizing recombinant DNA methodology. Thus, the
term antibody, as used herein, also includes antibody fragments
such as single chain Fv, chimeric antibodies (i.e., comprising
constant and variable regions from different species), humanized
antibodies (i.e., comprising a complementarity determining region
(CDR) from a non-human source) and heteroconjugate antibodies (e.
g., bispecific antibodies).
[0048] The term "antibody heavy or light chain" are used in their
art-recognized meaning. The term "functional fragment" refers to a
shortened version of the protein which is a functional variant or
functional derivative. A "functional variant" or a "functional
derivative" of a protein is a protein the amino acid sequence of
which can be derived from the amino acid sequence of the original
protein by the substitution, deletion and/or addition of one or
more amino acid residues in a way that, in spite of the change in
the amino acid sequence, the functional variant retains at least a
part of at least one of the biological activities of the original
protein that is detectable for a person skilled in the art. A
functional variant is generally at least 50% homologous (preferably
the amino acid sequence is at least 50% identical), at least 70%
homologous or at least 90% homologous to the protein from which it
can be derived. A functional variant may also be any functional
part of a protein. In certain embodiments, the function is
galactosyltransferase activity. In some embodiments the amino acid
sequence differs from SEQ ID NO:2 (the protein sequence of chicken
galactosyltransferase) or SEQ ID NO:14 (the protein sequence of
zebrafish galactosyltransferase) mainly or only by conservative
substitutions. In some embodiments the protein comprises an amino
acid sequence having 65% or more, 75% or more, 85% or more, 90% or
more, or 95% or more, sequence identity with SEQ ID NO:2 or SEQ ID
NO: 14 and in certain embodiments 100% identity with those
sequences. "Functional" as used herein also includes functional in
plants.
[0049] The expression "conservative substitutions" as used with
respect to amino acids relates to the substitution of a given amino
acid by an amino acid having similar biochemical characteristics.
Thus, in some embodiments, where an amino acid in the sequence of
SEQ ID NO:2 or SEQ ID NO: 14 has a hydrophobic group, a
conservative substitution replaces it by another amino acid also
having a hydrophobic group; other such biochemical similarities are
those where the characteristic group is hydrophilic, cationic,
anionic or contains a thiol or thioether. Such substitutions are
well known to those of ordinary skill in the art, i.e. see U.S.
Pat. No. 5,380,712. Conservative amino acid substitutions may be
made, for example within the group of aliphatic non-polar amino
acids (Gly, Ala, Pro, Ile, Leu, Val), the group of polar uncharged
amino acids (Cys, Ser, Thr, Met, Asn, Gln), the group of polar
charged amino acids (Asp, Glu, Lys, Arg) or the group of aromatic
amino acids (His, Phe, Tyr, Trp).
[0050] The term "selection marker" refers to a polynucleotide
sequence encoding a metabolic trait which allows for the separation
of transgenic and non-transgenic organisms and may refer to the
provision of antibiotic resistance. A selectable marker is for
example the aphLl encoded kanamycin resistance marker, the nptll
gene, the gene coding for hygromycin resistance. Other resistance
markers are well known in the art. Other selection markers are for
instance reporter genes such as chloramphenicol acetyl transferase,
.beta.-galactosidase, luciferase and green fluorescence protein.
Identification methods for the products of reporter genes include,
but are not limited to, enzymatic assays and fluorimetric assays.
Reporter genes and assays to detect their products are well known
in the art and are described, for example in Current Protocols in
Molecular Biology, eds. Ausubel et al., Greene Publishing and
Wiley-Interscience: New York (1987) and periodic updates.
[0051] As used herein, the term "vector" includes reference to a
nucleic acid used in transfection of a host cell and into which can
be inserted a polynucleotide. Vectors are often replicons.
Expression vectors permit transcription of a nucleic acid inserted
therein.
[0052] As used herein, the term "operably linked" refers to a
functional linkage or juxtaposition wherein the components so
described are in a relationship permitting them to function in
their intended manner. A control sequence "operably linked" to
another control sequence and/or to a coding sequence is ligated in
such a way that transcription and/or expression of the coding
sequence is achieved under conditions compatible with the control
sequence. Generally, operably linked means that the nucleic acid
sequences being linked are contiguous and, where necessary to join
two protein coding regions, contiguous and in the same reading
frame.
[0053] By "host cell" is meant a cell which contains a vector and
supports the replication and/or expression of the vector. Host
cells may be prokaryotic cells such as E. coli, or eukaryotic cells
such as plant, yeast, insect, amphibian, or mammalian cells.
[0054] As used herein, "heterologous" in reference to a nucleic
acid is a nucleic acid that originates from a foreign species, or,
if from the same species, is modified from its native form in
composition and/or genomic locus by intervention. For example, a
promoter operably linked to a heterologous structural gene is from
a species different from that from which the structural gene was
derived, or, if from the same species, one or both are modified
from their original form. A heterologous protein may originate from
a foreign species or, if from the same species, is modified from
its original form by intervention.
[0055] The term "regulatory sequence" or "control sequence" is
defined herein to include any component which is necessary or
advantageous for expression of a coding sequence. A regulatory
sequence may be native or foreign to the coding sequence. Such
regulatory sequences include, but are not limited to, a leader, a
polyadenylation sequence, a propeptide sequence, a promoter, a
signal sequence, and a transcription terminator. Such sequences are
well known in the art. At a minimum, the regulatory sequences
include a promoter, or certain promoter elements and
transcriptional and translational stop signals. The regulatory
sequences may be provided with linkers for the purpose of
introducing specific restriction sites facilitating ligation of the
regulatory sequences with the coding region of the nucleic acid
sequence encoding a polypeptide.
[0056] The term "promoter" is used herein for its art-recognized
meaning to denote a portion of a gene containing DNA sequences that
provide for the binding of RNA polymerase and initiation of
transcription. Promoter sequences are commonly, but not always,
found in the 5' non-coding regions of genes. A "plant promoter" is
a promoter capable of initiating transcription in plant cells
whether or not its origin is a plant cell. Exemplary plant
promoters include, but are not limited to, those that are obtained
from plants, plant viruses, and bacteria which comprise genes
expressed in plant cells such as Agrobacterium or Rhizobium.
Examples of suitable promoters are the 35S promoter of Cauliflauwer
mosaic virus and derivatives thereof, the ferredoxin promoter, the
nopaline synthase (nos), mannopine synthase (mas) and octopine
synthase (ocs) promoters (EP 0 122 791, EP 0 126 546, EP 0 145
338), the ubiquitin promoter (EP 0 342 926), the cassava vein
mosaic virus promoter and the chrysanthemum promoter for the short
subunit of Rubisco.
[0057] The term "transgenic plant or plant cell" includes reference
to a plant or plant cell which comprises within its genome a
heterologous polynucleotide. Generally, the heterologous
polynucleotide is stably integrated within the genome such that the
polynucleotide is passed on to successive generations. The
heterologous polynucleotide may be integrated into the genome alone
or as part of a recombinant expression cassette. Also, it is
possible that the heterologous polynucleotide is not or not stably
integrated in the genome of the transformed plant. In that case,
the gene can be `transiently` expressed, implying that expression
occurs for a given time, after which the introduced polynucleotide
is lost from the cell. For the purposes of this invention, a
transgenic plant or plant cell also includes plants or plant cells
which transiently express the heterologous polypeptide.
"Transgenic" is used herein to include any cell, cell line, callus,
tissue, plant part or plant, the genotype of which has been altered
by the presence of heterologous nucleic acid including those
transgenics initially so altered as well as those created by sexual
crosses or asexual propagation from the initial transgenic. The
term "transgenic" as used herein does not encompass the alteration
of the genome (chromosomal or extra-chromosomal) by conventional
plant breeding methods or by naturally occurring events such as
random cross-fertilization, non-recombinant viral infection,
non-recombinant bacterial transformation, non-recombinant
transposition, or spontaneous mutation.
[0058] The term "insertion" in the context of introducing a nucleic
acid into a cell, means "transfection" or "transformation" or
"transduction" and includes reference to the incorporation of a
nucleic acid into a eukaryotic or prokaryotic cell where the
nucleic acid may be incorporated into the genome of the cell (e.g.,
chromosome, plasmid, plastid or mitochondrial DNA), converted into
an autonomous replicon, or transiently expressed (e.g., transfected
mRNA).
[0059] As used herein, the term "plant" includes (reference to)
whole plants, plant organs (e.g., leaves, stems, roots, etc.),
seeds and plant cells and progeny of same. Plant cell(s), as used
herein includes, without limitation, seeds, embryos, meristematic
regions, callus tissue, leaves, roots, shoots, gametophytes,
sporophytes, pollen, and microspores. In some embodiments plant
cells are grown in suspension culture. In some embodiments plant
cells are capable of regenerating a whole plant. The class of
plants which can be used in the methods of the invention is
generally as broad as the class of higher plants amenable to
transformation techniques, including both monocotyledonous and
dicotyledonous plants. As used herein when referring to plants the
whole spectrum of plants ranging from algae to trees is intended
unless otherwise specified. Preferred plants are Nicotiana ssp.,
preferably N. tabacum or N. benthamiana.
[0060] The term "specifically recognizing", includes reference to a
binding reaction between an antibody and a protein having an
epitope recognized by the antigen binding site of the antibody.
This binding reaction is determinative of the presence of a protein
having the recognized epitope amongst the presence of a
heterogeneous population of proteins and other biologics. Thus,
under designated immunoassay conditions, the specified antibodies
bind to an analyte having the recognized epitope to a substantially
greater degree (e.g., at least 2-fold over background) than to
substantially all analytes lacking the epitope which are present in
the sample. Specific binding to an antibody under such conditions
may require an antibody that is selected for its specificity for a
particular protein. For example, antibodies raised to the
polypeptides described herein, e.g., SEQ ID NOS. 2, 4, 7, 9, 11,
14, 16, 18 and 20 can be selected to obtain antibodies specifically
recognizing these polypeptides. The proteins or polypeptides used
as immunogens can be in native conformation or denatured so as to
provide a linear epitope. A variety of immunoassay formats may be
used to select antibodies specifically recognizing a particular
protein (or other analyte). For example, solid-phase ELISA
immunoassays are routinely used to select monoclonal antibodies
specifically immunoreactive with a protein. See Harlow and Lane,
Antibodies, A Laboratory Manual, Cold Spring Harbor Publications,
New York (1988), for a description of immunoassay formats and
conditions that can be used to determine selective reactivity.
Nucleic Acid Molecules and Cellular Expression Systems
[0061] Although a nucleic acid molecule encoding a polypeptide
described herein can be expressed in any cellular expression
system, such as plants, yeast, bacteria, non-mammalian and
mammalian cellular expression systems, the nucleic acid molecules
are preferably expressed in plants or plant cells, which may be
grown in suspension.
[0062] In some embodiments, the present invention provides plants
or plant cells comprising functional proteins providing N-glycan
biosynthesis, wherein the protein is a non-mammalian
.beta.-1,4-galactosyltransferase, e.g., from chicken or fish
origin. In other embodiments, said non-mammalian
.beta.-1,4-galactosyltransferases are extended at the N-terminus
with an N-terminal extension sequence facilitating localization
with respect to the Golgi-apparatus to enable the intended function
of the enzyme. The N-terminal extension sequence generally consists
of a cytosolic tail comprising a Golgi-localization signal sequence
and a transmembrane domain. Such an N-terminal sequence (designated
as "CTS") can be derived from a mammalian
.beta.-1,4-galactosyltransferase, from a mammalian
sialyltransferase or from any other Golgi-localized protein and
fused to the catalytic domain of a non-mammalian GalT, e.g., from
chicken or fish origin, and expressed in plant cells or plants.
[0063] The N-terminal cytoplasmic, transmembrane region (referred
to as CTS region herein) of glycosyltransferases determines the
localisation of the enzyme in the ER or Golgi membrane. To provide
natural or desirable glycosylation, glycosyltransferases can be
expressed in plants as they occur in mammals, but can also be
expressed as a fusion protein between two, or part of two,
different glycosyltransferases. In this case the localisation is
determined by one enzyme and the catalytic activity by a second
enzyme. As an example, a fusion between the cytoplasmic,
transmembrane and stem region of a rat sialyltransferase and the
catalytic domain of mammalian galactosyltransferase, such as
provided, for example, in SEQ ID NO: 10 and SEQ ID NO: 17, provides
an enzyme with galactosyltransferase activity and localisation of
the sialyltransferase.
[0064] The usable N-terminal extensions of mammalian GalT enzymes
are characterised in that they have a length of about 10-20 amino
acids and that they contain the motif [K/R]-X-[K/R] (in which K/R
means either a lysine or an arginine residue and X can be any amino
acid) in the first 10 amino-terminal amino acids of the cytosolic
tail sequence.
[0065] In certain embodiments, the N-terminal amino acid sequence
extension comprises the first 13 amino acid residues of the human
.beta.-1,4-galactosyltransferase polypeptide 1 sequence, i.e.,
MRLREPLLSGSAA (SEQ ID NO:21), see FIG. 1. In other embodiments, the
CTS of the non-mammalian GalT is replaced with the CTS from another
Golgi-localized protein; the replacement could for example be
derived from the CTS from the rat .alpha.2,6-sialyltransferase
(Genbank accession M18769).
[0066] In certain embodiments the plant cells or plants express a
functional non-mammalian .beta.1,4-galactosyltransferase that is at
least 85% identical to chicken .beta.1,4-galactosyltransferase
nucleic acid sequence (SEQ ID NO:1). In other embodiments the
functional non-mammalian .beta.1,4-galactosyltransferase is 90%,
91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to chicken
.beta.1,4-galactosyltransferase nucleic acid sequence (SEQ ID
NO:1).
[0067] In certain embodiments nucleic acids and vectors thereof are
provided that are 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
or 99% identical to chicken .beta.1,4-galactosyltransferase nucleic
acid sequence (SEQ ID NO:1).
[0068] In certain embodiments the plant cells or plants express a
functional non-mammalian .beta.1,4-galactosyltransferase that is at
least 65% identical to chicken .beta.1,4-galactosyltransferase
amino acid sequence (SEQ ID NO:2). In other embodiments the
functional non-mammalian .beta.1,4-galactosyltransferase is 75%,
85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical
to chicken .beta.1,4-galactosyltransferase amino acid sequence (SEQ
ID NO:2).
[0069] In certain embodiments the plant cells or plants express a
functional non-mammalian .beta.1,4-galactosyltransferase that is at
least 65% identical to chicken .beta.1,4-galactosyltransferase
amino acid sequence (SEQ ID NO:2) and comprises a modified
N-terminus comprising a mammalian extension. The mammalian
extension may comprise, for example, the first 13 amino acid
residues of the human .beta.-1,4-galactosyltransferase polypeptide
1 sequence, i.e., MRLREPLLSGSAA (SEQ ID NO:21), or the CTS of the
non-mammalian GalT is replaced with the CTS from another
Golgi-localized protein; the replacement could for example be
derived from the CTS from the rat .alpha.2,6-sialyltransferase
(Genbank accession M18769). In other embodiments the functional
non-mammalian .beta.1,4-galactosyltransferase comprising the
mammalian extension is 75%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97%, 98%, or 99% identical to chicken
.beta.1,4-galactosyltransferase amino acid sequence (SEQ ID
NO:2).
[0070] In certain embodiments nucleic acids and vectors thereof are
provided comprising a mammalian extension or altered CTS region as
described above, that are 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97%, 98%, or 99% identical to chicken .beta.1,4-galactosyltransfer
nucleic acid sequence (SEQ ID NO:1) with regards to the chicken
.beta.1,4-galactosyltransferase nucleic acid sequence only; that is
sequence identity is not established over the mammalian extension
or altered CTS region.
[0071] In certain embodiments the plant cells or plants express a
functional non-mammalian .beta.1,4-galactosyltransferase that is at
least 85% identical to zebrafish .beta.1,4-galactosyltransferase
nucleic acid sequence (SEQ ID NO:13). In other embodiments the
functional non-mammalian .beta.1,4-galactosyltransferase is 90%,
91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to
zebrafish .beta.1,4-galactosyltransferase nucleic acid sequence
(SEQ ID NO:13).
[0072] In certain embodiments nucleic acids and vectors thereof are
provided that are 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
or 99% identical to zebrafish .beta.1,4-galactosyltransferase
nucleic acid sequence (SEQ ID NO:13).
[0073] In certain embodiments the plant cells or plants express a
functional non-mammalian .beta.1,4-galactosyltransferase that is at
least 65% identical to zebrafish .beta.1,4-galactosyltransferase
amino acid sequence (SEQ ID NO:14). In other embodiments the
functional non-mammalian .beta.1,4-galactosyltransferase is 75%,
85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical
to zebrafish .beta.1,4-galactosyltransferase amino acid sequence
(SEQ ID NO:14).
[0074] In certain embodiments the plant cells or plants express a
non-mammalian .beta.1,4-galactosyltransferase that is at least 65%
identical to zebrafish .beta.1,4-galactosyltransferase amino acid
sequence (SEQ ID NO:14) and comprises a modified N-terminus
comprising a mammalian extension. In other embodiments the
functional non-mammalian .beta.1,4-galactosyltransferase comprising
the mammalian extension is 75%, 85%, 90%, 91%, 92%, 93%, 94%, 95%,
96%, 97%, 98%, or 99% identical to zebrafish
.beta.1,4-galactosyltransferase amino acid sequence (SEQ ID
NO:14).
[0075] In certain embodiments the plant cells or plants express a
non-mammalian .beta.1,4-galactosyltransferase that is at least 65%
identical to zebrafish .beta.1,4-galactosyltransferase amino acid
sequence (SEQ ID NO:14), wherein the CTS of the zebrafish
.beta.1,4-galactosyltransferase is replaced with the CTS from
another Golgi-localized protein. In other embodiments the
functional non-mammalian .beta.1,4-galactosyltransferase comprising
the mammalian extension is 75%, 85%, 90%, 91%, 92%, 93%, 94%, 95%,
96%, 97%, 98%, or 99% identical to zebrafish
.beta.1,4-galactosyltransferase amino acid sequence (SEQ ID
NO:14).
[0076] In certain embodiments nucleic acids and vectors thereof are
provided comprising a mammalian extension or altered CTS region as
described above, that are 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97%, 98%, or 99% identical to zebrafish
.beta.1,4-galactosyltransferase nucleic acid sequence (SEQ ID
NO:13) with regards to the zebrafish
.beta.1,4-galactosyltransferase nucleic acid sequence only; that is
sequence identity is not established over the mammalian extension
or altered CTS region.
[0077] In some embodiments the non-mammalian
.beta.-1,4-galactosyltransferase is chicken or fish
.beta.-1,4-galactosyltransferase, while the N-terminal extension is
derived from human .beta.-1,4-galactosyltransferase gene or the CTS
is derived from rat sialyltransferase. In certain embodiments the
chicken .beta.-1,4-galactosyltransferase has the amino acid
sequence of SEQ ID NO:2 and the fish
.beta.-1,4-galactosyltransferase is derived from zebrafish (Danio
rerio) and has the amino acid sequence of SEQ ID NO: 14. In certain
embodiments, the enzyme is encoded by the nucleic acid of SEQ ID
NO:1 and SEQ ID NO:13, respectively.
[0078] In some embodiments plant cells or plants are provided that
express non-mammalian .beta.1,4-galactosyltransferases, such as
those derived from chicken and fish. In certain embodiments the
plant cells or plants express functional wild-type chicken
.beta.1,4-galactosyltransferase (SEQ ID NO:2). In some embodiments
the above mentioned plant cell or plant produces at least
hybrid-type N-linked glycans (i.e., N-glycans at least comprising
the trimannosylated chitobiose core, one additional mannose and a
galactosylated GlcNAc residue at the nonreducing end on the
.alpha.1,3-arm of the N-glycan) lacking both .beta.1,2-xylose and
.alpha.1,3-fucose residues. In certain embodiments the total amount
of hybrid-type N-linked glycans lacking both .beta.1,2-xylose and
.alpha.1,3-fucose residues is 2-fold increased over the amount
produced by a plant cell or plant expressing wild-type human
.beta.1,4-galactosyltransferase. In other embodiments the amount is
increased by 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 50-, 100-,
250-, 500-, 1000-, or 10,000-fold increased.
[0079] In other embodiments the plant cells or plants express
chicken .beta.1,4-galactosyltransferase comprising a 13 amino acid
extension at the N-terminus (SEQ ID NO:9). In some embodiments the
above mentioned plant cell or plant produces at least hybrid-type
N-linked glycans lacking both .beta.1,2-xylose and
.alpha.1,3-fucose residues. In certain embodiments the total amount
of hybrid-type N-linked glycans lacking both .beta.1,2-xylose and
.alpha.1,3-fucose residues is 2-fold increased over the amount
produced by a plant cell or plant expressing wild-type human
.beta.1,4-galactosyltransferase. In other embodiments the amount is
increased by 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 50-, 100-,
250-, 500-, 1000-, or 10,000-fold increased.
[0080] In other embodiments the plant cells or plants express
chicken .beta.1,4-galactosyltransferase comprising a
sialyltransferase CTS extension at the N-terminus (SEQ ID NO:11).
In some embodiments the above mentioned plant cell or plant
produces at least hybrid-type N-linked glycans lacking both
.beta.1,2-xylose and .alpha.1,3-fucose residues, as well as
bi-antennary N-glycans comprising at least one galactosylated
GlcNAc residue (i.e., N-glycans with at least one galactosylated
GlcNAc residue at the non-reducing end in addition to the
trimannosylated chitobiose core). In certain embodiments the total
amount of hybrid-type N-linked glycans lacking both
.beta.1,2-xylose and .alpha.1,3-fucose residues and/or bi-antennary
N-glycans comprising at least one galactosylated GlcNAc residue is
2-fold increased over the amount produced by a plant cell or plant
expressing wild-type human .beta.1,4-galactosyltransferase. In
other embodiments the amount is increased by 3-, 4-, 5-, 6-, 7-,
8-, 9-, 10-, 15-, 20-, 50-, 100-, 250-, 500-, 1000-, or 10,000-fold
increased.
[0081] In certain embodiments the plant cells or plants express
wild-type zebrafish .beta.1,4-galactosyltransferase (SEQ ID NO:14).
In some embodiments the above mentioned plant cell or plant
produces at least bi-antennary N-linked glycans, as well as
bi-antennary N-glycans comprising at least one galactosylated
GlcNAc residue. In certain embodiments the total amount of
bi-antennary N-linked glycans and/or bi-antennary N-glycans
comprising at least one galactosylated GlcNAc residue is 2-fold
increased over the amount produced by a plant cell or plant
expressing wild-type human .beta.1,4-galactosyltransferase. In
other embodiments the amount is increased by 3-, 4-, 5-, 6-, 7-,
8-, 9-, 10-, 15-, 20-, 50-, 100-, 250-, 500-, 1000-, or 10,000-fold
increased.
[0082] In other embodiments the plant cells or plants express
zebrafish .beta.1,4-galactosyltransferase comprising a 13 amino
acid extension at the N-terminus (SEQ ID NO:16). In some
embodiments the above mentioned plant cell or plant produces at
least bi-antennary N-linked glycans, as well as bi-antennary
N-glycans comprising at least one galactosylated GlcNAc residue. In
certain embodiments the total amount of bi-antennary N-linked
glycans and/or bi-antennary N-glycans comprising at least one
galactosylated GlcNAc residue is 2-fold increased over the amount
produced by a plant cell or plant expressing wild-type human
.beta.1,4-galactosyltransferase. In other embodiments the amount is
increased by 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 50-, 100-,
250-, 500-, 1000-, or 10,000-fold increased.
[0083] In other embodiments the plant cells or plants express
zebrafish .beta.1,4-galactosyltransferase comprising a
sialyltransferase CTS extension at the N-terminus (SEQ ID NO:18).
In some embodiments the above mentioned plant cell or plant
produces at least bi-antennary N-linked glycans, as well as
bi-antennary N-glycans comprising at least one galactosylated
GlcNAc residue. In certain embodiments the total amount of
bi-antennary N-linked glycans and/or bi-antennary N-glycans
comprising at least one galactosylated GlcNAc residue is 2-fold
increased over the amount produced by a plant cell or plant
expressing wild-type human .beta.1,4-galactosyltransferase. In
other embodiments the amount is increased by 3-, 4-, 5-, 6-, 7-,
8-, 9-, 10-, 15-, 20-, 50-, 100-, 250-, 500-, 1000-, or 10,000-fold
increased.
[0084] In certain embodiments the nucleic acids encoding a
non-mammalian .beta.-1,4-galactosyltransferase that is extended at
the N-terminus with a sequence derived from the N-terminus of a
mammalian .beta.1,4-galactosyltransferase 1 or with an N-terminal
CTS sequence from a mammalian .beta.-1,4-galactosyltransferase or
sialyltransferase, described herein, may alternatively be extended
with any other CTS sequence from a Golgi-localized protein from
plants, animals or fungi resulting in trans-Golgi localized
expression of the non-mammalian GalT catalytic domain to which it
is fused at its C-terminus. Such nucleic acids are provided
herein.
[0085] In certain embodiments the plant cells or plants express in
addition to a non-mammalian .beta.-1,4-galactosyltransferase,
described herein, a second protein, preferably a mammalian protein
to be provided with a galactosylated N-linked glycan, producing a
heterologuos glycoprotein of which .beta.1,4-galactosylation of its
N-glycans, biantennary or alternatively in a hybrid form is of
interest. Such glycoproteins produced in plant cells or plants
expressing a non-mammalian .beta.-1,4-galactosyltransferase are
also provided herein.
[0086] In certain embodiments, said second protein is expressed
from a nucleic acid that encodes an antibody heavy and/or light
chain or a functional fragment thereof.
[0087] The skilled person is well acquainted with expression of
recombinant nucleic acids in cellular expression systems, such as
for example plant cells that can generate whole plants. An
expression vector may be used for expression of recombinant nucleic
acids in cellular expression systems. In certain embodiments, such
a vector will comprise a DNA encoding a non-mammalian
.beta.-1,4-galactosyltransferase or an enzymatically active
derivative or part thereof that optionally is extended at the
N-terminus or in which its own CTS is replaced with an N-terminal
CTS sequence from another Golgi-localized protein in such a way
that it will have galactosylating activity on N-linked glycans. A
suitable vector may further comprise regulatory elements such as a
promotor, and optionally at least one selection marker expressible
in said cellular expression system. The expression vector may
further encode at least one further DNA encoding a mammalian
glycoprotein which can be glycosylated.
[0088] In certain embodiments a plants or plant cell is provided
that has been provided with a functional non-mammalian enzyme
(optionally with N-terminal extension derived from a mammalian GalT
or in which the endogenous CTS has been replaced with another CTS
from a Golgi-localized protein from plants) providing N-glycan
biosynthesis that is normally not present in plants thereby for
example providing the capacity to extend an N-linked glycan by the
addition of a galactose. In certain embodiments expression is
transient while in other embodiments, plants or plant cells are
provided wherein expression of non-mammalian
.beta.-1,4-galactosyltransferase or an enzymatically active
derivative or part thereof, and optionally of an additional
heterologous protein that may be glycosylated, is stable. In
certain embodiments a third protein is additionally expressed by a
plant cell or plant. Such a third protein may be an enzyme which
further processes the glycosylation of said galactosylated second
protein. In certain embodiments, a plant cell or plant may comprise
two nucleic acids encoding for a monomer of a dimeric or multimeric
protein. In certain embodiments separate nucleic acids are provided
for both an antibody light and heavy chain or functional fragment
thereof or for any other dimeric or multimeric protein of interest.
Of course, it is not necessary that a full protein is expressed. In
certain embodiments a plant cell or plant according to the
invention expresses only a fragment, preferably a functional
fragment of said second mammalian glycoprotein, said fragment
having at least one activity of the whole protein and further being
characterized by for example a truncated polypeptide chain, or a
not fully extended glycan, for example only extended with
galactose. Such glycoproteins or fragments thereof are also
provided herein.
[0089] The addition of plant-specific residues such as
.beta.1,2-xylose and .alpha.1,3-fucose residues to glycoproteins
produced in plants makes such glycoproteins less suited for
pharmaceutical use, because of the undesirable antigenic and
immunogenic characteristics of .beta.1,2-xylose and
.alpha.1,3-fucose residues in mammals. To substantially limit the
number of .beta.1,2-xylose and .alpha.1,3-fucose residues on plant
produced glycoproteins or to achieve a complete lack of these
residues, strategies are required that modify the genome of plant
cells in such a manner that the synthesized glycoproteins display
humanized or mammalized characteristics.
[0090] In certain embodiments, plant cells or plants are provided,
wherein a second protein, and preferably a second mammalian protein
or functional fragment thereof, comprises an extended N-linked
glycan that is devoid of xylose and/or of fucose. Plant-derived
galactosylated glycoproteins still may contain xylose and fucose
residues. In certain embodiments, non-mammalian
.beta.1,4-galactosyltransferase or a modified mersion thereof
described elsewhere herein, is therefore expressed in plants in
such a way that the enzyme acts in the Golgi apparatus on the
natural substrates, that is, subsequent to the action of
N-acetylglucosaminyltransferase I, Golgi-mannosidase II and
N-acetylglucosaminyltransferase II, and in plants, provided that
these enzymes are not inhibited in another way, subsequent to or
during the action of xylosyltransferase and fucosyltransferase. A
galactosylated protein obtained from a plant is herein referred to
as plant-derived. Such plant-derived galactosylated proteins are
also provided herein.
[0091] To mammalize the glycosylation of plants for the production
of tailor-made glycoproteins in plants xylosyltransferases and
fucosyltransferases may be knocked out or silenced and at least one
of several mammalian glycosyltransferases has to be expressed.
Providing the xylosyltransferase and fucosyltransferase knock-outs
and thereby reducing the unwanted glycosylation potential of plants
is a feasible option because for example an Arabidopsis thaliana
mutant mutated in the gene encoding N-acetylglucosaminyltransferase
I was completely viable. As N-acetylglucosaminyltransferase I is
the enzyme initiating the formation of complex glycans this plant
completely lacks the xylose and fucose residues containing complex
glycans.
[0092] In certain embodiments plants or plant cells are provided
wherein a non-mammalian .beta.-1,4-galactosyltransferase or an
enzymatically active derivative or part thereof, an additional
heterologous protein that may be glycosylated, and optionally
additionally a third protein providing further N-glycan
biosynthesis are expressed, and wherein the genes encoding enzymes
responsible for xylose and/or fucose addition are knocked-out or
wherein expression of these genes is silenced using antisense or
RNAi technology. Methods for gene knockouts in plants or gene
silencing through RNAi are well known in the art.
[0093] RNA interference (RNAi) is a mechanism that inhibits gene
expression at the stage of translation or by hindering the
transcription of specific genes. Small interfering RNA strands
(siRNA) are key to the RNAi process, and have complementary
nucleotide sequences to the targeted RNA strand. Specific RNAi
pathway proteins, such as dicer (RISC), are guided by the siRNA to
the targeted messenger RNA (mRNA), where they cleave the target
into smaller portions that can no longer be translated into
protein. RNA interference is a vital part of the immune response to
viruses and other foreign genetic material, especially in
plants.
[0094] RNA interference has been used for applications in plant
biotechnology, for example in the engineering of food plants that
produce lower levels of natural plant toxins, in tomato plants to
reduce the levels of allergens, and in tomatoes to fortify the
plant with dietary antioxidants (Sunilkumar G. et al. (2006) Proc
Natl Acad Sci USA 103 (48): 18054-9; Siritunga D, Sayre R (2003)
Planta 217 (3): 367-73; Le L. et al. (2006) Plant Biotechnol J 4
(2): 231-42; Niggeweg R. et al. (2004) Nat Biotechnol 22 (6):
746-54). Such techniques take advantage of the stable and heritable
RNAi phenotype in plant stocks.
[0095] In other embodiments methods are provided to specifically
separate and purify glycoproteins comprising extended N-linked
glycan that is devoid of xylose and/or of fucose. Several types of
separation techniques exist, such as (immuno) affinity purification
or size-exclusion chromatography or electrophoresis, to mediate the
required purification. Such methods are well known in the art (see,
e.g., US 2008/0003680).
[0096] One of skill in the art will appreciate that the invention
is not limited to plants or plant cells but also provides other
organisms like animals, fungi or yeast, or cell lines like
mammalian cell lines or insect cell lines with the capacity to
produce a glycoprotein (essentially nonsialylated) according to the
invention wherein said N-linked glycan comprises a galactose.
[0097] Generating transiently or stably transformed plants which
produce tailored glycoproteins of commercial interest may be
established, in some embodiments, by inoculating plant cells or
tissues with Agrobacterium strains containing a (binary) vector
which comprises both nucleotide sequences encoding N-glycosylation
modifying enzymes as described herein and genes encoding
commercially interesting heterologous glycoproteins. Alternatively,
in some embodiments, transiently or stably transformed plants which
produce tailored glycoproteins of commercial interest may be
generated by simultaneous inoculation (co-transformation) of two or
more Agrobacterium strains each carrying a vector comprising either
nucleotide sequences encoding N-glycosylation modifying enzymes or
nucleotide sequences encoding heterologous glycoproteins of
commercial interest. Alternatively, in some embodiments,
transiently or stably transformed plants which produce tailored
glycoproteins of commercial interest can be generated by (multiple)
crossing (s) of plants with modified N-glycosylation with plants
which express polynucleotides encoding proteins of commercial
interest. In all of these procedures, the vector may also comprise
a nucleic acid sequence which confers resistance against a
selection agent.
[0098] In order to obtain satisfactory expression of the proteins
involved in N-glycosylation and of the glycoproteins or
polypeptides of commercial interest, the nucleotide sequences may
be adapted to the specific transcription and translation machinery
of the host plant as known to people skilled in the art. For
example, silent mutations in the coding regions may be introduced
to improve codon usage and specific promoters may be used to drive
expression of said genes in relevant plant tissues. Promoters which
are developmentally regulated or which can be induced at will, may
be used to ensure expression at the appropriate time, for example,
only after plant tissues have been harvested from the field and
brought into controlled conditions. In all these cases, choice of
expression cassettes of the glycosylation modifying proteins and of
the glycoproteins of commercial interest should be such that they
express in the same cells to allow desired post-translational
modifications to the glycoprotein.
[0099] In certain embodiments tobacco plants are provided, or a
plant related to the genus Nicotiana ssp., preferably N. tabacum or
N.benthamiana. In other embodiments other relatively easily
transformable plants, such as Arabidopsis thaliana, or Zea mays, or
plants related thereto may be used. For the production of
recombinant glycoproteins, use of duckweed offers specific
advantages. The plants are in general small and reproduce asexually
through vegetative budding. Most duckweed species have all the
tissues and organs of much larger plants including roots, stems,
flowers, seeds and fronds. Duckweed can be grown cheaply and very
fast as a free floating plant on the surface of simple liquid
solutions in full containment from which they can easily be
harvested. In certain embodiments duckweed is recombinantly
provided with a non-mammalian .beta.-1,4-galactosyltransferase or
modified version thereof described herein and/or genes encoding
commercially interesting heterologous glycoproteins. The duckweed
plant may for example comprise the genus Spirodella, genus Wolffia,
genus Wolffiella, or the genus Lemna, Lemna minor, Lemna miniscule
and Lemna gibba.
[0100] In certain embodiments, expression in tomato fruits is
provided. Tomatoes can be easily grown in greenhouses under
contained and controlled conditions and tomato fruit biomass can be
harvested continuously throughout the year in enormous quantities.
The watery fraction containing the glycoproteins of interest can be
readily separated from the rest of the tomato fruit which allows
easier purification of the glycoprotein. In certain embodiments
expression in storage organs of other crops is provided including,
but not limited to, the kernels of corn, the tubers of potato and
the seeds of rape seed or sunflower, which are attractive
alternatives that provide huge biomass in organs for which
harvesting and processing technology is readily available.
[0101] In some embodiments methods are provided for providing a
transgenic plant, such as transgenic Nicotiana ssp., preferably N.
tabacum or N. benthamiana, Arabidopsis thaliana, or corn, potato,
tomato, or duckweed, which are capable of expressing a recombinant
protein, with the capacity to extend an N-linked glycan with
galactose comprising crossing said transgenic plant with a plant
comprising at least one optionally functional non-mammalian
protein, for example, a transporter or an enzyme providing N-glycan
biosynthesis that is normally not present in plants, harvesting
progeny from said crossing and selecting a desired progeny plant
expressing said recombinant protein and expressing a functional
non-mammalian enzyme involved in mammalian-like N-glycan
biosynthesis that is normally not present in plants. In one
embodiment, the method may further comprise selecting a desired
progeny plant expressing said recombinant protein comprising an
extended N-linked glycan at least comprising galactose.
[0102] In some embodiments plants are provided expressing said
recombinant glycoprotein comprising an N-linked glycan and
expressing non-mammalian enzyme involved in mammalian-like N-glycan
biosynthesis. In additional embodiments, the invention also
provides for use of a transgenic plant to produce a desired
glycoprotein or functional fragment thereof, in particular wherein
said glycoprotein or functional fragment thereof comprises an
extended N-linked glycan at least comprising galactose.
[0103] In some embodiments methods are provided for providing a
transgenic plant cell suspension culture, such as transgenic
Nicotiana spp., preferably N. tabacum BY2, Daucus carota or
Arabidopsis thaliana cell suspension, which are capable of
expressing a recombinant protein, with the capacity to extend an
N-linked glycan with galactose.
[0104] In some embodiments methods are provided for providing a
transgenic moss, such as transgenic Bryophytaea, preferably
Physcomitrella patens, or Funaria hygrometrica, Ceratodon
purpureus, which are capable of expressing a recombinant protein,
with the capacity to extend an N-linked glycan with galactose.
[0105] In some embodiments methods are provided for obtaining a
desired glycoprotein or functional fragment thereof comprising for
example an extended N-linked glycan at least comprising galactose.
Said methods comprising cultivating a plant as described herein
until said plant has reached a harvestable stage, for example when
sufficient biomass has grown to allow profitable harvesting,
followed by harvesting said plant with established techniques known
in the art and fractionating said plant with established techniques
known in the art to obtain fractionated plant material and at least
partly isolating said glycoprotein from said fractionated plant
material.
[0106] In some embodiments plant-derived glycoproteins or
functional fragments thereof are provided comprising an extended
N-linked glycan at least comprising galactose, for example obtained
by a method as explained above. Such a plant-derived glycoprotein
with an extended glycan at least comprising galactose essentially
can be any desired glycoprotein that can be expressed in a plant.
For example, antibodies, vaccines, cytokines, FSH, TSH and other
hormone glycoproteins, other hormones like EPO, enzymes like
antitrypsin or lipase, cellular adhesion molecules like NCAM or
collagen can be produced in plants and be provided with essentially
mammalian glycosylation patterns.
[0107] In some embodiments, the invention provides use of such a
plant-derived glycoprotein or functional fragment thereof as
described herein for the production of a pharmaceutical
composition, for example for the treatment of a patient with an
antibody, a hormone, a cytokine, a vaccine antigen, an enzyme, or
the like. Such a pharmaceutical composition comprising a
glycoprotein or functional fragment thereof is also provided.
Plant Transformation
[0108] Expression of proteins, such as for example non-mammalian
enzymes providing N-glycan biosynthesis, as well as glycoproteins,
such as antibodies, cytokines, vaccines, hormones and the like, can
be performed by using methods known in the art. For example, by
stable expression via Agrobacterium-mediated transformation,
electroporation or particle bombardment, or by transient expression
using viral vectors such as PVX, for example, or agrofiltration, or
other method known in the art. The glycosyltransferases of the
invention, capable of glycan biosynthesis, and/or the glycoprotein
which undergoes glycosylation may be expressed under control of a
specific promoter to facilitate expression in certain tissues or
organs. A DNA sequence coding for the desired polypeptide of the
non-mammalian glycosyltransferase and/or glycoproteins described
herein, for example a cDNA or a genomic sequence encoding a full
length protein, may be used to construct a recombinant expression
cassette which can be introduced into the desired plant.
[0109] Isolated nucleic acids as described herein, e.g. comprising
sequences such as SEQ ID NOs: 1, 8, 10, 13, 15 and 17, can be
introduced into plants according to techniques known in the art.
Generally, recombinant expression cassettes as described above and
suitable for transformation of plant cells are prepared. The
isolated nucleic acids described herein can then be used for
transformation. In this manner, genetically modified plants, plant
cells, plant tissue, seed, and the like can be obtained.
[0110] Transformation protocols may vary depending on the type of
plant cell, i.e., monocot or dicot, targeted for transformation.
Suitable methods of transforming plant cells include microinjection
(Crossway et al. (1986) Biotechniques 4: 320-334), electroporation
(Riggs et al (1986) Proc. Natl. Acad. Sci. USA 83: 5602-5606),
Agrobacterium mediated transformation (see for example, Zhao et al.
U.S. Pat. No. 5,981,840; Hinchee et al. (1988) Biotechnology 6:
915-921), direct gene transfer (Paszkowski et al (1984) EMBO J. 3:
27172722), and ballistic particle acceleration (see, for example,
Sanford et al. U.S. Pat. No. 4,945,050; Tomes et al. "Direct DNA
Transfer into Intact Plant Cells via Microprojectile Bombardment"
In Gamborg and Phillips (Eds.) Plant Cell, Tissue and Organ
Culture: Fundamental Methods, Springer-Verlag, Berlin (1995); and
McCabe et al. (1988) Biotechnology 6: 923-926).
[0111] The cells which have been transformed may be grown into
plants in accordance with conventional methods. See, for example,
McCormick et al. (1986) Plant Cell Reports, 5: 81-84. These plants
may then be grown, and either pollinated with the same transformed
strain or different strains, and the resulting hybrid having the
desired phenotypic characteristic identified. Two or more
generations may be grown to ensure that the subject phenotypic
characteristic is stably maintained and inherited and then seeds
harvested to ensure the desired phenotype or other property has
been achieved.
Transgenic Plant Regeneration
[0112] Plant cells transformed with a plant expression vector can
be regenerated, e.g., from single cells, callus tissue or leaf
discs according to standard plant tissue culture techniques. It is
well known in the art that various cells, tissues, and organs from
almost any plant can be successfully cultured to regenerate an
entire plant. Plant regeneration from cultured protoplasts is
described in Evans et al., Protoplasts Isolation and Culture,
Handbook of Plant Cell Culture, Macmillan Publishing Company, New
York, pp. 124 176 (1983); and Binding, Regeneration of Plants,
Plant Protoplasts, CRC Press, Boca Raton, pp. 21-73 (1985).
[0113] The regeneration of plants containing the foreign gene
introduced by Agrobacterium from leaf explants can be achieved as
described by Horsch et al., Science, 227: 1229-1231 (1985). In this
procedure, transformants are grown in the presence of a selection
agent and in a medium that induces the regeneration of shoots in
the plant species being transformed as described by Fraley et al.,
Proc. Natl. Acad. Sci. (U.S.A.), 80: 4803 (1983). This procedure
typically produces shoots within two to four weeks and these
transformant shoots are then transferred to an appropriate
root-inducing medium containing the selective agent and an
antibiotic to prevent bacterial growth. Transgenic plants of the
present invention may be fertile or sterile.
[0114] Regeneration can also be obtained from plant callus,
explants, organs, or parts thereof. Such regeneration techniques
are described generally in Klee et al., Annu Rev Plant Phys. 38:
467-486 (1987). The regeneration of plants from either single plant
protoplasts or various explants is well known in the art. See, for
example, Methods for Plant Molecular Biology, A. Weissbach and H.
Weissbach, eds., Academic Press, Inc., San Diego, Calif. (1988).
This regeneration and growth process includes the steps of
selection of transformant cells and shoots, rooting the
transformant shoots and growth of the plantlets in soil. For maize
cell culture and regeneration see generally, The Maize Handbook,
Freeling and Walbot, Eds., Springer, New York (1994); Corn and Corn
Improvement, 3rd edition, Sprague and Dudley Eds., American Society
of Agronomy, Madison, Wis. (1988).
[0115] One of skill will recognize that after the recombinant
expression cassette is stably incorporated in transgenic plants and
confirmed to be operable, it can be introduced into other plants by
sexual crossing. Any of a number of standard breeding techniques
can be used, depending upon the species to be crossed. In
vegetatively propagated crops, mature transgenic plants can be
propagated by the taking of cuttings or by tissue culture
techniques to produce multiple identical plants.
[0116] Selection of desirable transgenics is made and new varieties
are obtained and preferably propagated vegetatively for commercial
use. In seed propagated crops, mature transgenic plants can be self
crossed to produce a homozygous inbred plant. The inbred plant
produces seed containing the newly introduced heterologous nucleic
acid. These seeds can be grown to produce plants that would produce
the selected phenotype.
[0117] Parts obtained from the regenerated plant, such as flowers,
seeds, leaves, branches, fruit, and the like are included in the
invention, provided that these parts comprise cells comprising the
isolated nucleic acids described herein. Progeny and variants, and
mutants of the regenerated plants are also included within the
scope of the invention, provided that these parts comprise the
introduced nucleic acid sequences.
[0118] Transgenic plants expressing the selectable marker can be
screened for transmission of the nucleic acids described herein by,
for example, standard immunoblot and DNA detection techniques.
Transgenic lines are also typically evaluated on levels of
expression of the heterologous nucleic acid. Expression at the RNA
level can be determined initially to identify and quantitate
expression-positive plants. Standard techniques for RNA analysis
can be employed and include PCR amplification assays using
oligonucleotide primers designed to amplify only the heterologous
RNA templates and solution hybridization assays using heterologous
nucleic acid-specific probes. The RNA positive plants can then be
analyzed for protein expression by Western immunoblot analysis
using the specifically reactive antibodies provided herein. In
addition, in situ hybridization and immunocytochemistry according
to standard protocols can be performed using heterologous nucleic
acid specific polynucleotide probes and antibodies, respectively,
to localize sites of expression within transgenic tissue.
Generally, a number of transgenic lines are screened for the
incorporated nucleic acid to identify and select plants with the
most appropriate expression profiles.
[0119] In certain embodiments a transgenic plant is provided that
is homozygous for the added heterologous nucleic acid; i.e., a
transgenic plant that contains two added nucleic acid sequences,
one gene at the same locus on each chromosome of a chromosome pair.
A homozygous transgenic plant can be obtained by sexually mating
(selling) a heterozygous transgenic plant that contains a single
added heterologous nucleic acid, germinating some of the seed
produced and analyzing the resulting plants produced for altered
expression of a polynucleotide described herein relative to a
control plant (i.e., native, non-transgenic). Back-crossing to a
parental plant and out-crossing with a non-transgenic plant are
also contemplated.
[0120] In certain embodiments a process for the production of a
transgenic plant or a transgenic plant cell is provided comprising
(a) insertion of a DNA into the genome of a plant or a plant cell,
said DNA comprising a nucleic acid sequence which encodes a
non-mammalian .beta.-1,4-galactosyltransferase, optionally extended
with a mammalian N-terminal sequence, as described herein, or
encoding said GalT in which its CTS has been replaced with that of
another Golgi-localized protein, as described herein, or
enzymatically active derivatives or parts thereof, and preferably
in addition at least one mammalian protein requiring
galactosylation of its N-linked glycan which DNA additionally
encodes at least one selection marker expressible in said plant or
said plant cell, (b) selection of transgenic plants or plant cells
which have taken up said DNA according to (a); and (c) culturing of
the desired transgenic plant or the desired transgenic plant cell
in a suitable culture medium. The skilled person will understand
that term "a protein comprising a galactosylated N-linked glycan"
in relation to a nucleic acid molecule encoding said protein merely
encodes the polypeptide, whereas the galactosylated N-linked glycan
is a result of processing of the protein in the Golgi.
[0121] In some embodiments additional methods are provided for
producing a transgenic plant that expresses a recombinant GalT
protein and a protein comprising a galactosylated N-linked glycan.
Such methods may for instance comprise crossing a transgenic plant
described herein with another plant, harvesting progeny from said
crossing and selecting a desired progeny plant expressing the
recombinant GalT protein and expressing a recombinant mammalian
glycoprotein, in particular a protein comprising a galactosylated
N-glycan, or functional fragment thereof.
Purification of Proteins
[0122] In certain embodiments methods for obtaining a desired
glycoprotein or functional fragment thereof comprise cultivating a
plant described herein until said plant has reached a harvestable
stage, harvesting and fractionating the plant to obtain
fractionated plant material and at least partly isolating said
glycoprotein from said fractionated plant material. In certain
embodiment methods for obtaining a desired glycoprotein or
functional fragment thereof comprise growing plant cells in cell
culture in a fermentor until said cell culture has reached a
harvestable stage or the desired glycoprotein can be collected from
the medium. The glycoproteins described herein, such as e.g.,
antibodies, vaccines, cytokines and hormones, may be purified by
standard techniques well known to those of skill in the art. Such
recombinantly produced proteins may be directly expressed or
expressed as a fusion protein. The recombinant protein is purified
by a combination of cell lysis (e.g., sonication, French press) and
affinity chromatography or other affinity-based method. For fusion
products, subsequent digestion of the fusion protein with an
appropriate proteolytic enzyme releases the desired recombinant
protein.
[0123] The proteins described herein, recombinant or synthetic, may
be purified to substantial purity by standard techniques well known
in the art, including detergent solubilization, selective
precipitation with such substances as ammonium sulfate, column
chromatography, immunopurification methods, and others. See, for
instance, R. Scopes, Protein Purification: Principles and Practice,
Springer-Verlag: New York (1982); Deutscher, Guide to Protein
Purification, Academic Press (1990). For example, antibodies may be
raised to the proteins as described herein. Purification from E.
coli can be achieved following procedures described in U.S. Pat.
No. 4,511,503. The protein may then be isolated from cells
expressing the protein and further purified by standard protein
chemistry techniques as described herein. Detection of the
expressed protein is achieved by methods known in the art and
include, for example, radioimmunoassays, Western blotting
techniques or immunoprecipitation.
Examples
Example 1
Identification of Putative Non-Mammalian .beta.1,4 GalTs
[0124] The family of .beta.-1,4-galactosyltransferases (GalT)
comprises at least seven members, of which several have been cloned
but only very few have been characterized. The
.beta.-1,4-galactosyltransferases of human and bovine origin have
been best characterized and were shown to be able to add a
galactose residue in .beta.-1,4-linkage to terminal GlcNAc residue
on an N-glycan. Putative GalT genes involved in N-glycosylation
were identified among non-mammalian species gene sequences based on
homology. FIG. 1 shows a Clustal W alignment of mammalian GalT gene
sequences (human, mouse and bovine) and non-mammalian putative GalT
gene sequences (chicken, zebrafish and frog). Remarkably, the
mammalian amino terminus (boxed, solid lines), which is cytosolic
and adjacent to the transmembrane region (TM, boxed, dashed lines)
and which putatively is involved in Golgi-localization is not
conserved in GalT orthologs from non-mammalian origin, such as, for
example, chicken and zebrafish (see FIG. 1).
[0125] Golgi-localization is thought to be important for GalT
activity, which can be `late` (probably trans-Golgi), meaning GalT
catalytic activity occurs after the actions of other
glycosyltransferases, such as, for example Man-I, GnT-I, Man-II,
GnT-II, XylT and FucT in the plant, producing bi-antennary
N-glycans, or GalT catalytic activity occurs `early`
(cis/medial-Golgi) that is before the activity of Man-II, XylT and
FucT, thereby preventing the activity of these enzymes, producing
in a plant hybrid-type N-glycans that lack fucose and xylose.
[0126] Non-mammalian GalT orthologs, for example derived from
chicken and zebrafish, have not previously been characterized for
their ability to add a galactose residue in .beta.-1,4-linkage to
terminal GlcNAc residue on an N-glycan, particularly not when
expressed exogenously in plants. The influence of different
mammalian amino termini, which may influence intracellular
localization, on the production of bi-antennary or hybrid-type
N-glycans and the effects on adding plant-specific fucose and
xylose residues to N-glycans when expressed fused to a
non-mammalian GalT ortholog in a plant has also not been
investigated.
[0127] Three GalT constructs for each chicken and zebrafish were
cloned and tested for N-glycosylation activity: a) wild-type,
non-mammalian chicken and zebrafish .beta.-1,4-GalT1; b) fusion
proteins of the 13 amino acid conserved mammalian (human) amino
terminus (see FIG. 1) extension to non-mammalian chicken and
zebrafish .beta.-1,4-GalT1; and c) fusion proteins of the mammalian
cytosolic tail and transmembrane domain (CTS) derived from rat
sialyltransferase gene to non-mammalian chicken and zebrafish
.beta.-1,4-GalT1, replacing the amino teuninus of chicken and
zebrafish .beta.-1,4-GalT1 with the CTS of rat sialyltransferase
(see Examples 2 and 3).
Example 2
Cloning and Expression of Genes Encoding the Full-Length Chicken
.beta.1,4-GalT1 Enzyme and Variants Thereof.
[0128] Putative chicken .beta.1,4-GalT1 (GGal; GenBank accession
U19890; SEQ Ggal, SEQ ID NO:2) has been cloned earlier, although it
was not shown to be capable of galactosylating N-glycans (Shaper et
al., J Biol Chem 272, 31389-31399, 1997). In our lab, the cDNA
fragment comprising residues 114 to 362 (SEQ GgGal114-362, SEQ ID
NO:3) has been amplified from chicken spleen total RNA using RT-PCR
with primers GgalLEEVAST and GgGaldw (see Table 1). The resulting
fragment containing the C-terminus was digested with Xho I and Bam
HI and then cloned into plasmid pCASeco, the latter being a pUC19
derivative in which the Hin dIII and Eco RI sites flanking the
multiple cloning site have been used to insert the sequence SEQ
CASeco at the same time removing these two sites and the Eco
31I-site in the backbone. This plasmid pCASeco was digested with
Xho I and Bam HI to accommodate the C-terminal GGal fragment
yielding clone GgGalC.
[0129] The cDNA fragment containing the N-terminus of the GGal and
comprising residues 1 to 113 was produced synthetically using
PCR-based methods from long oligos. The GC-rich nature of the
natural cDNA fragment hampered straightforward RT-PCR cloning and a
codon optimized version of this fragment (SEQ GgGalsyn, SEQ ID
NO:6) without amino acid alterations compared to the wild-type
sequence was combined with clone GgGalC encoding SEQ GgGal114-362
in such a way as to create a gene (SEQ GgGalhybr, SEQ ID NO:1)
encoding the wild-type GGal amino acid sequence (SEQ Ggal, SEQ ID
NO:2). The gene as described under SEQ GgGalhybr was then used as
starting material to create two variants, one in which its
N-terminus is extended with a sequence encoding the 13 amino acid
residues of the full-length human .beta.1,4-GalT1 (GenBank
accession NM.sub.--001497) and another in which the fragment
encoding residues 40 to 362 comprising the catalytic domain of the
GGal is fused to the C-terminus of the rat
.alpha.2,6-sialyltransferase (SialT; GenBank accession M18769)
N-terminal domain comprising residues 1 to 53, thus including the
cytosolic tail, the transmembrane domain and a part of the stem
region. The rat SialT-derived sequence contains one silent mutation
with regard to the wild-type sequence.
[0130] The GGal with 13 amino acid N-terminal extension was made
from the hybrid clone encoding GGal (SEQ GgGalhybr, SEQ ID NO:1)
using PCR with oligo HsGgGalstart and M13 forward primer (Table 1).
The resulting PCR fragment was digested with Bpi I and Xba I and
cloned into likewise digested GGal clone. The resulting clone
contains a gene with SEQ HsGGal (SEQ ID NO:8).
[0131] The variant with a rat SialT N-terminal domain was made from
the clone encoding the complete GGal (SEQ GgGalhybr, SEQ ID NO:1)
using PCR with oligos GgGal142 and M13 forward primer (Table 1).
The resulting fragment was digested with Eco 31I and Bam HI and
cloned into pCASeco plasmid containing the rat sequence digested
with Nco I and Bam HI. The resulting clone contains a gene with SEQ
sialGGal (SEQ ID NO:10).
[0132] Plant transformation vectors containing the three different
GGal genes were made by first cloning the genes digested with Eco
31I and Bam HI into vector pRAP40 digested with Nco I and Bam HI
causing the genes to be downstream of the enhanced CaMV 35S
promoter and the AMV translational enhancer. pRAP40is a pUC19
derivative containing the enhanced CaMV 35S promoter and the nos
terminator flanked upstream of the promoter by the Asc I site and
downstream of the terminator by the Pac I site; the entire cassette
including the flanking restriction sites is described under SEQ
RAP40 (SEQ ID NO:12). Each of the three cassettes comprising the
promoter, one of the three genes and the terminator was then
transferred separately to a modified version of binary vector
pMOG22 in which the Eco RI and Hin dIII sites of the multiple
cloning site have been replaced by Pac I and Asc I, respectively
(Goddijn et al., 1993, Plant J 4:863-873). To this end, the
pRAP-derived clones were digested with Pac I and Asc I and then
cloned into Asc-Pac digested binary vector giving three different
vectors ready for plant transformation. After Agrobacterium
tumefaciens-mediated transformation of Nicotiana tabacum,
transgenic plants expressing the GGal or its variants were selected
by analyzing the N-glycans synthesized by the transformants using
methods as described previously by Bakker et al., (Proc Natl Acad
Sci USA 98:2899-904, 2001 and Proc Natl Acad Sci USA 103:7577-82,
2006), for example.
[0133] Results from MALDI-TOF analyses, see FIG. 2 and summarized
in FIG. 4, right column and Table 3, of N-glycans purified from
transgenic plants expressing the chicken gene show that only the
chicken gene sequence with either 13 amino acid extension (HsGGal,
SEQ ID NO:8) or SialT-CTS (sialGGal, SEQ ID NO:10) expression
results in production of full bi-antennary N-glycans with galactose
residues. Expression of wild-type chicken GalT gene results in
hybrid type N-glycans only. Both 13 amino acid extension (HsGGal,
SEQ ID NO:8) or SialT-CTS (sialGGal, SEQ ID NO:10) chicken GalT's
also have some hybrid type galactosylated N-glycans.
[0134] Remarkably, expression of the three different GGal genes
results in the almost complete lack of bi-antennary N-glycans
ending in two GlcNAc residues (see Table 3 and FIG. 4, upper panel,
right column), instead hybrid-type galactosylated N-glycans with
one galactose and lacking both xylose and fucose are predominant,
especially for expression of wild-type chicken GalT (see FIG. 4,
middle panel, right column). This pattern of N-glycan production is
markedly different from that obtained from plants transformed with
either human GalT or GalT from zebrafish (see Table 3 and FIG. 4,
left and middle column, respectively, and see below).
[0135] A reduction in plant-specific xylose and fucose residues, or
the complete lack thereof, such as it is seen in the hybrid-type
galactosylated N-glycans when wild-type chicken GalT is expressed
in plants, is desirable when producing, for example, exogenous
therapeutic glycoproteins, since .beta.1,2-xylose and
.beta.1,3-fucose residues are not attached to glycoproteins of
mammals and act as an allergen.
Example 3
Cloning and Expression of Genes Encoding the Full-Length Zebrafish
.beta.1,4-GalT1 Enzyme and Variants Thereof.
[0136] A putative zebrafish .beta.1,4-GalT1 (Machingo et al., Dev
Biol 297, 471-82, 2006; NM.sub.--001017730) has been identified,
but its function has not been proven and the inventors believe the
identification to be incorrect. Starting from whole zebrafish total
RNA, a full-length DGal gene (SEQ Dgal, SEQ ID NO:13) has been
amplified using RT-PCR with primers DrGalup and DrGaldw (see Table
2). The resulting fragment was digested with Xba I and Bam HI and
then cloned into likewise digested plasmid pCASeco (see above).
Sequencing showed that it was virtually identical to unidentified
Genbank accession NM.sub.--001077259, albeit with three mutations
as shown here (start at +1 and non-silent mutations underlined):
T126C, T230G, G862C. Amino acid sequence comparison of Dgal (SEQ
Dgal, SEQ ID NO:14) with putative zebrafish .beta.1,4-GalT1 as
published (Machingo et al., Dev Biol 297, 471-82, 2006;
NM.sub.--001017730) showed that there was little sequence homology
at the amino acid level, especially at the N-terminus that is
supposedly involved in Golgi-localization, and C-terminus where our
clone is significantly longer (see FIG. 5).
[0137] The DGal with 13 amino acid N-terminal extension was made
from the clone encoding DGal (SEQ Dgal, SEQ ID NO:13) using PCR
with oligos HsDrup and DrGaldw (Table 2). The resulting PCR
fragment was digested with Acc I and Bpi I and cloned into likewise
digested DGal clone. The resulting clone contains a gene with SEQ
HsDGal (SEQ ID NO:15).
[0138] The variant with a rat SialT N-terminal domain was made from
the clone encoding the complete DGal (SEQ Dgal, SEQ ID NO:13) using
PCR with oligos DrGal160 and DrGaldw (Table 2). The resulting
fragment was digested with Bpi I and Bam HI and cloned into pCASeco
plasmid containing the rat sequence digested with Nco I and Bam HI.
The resulting clone contains the DGal catalytic domain fused to the
N-terminus of the rat SialT gene (SEQ sialDGal, SEQ ID NO:17).
[0139] Plant transformation vectors containing the three different
DGal genes were made by first cloning the genes digested with Eco
31I and Bam HI into vector pRAP40 digested with Nco I and Bam HI
causing the genes to be downstream of the enhanced CaMV 35S
promoter. Each of the three cassettes comprising the promoter, one
of the three genes and the terminator were then transferred
separately to a modified version of binary vector pMOG22 in which
the Eco RI and Hin dIII sites of the multiple cloning site have
been replaced by Pac I and Asc I, respectively (Goddijn et al.,
1993, Plant J 4:863-873). To this end, the pRAP-derived clones was
digested with Pac I and Asc I and then cloned into Asc-Pac digested
binary vector giving three different vectors ready for plant
transformation. After Agrobacterium tumefaciens-mediated
transformation of Nicotiana tabacum, transgenic plants expressing
the DGal or its variants were selected by analyzing the N-glycans
synthesized by the transformants using methods as described
previously by Bakker et al., (Proc Natl Acad Sci USA 98:2899-904,
2001 and Proc Natl Acad Sci USA 103:7577-82, 2006), for
example.
[0140] Results from MALDI-TOF analyses, see FIG. 3 and summarized
in FIG. 4, middle column and Table 3, of N-glycans purified from
transgenic plants expressing the zebrafish GalT gene sequences show
that expression of wild-type zebrafish GalT gene sequence results
in some hybrid type galactosylated N-glycans but also fully
bi-antennary N-glycans with two galactoses. Depending on the plant
some plants only have galactosylated bi-antennary N-glycans upon
expression of zebrafish wild-type GalT gene sequence (see FIG. 3,
uppermost versus 2.sup.nd from top panel). The amount of double
galactosylated bi-antennary N-glycans can be significantly
increased by either the 13 aminoacid N-terminus human GalT (HsDGal,
SEQ ID NO:15) or SialT-CTS-GalT (sialDGal, SEQ ID NO:17), with the
latter having highest amount of galactosylated bi-antennary
N-glycans (see Table 3 and FIG. 4, bottom panel, middle
column).
[0141] Remarkably, galactosylation of double-galactosylated
bi-antennary N-glycans obtained through the expression of
Sial-CTS-zebrafish GalT in tobacco is 50% increased in
SialT-CTS-zebrafish GalT compared to SialT-CTS-human GalT (see
Table 3 and FIG. 4, bottom panel, middle column and left column,
respectively). The Sial-CTS-zebrafish GalT produces up to 45% of
total N-glycans that have one or more galactose residues (see Table
3).
[0142] A high yield in total N-glycans that have one or more
galactose residues such as it is seen in the bi-antennary N-glycans
when Sial-CTS-zebrafish GalT is expressed in plants, is desirable
when producing, for example, exogenous therapeutic glycoproteins.
Table 1. Oligonucleotides used in Example 1 (5' to 3')
TABLE-US-00001 TABLE 1 Oligonucleotides used in Example 1 (5' to
3') Name Sequence GgalLEEVAST (SEQ ID NO: 22)
GTGACCTCGAGGAGGTGGCGAGCACAAACC GgGaldw (SEQ ID NO: 23)
GTGACGGATCCTTCAGCTGCCGGGCGCTCCGATA HsGgalstart (SEQ ID NO: 24)
GTCAGGTCGACGAAGACAACATGAGGCTTCGGGAGCC TCTCCTCAGCGGCAGCGCCGCT
ATGAAGGAGCCAGC CCT GgGal142 (SEQ ID NO: 25)
GTGACGGTCTCACATGACGCCACCTAGAAGTCCTGA
TABLE-US-00002 TABLE 2 Oligonucleotides used in Example 2 (5' to
3') Name Sequence DrGalup (SEQ ID NO: 26)
GTGACTCTAGAAGACAACATGCCGGACTCCACCGGGAACT DrGaldw (SEQ ID NO: 27)
GTGACGGATCCTTCAGGGTTTGCCCACGTCCA DrGal160 (SEQ ID NO: 28)
GTGACGAAGACAACATGCACAGGAAACTGGCGGAGC HsDrup (SEQ ID NO: 29)
GTGACTCTAGAAGACAACATGAGGCTTCGGGAGCCGCTCCT
GAGCGGCAGCGCCGCGATGCCGGACTCCACCG
TABLE-US-00003 TABLE 3 Summary of results obtained from MALDI-TOF
analysis. Total Construct Line 1617.5 1622.6 1941.7 Galactose
Zebrafish GalT D1 2.6 4.7 1.7 32.9 Zebrafish GalT D2 10.2 0.8 3.4
23.5 Zebrafish GalT D3 4.7 4.3 1.4 34.2 Zebrafish GalT D4 17.4 0.7
3.4 23.9 Zebrafish GalT + 13 HD1 18.8 0.5 5.9 25.2 aa Zebrafish
GalT + 13 HD2 15.9 0.3 5.1 23.5 aa Zebrafish GalT + 13 HD4 24.5
<0.1 4.5 30.1 aa Zebrafish GalT with SDa 11.9 0.5 9.1 44.8
CTSsialT Zebrafish GalT with SDb 13.6 0.4 7.6 29.4 CTSsialT
Zebrafish GalT with SDc 11.5 0.5 7.7 29.4 CTSsialT Chicken GalT Ga
ND 11.2 ND 30.5 Chicken GalT Gb ND 15.7 ND 33.3 Chicken GalT Gc ND
11.8 ND 30.6 Chicken GalT + 13 HG1 2.1 5.6 0.8 31.4 aa Chicken GalT
+ 13 HG2 1.5 7.1 0.4 29.4 aa Chicken GalT + 13 HG4 3.7 3.6 1.1 26.9
aa Chicken GalT + 13 HG5 2.1 9 <0.1 30.4 aa Chicken GalT with
SG1 1.1 3.6 1.9 35.5 CTSsialT Chicken GalT with SG2 0.7 2.5 1.6
30.4 CTSsialT ND = not detected Numbers are % total peak area for
columns 3-5; % total galactose is % of total N-glycans having one
or more galactose residues (column 6).
TABLE-US-00004 SEQ GgGalhybr (SEQ ID NO: 1):
ATGAAGGAGCCAGCCCTCCCAGGTACATCACTTCAGAGGGCTTGCAGGCT
CCTCGTCGCTTTCTGTGCACTTCACCTCTCTGCAACTCTGCTCTACTACC
TCGCAGGTAGTTCTCTCACGCCACCTAGAAGTCCTGAACCTCCACCTAGA
CGACCACCTCCAGCTAACCTCTCTCTTCCACCATCTAGACCACCTCCTCC
ACCTGCTGCACGTCCACGACCTGGACCTGTTTCAGCACAACCACGTAACC
TCCCAGACTCTGCTCCATCTGGACTTTGTCCTGACCCTTCTCCACTTCTC
GTCGGACCACTTAGAGTTGAGTTCTCTCAGCCTGTGAACCTCGAGGAGGT
GGCGAGCACAAACCCTGAGGTCAGGGAGGGAGGTCGTTTTGCTCCAAAGG
ACTGCAAGGCGCTGCAGAAAGTAGCAATCATCATCCCGTTCCGAAACCGA
GAGGAGCATCTGAAGTACTGGCTCTATTACATGCACCCAATTCTTCAAAG
GCAGCAGCTAGATTATGGAGTGTATGTCATCAACCAGGATGGAGACGAAG
AATTTAACCGTGCTAAACTGCTGAATGTAGGATTCACGGAAGCTTTGAAG
GAGTATGACTATGACTGCTTTGTGTTTAGTGATGTAGACCTGATCCCAAT
GGATGACAGGAACACCTACAAGTGCTACAGCCAACCAAGGCACCTTTCTG
TCTCCATGGATAAATTCGGATTTCGGTTACCCTACAATCAGTATTTTGGA
GGTGTGTCTGCCTTGAGCAAAGAACAATTCACGAAGATCAATGGGTTCCC
AAACAATTACTGGGGCTGGGGAGGCGAAGATGATGACATCTACAACAGGC
TGGTGTTCAAAGGCATGGGCATATCTCGGCCAGATGCTGTCATTGGGAAA
TGCAGAATGATTCGCCACTCGCGTGATCGGAAGAACGAGCCCAACCCGGA
GAGGTTTGACCGTATTGCTCACACCAGGGAGACGATGAGCTCTGATGGCT
TGAACTCGCTCTCCTACGAGGTGCTAAGGACTGACAGGTTCCCTCTGTAC
ACGAGGATCACAGTGGATATCGGAGCGCCCGGCAGCTGA SEQ Ggal (SEQ ID NO: 2):
MKEPALPGTSLQRACRLLVAFCALHLSATLLYYLAGSSLTPPRSPEPPPR
RPPPANLSLPPSRPPPPPAARPRPGPVSAQPRNLPDSAPSGLCPDPSPLL
VGPLRVEFSQPVNLEEVASTNPEVREGGRFAPKDCKALQKVAIIIPFRNR
EEHLKYWLYYMHPILQRQQLDYGVYVINQDGDEEFNRAKLLNVGFTEALK
EYDYDCFVFSDVDLIPMDDRNTYKCYSQPRHLSVSMDKFGFRLPYNQYFG
GVSALSKEQFTKINGFPNNYWGWGGEDDDIYNRLVFKGMGISRPDAVIGK
CRMIRHSRDRKNEPNPERFDRIAHTRETMSSDGLNSLSYEVLRTDRFPLY TRITVDIGAPGS SEQ
GgGal114-362 (SEQ ID NO: 3):
CTCGAGGAGGTGGCGAGCACAAACCCTGAGGTCAGGGAGGGAGGTCGTTT
TGCTCCAAAGGACTGCAAGGCGCTGCAGAAAGTAGCAATCATCATCCCGT
TCCGAAACCGAGAGGAGCATCTGAAGTACTGGCTCTATTACATGCACCCA
ATTCTTCAAAGGCAGCAGCTAGATTATGGAGTGTATGTCATCAACCAGGA
TGGAGACGAAGAATTTAACCGTGCTAAACTGCTGAATGTAGGATTCACGG
AAGCTTTGAAGGAGTATGACTATGACTGCTTTGTGTTTAGTGATGTAGAC
CTGATCCCAATGGATGACAGGAACACCTACAAGTGCTACAGCCAACCAAG
GCACCTTTCTGTCTCCATGGATAAATTCGGATTTCGGTTACCCTACAATC
AGTATTTTGGAGGTGTGTCTGCCTTGAGCAAAGAACAATTCACGAAGATC
AATGGGTTTCCAAACAATTACTGGGGCTGGGGAGGCGAAGATGATGACAT
CTACAACAGGCTGGTGTTCAAAGGCATGGGCATATCTCGGCCAGATGCTG
TCATTGGGAAATGCAGAATGATTCGCCACTCGCGTGATCGGAAGAACGAG
CCCAACCCGGAGAGGTTTGACCGTATTGCTCACACCAGGGAGACGATGAG
CTCTGATGGCTTGAACTCGCTCTCCTACGAGGTGCTAAGGACTGACAGGT
TCCCTCTGTACACGAGGATCACAGTGGATATCGGAGCGCCCGGCAGCTGA SEQ GgGal114-362
(SEQ ID NO: 4): LEEVASTNPEVREGGRFAPKDCKALQKVAIIIPFRNREEHLKYWLYYMHP
ILQRQQLDYGVYVINQDGDEEFNRAKLLNVGFTEALKEYDYDCFVFSDVD
LIPMDDRNTYKCYSQPRHLSVSMDKFGFRLPYNQYFGGVSALSKEQFTKI
NGFPNNYWGWGGEDDDIYNRLVFKGMGISRPDAVIGKCRMIRHSRDRKNE
PNPERFDRIAHTRETMSSDGLNSLSYEVLRTDRFPLYTRITVDIGAPGS SEQ CASeco (SEQ
ID NO: 5): GGCGCGCCTCGAGGCGATCGCAGATCTATCGATGCATGCCATGGTACCCG
GGAGCTCGAATTCTAGAAGCTTCTGCAGACGCGTCGACGTCATATGGATC
CGCGAGAGACCTCTTAATTAA SEQ GgGalsyn (SEQ ID NO: 6):
CTCGAGGAGACCGAAGACAACATGAAGGAGCCAGCCCTCCCAGGTACATC
ACTTCAGAGGGCTTGCAGGCTCCTCGTCGCTTTCTGTGCACTTCACCTCT
CTGCAACTCTGCTCTACTACCTCGCAGGTAGTTCTCTCACGCCACCTAGA
AGTCCTGAACCTCCACCTAGACGACCACCTCCAGCTAACCTCTCTCTTCC
ACCATCTAGACCACCTCCTCCACCTGCTGCACGTCCACGACCTGGACCTG
TTTCAGCACAACCACGTAACCTCCCAGACTCTGCTCCATCTGGACTTTGT
CCTGACCCTTCTCCACTTCTCGTCGGACCACTTAGAGTTGAGTTCTCTCA GCCTGTGAACCTCGAG
SEQ GgGalsyn (SEQ ID NO: 7):
MKEPALPGTSLQRACRLLVAFCALHLSATLLYYLAGSSLTPPRSPEPPPR
RPPPANLSLPPSRPPPPPAARPRPGPVSAQPRNLPDSAPSGLCPDPSPLL VGPLRVEFSQPVNLE
SEQ HsGGal (SEQ ID NO: 8):
ATGAGGCTTCGGGAGCCTCTCCTCAGCGGCAGCGCCGCTATGAAGGAGCC
AGCCCTCCCAGGTACATCACTTCAGAGGGCTTGCAGGCTCCTCGTCGCTT
TCTGTGCACTTCACCTCTCTGCAACTCTGCTCTACTACCTCGCAGGTAGT
TCTCTCACGCCACCTAGAAGTCCTGAACCTCCACCTAGACGACCACCTCC
AGCTAACCTCTCTCTTCCACCATCTAGACCACCTCCTCCACCTGCTGCAC
GTCCACGACCTGGACCTGTTTCAGCACAACCACGTAACCTCCCAGACTCT
GCTCCATCTGGACTTTGTCCTGACCCTTCTCCACTTCTCGTCGGACCACT
TAGAGTTGAGTTCTCTCAGCCTGTGAACCTCGAGGAGGTGGCGAGCACAA
ACCCTGAGGTCAGGGAGGGAGGTCGTTTTGCTCCAAAGGACTGCAAGGCG
CTGCAGAAAGTAGCAATCATCATCCCGTTCCGAAACCGAGAGGAGCATCT
GAAGTACTGGCTCTATTACATGCACCCAATTCTTCAAAGGCAGCAGCTAG
ATTATGGAGTGTATGTCATCAACCAGGATGGAGACGAAGAATTTAACCGT
GCTAAACTGCTGAATGTAGGATTCACGGAAGCTTTGAAGGAGTATGACTA
TGACTGCTTTGTGTTTAGTGATGTAGACCTGATCCCAATGGATGACAGGA
ACACCTACAAGTGCTACAGCCAACCAAGGCACCTTTCTGTCTCCATGGAT
AAATTCGGATTTCGGTTACCCTACAATCAGTATTTTGGAGGTGTGTCTGC
CTTGAGCAAAGAACAATTCACGAAGATCAATGGGTTCCCAAACAATTACT
GGGGCTGGGGAGGCGAAGATGATGACATCTACAACAGGCTGGTGTTCAAA
GGCATGGGCATATCTCGGCCAGATGCTGTCATTGGGAAATGCAGAATGAT
TCGCCACTCGCGTGATCGGAAGAACGAGCCCAACCCGGAGAGGTTTGACC
GTATTGCTCACACCAGGGAGACGATGAGCTCTGATGGCTTGAACTCGCTC
TCCTACGAGGTGCTAAGGACTGACAGGTTCCCTCTGTACACGAGGATCAC
AGTGGATATCGGAGCGCCCGGCAGCTGA SEQ HsGgGal (SEQ ID NO: 9):
MRLREPLLSGSAAMKEPALPGTSLQRACRLLVAFCALHLSATLLYYLAGS
SLTPPRSPEPPPRRPPPANLSLPPSRPPPPPAARPRPGPVSAQPRNLPDS
APSGLCPDPSPLLVGPLRVEFSQPVNLEEVASTNPEVREGGRFAPKDCKA
LQKVAIIIPFRNREEHLKYWLYYMHPILQRQQLDYGVYVINQDGDEEFNR
AKLLNVGFTEALKEYDYDCFVFSDVDLIPMDDRNTYKCYSQPRHLSVSMD
KFGFRLPYNQYFGGVSALSKEQFTKINGFPNNYWGWGGEDDDIYNRLVFK
GMGISRPDAVIGKCRMIRHSRDRKNEPNPERFDRIAHTRETMSSDGLNSL
SYEVLRTDRFPLYTRITVDIGAPGS SEQ sialGGal (SEQ ID NO: 10):
ATGATTCATACCAACTTGAAGAAAAAGTTCAGCCTCTTCATCCTGGTCTT
TCTCCTGTTCGCAGTCATCTGTGTTTGGAAGAAAGGGAGCGACTATGAGG
CCCTTACACTGCAAGCCAAGGAGTTCCAGATGCCCAAGAGCCAGGAGAAA
GTGGCCATGACGCCACCTAGAAGTCCTGAACCTCCACCTAGACGACCACC
TCCAGCTAACCTCTCTCTTCCACCATCTAGACCACCTCCTCCACCTGCTG
CACGTCCACGACCTGGACCTGTTTCAGCACAACCACGTAACCTCCCAGAC
TCTGCTCCATCTGGACTTTGTCCTGACCCTTCTCCACTTCTCGTCGGACC
ACTTAGAGTTGAGTTCTCTCAGCCTGTGAACCTCGAGGAGGTGGCGAGCA
CAAACCCTGAGGTCAGGGAGGGAGGTCGTTTTGCTCCAAAGGACTGCAAG
GCGCTGCAGAAAGTAGCAATCATCATCCCGTTCCGAAACCGAGAGGAGCA
TCTGAAGTACTGGCTCTATTACATGCACCCAATTCTTCAAAGGCAGCAGC
TAGATTATGGAGTGTATGTCATCAACCAGGATGGAGACGAAGAATTTAAC
CGTGCTAAACTGCTGAATGTAGGATTCACGGAAGCTTTGAAGGAGTATGA
CTATGACTGCTTTGTGTTTAGTGATGTAGACCTGATCCCAATGGATGACA
GGAACACCTACAAGTGCTACAGCCAACCAAGGCACCTTTCTGTCTCCATG
GATAAATTCGGATTTCGGTTACCCTACAATCAGTATTTTGGAGGTGTGTC
TGCCTTGAGCAAAGAACAATTCACGAAGATCAATGGGTTTCCAAACAATT
ACTGGGGCTGGGGAGGCGAAGATGATGACATCTACAACAGGCTGGTGTTC
AAAGGCATGGGCATATCTCGGCCAGATGCTGTCATTGGGAAATGCAGAAT
GATTCGCCACTCGCGTGATCGGAAGAACGAGCCCAACCCGGAGAGGTTTG
ACCGTATTGCTCACACCAGGGAGACGATGAGCTCTGATGGCTTGAACTCG
CTCTCCTACGAGGTGCTAAGGACTGACAGGTTCCCTCTGTACACGAGGAT
CACAGTGGATATCGGAGCGCCCGGCAGCTGA SEQ sialGGal (SEQ ID NO: 11):
MIHTNLKKKFSLFILVFLLFAVICVWKKGSDYEALTLQAKEFQMPKSQEK
VAMTPPRSPEPPPRRPPPANLSLPPSRPPPPPAARPRPGPVSAQPRNLPD
SAPSGLCPDPSPLLVGPLRVEFSQPVNLEEVASTNPEVREGGRFAPKDCK
ALQKVAIIIPFRNREEHLKYWLYYMHPILQRQQLDYGVYVINQDGDEEFN
RAKLLNVGFTEALKEYDYDCFVFSDVDLIPMDDRNTYKCYSQPRHLSVSM
DKFGFRLPYNQYFGGVSALSKEQFTKINGFPNNYWGWGGEDDDIYNRLVF
KGMGISRPDAVIGKCRMIRHSRDRKNEPNPERFDRIAHTRETMSSDGLNS
LSYEVLRTDRFPLYTRITVDIGAPGS SEQ RAP40 (SEQ ID NO: 12):
GGCGCGCCAAGCTTGAATTAATTCTACTCCAAAAATATCAAAGATACAGT
CTCAGAAGACCAAAGGGCAATTGAGACTTTTCAACAAAGGGTAATATCCG
GAAACCTCCTCGGATTCCATTGCCCAGCTATCTGTCACTTTATTGTGAAG
ATAGTGGAAAAGGAAGGTGGCTCCTACAAATGCCATCATTGCGATAAAGG
AAAGGCCATCGTTGAAGATGCCTCTGCCGACAGTGGTCCCAAAGATGGAC
CCCCACCCACGAGGAGCATCGTGGAAAAAGAAGACGTTCCAACCACGTCT
TCAAAGCAAGTGGATTGATGTGATAATTCCGCATGGAGTCAAAGATTCAA
ATAGAGGACCTAACAGAACTCGCCGTAAAGACTGGCGAACAGTTCATACA
GAGTCTCTTACGACTCAATGACAAGAAGAAAATCTTCGTCAACATGGTGG
AGCACGACACACTTGTCTACTCCAAAAATATCAAAGATACAGTCTCAGAA
GACCAAAGGGCAATTGAGACTTTTCAACAAAGGGTAATATCCGGAAACCT
CCTCGGATTCCATTGCCCAGCTATCTGTCACTTTATTGTGAAGATAGTGG
AAAAGGAAGGTGGCTCCTACAAATGCCATCATTGCGATAAAGGAAAGGCC
ATCGTTGAAGATGCCTCTGCCGACAGTGGTCCCAAAGATGGACCCCCACC
CACGAGGAGCATCGTGGAAAAAGAAGACGTTCCAACCACGTCTTCAAAGC
AAGTGGATTGATGTGATATCTCCACTGACGTAAGGGATGACGCACAATCC
CACTATCCTTCGCAAGACCCTTCCTCTATATAAGGAAGTTCATTTCATTT
GGAGAGGGTTTTTATTTTTAATTTTCTTTCAAATACTTCCACCATGGGCG
AGCTCGGTACCCGGGGATCCCCGGGTACCGAGCTCGAATTTCCCCGATCG
TTCAAACATTTGGCAATAAAGTTTCTTAAGATTGAATCCTGTTGCCGGTC
TTGCGATGATTATCATATAATTTCTGTTGAATTACGTTAAGCATGTAATA
ATTAACATGTAATGCATGACGTTATTTATGAGATGGGTTTTTATGATTAG
AGTCCCGCAATTATACATTTAATACGCGATAGAAAACAAAATATAGCGCG
CAAACTAGGATAAATTATCGCGCGCGGTGTCATCTATGTTACTAGATCGG
GAATTCCAGATCTGCGGCCGCTTAATTAA SEQ Dgal (SEQ ID NO: 13):
TCTAGAAGACAACATGCCGGACTCCACCGGGAACTTCAGCCTCCTGCAGC
GGACCTGCTCTCTGGTGGTGCTGCTGTGCTTCTTACACATCTTTGTCACC
GTCATTTACTACATGAGGAACTCGGACTCTCGGCCAGCCTTCGCCCAGAA
CCAGCAGCAGAGACCGACGATACACAGGAAACTGGCGGAGCAGAGGGGCA
CCACTGAGGACAGCAGACCCGCGGCCAACGCCTCGAGCAACGGCCAGGAG
CTGCAGATCTGCCCAGAGGAGCCGCCGCGCCTGGTGGGTCCTCTGCGTGT
GGAGTTCTCAGACCCGATCACGTTAGAAATGGTGCGGACAGAGAACAGTG
TTCTGCAAGAGGGCGGACGCTTCAGACCCCCAGACTGCATAGCTCGGCAG
AAGGTGGCCATGATCATCCCCTTCCGGAACCGAGACGAGCACCTGAAGTT
CTGGCTCTATTACCTGCACCCCATCCTGCAGCGCCAACAGCTCGACTACG
GCGTCTACGTCATCAACCAGGATGGCGAGGACACGTTTAATCGAGCTAAA
CTCCTGAACATCGGCTATGCGGAGGCGCTGAAGGAGTACGATTACGACTG
TTTTGTGTTCAGCGACGTGGACCTGATCCCGATGGATGACCGCAACATCT
ACAAGTGCTACAATCAGCCCAGACACCTGGCCGTCTCCATGGACAAGTTC
GGCTTCAGGCTGCCGTACACACAGTATTTCGGTGGCGTTTCGTCGCTCAG
CAAAGAGCAGTTCCTGAAGATCAACGGATTCCCCAACAACTACTGGGGCT
GGGGCGGAGAGGACGACGACATCTTCAACAGGATCTCCTCCAGAGGGATG
TCGATATCTAGGCCTGACGGACTCCTGGGTCGCTGTAGGATGATCCGGCA
TGAGAGAGACAAGCAGAACGACCCAAACCCTCAAAGATTTGACCGAATCG
CGCACACAAGGGAAACCATGGCAACTGATGGGATCAATTCGCTAAAATAT
AACGTGGTAAAAATCGAGAAAGACCTGCTCTTCACCAAAATCACAGTGGA CGTGGGCAAACCCTGA
SEQ Dgal (SEQ ID NO: 14):
MPDSTGNFSLLQRTCSLVVLLCFLHIFVTVIYYMRNSDSRPAFAQNQQQR
PTIHRKLAEQRGTTEDSRPAANASSNGQELQICPEEPPRLVGPLRVEFSD
PITLEMVRTENSVLQEGGRFRPPDCIARQKVAMIIPFRNRDEHLKFWLYY
LHPILQRQQLDYGVYVINQDGEDTFNRAKLLNIGYAEALKEYDYDCFVFS
DVDLIPMDDRNIYKCYNQPRHLAVSMDKFGFRLPYTQYFGGVSSLSKEQF
LKINGFPNNYWGWGGEDDDIFNRISSRGMSISRPDGLLGRCRMIRHERDK
QNDPNPQRFDRIAHTRETMATDGINSLKYNVVKIEKDLLFTKITVDVGKP SEQ HsDGal (SEQ
ID NO: 15): TCTAGAAGACAACATGAGGCTTCGGGAGCCGCTCCTGAGCGGCAGCGCCG
CGATGCCGGACTCCACCGGGAACTTCAGCCTCCTGCAGCGGACCTGCTCT
CTGGTGGTGCTGCTGTGCTTCTTACACATCTTTGTCACCGTCATTTACTA
CATGAGGAACTCGGACTCTCGGCCAGCCTTCGCCCAGAACCAGCAGCAGA
GACCGACGATACACAGGAAACTGGCGGAGCAGAGGGGCACCACTGAGGAC
AGCAGACCCGCGGCCAACGCCTCGAGCAACGGCCAGGAGCTGCAGATCTG
CCCAGAGGAGCCGCCGCGCCTGGTGGGTCCTCTGCGTGTGGAGTTCTCAG
ACCCGATCACGTTAGAAATGGTGCGGACAGAGAACAGTGTTCTGCAAGAG
GGCGGACGCTTCAGACCCCCAGACTGCATAGCTCGGCAGAAGGTGGCCAT
GATCATCCCCTTCCGGAACCGAGACGAGCACCTGAAGTTCTGGCTCTATT
ACCTGCACCCCATCCTGCAGCGCCAACAGCTCGACTACGGCGTCTACGTC
ATCAACCAGGATGGCGAGGACACGTTTAATCGAGCTAAACTCCTGAACAT
CGGCTATGCGGAGGCGCTGAAGGAGTACGATTACGACTGTTTTGTGTTCA
GCGACGTGGACCTGATCCCGATGGATGACCGCAACATCTACAAGTGCTAC
AATCAGCCCAGACACCTGGCCGTCTCCATGGACAAGTTCGGCTTCAGGCT
GCCGTACACACAGTATTTCGGTGGCGTTTCGTCGCTCAGCAAAGAGCAGT
TCCTGAAGATCAACGGATTCCCCAACAACTACTGGGGCTGGGGCGGAGAG
GACGACGACATCTTCAACAGGATCTCCTCCAGAGGGATGTCGATATCTAG
GCCTGACGGACTCCTGGGTCGCTGTAGGATGATCCGGCATGAGAGAGACA
AGCAGAACGACCCAAACCCTCAAAGATTTGACCGAATCGCGCACACAAGG
GAAACCATGGCAACTGATGGGATCAATTCGCTAAAATATAACGTGGTAAA
AATCGAGAAAGACCTGCTCTTCACCAAAATCACAGTGGACGTGGGCAAAC CCTGA SEQ HsDGal
(SEQ ID NO: 16): MRLREPLLSGSAAMPDSTGNFSLLQRTCSLVVLLCFLHIFVTVIYYMRNS
DSRPAFAQNQQQRPTIHRKLAEQRGTTEDSRPAANASSNGQELQICPEEP
PRLVGPLRVEFSDPITLEMVRTENSVLQEGGRFRPPDCIARQKVAMIIPF
RNRDEHLKFWLYYLHPILQRQQLDYGVYVINQDGEDTFNRAKLLNIGYAE
ALKEYDYDCFVFSDVDLIPMDDRNIYKCYNQPRHLAVSMDKFGFRLPYTQ
YFGGVSSLSKEQFLKINGFPNNYWGWGGEDDDIFNRISSRGMSISRPDGL
LGRCRMIRHERDKQNDPNPQRFDRIAHTRETMATDGINSLKYNVVKIEKD LLFTKITVDVGKP
SEQ sialDGal (SEQ ID NO: 17):
ATGATTCATACCAACTTGAAGAAAAAGTTCAGCCTCTTCATCCTGGTCTT
TCTCCTGTTCGCAGTCATCTGTGTTTGGAAGAAAGGGAGCGACTATGAGG
CCCTTACACTGCAAGCCAAGGAGTTCCAGATGCCCAAGAGCCAGGAGAAA
GTGGCCATGCACAGGAAACTGGCGGAGCAGAGGGGCACCACTGAGGACAG
CAGACCCGCGGCCAACGCCTCGAGCAACGGCCAGGAGCTGCAGATCTGCC
CAGAGGAGCCGCCGCGCCTGGTGGGTCCTCTGCGTGTGGAGTTCTCAGAC
CCGATCACGTTAGAAATGGTGCGGACAGAGAACAGTGTTCTGCAAGAGGG
CGGACGCTTCAGACCCCCAGACTGCATAGCTCGGCAGAAGGTGGCCATGA
TCATCCCCTTCCGGAACCGAGACGAGCACCTGAAGTTCTGGCTCTATTAC
CTGCACCCCATCCTGCAGCGCCAACAGCTCGACTACGGCGTCTACGTCAT
CAACCAGGATGGCGAGGACACGTTTAATCGAGCTAAACTCCTGAACATCG
GCTATGCGGAGGCGCTGAAGGAGTACGATTACGACTGTTTTGTGTTCAGC
GACGTGGACCTGATCCCGATGGATGACCGCAACATCTACAAGTGCTACAA
TCAGCCCAGACACCTGGCCGTCTCCATGGACAAGTTCGGCTTCAGGCTGC
CGTACACACAGTATTTCGGTGGCGTTTCGTCGCTCAGCAAAGAGCAGTTC
CTGAAGATCAACGGATTCCCCAACAACTACTGGGGCTGGGGCGGAGAGGA
CGACGACATCTTCAACAGGATCTCCTCCAGAGGGATGTCGATATCTAGGC
CTGACGGACTCCTGGGTCGCTGTAGGATGATCCGGCATGAGAGAGACAAG
CAGAACGACCCAAACCCTCAAAGATTTGACCGAATCGCGCACACAAGGGA
AACCATGGCAACTGATGGGATCAATTCGCTAAAATATAACGTGGTAAAAA
TCGAGAAAGACCTGCTCTTCACCAAAATCACAGTGGACGTGGGCAAACCC TGA SEQ sialDGal
(SEQ ID NO: 18): MIHTNLKKKFSLFILVFLLFAVICVWKKGSDYEALTLQAKEFQMPKSQEK
VAMHRKLAEQRGTTEDSRPAANASSNGQELQICPEEPPRLVGPLRVEFSD
PITLEMVRTENSVLQEGGRFRPPDCIARQKVAMIIPFRNRDEHLKFWLYY
LHPILQRQQLDYGVYVINQDGEDTFNRAKLLNIGYAEALKEYDYDCFVFS
DVDLIPMDDRNIYKCYNQPRHLAVSMDKFGFRLPYTQYFGGVSSLSKEQF
LKINGFPNNYWGWGGEDDDIFNRISSRGMSISRPDGLLGRCRMIRHERDK
QNDPNPQRFDRIAHTRETMATDGINSLKYNVVKIEKDLLFTKITVDVGKP SEQ CTS sialT
(SEQ ID NO: 19):
ATGATTCATACCAACTTGAAGAAAAAGTTCAGCCTCTTCATCCTGGTCTT
TCTCCTGTTCGCAGTCATCTGTGTTTGGAAGAAAGGGAGCGACTATGAGG
CCCTTACACTGCAAGCCAAGGAATTCCAGATGCCCAAGAGCCAGGAGAAA GTGGCCATG SEQ
CTS sialT (SEQ ID NO: 20):
MIHTNLKKKFSLFILVFLLFAVICVWKKGSDYEALTLQAKEFQMPKSQEK VAM N-terminal
13 amino acid residues, human .beta.-1,4- galactosyltransferase 1
(SEQ ID NO: 21) MRLREPLLSGSAA
Sequence CWU 1
1
4311089DNAGallus gallusCDS(1)..(1089) 1atg aag gag cca gcc ctc cca
ggt aca tca ctt cag agg gct tgc agg 48Met Lys Glu Pro Ala Leu Pro
Gly Thr Ser Leu Gln Arg Ala Cys Arg1 5 10 15ctc ctc gtc gct ttc tgt
gca ctt cac ctc tct gca act ctg ctc tac 96Leu Leu Val Ala Phe Cys
Ala Leu His Leu Ser Ala Thr Leu Leu Tyr 20 25 30tac ctc gca ggt agt
tct ctc acg cca cct aga agt cct gaa cct cca 144Tyr Leu Ala Gly Ser
Ser Leu Thr Pro Pro Arg Ser Pro Glu Pro Pro 35 40 45cct aga cga cca
cct cca gct aac ctc tct ctt cca cca tct aga cca 192Pro Arg Arg Pro
Pro Pro Ala Asn Leu Ser Leu Pro Pro Ser Arg Pro 50 55 60cct cct cca
cct gct gca cgt cca cga cct gga cct gtt tca gca caa 240Pro Pro Pro
Pro Ala Ala Arg Pro Arg Pro Gly Pro Val Ser Ala Gln65 70 75 80cca
cgt aac ctc cca gac tct gct cca tct gga ctt tgt cct gac cct 288Pro
Arg Asn Leu Pro Asp Ser Ala Pro Ser Gly Leu Cys Pro Asp Pro 85 90
95tct cca ctt ctc gtc gga cca ctt aga gtt gag ttc tct cag cct gtg
336Ser Pro Leu Leu Val Gly Pro Leu Arg Val Glu Phe Ser Gln Pro Val
100 105 110aac ctc gag gag gtg gcg agc aca aac cct gag gtc agg gag
gga ggt 384Asn Leu Glu Glu Val Ala Ser Thr Asn Pro Glu Val Arg Glu
Gly Gly 115 120 125cgt ttt gct cca aag gac tgc aag gcg ctg cag aaa
gta gca atc atc 432Arg Phe Ala Pro Lys Asp Cys Lys Ala Leu Gln Lys
Val Ala Ile Ile 130 135 140atc ccg ttc cga aac cga gag gag cat ctg
aag tac tgg ctc tat tac 480Ile Pro Phe Arg Asn Arg Glu Glu His Leu
Lys Tyr Trp Leu Tyr Tyr145 150 155 160atg cac cca att ctt caa agg
cag cag cta gat tat gga gtg tat gtc 528Met His Pro Ile Leu Gln Arg
Gln Gln Leu Asp Tyr Gly Val Tyr Val 165 170 175atc aac cag gat gga
gac gaa gaa ttt aac cgt gct aaa ctg ctg aat 576Ile Asn Gln Asp Gly
Asp Glu Glu Phe Asn Arg Ala Lys Leu Leu Asn 180 185 190gta gga ttc
acg gaa gct ttg aag gag tat gac tat gac tgc ttt gtg 624Val Gly Phe
Thr Glu Ala Leu Lys Glu Tyr Asp Tyr Asp Cys Phe Val 195 200 205ttt
agt gat gta gac ctg atc cca atg gat gac agg aac acc tac aag 672Phe
Ser Asp Val Asp Leu Ile Pro Met Asp Asp Arg Asn Thr Tyr Lys 210 215
220tgc tac agc caa cca agg cac ctt tct gtc tcc atg gat aaa ttc gga
720Cys Tyr Ser Gln Pro Arg His Leu Ser Val Ser Met Asp Lys Phe
Gly225 230 235 240ttt cgg tta ccc tac aat cag tat ttt gga ggt gtg
tct gcc ttg agc 768Phe Arg Leu Pro Tyr Asn Gln Tyr Phe Gly Gly Val
Ser Ala Leu Ser 245 250 255aaa gaa caa ttc acg aag atc aat ggg ttc
cca aac aat tac tgg ggc 816Lys Glu Gln Phe Thr Lys Ile Asn Gly Phe
Pro Asn Asn Tyr Trp Gly 260 265 270tgg gga ggc gaa gat gat gac atc
tac aac agg ctg gtg ttc aaa ggc 864Trp Gly Gly Glu Asp Asp Asp Ile
Tyr Asn Arg Leu Val Phe Lys Gly 275 280 285atg ggc ata tct cgg cca
gat gct gtc att ggg aaa tgc aga atg att 912Met Gly Ile Ser Arg Pro
Asp Ala Val Ile Gly Lys Cys Arg Met Ile 290 295 300cgc cac tcg cgt
gat cgg aag aac gag ccc aac ccg gag agg ttt gac 960Arg His Ser Arg
Asp Arg Lys Asn Glu Pro Asn Pro Glu Arg Phe Asp305 310 315 320cgt
att gct cac acc agg gag acg atg agc tct gat ggc ttg aac tcg 1008Arg
Ile Ala His Thr Arg Glu Thr Met Ser Ser Asp Gly Leu Asn Ser 325 330
335ctc tcc tac gag gtg cta agg act gac agg ttc cct ctg tac acg agg
1056Leu Ser Tyr Glu Val Leu Arg Thr Asp Arg Phe Pro Leu Tyr Thr Arg
340 345 350atc aca gtg gat atc gga gcg ccc ggc agc tga 1089Ile Thr
Val Asp Ile Gly Ala Pro Gly Ser 355 3602362PRTGallus gallus 2Met
Lys Glu Pro Ala Leu Pro Gly Thr Ser Leu Gln Arg Ala Cys Arg1 5 10
15Leu Leu Val Ala Phe Cys Ala Leu His Leu Ser Ala Thr Leu Leu Tyr
20 25 30Tyr Leu Ala Gly Ser Ser Leu Thr Pro Pro Arg Ser Pro Glu Pro
Pro 35 40 45Pro Arg Arg Pro Pro Pro Ala Asn Leu Ser Leu Pro Pro Ser
Arg Pro 50 55 60Pro Pro Pro Pro Ala Ala Arg Pro Arg Pro Gly Pro Val
Ser Ala Gln65 70 75 80Pro Arg Asn Leu Pro Asp Ser Ala Pro Ser Gly
Leu Cys Pro Asp Pro 85 90 95Ser Pro Leu Leu Val Gly Pro Leu Arg Val
Glu Phe Ser Gln Pro Val 100 105 110Asn Leu Glu Glu Val Ala Ser Thr
Asn Pro Glu Val Arg Glu Gly Gly 115 120 125Arg Phe Ala Pro Lys Asp
Cys Lys Ala Leu Gln Lys Val Ala Ile Ile 130 135 140Ile Pro Phe Arg
Asn Arg Glu Glu His Leu Lys Tyr Trp Leu Tyr Tyr145 150 155 160Met
His Pro Ile Leu Gln Arg Gln Gln Leu Asp Tyr Gly Val Tyr Val 165 170
175Ile Asn Gln Asp Gly Asp Glu Glu Phe Asn Arg Ala Lys Leu Leu Asn
180 185 190Val Gly Phe Thr Glu Ala Leu Lys Glu Tyr Asp Tyr Asp Cys
Phe Val 195 200 205Phe Ser Asp Val Asp Leu Ile Pro Met Asp Asp Arg
Asn Thr Tyr Lys 210 215 220Cys Tyr Ser Gln Pro Arg His Leu Ser Val
Ser Met Asp Lys Phe Gly225 230 235 240Phe Arg Leu Pro Tyr Asn Gln
Tyr Phe Gly Gly Val Ser Ala Leu Ser 245 250 255Lys Glu Gln Phe Thr
Lys Ile Asn Gly Phe Pro Asn Asn Tyr Trp Gly 260 265 270Trp Gly Gly
Glu Asp Asp Asp Ile Tyr Asn Arg Leu Val Phe Lys Gly 275 280 285Met
Gly Ile Ser Arg Pro Asp Ala Val Ile Gly Lys Cys Arg Met Ile 290 295
300Arg His Ser Arg Asp Arg Lys Asn Glu Pro Asn Pro Glu Arg Phe
Asp305 310 315 320Arg Ile Ala His Thr Arg Glu Thr Met Ser Ser Asp
Gly Leu Asn Ser 325 330 335Leu Ser Tyr Glu Val Leu Arg Thr Asp Arg
Phe Pro Leu Tyr Thr Arg 340 345 350Ile Thr Val Asp Ile Gly Ala Pro
Gly Ser 355 3603750DNAGallus gallusCDS(1)..(750) 3ctc gag gag gtg
gcg agc aca aac cct gag gtc agg gag gga ggt cgt 48Leu Glu Glu Val
Ala Ser Thr Asn Pro Glu Val Arg Glu Gly Gly Arg1 5 10 15ttt gct cca
aag gac tgc aag gcg ctg cag aaa gta gca atc atc atc 96Phe Ala Pro
Lys Asp Cys Lys Ala Leu Gln Lys Val Ala Ile Ile Ile 20 25 30ccg ttc
cga aac cga gag gag cat ctg aag tac tgg ctc tat tac atg 144Pro Phe
Arg Asn Arg Glu Glu His Leu Lys Tyr Trp Leu Tyr Tyr Met 35 40 45cac
cca att ctt caa agg cag cag cta gat tat gga gtg tat gtc atc 192His
Pro Ile Leu Gln Arg Gln Gln Leu Asp Tyr Gly Val Tyr Val Ile 50 55
60aac cag gat gga gac gaa gaa ttt aac cgt gct aaa ctg ctg aat gta
240Asn Gln Asp Gly Asp Glu Glu Phe Asn Arg Ala Lys Leu Leu Asn
Val65 70 75 80gga ttc acg gaa gct ttg aag gag tat gac tat gac tgc
ttt gtg ttt 288Gly Phe Thr Glu Ala Leu Lys Glu Tyr Asp Tyr Asp Cys
Phe Val Phe 85 90 95agt gat gta gac ctg atc cca atg gat gac agg aac
acc tac aag tgc 336Ser Asp Val Asp Leu Ile Pro Met Asp Asp Arg Asn
Thr Tyr Lys Cys 100 105 110tac agc caa cca agg cac ctt tct gtc tcc
atg gat aaa ttc gga ttt 384Tyr Ser Gln Pro Arg His Leu Ser Val Ser
Met Asp Lys Phe Gly Phe 115 120 125cgg tta ccc tac aat cag tat ttt
gga ggt gtg tct gcc ttg agc aaa 432Arg Leu Pro Tyr Asn Gln Tyr Phe
Gly Gly Val Ser Ala Leu Ser Lys 130 135 140gaa caa ttc acg aag atc
aat ggg ttt cca aac aat tac tgg ggc tgg 480Glu Gln Phe Thr Lys Ile
Asn Gly Phe Pro Asn Asn Tyr Trp Gly Trp145 150 155 160gga ggc gaa
gat gat gac atc tac aac agg ctg gtg ttc aaa ggc atg 528Gly Gly Glu
Asp Asp Asp Ile Tyr Asn Arg Leu Val Phe Lys Gly Met 165 170 175ggc
ata tct cgg cca gat gct gtc att ggg aaa tgc aga atg att cgc 576Gly
Ile Ser Arg Pro Asp Ala Val Ile Gly Lys Cys Arg Met Ile Arg 180 185
190cac tcg cgt gat cgg aag aac gag ccc aac ccg gag agg ttt gac cgt
624His Ser Arg Asp Arg Lys Asn Glu Pro Asn Pro Glu Arg Phe Asp Arg
195 200 205att gct cac acc agg gag acg atg agc tct gat ggc ttg aac
tcg ctc 672Ile Ala His Thr Arg Glu Thr Met Ser Ser Asp Gly Leu Asn
Ser Leu 210 215 220tcc tac gag gtg cta agg act gac agg ttc cct ctg
tac acg agg atc 720Ser Tyr Glu Val Leu Arg Thr Asp Arg Phe Pro Leu
Tyr Thr Arg Ile225 230 235 240aca gtg gat atc gga gcg ccc ggc agc
tga 750Thr Val Asp Ile Gly Ala Pro Gly Ser 2454249PRTGallus gallus
4Leu Glu Glu Val Ala Ser Thr Asn Pro Glu Val Arg Glu Gly Gly Arg1 5
10 15Phe Ala Pro Lys Asp Cys Lys Ala Leu Gln Lys Val Ala Ile Ile
Ile 20 25 30Pro Phe Arg Asn Arg Glu Glu His Leu Lys Tyr Trp Leu Tyr
Tyr Met 35 40 45His Pro Ile Leu Gln Arg Gln Gln Leu Asp Tyr Gly Val
Tyr Val Ile 50 55 60Asn Gln Asp Gly Asp Glu Glu Phe Asn Arg Ala Lys
Leu Leu Asn Val65 70 75 80Gly Phe Thr Glu Ala Leu Lys Glu Tyr Asp
Tyr Asp Cys Phe Val Phe 85 90 95Ser Asp Val Asp Leu Ile Pro Met Asp
Asp Arg Asn Thr Tyr Lys Cys 100 105 110Tyr Ser Gln Pro Arg His Leu
Ser Val Ser Met Asp Lys Phe Gly Phe 115 120 125Arg Leu Pro Tyr Asn
Gln Tyr Phe Gly Gly Val Ser Ala Leu Ser Lys 130 135 140Glu Gln Phe
Thr Lys Ile Asn Gly Phe Pro Asn Asn Tyr Trp Gly Trp145 150 155
160Gly Gly Glu Asp Asp Asp Ile Tyr Asn Arg Leu Val Phe Lys Gly Met
165 170 175Gly Ile Ser Arg Pro Asp Ala Val Ile Gly Lys Cys Arg Met
Ile Arg 180 185 190His Ser Arg Asp Arg Lys Asn Glu Pro Asn Pro Glu
Arg Phe Asp Arg 195 200 205Ile Ala His Thr Arg Glu Thr Met Ser Ser
Asp Gly Leu Asn Ser Leu 210 215 220Ser Tyr Glu Val Leu Arg Thr Asp
Arg Phe Pro Leu Tyr Thr Arg Ile225 230 235 240Thr Val Asp Ile Gly
Ala Pro Gly Ser 2455121DNAartificial sequencesynthetic
oligonucleotide (CASeco) 5ggcgcgcctc gaggcgatcg cagatctatc
gatgcatgcc atggtacccg ggagctcgaa 60ttctagaagc ttctgcagac gcgtcgacgt
catatggatc cgcgagagac ctcttaatta 120a 1216366DNAartificial
sequencesynthetic oligonucleotide (GGal N-terminus) 6ctcgaggaga
ccgaagacaa c atg aag gag cca gcc ctc cca ggt aca tca 51 Met Lys Glu
Pro Ala Leu Pro Gly Thr Ser 1 5 10ctt cag agg gct tgc agg ctc ctc
gtc gct ttc tgt gca ctt cac ctc 99Leu Gln Arg Ala Cys Arg Leu Leu
Val Ala Phe Cys Ala Leu His Leu 15 20 25tct gca act ctg ctc tac tac
ctc gca ggt agt tct ctc acg cca cct 147Ser Ala Thr Leu Leu Tyr Tyr
Leu Ala Gly Ser Ser Leu Thr Pro Pro 30 35 40aga agt cct gaa cct cca
cct aga cga cca cct cca gct aac ctc tct 195Arg Ser Pro Glu Pro Pro
Pro Arg Arg Pro Pro Pro Ala Asn Leu Ser 45 50 55ctt cca cca tct aga
cca cct cct cca cct gct gca cgt cca cga cct 243Leu Pro Pro Ser Arg
Pro Pro Pro Pro Pro Ala Ala Arg Pro Arg Pro 60 65 70gga cct gtt tca
gca caa cca cgt aac ctc cca gac tct gct cca tct 291Gly Pro Val Ser
Ala Gln Pro Arg Asn Leu Pro Asp Ser Ala Pro Ser75 80 85 90gga ctt
tgt cct gac cct tct cca ctt ctc gtc gga cca ctt aga gtt 339Gly Leu
Cys Pro Asp Pro Ser Pro Leu Leu Val Gly Pro Leu Arg Val 95 100
105gag ttc tct cag cct gtg aac ctc gag 366Glu Phe Ser Gln Pro Val
Asn Leu Glu 110 1157115PRTartificial sequencesynthetic peptide 7Met
Lys Glu Pro Ala Leu Pro Gly Thr Ser Leu Gln Arg Ala Cys Arg1 5 10
15Leu Leu Val Ala Phe Cys Ala Leu His Leu Ser Ala Thr Leu Leu Tyr
20 25 30Tyr Leu Ala Gly Ser Ser Leu Thr Pro Pro Arg Ser Pro Glu Pro
Pro 35 40 45Pro Arg Arg Pro Pro Pro Ala Asn Leu Ser Leu Pro Pro Ser
Arg Pro 50 55 60Pro Pro Pro Pro Ala Ala Arg Pro Arg Pro Gly Pro Val
Ser Ala Gln65 70 75 80Pro Arg Asn Leu Pro Asp Ser Ala Pro Ser Gly
Leu Cys Pro Asp Pro 85 90 95Ser Pro Leu Leu Val Gly Pro Leu Arg Val
Glu Phe Ser Gln Pro Val 100 105 110Asn Leu Glu
11581128DNAartificial sequencesynthetic oligonucleotide (HsGGal)
8atg agg ctt cgg gag cct ctc ctc agc ggc agc gcc gct atg aag gag
48Met Arg Leu Arg Glu Pro Leu Leu Ser Gly Ser Ala Ala Met Lys Glu1
5 10 15cca gcc ctc cca ggt aca tca ctt cag agg gct tgc agg ctc ctc
gtc 96Pro Ala Leu Pro Gly Thr Ser Leu Gln Arg Ala Cys Arg Leu Leu
Val 20 25 30gct ttc tgt gca ctt cac ctc tct gca act ctg ctc tac tac
ctc gca 144Ala Phe Cys Ala Leu His Leu Ser Ala Thr Leu Leu Tyr Tyr
Leu Ala 35 40 45ggt agt tct ctc acg cca cct aga agt cct gaa cct cca
cct aga cga 192Gly Ser Ser Leu Thr Pro Pro Arg Ser Pro Glu Pro Pro
Pro Arg Arg 50 55 60cca cct cca gct aac ctc tct ctt cca cca tct aga
cca cct cct cca 240Pro Pro Pro Ala Asn Leu Ser Leu Pro Pro Ser Arg
Pro Pro Pro Pro65 70 75 80cct gct gca cgt cca cga cct gga cct gtt
tca gca caa cca cgt aac 288Pro Ala Ala Arg Pro Arg Pro Gly Pro Val
Ser Ala Gln Pro Arg Asn 85 90 95ctc cca gac tct gct cca tct gga ctt
tgt cct gac cct tct cca ctt 336Leu Pro Asp Ser Ala Pro Ser Gly Leu
Cys Pro Asp Pro Ser Pro Leu 100 105 110ctc gtc gga cca ctt aga gtt
gag ttc tct cag cct gtg aac ctc gag 384Leu Val Gly Pro Leu Arg Val
Glu Phe Ser Gln Pro Val Asn Leu Glu 115 120 125gag gtg gcg agc aca
aac cct gag gtc agg gag gga ggt cgt ttt gct 432Glu Val Ala Ser Thr
Asn Pro Glu Val Arg Glu Gly Gly Arg Phe Ala 130 135 140cca aag gac
tgc aag gcg ctg cag aaa gta gca atc atc atc ccg ttc 480Pro Lys Asp
Cys Lys Ala Leu Gln Lys Val Ala Ile Ile Ile Pro Phe145 150 155
160cga aac cga gag gag cat ctg aag tac tgg ctc tat tac atg cac cca
528Arg Asn Arg Glu Glu His Leu Lys Tyr Trp Leu Tyr Tyr Met His Pro
165 170 175att ctt caa agg cag cag cta gat tat gga gtg tat gtc atc
aac cag 576Ile Leu Gln Arg Gln Gln Leu Asp Tyr Gly Val Tyr Val Ile
Asn Gln 180 185 190gat gga gac gaa gaa ttt aac cgt gct aaa ctg ctg
aat gta gga ttc 624Asp Gly Asp Glu Glu Phe Asn Arg Ala Lys Leu Leu
Asn Val Gly Phe 195 200 205acg gaa gct ttg aag gag tat gac tat gac
tgc ttt gtg ttt agt gat 672Thr Glu Ala Leu Lys Glu Tyr Asp Tyr Asp
Cys Phe Val Phe Ser Asp 210 215 220gta gac ctg atc cca atg gat gac
agg aac acc tac aag tgc tac agc 720Val Asp Leu Ile Pro Met Asp Asp
Arg Asn Thr Tyr Lys Cys Tyr Ser225 230 235 240caa cca agg cac ctt
tct gtc tcc atg gat aaa ttc gga ttt cgg tta 768Gln Pro Arg His Leu
Ser Val Ser Met Asp Lys Phe Gly Phe Arg Leu 245 250 255ccc tac aat
cag tat ttt gga ggt gtg tct gcc ttg agc aaa gaa caa 816Pro Tyr Asn
Gln Tyr Phe Gly Gly Val Ser Ala Leu Ser Lys Glu Gln 260 265 270ttc
acg aag atc aat ggg ttc cca aac aat tac tgg ggc tgg gga ggc 864Phe
Thr Lys Ile Asn Gly Phe Pro Asn Asn Tyr Trp Gly Trp Gly Gly 275 280
285gaa gat gat gac atc tac aac agg ctg gtg ttc aaa ggc atg ggc ata
912Glu Asp Asp Asp Ile Tyr Asn
Arg Leu Val Phe Lys Gly Met Gly Ile 290 295 300tct cgg cca gat gct
gtc att ggg aaa tgc aga atg att cgc cac tcg 960Ser Arg Pro Asp Ala
Val Ile Gly Lys Cys Arg Met Ile Arg His Ser305 310 315 320cgt gat
cgg aag aac gag ccc aac ccg gag agg ttt gac cgt att gct 1008Arg Asp
Arg Lys Asn Glu Pro Asn Pro Glu Arg Phe Asp Arg Ile Ala 325 330
335cac acc agg gag acg atg agc tct gat ggc ttg aac tcg ctc tcc tac
1056His Thr Arg Glu Thr Met Ser Ser Asp Gly Leu Asn Ser Leu Ser Tyr
340 345 350gag gtg cta agg act gac agg ttc cct ctg tac acg agg atc
aca gtg 1104Glu Val Leu Arg Thr Asp Arg Phe Pro Leu Tyr Thr Arg Ile
Thr Val 355 360 365gat atc gga gcg ccc ggc agc tga 1128Asp Ile Gly
Ala Pro Gly Ser 370 3759375PRTartificial sequencesynthetic peptide
9Met Arg Leu Arg Glu Pro Leu Leu Ser Gly Ser Ala Ala Met Lys Glu1 5
10 15Pro Ala Leu Pro Gly Thr Ser Leu Gln Arg Ala Cys Arg Leu Leu
Val 20 25 30Ala Phe Cys Ala Leu His Leu Ser Ala Thr Leu Leu Tyr Tyr
Leu Ala 35 40 45Gly Ser Ser Leu Thr Pro Pro Arg Ser Pro Glu Pro Pro
Pro Arg Arg 50 55 60Pro Pro Pro Ala Asn Leu Ser Leu Pro Pro Ser Arg
Pro Pro Pro Pro65 70 75 80Pro Ala Ala Arg Pro Arg Pro Gly Pro Val
Ser Ala Gln Pro Arg Asn 85 90 95Leu Pro Asp Ser Ala Pro Ser Gly Leu
Cys Pro Asp Pro Ser Pro Leu 100 105 110Leu Val Gly Pro Leu Arg Val
Glu Phe Ser Gln Pro Val Asn Leu Glu 115 120 125Glu Val Ala Ser Thr
Asn Pro Glu Val Arg Glu Gly Gly Arg Phe Ala 130 135 140Pro Lys Asp
Cys Lys Ala Leu Gln Lys Val Ala Ile Ile Ile Pro Phe145 150 155
160Arg Asn Arg Glu Glu His Leu Lys Tyr Trp Leu Tyr Tyr Met His Pro
165 170 175Ile Leu Gln Arg Gln Gln Leu Asp Tyr Gly Val Tyr Val Ile
Asn Gln 180 185 190Asp Gly Asp Glu Glu Phe Asn Arg Ala Lys Leu Leu
Asn Val Gly Phe 195 200 205Thr Glu Ala Leu Lys Glu Tyr Asp Tyr Asp
Cys Phe Val Phe Ser Asp 210 215 220Val Asp Leu Ile Pro Met Asp Asp
Arg Asn Thr Tyr Lys Cys Tyr Ser225 230 235 240Gln Pro Arg His Leu
Ser Val Ser Met Asp Lys Phe Gly Phe Arg Leu 245 250 255Pro Tyr Asn
Gln Tyr Phe Gly Gly Val Ser Ala Leu Ser Lys Glu Gln 260 265 270Phe
Thr Lys Ile Asn Gly Phe Pro Asn Asn Tyr Trp Gly Trp Gly Gly 275 280
285Glu Asp Asp Asp Ile Tyr Asn Arg Leu Val Phe Lys Gly Met Gly Ile
290 295 300Ser Arg Pro Asp Ala Val Ile Gly Lys Cys Arg Met Ile Arg
His Ser305 310 315 320Arg Asp Arg Lys Asn Glu Pro Asn Pro Glu Arg
Phe Asp Arg Ile Ala 325 330 335His Thr Arg Glu Thr Met Ser Ser Asp
Gly Leu Asn Ser Leu Ser Tyr 340 345 350Glu Val Leu Arg Thr Asp Arg
Phe Pro Leu Tyr Thr Arg Ile Thr Val 355 360 365Asp Ile Gly Ala Pro
Gly Ser 370 375101131DNAartificial sequencesynthetic
oligonucleotide (sialGGal) 10atg att cat acc aac ttg aag aaa aag
ttc agc ctc ttc atc ctg gtc 48Met Ile His Thr Asn Leu Lys Lys Lys
Phe Ser Leu Phe Ile Leu Val1 5 10 15ttt ctc ctg ttc gca gtc atc tgt
gtt tgg aag aaa ggg agc gac tat 96Phe Leu Leu Phe Ala Val Ile Cys
Val Trp Lys Lys Gly Ser Asp Tyr 20 25 30gag gcc ctt aca ctg caa gcc
aag gag ttc cag atg ccc aag agc cag 144Glu Ala Leu Thr Leu Gln Ala
Lys Glu Phe Gln Met Pro Lys Ser Gln 35 40 45gag aaa gtg gcc atg acg
cca cct aga agt cct gaa cct cca cct aga 192Glu Lys Val Ala Met Thr
Pro Pro Arg Ser Pro Glu Pro Pro Pro Arg 50 55 60cga cca cct cca gct
aac ctc tct ctt cca cca tct aga cca cct cct 240Arg Pro Pro Pro Ala
Asn Leu Ser Leu Pro Pro Ser Arg Pro Pro Pro65 70 75 80cca cct gct
gca cgt cca cga cct gga cct gtt tca gca caa cca cgt 288Pro Pro Ala
Ala Arg Pro Arg Pro Gly Pro Val Ser Ala Gln Pro Arg 85 90 95aac ctc
cca gac tct gct cca tct gga ctt tgt cct gac cct tct cca 336Asn Leu
Pro Asp Ser Ala Pro Ser Gly Leu Cys Pro Asp Pro Ser Pro 100 105
110ctt ctc gtc gga cca ctt aga gtt gag ttc tct cag cct gtg aac ctc
384Leu Leu Val Gly Pro Leu Arg Val Glu Phe Ser Gln Pro Val Asn Leu
115 120 125gag gag gtg gcg agc aca aac cct gag gtc agg gag gga ggt
cgt ttt 432Glu Glu Val Ala Ser Thr Asn Pro Glu Val Arg Glu Gly Gly
Arg Phe 130 135 140gct cca aag gac tgc aag gcg ctg cag aaa gta gca
atc atc atc ccg 480Ala Pro Lys Asp Cys Lys Ala Leu Gln Lys Val Ala
Ile Ile Ile Pro145 150 155 160ttc cga aac cga gag gag cat ctg aag
tac tgg ctc tat tac atg cac 528Phe Arg Asn Arg Glu Glu His Leu Lys
Tyr Trp Leu Tyr Tyr Met His 165 170 175cca att ctt caa agg cag cag
cta gat tat gga gtg tat gtc atc aac 576Pro Ile Leu Gln Arg Gln Gln
Leu Asp Tyr Gly Val Tyr Val Ile Asn 180 185 190cag gat gga gac gaa
gaa ttt aac cgt gct aaa ctg ctg aat gta gga 624Gln Asp Gly Asp Glu
Glu Phe Asn Arg Ala Lys Leu Leu Asn Val Gly 195 200 205ttc acg gaa
gct ttg aag gag tat gac tat gac tgc ttt gtg ttt agt 672Phe Thr Glu
Ala Leu Lys Glu Tyr Asp Tyr Asp Cys Phe Val Phe Ser 210 215 220gat
gta gac ctg atc cca atg gat gac agg aac acc tac aag tgc tac 720Asp
Val Asp Leu Ile Pro Met Asp Asp Arg Asn Thr Tyr Lys Cys Tyr225 230
235 240agc caa cca agg cac ctt tct gtc tcc atg gat aaa ttc gga ttt
cgg 768Ser Gln Pro Arg His Leu Ser Val Ser Met Asp Lys Phe Gly Phe
Arg 245 250 255tta ccc tac aat cag tat ttt gga ggt gtg tct gcc ttg
agc aaa gaa 816Leu Pro Tyr Asn Gln Tyr Phe Gly Gly Val Ser Ala Leu
Ser Lys Glu 260 265 270caa ttc acg aag atc aat ggg ttt cca aac aat
tac tgg ggc tgg gga 864Gln Phe Thr Lys Ile Asn Gly Phe Pro Asn Asn
Tyr Trp Gly Trp Gly 275 280 285ggc gaa gat gat gac atc tac aac agg
ctg gtg ttc aaa ggc atg ggc 912Gly Glu Asp Asp Asp Ile Tyr Asn Arg
Leu Val Phe Lys Gly Met Gly 290 295 300ata tct cgg cca gat gct gtc
att ggg aaa tgc aga atg att cgc cac 960Ile Ser Arg Pro Asp Ala Val
Ile Gly Lys Cys Arg Met Ile Arg His305 310 315 320tcg cgt gat cgg
aag aac gag ccc aac ccg gag agg ttt gac cgt att 1008Ser Arg Asp Arg
Lys Asn Glu Pro Asn Pro Glu Arg Phe Asp Arg Ile 325 330 335gct cac
acc agg gag acg atg agc tct gat ggc ttg aac tcg ctc tcc 1056Ala His
Thr Arg Glu Thr Met Ser Ser Asp Gly Leu Asn Ser Leu Ser 340 345
350tac gag gtg cta agg act gac agg ttc cct ctg tac acg agg atc aca
1104Tyr Glu Val Leu Arg Thr Asp Arg Phe Pro Leu Tyr Thr Arg Ile Thr
355 360 365gtg gat atc gga gcg ccc ggc agc tga 1131Val Asp Ile Gly
Ala Pro Gly Ser 370 37511376PRTartificial sequencesynthetic petide
11Met Ile His Thr Asn Leu Lys Lys Lys Phe Ser Leu Phe Ile Leu Val1
5 10 15Phe Leu Leu Phe Ala Val Ile Cys Val Trp Lys Lys Gly Ser Asp
Tyr 20 25 30Glu Ala Leu Thr Leu Gln Ala Lys Glu Phe Gln Met Pro Lys
Ser Gln 35 40 45Glu Lys Val Ala Met Thr Pro Pro Arg Ser Pro Glu Pro
Pro Pro Arg 50 55 60Arg Pro Pro Pro Ala Asn Leu Ser Leu Pro Pro Ser
Arg Pro Pro Pro65 70 75 80Pro Pro Ala Ala Arg Pro Arg Pro Gly Pro
Val Ser Ala Gln Pro Arg 85 90 95Asn Leu Pro Asp Ser Ala Pro Ser Gly
Leu Cys Pro Asp Pro Ser Pro 100 105 110Leu Leu Val Gly Pro Leu Arg
Val Glu Phe Ser Gln Pro Val Asn Leu 115 120 125Glu Glu Val Ala Ser
Thr Asn Pro Glu Val Arg Glu Gly Gly Arg Phe 130 135 140Ala Pro Lys
Asp Cys Lys Ala Leu Gln Lys Val Ala Ile Ile Ile Pro145 150 155
160Phe Arg Asn Arg Glu Glu His Leu Lys Tyr Trp Leu Tyr Tyr Met His
165 170 175Pro Ile Leu Gln Arg Gln Gln Leu Asp Tyr Gly Val Tyr Val
Ile Asn 180 185 190Gln Asp Gly Asp Glu Glu Phe Asn Arg Ala Lys Leu
Leu Asn Val Gly 195 200 205Phe Thr Glu Ala Leu Lys Glu Tyr Asp Tyr
Asp Cys Phe Val Phe Ser 210 215 220Asp Val Asp Leu Ile Pro Met Asp
Asp Arg Asn Thr Tyr Lys Cys Tyr225 230 235 240Ser Gln Pro Arg His
Leu Ser Val Ser Met Asp Lys Phe Gly Phe Arg 245 250 255Leu Pro Tyr
Asn Gln Tyr Phe Gly Gly Val Ser Ala Leu Ser Lys Glu 260 265 270Gln
Phe Thr Lys Ile Asn Gly Phe Pro Asn Asn Tyr Trp Gly Trp Gly 275 280
285Gly Glu Asp Asp Asp Ile Tyr Asn Arg Leu Val Phe Lys Gly Met Gly
290 295 300Ile Ser Arg Pro Asp Ala Val Ile Gly Lys Cys Arg Met Ile
Arg His305 310 315 320Ser Arg Asp Arg Lys Asn Glu Pro Asn Pro Glu
Arg Phe Asp Arg Ile 325 330 335Ala His Thr Arg Glu Thr Met Ser Ser
Asp Gly Leu Asn Ser Leu Ser 340 345 350Tyr Glu Val Leu Arg Thr Asp
Arg Phe Pro Leu Tyr Thr Arg Ile Thr 355 360 365Val Asp Ile Gly Ala
Pro Gly Ser 370 375121229DNAartificial sequencesynthetic
oligonucleotide (cassette RAP40) 12ggcgcgccaa gcttgaatta attctactcc
aaaaatatca aagatacagt ctcagaagac 60caaagggcaa ttgagacttt tcaacaaagg
gtaatatccg gaaacctcct cggattccat 120tgcccagcta tctgtcactt
tattgtgaag atagtggaaa aggaaggtgg ctcctacaaa 180tgccatcatt
gcgataaagg aaaggccatc gttgaagatg cctctgccga cagtggtccc
240aaagatggac ccccacccac gaggagcatc gtggaaaaag aagacgttcc
aaccacgtct 300tcaaagcaag tggattgatg tgataattcc gcatggagtc
aaagattcaa atagaggacc 360taacagaact cgccgtaaag actggcgaac
agttcataca gagtctctta cgactcaatg 420acaagaagaa aatcttcgtc
aacatggtgg agcacgacac acttgtctac tccaaaaata 480tcaaagatac
agtctcagaa gaccaaaggg caattgagac ttttcaacaa agggtaatat
540ccggaaacct cctcggattc cattgcccag ctatctgtca ctttattgtg
aagatagtgg 600aaaaggaagg tggctcctac aaatgccatc attgcgataa
aggaaaggcc atcgttgaag 660atgcctctgc cgacagtggt cccaaagatg
gacccccacc cacgaggagc atcgtggaaa 720aagaagacgt tccaaccacg
tcttcaaagc aagtggattg atgtgatatc tccactgacg 780taagggatga
cgcacaatcc cactatcctt cgcaagaccc ttcctctata taaggaagtt
840catttcattt ggagagggtt tttattttta attttctttc aaatacttcc
accatgggcg 900agctcggtac ccggggatcc ccgggtaccg agctcgaatt
tccccgatcg ttcaaacatt 960tggcaataaa gtttcttaag attgaatcct
gttgccggtc ttgcgatgat tatcatataa 1020tttctgttga attacgttaa
gcatgtaata attaacatgt aatgcatgac gttatttatg 1080agatgggttt
ttatgattag agtcccgcaa ttatacattt aatacgcgat agaaaacaaa
1140atatagcgcg caaactagga taaattatcg cgcgcggtgt catctatgtt
actagatcgg 1200gaattccaga tctgcggccg cttaattaa 1229131066DNADanio
rerioCDS(14)..(1066) 13tctagaagac aac atg ccg gac tcc acc ggg aac
ttc agc ctc ctg cag 49 Met Pro Asp Ser Thr Gly Asn Phe Ser Leu Leu
Gln 1 5 10cgg acc tgc tct ctg gtg gtg ctg ctg tgc ttc tta cac atc
ttt gtc 97Arg Thr Cys Ser Leu Val Val Leu Leu Cys Phe Leu His Ile
Phe Val 15 20 25acc gtc att tac tac atg agg aac tcg gac tct cgg cca
gcc ttc gcc 145Thr Val Ile Tyr Tyr Met Arg Asn Ser Asp Ser Arg Pro
Ala Phe Ala 30 35 40cag aac cag cag cag aga ccg acg ata cac agg aaa
ctg gcg gag cag 193Gln Asn Gln Gln Gln Arg Pro Thr Ile His Arg Lys
Leu Ala Glu Gln45 50 55 60agg ggc acc act gag gac agc aga ccc gcg
gcc aac gcc tcg agc aac 241Arg Gly Thr Thr Glu Asp Ser Arg Pro Ala
Ala Asn Ala Ser Ser Asn 65 70 75ggc cag gag ctg cag atc tgc cca gag
gag ccg ccg cgc ctg gtg ggt 289Gly Gln Glu Leu Gln Ile Cys Pro Glu
Glu Pro Pro Arg Leu Val Gly 80 85 90cct ctg cgt gtg gag ttc tca gac
ccg atc acg tta gaa atg gtg cgg 337Pro Leu Arg Val Glu Phe Ser Asp
Pro Ile Thr Leu Glu Met Val Arg 95 100 105aca gag aac agt gtt ctg
caa gag ggc gga cgc ttc aga ccc cca gac 385Thr Glu Asn Ser Val Leu
Gln Glu Gly Gly Arg Phe Arg Pro Pro Asp 110 115 120tgc ata gct cgg
cag aag gtg gcc atg atc atc ccc ttc cgg aac cga 433Cys Ile Ala Arg
Gln Lys Val Ala Met Ile Ile Pro Phe Arg Asn Arg125 130 135 140gac
gag cac ctg aag ttc tgg ctc tat tac ctg cac ccc atc ctg cag 481Asp
Glu His Leu Lys Phe Trp Leu Tyr Tyr Leu His Pro Ile Leu Gln 145 150
155cgc caa cag ctc gac tac ggc gtc tac gtc atc aac cag gat ggc gag
529Arg Gln Gln Leu Asp Tyr Gly Val Tyr Val Ile Asn Gln Asp Gly Glu
160 165 170gac acg ttt aat cga gct aaa ctc ctg aac atc ggc tat gcg
gag gcg 577Asp Thr Phe Asn Arg Ala Lys Leu Leu Asn Ile Gly Tyr Ala
Glu Ala 175 180 185ctg aag gag tac gat tac gac tgt ttt gtg ttc agc
gac gtg gac ctg 625Leu Lys Glu Tyr Asp Tyr Asp Cys Phe Val Phe Ser
Asp Val Asp Leu 190 195 200atc ccg atg gat gac cgc aac atc tac aag
tgc tac aat cag ccc aga 673Ile Pro Met Asp Asp Arg Asn Ile Tyr Lys
Cys Tyr Asn Gln Pro Arg205 210 215 220cac ctg gcc gtc tcc atg gac
aag ttc ggc ttc agg ctg ccg tac aca 721His Leu Ala Val Ser Met Asp
Lys Phe Gly Phe Arg Leu Pro Tyr Thr 225 230 235cag tat ttc ggt ggc
gtt tcg tcg ctc agc aaa gag cag ttc ctg aag 769Gln Tyr Phe Gly Gly
Val Ser Ser Leu Ser Lys Glu Gln Phe Leu Lys 240 245 250atc aac gga
ttc ccc aac aac tac tgg ggc tgg ggc gga gag gac gac 817Ile Asn Gly
Phe Pro Asn Asn Tyr Trp Gly Trp Gly Gly Glu Asp Asp 255 260 265gac
atc ttc aac agg atc tcc tcc aga ggg atg tcg ata tct agg cct 865Asp
Ile Phe Asn Arg Ile Ser Ser Arg Gly Met Ser Ile Ser Arg Pro 270 275
280gac gga ctc ctg ggt cgc tgt agg atg atc cgg cat gag aga gac aag
913Asp Gly Leu Leu Gly Arg Cys Arg Met Ile Arg His Glu Arg Asp
Lys285 290 295 300cag aac gac cca aac cct caa aga ttt gac cga atc
gcg cac aca agg 961Gln Asn Asp Pro Asn Pro Gln Arg Phe Asp Arg Ile
Ala His Thr Arg 305 310 315gaa acc atg gca act gat ggg atc aat tcg
cta aaa tat aac gtg gta 1009Glu Thr Met Ala Thr Asp Gly Ile Asn Ser
Leu Lys Tyr Asn Val Val 320 325 330aaa atc gag aaa gac ctg ctc ttc
acc aaa atc aca gtg gac gtg ggc 1057Lys Ile Glu Lys Asp Leu Leu Phe
Thr Lys Ile Thr Val Asp Val Gly 335 340 345aaa ccc tga 1066Lys Pro
35014350PRTDanio rerio 14Met Pro Asp Ser Thr Gly Asn Phe Ser Leu
Leu Gln Arg Thr Cys Ser1 5 10 15Leu Val Val Leu Leu Cys Phe Leu His
Ile Phe Val Thr Val Ile Tyr 20 25 30Tyr Met Arg Asn Ser Asp Ser Arg
Pro Ala Phe Ala Gln Asn Gln Gln 35 40 45Gln Arg Pro Thr Ile His Arg
Lys Leu Ala Glu Gln Arg Gly Thr Thr 50 55 60Glu Asp Ser Arg Pro Ala
Ala Asn Ala Ser Ser Asn Gly Gln Glu Leu65 70 75 80Gln Ile Cys Pro
Glu Glu Pro Pro Arg Leu Val Gly Pro Leu Arg Val 85 90 95Glu Phe Ser
Asp Pro Ile Thr Leu Glu Met Val Arg Thr Glu Asn Ser 100 105 110Val
Leu Gln Glu Gly Gly Arg Phe Arg Pro Pro Asp Cys Ile Ala Arg 115 120
125Gln Lys Val Ala Met Ile Ile Pro Phe Arg Asn Arg Asp Glu His Leu
130 135 140Lys Phe Trp Leu Tyr Tyr Leu His Pro Ile Leu Gln Arg Gln
Gln Leu145 150 155 160Asp Tyr
Gly Val Tyr Val Ile Asn Gln Asp Gly Glu Asp Thr Phe Asn 165 170
175Arg Ala Lys Leu Leu Asn Ile Gly Tyr Ala Glu Ala Leu Lys Glu Tyr
180 185 190Asp Tyr Asp Cys Phe Val Phe Ser Asp Val Asp Leu Ile Pro
Met Asp 195 200 205Asp Arg Asn Ile Tyr Lys Cys Tyr Asn Gln Pro Arg
His Leu Ala Val 210 215 220Ser Met Asp Lys Phe Gly Phe Arg Leu Pro
Tyr Thr Gln Tyr Phe Gly225 230 235 240Gly Val Ser Ser Leu Ser Lys
Glu Gln Phe Leu Lys Ile Asn Gly Phe 245 250 255Pro Asn Asn Tyr Trp
Gly Trp Gly Gly Glu Asp Asp Asp Ile Phe Asn 260 265 270Arg Ile Ser
Ser Arg Gly Met Ser Ile Ser Arg Pro Asp Gly Leu Leu 275 280 285Gly
Arg Cys Arg Met Ile Arg His Glu Arg Asp Lys Gln Asn Asp Pro 290 295
300Asn Pro Gln Arg Phe Asp Arg Ile Ala His Thr Arg Glu Thr Met
Ala305 310 315 320Thr Asp Gly Ile Asn Ser Leu Lys Tyr Asn Val Val
Lys Ile Glu Lys 325 330 335Asp Leu Leu Phe Thr Lys Ile Thr Val Asp
Val Gly Lys Pro 340 345 350151105DNAartificial sequncesynthetic
oligonucleotide (HsDGal) 15tctagaagac aac atg agg ctt cgg gag ccg
ctc ctg agc ggc agc gcc 49 Met Arg Leu Arg Glu Pro Leu Leu Ser Gly
Ser Ala 1 5 10gcg atg ccg gac tcc acc ggg aac ttc agc ctc ctg cag
cgg acc tgc 97Ala Met Pro Asp Ser Thr Gly Asn Phe Ser Leu Leu Gln
Arg Thr Cys 15 20 25tct ctg gtg gtg ctg ctg tgc ttc tta cac atc ttt
gtc acc gtc att 145Ser Leu Val Val Leu Leu Cys Phe Leu His Ile Phe
Val Thr Val Ile 30 35 40tac tac atg agg aac tcg gac tct cgg cca gcc
ttc gcc cag aac cag 193Tyr Tyr Met Arg Asn Ser Asp Ser Arg Pro Ala
Phe Ala Gln Asn Gln45 50 55 60cag cag aga ccg acg ata cac agg aaa
ctg gcg gag cag agg ggc acc 241Gln Gln Arg Pro Thr Ile His Arg Lys
Leu Ala Glu Gln Arg Gly Thr 65 70 75act gag gac agc aga ccc gcg gcc
aac gcc tcg agc aac ggc cag gag 289Thr Glu Asp Ser Arg Pro Ala Ala
Asn Ala Ser Ser Asn Gly Gln Glu 80 85 90ctg cag atc tgc cca gag gag
ccg ccg cgc ctg gtg ggt cct ctg cgt 337Leu Gln Ile Cys Pro Glu Glu
Pro Pro Arg Leu Val Gly Pro Leu Arg 95 100 105gtg gag ttc tca gac
ccg atc acg tta gaa atg gtg cgg aca gag aac 385Val Glu Phe Ser Asp
Pro Ile Thr Leu Glu Met Val Arg Thr Glu Asn 110 115 120agt gtt ctg
caa gag ggc gga cgc ttc aga ccc cca gac tgc ata gct 433Ser Val Leu
Gln Glu Gly Gly Arg Phe Arg Pro Pro Asp Cys Ile Ala125 130 135
140cgg cag aag gtg gcc atg atc atc ccc ttc cgg aac cga gac gag cac
481Arg Gln Lys Val Ala Met Ile Ile Pro Phe Arg Asn Arg Asp Glu His
145 150 155ctg aag ttc tgg ctc tat tac ctg cac ccc atc ctg cag cgc
caa cag 529Leu Lys Phe Trp Leu Tyr Tyr Leu His Pro Ile Leu Gln Arg
Gln Gln 160 165 170ctc gac tac ggc gtc tac gtc atc aac cag gat ggc
gag gac acg ttt 577Leu Asp Tyr Gly Val Tyr Val Ile Asn Gln Asp Gly
Glu Asp Thr Phe 175 180 185aat cga gct aaa ctc ctg aac atc ggc tat
gcg gag gcg ctg aag gag 625Asn Arg Ala Lys Leu Leu Asn Ile Gly Tyr
Ala Glu Ala Leu Lys Glu 190 195 200tac gat tac gac tgt ttt gtg ttc
agc gac gtg gac ctg atc ccg atg 673Tyr Asp Tyr Asp Cys Phe Val Phe
Ser Asp Val Asp Leu Ile Pro Met205 210 215 220gat gac cgc aac atc
tac aag tgc tac aat cag ccc aga cac ctg gcc 721Asp Asp Arg Asn Ile
Tyr Lys Cys Tyr Asn Gln Pro Arg His Leu Ala 225 230 235gtc tcc atg
gac aag ttc ggc ttc agg ctg ccg tac aca cag tat ttc 769Val Ser Met
Asp Lys Phe Gly Phe Arg Leu Pro Tyr Thr Gln Tyr Phe 240 245 250ggt
ggc gtt tcg tcg ctc agc aaa gag cag ttc ctg aag atc aac gga 817Gly
Gly Val Ser Ser Leu Ser Lys Glu Gln Phe Leu Lys Ile Asn Gly 255 260
265ttc ccc aac aac tac tgg ggc tgg ggc gga gag gac gac gac atc ttc
865Phe Pro Asn Asn Tyr Trp Gly Trp Gly Gly Glu Asp Asp Asp Ile Phe
270 275 280aac agg atc tcc tcc aga ggg atg tcg ata tct agg cct gac
gga ctc 913Asn Arg Ile Ser Ser Arg Gly Met Ser Ile Ser Arg Pro Asp
Gly Leu285 290 295 300ctg ggt cgc tgt agg atg atc cgg cat gag aga
gac aag cag aac gac 961Leu Gly Arg Cys Arg Met Ile Arg His Glu Arg
Asp Lys Gln Asn Asp 305 310 315cca aac cct caa aga ttt gac cga atc
gcg cac aca agg gaa acc atg 1009Pro Asn Pro Gln Arg Phe Asp Arg Ile
Ala His Thr Arg Glu Thr Met 320 325 330gca act gat ggg atc aat tcg
cta aaa tat aac gtg gta aaa atc gag 1057Ala Thr Asp Gly Ile Asn Ser
Leu Lys Tyr Asn Val Val Lys Ile Glu 335 340 345aaa gac ctg ctc ttc
acc aaa atc aca gtg gac gtg ggc aaa ccc tga 1105Lys Asp Leu Leu Phe
Thr Lys Ile Thr Val Asp Val Gly Lys Pro 350 355
36016363PRTartificial sequencesynthetic peptide 16Met Arg Leu Arg
Glu Pro Leu Leu Ser Gly Ser Ala Ala Met Pro Asp1 5 10 15Ser Thr Gly
Asn Phe Ser Leu Leu Gln Arg Thr Cys Ser Leu Val Val 20 25 30Leu Leu
Cys Phe Leu His Ile Phe Val Thr Val Ile Tyr Tyr Met Arg 35 40 45Asn
Ser Asp Ser Arg Pro Ala Phe Ala Gln Asn Gln Gln Gln Arg Pro 50 55
60Thr Ile His Arg Lys Leu Ala Glu Gln Arg Gly Thr Thr Glu Asp Ser65
70 75 80Arg Pro Ala Ala Asn Ala Ser Ser Asn Gly Gln Glu Leu Gln Ile
Cys 85 90 95Pro Glu Glu Pro Pro Arg Leu Val Gly Pro Leu Arg Val Glu
Phe Ser 100 105 110Asp Pro Ile Thr Leu Glu Met Val Arg Thr Glu Asn
Ser Val Leu Gln 115 120 125Glu Gly Gly Arg Phe Arg Pro Pro Asp Cys
Ile Ala Arg Gln Lys Val 130 135 140Ala Met Ile Ile Pro Phe Arg Asn
Arg Asp Glu His Leu Lys Phe Trp145 150 155 160Leu Tyr Tyr Leu His
Pro Ile Leu Gln Arg Gln Gln Leu Asp Tyr Gly 165 170 175Val Tyr Val
Ile Asn Gln Asp Gly Glu Asp Thr Phe Asn Arg Ala Lys 180 185 190Leu
Leu Asn Ile Gly Tyr Ala Glu Ala Leu Lys Glu Tyr Asp Tyr Asp 195 200
205Cys Phe Val Phe Ser Asp Val Asp Leu Ile Pro Met Asp Asp Arg Asn
210 215 220Ile Tyr Lys Cys Tyr Asn Gln Pro Arg His Leu Ala Val Ser
Met Asp225 230 235 240Lys Phe Gly Phe Arg Leu Pro Tyr Thr Gln Tyr
Phe Gly Gly Val Ser 245 250 255Ser Leu Ser Lys Glu Gln Phe Leu Lys
Ile Asn Gly Phe Pro Asn Asn 260 265 270Tyr Trp Gly Trp Gly Gly Glu
Asp Asp Asp Ile Phe Asn Arg Ile Ser 275 280 285Ser Arg Gly Met Ser
Ile Ser Arg Pro Asp Gly Leu Leu Gly Arg Cys 290 295 300Arg Met Ile
Arg His Glu Arg Asp Lys Gln Asn Asp Pro Asn Pro Gln305 310 315
320Arg Phe Asp Arg Ile Ala His Thr Arg Glu Thr Met Ala Thr Asp Gly
325 330 335Ile Asn Ser Leu Lys Tyr Asn Val Val Lys Ile Glu Lys Asp
Leu Leu 340 345 350Phe Thr Lys Ile Thr Val Asp Val Gly Lys Pro 355
360171053DNAartificial sequencesynthetic oligonucleotide (sialDGal)
17atg att cat acc aac ttg aag aaa aag ttc agc ctc ttc atc ctg gtc
48Met Ile His Thr Asn Leu Lys Lys Lys Phe Ser Leu Phe Ile Leu Val1
5 10 15ttt ctc ctg ttc gca gtc atc tgt gtt tgg aag aaa ggg agc gac
tat 96Phe Leu Leu Phe Ala Val Ile Cys Val Trp Lys Lys Gly Ser Asp
Tyr 20 25 30gag gcc ctt aca ctg caa gcc aag gag ttc cag atg ccc aag
agc cag 144Glu Ala Leu Thr Leu Gln Ala Lys Glu Phe Gln Met Pro Lys
Ser Gln 35 40 45gag aaa gtg gcc atg cac agg aaa ctg gcg gag cag agg
ggc acc act 192Glu Lys Val Ala Met His Arg Lys Leu Ala Glu Gln Arg
Gly Thr Thr 50 55 60gag gac agc aga ccc gcg gcc aac gcc tcg agc aac
ggc cag gag ctg 240Glu Asp Ser Arg Pro Ala Ala Asn Ala Ser Ser Asn
Gly Gln Glu Leu65 70 75 80cag atc tgc cca gag gag ccg ccg cgc ctg
gtg ggt cct ctg cgt gtg 288Gln Ile Cys Pro Glu Glu Pro Pro Arg Leu
Val Gly Pro Leu Arg Val 85 90 95gag ttc tca gac ccg atc acg tta gaa
atg gtg cgg aca gag aac agt 336Glu Phe Ser Asp Pro Ile Thr Leu Glu
Met Val Arg Thr Glu Asn Ser 100 105 110gtt ctg caa gag ggc gga cgc
ttc aga ccc cca gac tgc ata gct cgg 384Val Leu Gln Glu Gly Gly Arg
Phe Arg Pro Pro Asp Cys Ile Ala Arg 115 120 125cag aag gtg gcc atg
atc atc ccc ttc cgg aac cga gac gag cac ctg 432Gln Lys Val Ala Met
Ile Ile Pro Phe Arg Asn Arg Asp Glu His Leu 130 135 140aag ttc tgg
ctc tat tac ctg cac ccc atc ctg cag cgc caa cag ctc 480Lys Phe Trp
Leu Tyr Tyr Leu His Pro Ile Leu Gln Arg Gln Gln Leu145 150 155
160gac tac ggc gtc tac gtc atc aac cag gat ggc gag gac acg ttt aat
528Asp Tyr Gly Val Tyr Val Ile Asn Gln Asp Gly Glu Asp Thr Phe Asn
165 170 175cga gct aaa ctc ctg aac atc ggc tat gcg gag gcg ctg aag
gag tac 576Arg Ala Lys Leu Leu Asn Ile Gly Tyr Ala Glu Ala Leu Lys
Glu Tyr 180 185 190gat tac gac tgt ttt gtg ttc agc gac gtg gac ctg
atc ccg atg gat 624Asp Tyr Asp Cys Phe Val Phe Ser Asp Val Asp Leu
Ile Pro Met Asp 195 200 205gac cgc aac atc tac aag tgc tac aat cag
ccc aga cac ctg gcc gtc 672Asp Arg Asn Ile Tyr Lys Cys Tyr Asn Gln
Pro Arg His Leu Ala Val 210 215 220tcc atg gac aag ttc ggc ttc agg
ctg ccg tac aca cag tat ttc ggt 720Ser Met Asp Lys Phe Gly Phe Arg
Leu Pro Tyr Thr Gln Tyr Phe Gly225 230 235 240ggc gtt tcg tcg ctc
agc aaa gag cag ttc ctg aag atc aac gga ttc 768Gly Val Ser Ser Leu
Ser Lys Glu Gln Phe Leu Lys Ile Asn Gly Phe 245 250 255ccc aac aac
tac tgg ggc tgg ggc gga gag gac gac gac atc ttc aac 816Pro Asn Asn
Tyr Trp Gly Trp Gly Gly Glu Asp Asp Asp Ile Phe Asn 260 265 270agg
atc tcc tcc aga ggg atg tcg ata tct agg cct gac gga ctc ctg 864Arg
Ile Ser Ser Arg Gly Met Ser Ile Ser Arg Pro Asp Gly Leu Leu 275 280
285ggt cgc tgt agg atg atc cgg cat gag aga gac aag cag aac gac cca
912Gly Arg Cys Arg Met Ile Arg His Glu Arg Asp Lys Gln Asn Asp Pro
290 295 300aac cct caa aga ttt gac cga atc gcg cac aca agg gaa acc
atg gca 960Asn Pro Gln Arg Phe Asp Arg Ile Ala His Thr Arg Glu Thr
Met Ala305 310 315 320act gat ggg atc aat tcg cta aaa tat aac gtg
gta aaa atc gag aaa 1008Thr Asp Gly Ile Asn Ser Leu Lys Tyr Asn Val
Val Lys Ile Glu Lys 325 330 335gac ctg ctc ttc acc aaa atc aca gtg
gac gtg ggc aaa ccc tga 1053Asp Leu Leu Phe Thr Lys Ile Thr Val Asp
Val Gly Lys Pro 340 345 35018350PRTartificial sequencesynthetic
peptide 18Met Ile His Thr Asn Leu Lys Lys Lys Phe Ser Leu Phe Ile
Leu Val1 5 10 15Phe Leu Leu Phe Ala Val Ile Cys Val Trp Lys Lys Gly
Ser Asp Tyr 20 25 30Glu Ala Leu Thr Leu Gln Ala Lys Glu Phe Gln Met
Pro Lys Ser Gln 35 40 45Glu Lys Val Ala Met His Arg Lys Leu Ala Glu
Gln Arg Gly Thr Thr 50 55 60Glu Asp Ser Arg Pro Ala Ala Asn Ala Ser
Ser Asn Gly Gln Glu Leu65 70 75 80Gln Ile Cys Pro Glu Glu Pro Pro
Arg Leu Val Gly Pro Leu Arg Val 85 90 95Glu Phe Ser Asp Pro Ile Thr
Leu Glu Met Val Arg Thr Glu Asn Ser 100 105 110Val Leu Gln Glu Gly
Gly Arg Phe Arg Pro Pro Asp Cys Ile Ala Arg 115 120 125Gln Lys Val
Ala Met Ile Ile Pro Phe Arg Asn Arg Asp Glu His Leu 130 135 140Lys
Phe Trp Leu Tyr Tyr Leu His Pro Ile Leu Gln Arg Gln Gln Leu145 150
155 160Asp Tyr Gly Val Tyr Val Ile Asn Gln Asp Gly Glu Asp Thr Phe
Asn 165 170 175Arg Ala Lys Leu Leu Asn Ile Gly Tyr Ala Glu Ala Leu
Lys Glu Tyr 180 185 190Asp Tyr Asp Cys Phe Val Phe Ser Asp Val Asp
Leu Ile Pro Met Asp 195 200 205Asp Arg Asn Ile Tyr Lys Cys Tyr Asn
Gln Pro Arg His Leu Ala Val 210 215 220Ser Met Asp Lys Phe Gly Phe
Arg Leu Pro Tyr Thr Gln Tyr Phe Gly225 230 235 240Gly Val Ser Ser
Leu Ser Lys Glu Gln Phe Leu Lys Ile Asn Gly Phe 245 250 255Pro Asn
Asn Tyr Trp Gly Trp Gly Gly Glu Asp Asp Asp Ile Phe Asn 260 265
270Arg Ile Ser Ser Arg Gly Met Ser Ile Ser Arg Pro Asp Gly Leu Leu
275 280 285Gly Arg Cys Arg Met Ile Arg His Glu Arg Asp Lys Gln Asn
Asp Pro 290 295 300Asn Pro Gln Arg Phe Asp Arg Ile Ala His Thr Arg
Glu Thr Met Ala305 310 315 320Thr Asp Gly Ile Asn Ser Leu Lys Tyr
Asn Val Val Lys Ile Glu Lys 325 330 335Asp Leu Leu Phe Thr Lys Ile
Thr Val Asp Val Gly Lys Pro 340 345 35019159DNAartificial
sequencesynthetic oligonucleotide (CTSsialT) 19atg att cat acc aac
ttg aag aaa aag ttc agc ctc ttc atc ctg gtc 48Met Ile His Thr Asn
Leu Lys Lys Lys Phe Ser Leu Phe Ile Leu Val1 5 10 15ttt ctc ctg ttc
gca gtc atc tgt gtt tgg aag aaa ggg agc gac tat 96Phe Leu Leu Phe
Ala Val Ile Cys Val Trp Lys Lys Gly Ser Asp Tyr 20 25 30gag gcc ctt
aca ctg caa gcc aag gaa ttc cag atg ccc aag agc cag 144Glu Ala Leu
Thr Leu Gln Ala Lys Glu Phe Gln Met Pro Lys Ser Gln 35 40 45gag aaa
gtg gcc atg 159Glu Lys Val Ala Met 502053PRTartificial
sequenceSynthetic peptide 20Met Ile His Thr Asn Leu Lys Lys Lys Phe
Ser Leu Phe Ile Leu Val1 5 10 15Phe Leu Leu Phe Ala Val Ile Cys Val
Trp Lys Lys Gly Ser Asp Tyr 20 25 30Glu Ala Leu Thr Leu Gln Ala Lys
Glu Phe Gln Met Pro Lys Ser Gln 35 40 45Glu Lys Val Ala Met
502113PRTartificial sequencesynthetic peptide 21Met Arg Leu Arg Glu
Pro Leu Leu Ser Gly Ser Ala Ala1 5 102230DNAartificial
sequencesynthetic oligonucleotide (primer) 22gtgacctcga ggaggtggcg
agcacaaacc 302334DNAartificial sequencesynthetic oligonucleotide
(primer) 23gtgacggatc cttcagctgc cgggcgctcc gata
342476DNAartificial sequencesynthetic oligonucleotide (primer)
24gtcaggtcga cgaagacaac atgaggcttc gggagcctct cctcagcggc agcgccgcta
60tgaaggagcc agccct 762536DNAartificial sequencesynthetic
oligonucleotide (primer) 25gtgacggtct cacatgacgc cacctagaag tcctga
362640DNAartificial sequencesynthetic oligonucleotide (primer)
26gtgactctag aagacaacat gccggactcc accgggaact 402732DNAartificial
sequencesynthetic oligonucleotide (primer) 27gtgacggatc cttcagggtt
tgcccacgtc ca 322836DNAartificial sequencesynthetic oligonucleotide
(primer) 28gtgacgaaga caacatgcac aggaaactgg cggagc
362973DNAartificial sequencesynthetic oligonucleotide (primer)
29gtgactctag aagacaacat gaggcttcgg gagccgctcc tgagcggcag cgccgcgatg
60ccggactcca ccg 733059PRTHomo sapiens 30Met Arg Leu Arg Glu Pro
Leu Leu Ser Gly Ser Ala Ala Met Pro Gly1 5 10 15Ala Ser Leu Gln Arg
Ala Cys Arg Leu Leu Val Ala Val Cys Ala Leu
20 25 30His Leu Gly Val Thr Leu Val Tyr Tyr Leu Ala Gly Arg Asp Leu
Ser 35 40 45Arg Leu Pro Gln Leu Val Gly Val Ser Thr Pro 50
553159PRTMus musculus 31Met Arg Phe Arg Glu Gln Phe Leu Gly Gly Ser
Ala Ala Met Pro Gly1 5 10 15Ala Thr Leu Gln Arg Ala Cys Arg Leu Leu
Val Ala Val Cys Ala Leu 20 25 30His Leu Gly Val Thr Leu Val Tyr Tyr
Leu Ser Gly Arg Asp Leu Ser 35 40 45Arg Leu Pro Gln Leu Val Gly Val
Ser Ser Thr 50 553259PRTBos taurus 32Met Lys Phe Arg Glu Pro Leu
Leu Gly Gly Ser Ala Ala Met Pro Gly1 5 10 15Ala Ser Leu Gln Arg Ala
Cys Arg Leu Leu Val Ala Val Cys Ala Leu 20 25 30His Leu Gly Val Thr
Leu Val Tyr Tyr Leu Ala Gly Arg Asp Leu Arg 35 40 45Arg Leu Pro Gln
Leu Val Gly Val His Pro Pro 50 553342PRTGallus gallus 33Met Lys Glu
Pro Ala Leu Pro Gly Thr Ser Leu Gln Arg Ala Cys Arg1 5 10 15Leu Leu
Val Ala Phe Cys Ala Leu His Leu Ser Ala Thr Leu Leu Tyr 20 25 30Tyr
Leu Ala Gly Ser Ser Leu Thr Pro Pro 35 403444PRTDanio rerio 34Met
Pro Asp Ser Thr Gly Asn Phe Ser Leu Leu Gln Arg Thr Cys Ser1 5 10
15Leu Val Val Leu Leu Cys Phe Leu His Ile Phe Val Thr Val Ile Tyr
20 25 30Tyr Met Arg Asn Ser Asp Ser Arg Pro Ala Phe Ala 35
403555PRTXenopus tropicalis 35Met Lys Glu Pro Gln Leu Pro Val Ser
Asn Leu Thr Ala Ala Leu Pro1 5 10 15Gly Ala Ser Leu Gln Lys Ala Cys
Lys Phe Val Val Val Phe Cys Ser 20 25 30Leu His Phe Cys Val Val Leu
Ile Tyr Tyr Leu Ser Gly Ala Asp Phe 35 40 45Gly Ile Leu Gln Phe Phe
Arg 50 553656PRTHomo sapiens 36Leu Gln Gly Gly Ser Asn Ser Ala Ala
Ala Ile Gly Gln Ser Ser Gly1 5 10 15Glu Leu Arg Thr Gly Gly Ala Arg
Pro Pro Pro Pro Leu Gly Ala Ser 20 25 30Ser Gln Pro Arg Pro Gly Gly
Asp Ser Ser Pro Val Val Asp Ser Gly 35 40 45Pro Gly Pro Ala Ser Asn
Leu Thr 50 553756PRTMus musculus 37Leu Gln Gly Gly Thr Asn Gly Ala
Ala Ala Ser Lys Gln Pro Pro Gly1 5 10 15Glu Gln Arg Pro Arg Gly Ala
Arg Pro Pro Pro Pro Leu Gly Val Ser 20 25 30Pro Lys Pro Arg Pro Gly
Leu Asp Ser Ser Pro Gly Ala Ala Ser Gly 35 40 45Pro Gly Leu Lys Ser
Asn Leu Ser 50 553860PRTBos taurus 38Leu Gln Gly Ser Ser His Gly
Ala Ala Ala Ile Gly Gln Pro Ser Gly1 5 10 15Glu Leu Arg Leu Arg Gly
Val Ala Pro Pro Pro Pro Leu Gln Asn Ser 20 25 30Ser Lys Pro Arg Ser
Arg Ala Pro Ser Asn Leu Asp Ala Tyr Ser His 35 40 45Pro Gly Pro Gly
Pro Gly Pro Gly Ser Asn Leu Thr 50 55 603940PRTGallus gallus 39Arg
Ser Pro Glu Pro Pro Pro Arg Arg Pro Pro Pro Ala Asn Leu Ser1 5 10
15Leu Pro Pro Ser Arg Pro Pro Pro Pro Pro Ala Ala Arg Pro Arg Pro
20 25 30Gly Pro Val Ser Ala Gln Pro Arg 35 404034PRTDanio rerio
40Gln Asn Gln Gln Gln Arg Pro Thr Ile His Arg Lys Leu Ala Glu Gln1
5 10 15Arg Gly Thr Thr Glu Asp Ser Arg Pro Ala Ala Asn Ala Ser Ser
Asn 20 25 30Gly Gln4134PRTXenopus tropicalis 41Gln Asn Gln Gln Ser
Gln Leu Ala Tyr Lys Gln Asn Tyr Thr Ile Ser1 5 10 15Asn Ala Thr Met
Arg Ala Ile Ser Thr Lys Gly Arg Thr Lys Glu Pro 20 25 30Lys
Glu42221PRTartificial sequencesynthetic peptide 42Met Pro Asp Ser
Thr Gly Asn Phe Ser Leu Leu Gln Arg Thr Cys Ser1 5 10 15Leu Val Val
Leu Leu Cys Phe Leu His Ile Phe Val Thr Val Ile Tyr 20 25 30Tyr Met
Arg Asn Ser Asp Ser Arg Pro Ala Phe Ala Gln Asn Gln Gln 35 40 45Gln
Arg Pro Thr Ile His Arg Lys Leu Ala Glu Gln Arg Gly Thr Thr 50 55
60Glu Asp Ser Arg Pro Ala Ala Asn Ala Ser Ser Asn Gly Gln Glu Leu65
70 75 80Gln Ile Cys Pro Glu Glu Pro Pro Arg Leu Val Gly Pro Leu Arg
Val 85 90 95Glu Phe Ser Asp Pro Ile Thr Leu Glu Met Val Arg Thr Glu
Asn Ser 100 105 110Val Leu Gln Glu Gly Gly Arg Phe Arg Pro Pro Asp
Cys Ile Ala Arg 115 120 125Gln Lys Val Ala Met Ile Ile Pro Phe Arg
Asn Arg Asp Glu His Leu 130 135 140Lys Phe Trp Leu Tyr Tyr Leu His
Pro Ile Leu Gln Arg Gln Gln Leu145 150 155 160Asp Tyr Gly Val Tyr
Val Ile Asn Gln Asp Gly Glu Asp Thr Phe Asn 165 170 175Arg Ala Lys
Leu Leu Asn Ile Gly Tyr Ala Glu Ala Leu Lys Glu Tyr 180 185 190Asp
Tyr Asp Cys Phe Val Phe Ser Asp Val Asp Leu Ile Pro Met Asp 195 200
205Asp Arg Asn Ile Tyr Lys Cys Tyr Asn Gln Pro Arg His 210 215
22043214PRTartificial sequencesynthetic peptide 43Met Ser Glu Ser
Val Gly Phe Phe Thr Lys Ala Cys Val Val Leu Val1 5 10 15Leu Leu Cys
Gly Leu His Leu Ile Val Ala Leu Ile Phe Tyr Leu Ser 20 25 30Glu Ser
Pro Leu Ala Lys Phe Arg Asn Tyr Arg His Ile Ser Phe Ile 35 40 45Ser
Asp Met Val Asn Ser Gln Thr His Gly Glu Leu Gly Gln Ala Asp 50 55
60Asn Glu Thr Leu Asp Val Ala Val Tyr Lys Arg Ile Tyr Asn Asn Glu65
70 75 80Thr Val Ile Ile Gly Asp Val Glu Lys Pro Ala Glu Val Leu Glu
Ser 85 90 95Cys Pro Glu Thr Ser Pro Leu Leu Val Gly Gln Leu Arg Val
Glu Phe 100 105 110Ser Thr Pro Val Asp Phe Asn Leu Val Arg Gln Gly
Asn Lys His Leu 115 120 125Thr Met Gly Gly Arg Tyr Thr Pro Thr Lys
Cys Val Ala Leu Gln Lys 130 135 140Val Ala Met Ile Thr Pro Tyr Arg
Asn Arg Glu Glu His Leu Lys Tyr145 150 155 160Trp Leu Tyr Tyr Leu
His Pro Ile Leu Lys Arg Gln Leu Leu Asp Tyr 165 170 175Gly Ile Tyr
Ile Ile Glu Gln Asp Gly Glu Asn Thr Pro Asn Lys Thr 180 185 190Leu
Lys Ser Leu Thr Ile Cys Ile Leu Gly Leu Ser Leu Arg Ile Ser 195 200
205Val Thr Leu Met Val Glu 210
* * * * *
References