U.S. patent application number 13/145528 was filed with the patent office on 2011-11-17 for binding-site modified lectins and uses thereof.
Invention is credited to Thomas M. Lancaster, Todd C. Zion.
Application Number | 20110281792 13/145528 |
Document ID | / |
Family ID | 42395977 |
Filed Date | 2011-11-17 |
United States Patent
Application |
20110281792 |
Kind Code |
A1 |
Zion; Todd C. ; et
al. |
November 17, 2011 |
BINDING-SITE MODIFIED LECTINS AND USES THEREOF
Abstract
In one aspect, the disclosure provides cross-linked materials
that include multivalent lectins with at least two binding sites
for glucose, wherein the lectins include at least one covalently
linked affinity ligand which is capable of competing with glucose
for binding with at least one of said binding sites; and conjugates
that include two or more separate affinity ligands bound to a
conjugate framework, wherein the two or more affinity ligands
compete with glucose for binding with the lectins at said binding
sites and wherein conjugates are cross-linked within the material
as a result of non-covalent interactions between lectins and
affinity ligands on different conjugates. These materials are
designed to release amounts of conjugate in response to desired
concentrations of glucose. Depending on the end application, in
various embodiments, the conjugates may also include a drug and/or
a detectable label.
Inventors: |
Zion; Todd C.; (Marblehead,
MA) ; Lancaster; Thomas M.; (Stoneham, MA) |
Family ID: |
42395977 |
Appl. No.: |
13/145528 |
Filed: |
January 27, 2010 |
PCT Filed: |
January 27, 2010 |
PCT NO: |
PCT/US2010/022213 |
371 Date: |
July 20, 2011 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
61147878 |
Jan 28, 2009 |
|
|
|
61159643 |
Mar 12, 2009 |
|
|
|
61162058 |
Mar 20, 2009 |
|
|
|
61162105 |
Mar 20, 2009 |
|
|
|
61162107 |
Mar 20, 2009 |
|
|
|
61162053 |
Mar 20, 2009 |
|
|
|
61163084 |
Mar 25, 2009 |
|
|
|
61219897 |
Jun 24, 2009 |
|
|
|
61223572 |
Jul 7, 2009 |
|
|
|
61252857 |
Oct 19, 2009 |
|
|
|
Current U.S.
Class: |
514/5.9 ;
436/501; 514/20.9; 530/370; 530/396 |
Current CPC
Class: |
G01N 33/66 20130101;
A61K 47/641 20170801; A61P 3/10 20180101; C07K 14/42 20130101; C07K
14/4726 20130101; G01N 2333/4724 20130101; A61K 47/6415 20170801;
A61K 38/28 20130101; A61K 47/61 20170801 |
Class at
Publication: |
514/5.9 ;
530/396; 436/501; 530/370; 514/20.9 |
International
Class: |
A61K 38/28 20060101
A61K038/28; C07K 14/62 20060101 C07K014/62; A61P 3/10 20060101
A61P003/10; C07K 14/42 20060101 C07K014/42; A61K 38/16 20060101
A61K038/16; C07K 14/00 20060101 C07K014/00; G01N 33/566 20060101
G01N033/566 |
Goverment Interests
GOVERNMENT LICENSE RIGHTS
[0002] The U.S. Government has a paid-up license in this invention
and the right in limited circumstances to require the patent owner
to license others on reasonable terms as provided for by the terms
of DK079482 and DK080565 awarded by National Institutes of Health.
Claims
1. A cross-linked material comprising: multivalent lectins with at
least two binding sites for glucose, wherein the lectins include at
least one covalently linked affinity ligand which is capable of
competing with glucose for binding with at least one of said
binding sites; and conjugates that include two or more separate
affinity ligands bound to a conjugate framework, wherein the two or
more affinity ligands compete with glucose for binding with the
lectins at said binding sites and wherein conjugates are
cross-linked within the material as a result of non-covalent
interactions between lectins and affinity ligands on different
conjugates.
2. The material of claim 1, wherein the conjugates further comprise
a drug bound to the conjugate framework.
3-6. (canceled)
7. The material of claim 1, wherein the lectins are Con A
lectins.
8. (canceled)
9. The material of claim 1, wherein the affinity ligands that are
covalently bound to the lectins include a saccharide.
10. The material of claim 9, wherein the saccharide is glucose.
11. (canceled)
12. The material of claim 9, wherein the affinity ligands that are
covalently bound to the lectins include a saccharide and a linker
and the saccharide is covalently bound to the linker via an
anomeric carbon.
13-17. (canceled)
18. The material of claim 12, wherein the affinity ligands were
covalently bound to the lectins using a photoactivatable linker of
the formula: ##STR00065## wherein: R.sup.3 is independently
selected from the group consisting of hydrogen, --OH, --NO.sub.2,
and halogen; X.sup.L is a covalent bond or a bivalent, straight or
branched, saturated or unsaturated, optionally substituted
C.sub.1-20 hydrocarbon chain wherein one or more methylene units of
X.sup.L are optionally and independently replaced by --O--, --S--,
--N(R')--, --C(O)--, --C(O)O--, --OC(O)--, --N(R')C(O)--,
--C(O)N(R')--, --S(O)--, --S(O).sub.2--, --N(R')SO.sub.2--,
--SO.sub.2N(R')--, a heterocyclic group, an aryl group, or a
heteroaryl group; and each occurrence of R' is independently
hydrogen, a suitable protecting group, or an acyl moiety, arylalkyl
moiety, aliphatic moiety, aryl moiety, heteroaryl moiety, or
heteroaliphatic moiety.
19-34. (canceled)
35. The material of claim 12, wherein the affinity ligands were
covalently bound to the lectins using a photoactivatable linker of
the formula: ##STR00066## R.sup.4 is hydrogen, C.sub.1-C.sub.6
alkyl or --CF.sub.3; X.sup.L is a covalent bond or a bivalent,
straight or branched, saturated or unsaturated, optionally
substituted C.sub.1-20 hydrocarbon chain wherein one or more
methylene units of X.sup.L are optionally and independently
replaced by --O--, --S--, --N(R')--, --C(O)--, --C(O)O--,
--OC(O)--, --N(R')C(O)--, --C(O)N(R')--, --S(O)--, --S(O).sub.2--,
--N(R')SO.sub.2--, --SO.sub.2N(R')--, a heterocyclic group, an aryl
group, or a heteroaryl group; and each occurrence of R' is
independently hydrogen, a suitable protecting group, or an acyl
moiety, arylalkyl moiety, aliphatic moiety, aryl moiety, heteroaryl
moiety, or heteroaliphatic moiety.
36-53. (canceled)
54. The material of claim 1, wherein the affinity ligands of the
conjugates include a saccharide.
55. The material of claim 54, wherein the affinity ligands of the
conjugates include a saccharide selected from glucose, mannose,
glucosamine, mannosamine, methylglucose, methylmannose,
ethylglucose, and ethylmannose.
56. The material of claim 54, wherein the affinity ligands of the
conjugates include a bimmanose or trimannose.
57. The material of claim 54, wherein the affinity ligands of the
conjugates include aminoethylglucose (AEG), aminoethylmannose
(AEM), aminoethylbimannose (AEBM) or aminoethyltrimannose
(AETM).
58-67. (canceled)
68. The material of claim 1, wherein the conjugate has the general
formula: ##STR00067## wherein: R.sup.x is hydrogen or optionally
substituted C.sub.1-6 alkyl; Z.sup.1 is an optionally substituted
bivalent C.sub.1-10 hydrocarbon chain, wherein 1, 2, 3, 4 or 5
methylene units of Z.sup.1 are optionally and independently
replaced with one or more groups selected from --S--, --O--,
--NR.sup.a--, --(C.dbd.NR.sup.a)--, --(C.dbd.O)--, --(S.dbd.O)--,
--S(.dbd.O).sub.2--, --(CR.sup.b.dbd.CR.sup.b)--, --(N.dbd.N)--, an
optionally substituted arylene moiety or an optionally substituted
heteroarylene moiety, wherein R.sup.a is hydrogen, optionally
substituted aliphatic, optionally substituted heteroaliphatic,
optionally substituted aryl, optionally substituted heteroaryl, or
a suitable amino protecting group; and R.sup.b is hydrogen,
optionally substituted aliphatic, optionally substituted
heteroaliphatic, optionally substituted aryl, or optionally
substituted heteroaryl; each occurrence of X.sup.1 is independently
--OR.sup.c or --N(R.sup.d).sub.2, wherein R.sup.c is hydrogen,
optionally substituted aliphatic, optionally substituted
heteroaliphatic, optionally substituted aryl, optionally
substituted heteroaryl, a suitable hydroxyl protecting group, a
cation group, or an affinity ligand, and each R.sup.d is,
independently, hydrogen, optionally substituted aliphatic,
optionally substituted heteroaliphatic, optionally substituted
aryl, optionally substituted heteroaryl, a suitable amino
protecting group, or an affinity ligand, with the proviso that at
least two occurrences of X.sup.1 include an affinity ligand;
Y.sup.1 is hydrogen, halogen, optionally substituted aliphatic,
optionally substituted heteroaliphatic, optionally substituted
aryl, optionally substituted heteroaryl, --OR.sup.e or --SR.sup.e
wherein R.sup.e is hydrogen, optionally substituted aliphatic,
optionally substituted heteroaliphatic, optionally substituted
aryl, or optionally substituted heteroaryl; r is an integer between
5-25, inclusive; W.sup.1 is a drug or detectable label; and
corresponds to a single or double covalent bond.
69. The material of claim 1, wherein the conjugate has the general
formula: ##STR00068## wherein: each occurrence of ##STR00069##
represents a potential branch within the conjugate; each occurrence
of ##STR00070## represents a potential repeat within a branch of
the conjugate; each occurrence of is independently a covalent bond,
a carbon atom, a heteroatom, or an optionally substituted group
selected from the group consisting of acyl, aliphatic,
heteroaliphatic, aryl, heteroaryl, and heterocyclic; each
occurrence of T is independently a covalent bond or a bivalent,
straight or branched, saturated or unsaturated, optionally
substituted C.sub.1-30 hydrocarbon chain wherein one or more
methylene units of T are optionally and independently replaced by
--O--, --S--, --N(R)--, --C(O)--, --C(O)O--, --OC(O)--,
--N(R)C(O)--, --C(O)N(R)--, --S(O)--, --S(O).sub.2--,
--N(R)SO.sub.2--, --SO.sub.2N(R)--, a heterocyclic group, an aryl
group, or a heteroaryl group; each occurrence of R is independently
hydrogen, a suitable protecting group, or an acyl moiety, arylalkyl
moiety, aliphatic moiety, aryl moiety, heteroaryl moiety, or
heteroaliphatic moiety; --B is -T-L.sup.B-X; each occurrence of X
is independently an affinity ligand; each occurrence of L.sup.B is
independently a covalent bond or a group derived from the covalent
conjugation of a T with an X; -D is -T-L.sup.D-W; each occurrence
of W is independently a drug or a detectable label; each occurrence
of L.sup.D is independently a covalent bond or a group derived from
the covalent conjugation of a T with a W; k is an integer from 2 to
11, inclusive, defining at least two k-branches within the
conjugate; q is an integer from 1 to 4, inclusive; k+q is an
integer from 3 to 12, inclusive; each occurrence of p is
independently an integer from 1 to 5, inclusive; and each
occurrence of n is independently an integer from 0 to 5, inclusive;
and each occurrence of m is independently an integer from 1 to 5,
inclusive; and each occurrence of v is independently an integer
from 0 to 5, inclusive, with the proviso that within each k-branch
at least one occurrence of n is .gtoreq.1 and at least one
occurrence of v is .gtoreq.1.
70-72. (canceled)
73. The material of claim 69, wherein at least two occurrences of X
include an affinity ligand that comprises a saccharide.
74. The material of claim 69, wherein at least two occurrences of X
include an affinity ligand that comprises a saccharide selected
from the group consisting of glucose, mannose, glucosamine,
mannosamine, methylglucose, methylmannose, ethylglucose, and
ethylmannose.
75. The material of claim 69, wherein at least two occurrences of X
include an affinity ligand that comprises a bimmanose or a
trimannose.
76. The material of claim 69, wherein at least two occurrences of X
include an affinity ligand selected from aminoethylglucose (AEG),
aminoethylmannose (AEM), aminoethylbimannose (AEBM) and
aminoethyltrimannose (AETM).
77-84. (canceled)
85. A method comprising administering a material of claim 1 to a
patient.
86. (canceled)
87. The method of claim 85, wherein the conjugates comprise an
insulin molecule bound to the framework.
88-94. (canceled)
95. A method comprising steps of: (I) mixing: (a) multivalent
lectins with at least two binding sites for glucose, wherein the
lectins include at least one covalently linked affinity ligand
which is capable of competing with glucose for binding with at
least one of said binding sites and the lectins include a first
label which generates a measurable response when in close proximity
to a second label, and (b) conjugates that comprise an affinity
ligand and the second label; (II) exposing a sample to the mixture
of multivalent lectins and conjugates, wherein: (a) if glucose is
absent from the sample, the conjugates form a cross-linked material
with the lectins through affinity binding to the multivalent
lectins to produce a measurable response, and (b) if glucose is
present in the sample, the response is reduced because formation of
cross-linked material is inhibited as a result of glucose from the
sample competing with the conjugates for the binding sites on the
multivalent lectins; and (III) detecting and optionally measuring
the response with a sensor to determine the presence and optionally
the amount of glucose in the sample.
96. A method comprising steps of: (I) mixing: (a) multivalent
lectins with at least two binding sites for glucose, wherein the
lectins include at least one covalently linked affinity ligand
which is capable of competing with glucose for binding with at
least one of said binding sites, (b) a first group of molecules
that comprise an affinity ligand and a first label which generates
a measurable response when in close proximity to a second label,
and (c) a second group of molecules that comprise an affinity
ligand and the second label; (II) exposing a sample to the mixture
of multivalent lectins, and first and second groups of molecules,
wherein: (a) if glucose is absent from the sample, members of the
first and second group of molecules are brought in close proximity
through affinity binding to the multivalent lectins to produce a
binding complex and a measurable response, and (b) if glucose is
present in the sample, the response is reduced because fewer of
said binding complexes form as a result of glucose from the sample
competing with the first and second molecules for the binding sites
on the multivalent lectins; and (III) detecting and optionally
measuring the response with a sensor to determine the presence and
optionally the amount of glucose in the sample.
97. A method comprising steps of: (I) providing: (a) conjugates
that comprise a plurality of affinity ligands, and (b) multivalent
lectins with at least two binding sites for glucose, wherein the
lectins include at least one covalently linked affinity ligand
which is capable of competing with glucose for binding with at
least one of said binding sites; (II) mixing the conjugates and
lectins, wherein the viscosity of the resulting mixture is due to
the binding between the conjugates and lectins; (III) contacting
the mixture with a sample containing glucose which displaces
conjugates from the lectins and causes a concentration dependent
reduction in viscosity; and (IV) detecting and optionally measuring
the resulting change in viscosity to determine the presence and
optionally the amount of glucose in the sample.
Description
RELATED APPLICATIONS
[0001] This application claims priority to U.S. Provisional
Application No. 61/147,878 filed Jan. 28, 2009, U.S. Provisional
Application No. 61/159,643 filed Mar. 12, 2009, U.S. Provisional
Application No. 61/162,107 filed Mar. 20, 2009, U.S. Provisional
Application No. 61/162,053 filed Mar. 20, 2009, U.S. Provisional
Application No. 61/162,058 filed Mar. 20, 2009, U.S. Provisional
Application No. 61/162,105 filed Mar. 20, 2009, U.S. Provisional
Application No. 61/163,084 filed Mar. 25, 2009, U.S. Provisional
Application No. 61/219,897 filed Jun. 24, 2009, U.S. Provisional
Application No. 61/223,572 filed Jul. 7, 2009, and U.S. Provisional
Application No. 61/252,857 filed Oct. 19, 2009, the content of each
of which is hereby incorporated by reference in its entirety.
BACKGROUND
[0003] The majority of "controlled-release" drug delivery systems
known in the prior art (e.g., U.S. Pat. No. 4,145,410 to Sears
which describes drug release from capsules which are enzymatically
labile) are incapable of releasing drugs at intervals and
concentrations which are in direct proportion to the amount of a
molecular indicator (e.g., a metabolite) present in the human body.
The delivery or release of drug in these prior art systems is thus
not literally "controlled," but simply a slow release which is
independent of external or internal factors.
[0004] The treatment of diabetes mellitus with injectable insulin
is a well-known and studied example where uncontrolled, slow
release of insulin is undesirable. In fact, it is apparent that the
simple replacement of the hormone is not sufficient to prevent the
pathological sequelae associated with this disease. The development
of these sequelae is believed to reflect an inability to provide
exogenous insulin proportional to varying blood glucose
concentrations experienced by the patient. To solve this problem
several biological and bioengineering approaches to develop a more
physiological insulin delivery system have been suggested (e.g.,
see U.S. Pat. No. 4,348,387 to Brownlee et al.; U.S. Pat. Nos.
5,830,506, 5,902,603, and 6,410,053 to Taylor et al. and U.S.
Patent Application Publication No. 2004-0202719 to Zion et
al.).
[0005] In certain embodiments of the Zion system multivalent
glucose-binding molecules are combined with a glycosylated
polymer-insulin conjugate. The glycosylated polymer contains
multiple saccharide binding groups and forms insoluble hydrogels or
particles in the presence of the glucose-binding molecule. The gel
releases the glycosylated polymer-insulin conjugate in response to
increases in glucose concentration. The Zion system has been
demonstrated using the lectin concanavalin A (Con A) as an
exemplary multivalent glucose-binding molecule. Unfortunately, Con
A and many of the other readily available lectins have the
potential to stimulate lymphocyte proliferation. By binding to
carbohydrate receptors on the surfaces of certain types of
lymphocytes, these so-called "mitogenic" lectins can potentially
induce the mitosis of lymphocytes and thereby cause them to
proliferate. Most mitogenic lectins including Con A are selective
T-cell mitogens. A few lectins are less selective and stimulate
both T-cells and B-cells. Local or systemic in vivo exposure to
mitogenic lectins can result in inflammation, cytotoxicity,
macrophage digestion, and allergic reactions including anaphylaxis.
In addition, plant lectins are known to be particularly
immunogenic, giving rise to the production of high titers of
anti-lectin specific antibodies. It will be appreciated that
mitogenic lectins cannot therefore be used in their native form for
in vivo methods and devices unless great care is taken to prevent
their release. For example, in U.S. Pat. No. 5,830,506, Taylor
highlights the toxic risks that are involved in using Con A and
emphasizes the importance and difficulty of containing Con A within
a drug delivery device that also requires glucose and insulin
molecules to diffuse freely in and out of the device.
[0006] The risks and difficulties that are involved with these and
other in vivo uses of lectins could be avoided if a method existed
for reducing the mitogenicity of lectins without interfering with
their ability to function as cross-linking agents within a Zion
system which responds to useful concentrations of glucose.
SUMMARY
[0007] In one aspect, the disclosure provides cross-linked
materials that include multivalent lectins with at least two
binding sites for glucose, wherein the lectins include at least one
covalently linked affinity ligand which is capable of competing
with glucose for binding with at least one of said binding sites;
and conjugates that include two or more separate affinity ligands
bound to a conjugate framework, wherein the two or more affinity
ligands compete with glucose for binding with the lectins at said
binding sites and wherein conjugates are cross-linked within the
material as a result of non-covalent interactions between lectins
and affinity ligands on different conjugates. These materials are
designed to release amounts of conjugate in response to desired
concentrations of glucose. Depending on the end application, in
various embodiments, the conjugates may also include a drug and/or
a detectable label. The drug, detectable label and affinity ligands
may be covalently or non-covalently bound to the conjugate
framework. The disclosure also provides methods of using these
materials and methods of making these materials. In another aspect,
the disclosure provides exemplary chemically modified lectins for
use in glucose responsive materials instead of native lectins such
as Con A.
DEFINITIONS
[0008] Definitions of specific functional groups, chemical terms,
and general terms used throughout the specification are described
in more detail below. For purposes of this invention, the chemical
elements are identified in accordance with the Periodic Table of
the Elements, CAS version, Handbook of Chemistry and Physics,
75.sup.th Ed., inside cover, and specific functional groups are
generally defined as described therein. Additionally, general
principles of organic chemistry, as well as specific functional
moieties and reactivity, are described in Organic Chemistry, Thomas
Sorrell, University Science Books, Sausalito, 1999; Smith and March
March's Advanced Organic Chemistry, 5.sup.th Edition, John Wiley
& Sons, Inc., New York, 2001; Larock, Comprehensive Organic
Transformations, VCH Publishers, Inc., New York, 1989; Carruthers,
Some Modern Methods of Organic Synthesis, 3.sup.rd Edition,
Cambridge University Press, Cambridge, 1987.
[0009] Acyl--As used herein, the term "acyl," refers to a group
having the general formula --C(.dbd.O)R.sup.X1,
--C(.dbd.O)OR.sup.X1, --C(.dbd.O)--O--C(.dbd.O)R.sup.X1,
--C(.dbd.O)SR.sup.X1, --C(.dbd.O)N(R.sup.X1).sub.2,
--C(.dbd.S)R.sup.X1, --C(.dbd.S)N(R.sup.X1).sub.2, and
--C(.dbd.S)S(R.sup.X1), --C(.dbd.NR.sup.X1)R.sup.X1,
--C(.dbd.NR.sup.X1)OR.sup.X1, --C(.dbd.NR.sup.X1)SR.sup.X1, and
--C(.dbd.NR.sup.X1)N(R.sup.X1).sub.2, wherein R.sup.X1 is hydrogen;
halogen; substituted or unsubstituted hydroxyl; substituted or
unsubstituted thiol; substituted or unsubstituted amino;
substituted or unsubstituted acyl; cyclic or acyclic, substituted
or unsubstituted, branched or unbranched aliphatic; cyclic or
acyclic, substituted or unsubstituted, branched or unbranched
heteroaliphatic; cyclic or acyclic, substituted or unsubstituted,
branched or unbranched alkyl; cyclic or acyclic, substituted or
unsubstituted, branched or unbranched alkenyl; substituted or
unsubstituted alkynyl, substituted or unsubstituted aryl,
substituted or unsubstituted heteroaryl, aliphaticoxy,
heteroaliphaticoxy, alkyloxy, heteroalkyloxy, aryloxy,
heteroaryloxy, aliphaticthioxy, heteroaliphaticthioxy, alkylthioxy,
heteroalkylthioxy, arylthioxy, heteroarylthioxy, mono- or
di-aliphaticamino, mono- or di-heteroaliphaticamino, mono- or
di-alkylamino, mono- or di-heteroalkylamino, mono- or di-arylamino,
or mono- or di-heteroarylamino; or two R.sup.X1 groups taken
together form a 5- to 6-membered heterocyclic ring. Exemplary acyl
groups include aldehydes (--CHO), carboxylic acids (--CO.sub.2H),
ketones, acyl halides, esters, amides, imines, carbonates,
carbamates, and ureas. Acyl substituents include, but are not
limited to, any of the substituents described herein, that result
in the formation of a stable moiety (e.g., aliphatic, alkyl,
alkenyl, alkynyl, heteroaliphatic, heterocyclic, aryl, heteroaryl,
acyl, oxo, imino, thiooxo, cyano, isocyano, amino, azido, nitro,
hydroxyl, thiol, halo, aliphaticamino, heteroaliphaticamino,
alkylamino, heteroalkylamino, arylamino, heteroarylamino,
alkylaryl, arylalkyl, aliphaticoxy, heteroaliphaticoxy, alkyloxy,
heteroalkyloxy, aryloxy, heteroaryloxy, aliphaticthioxy,
heteroaliphaticthioxy, alkylthioxy, heteroalkylthioxy, arylthioxy,
heteroarylthioxy, acyloxy, and the like, each of which may or may
not be further substituted).
[0010] Aliphatic--As used herein, the term "aliphatic" or
"aliphatic group" denotes an optionally substituted hydrocarbon
moiety that may be straight-chain (i.e., unbranched), branched, or
cyclic ("carbocyclic") and may be completely saturated or may
contain one or more units of unsaturation, but which is not
aromatic. Unless otherwise specified, aliphatic groups contain 1-12
carbon atoms. In some embodiments, aliphatic groups contain 1-6
carbon atoms. In some embodiments, aliphatic groups contain 1-4
carbon atoms, and in yet other embodiments aliphatic groups contain
1-3 carbon atoms. Suitable aliphatic groups include, but are not
limited to, linear or branched, alkyl, alkenyl, and alkynyl groups,
and hybrids thereof such as (cycloalkyl)alkyl, (cycloalkenyl)alkyl
or (cycloalkyl)alkenyl.
[0011] Alkenyl--As used herein, the term "alkenyl" denotes an
optionally substituted monovalent group derived from a straight- or
branched-chain aliphatic moiety having at least one carbon-carbon
double bond by the removal of a single hydrogen atom. In certain
embodiments, the alkenyl group employed in the invention contains
2-6 carbon atoms. In certain embodiments, the alkenyl group
employed in the invention contains 2-5 carbon atoms. In some
embodiments, the alkenyl group employed in the invention contains
2-4 carbon atoms. In another embodiment, the alkenyl group employed
contains 2-3 carbon atoms. Alkenyl groups include, for example,
ethenyl, propenyl, butenyl, 1-methyl-2-buten-1-yl, and the
like.
[0012] Alkyl--As used herein, the term "alkyl" refers to optionally
substituted saturated, straight- or branched-chain hydrocarbon
radicals derived from an aliphatic moiety containing between 1-6
carbon atoms by removal of a single hydrogen atom. In some
embodiments, the alkyl group employed in the invention contains 1-5
carbon atoms. In another embodiment, the alkyl group employed
contains 1-4 carbon atoms. In still other embodiments, the alkyl
group contains 1-3 carbon atoms. In yet another embodiments, the
alkyl group contains 1-2 carbons. Examples of alkyl radicals
include, but are not limited to, methyl, ethyl, n-propyl,
isopropyl, n-butyl, iso-butyl, sec-butyl, sec-pentyl, iso-pentyl,
tert-butyl, n-pentyl, neopentyl, n-hexyl, sec-hexyl, n-heptyl,
n-octyl, n-decyl, n-undecyl, dodecyl, and the like.
[0013] Alkynyl--As used herein, the term "alkynyl" refers to an
optionally substituted monovalent group derived from a straight- or
branched-chain aliphatic moiety having at least one carbon-carbon
triple bond by the removal of a single hydrogen atom. In certain
embodiments, the alkynyl group employed in the invention contains
2-6 carbon atoms. In certain embodiments, the alkynyl group
employed in the invention contains 2-5 carbon atoms. In some
embodiments, the alkynyl group employed in the invention contains
2-4 carbon atoms. In another embodiment, the alkynyl group employed
contains 2-3 carbon atoms. Representative alkynyl groups include,
but are not limited to, ethynyl, 2-propynyl (propargyl),
1-propynyl, and the like.
[0014] Aryl--As used herein, the term "aryl" used alone or as part
of a larger moiety as in "aralkyl", "aralkoxy", or "aryloxyalkyl",
refers to an optionally substituted monocyclic and bicyclic ring
systems having a total of five to 10 ring members, wherein at least
one ring in the system is aromatic and wherein each ring in the
system contains three to seven ring members. The term "aryl" may be
used interchangeably with the term "aryl ring". In certain
embodiments of the present invention, "aryl" refers to an aromatic
ring system which includes, but not limited to, phenyl, biphenyl,
naphthyl, anthracyl and the like, which may bear one or more
substituents.
[0015] Arylalkyl--As used herein, the term "arylalkyl" refers to an
alkyl group substituted with an aryl group (e.g., an aromatic or
heteroaromatic group).
[0016] Bivalent hydrocarbon chain--As used herein, the term
"bivalent hydrocarbon chain" (also referred to as a "bivalent
alkylene group") is a polymethylene group, i.e.,
--(CH.sub.2).sub.z--, wherein z is a positive integer from 1 to 30,
from 1 to 20, from 1 to 12, from 1 to 8, from 1 to 6, from 1 to 4,
from 1 to 3, from 1 to 2, from 2 to 30, from 2 to 20, from 2 to 10,
from 2 to 8, from 2 to 6, from 2 to 4, or from 2 to 3. A
substituted bivalent hydrocarbon chain is a polymethylene group in
which one or more methylene hydrogen atoms are replaced with a
substituent. Suitable substituents include those described below
for a substituted aliphatic group.
[0017] Carbonyl--As used herein, the term "carbonyl" refers to a
monovalent or bivalent moiety containing a carbon-oxygen double
bond. Non-limiting examples of carbonyl groups include aldehydes,
ketones, carboxylic acids, ester, amide, enones, acyl halides,
anhydrides, ureas, carbamates, carbonates, thioesters, lactones,
lactams, hydroxamates, isocyanates, and chloroformates.
[0018] Cycloaliphatic--As used herein, the terms "cycloaliphatic",
"carbocycle", or "carbocyclic", used alone or as part of a larger
moiety, refer to an optionally substituted saturated or partially
unsaturated cyclic aliphatic monocyclic or bicyclic ring systems,
as described herein, having from 3 to 10 members. Cycloaliphatic
groups include, without limitation, cyclopropyl, cyclobutyl,
cyclopentyl, cyclopentenyl, cyclohexyl, cyclohexenyl, cycloheptyl,
cycloheptenyl, cyclooctyl, cyclooctenyl, and cyclooctadienyl. In
some embodiments, the cycloalkyl has 3-6 carbons.
[0019] Halogen--As used herein, the terms "halo" and "halogen"
refer to an atom selected from fluorine (fluoro, --F), chlorine
(chloro, --Cl), bromine (bromo, --Br), and iodine (iodo, --I).
[0020] Heteroaliphatic--As used herein, the terms "heteroaliphatic"
or "heteroaliphatic group", denote an optionally substituted
hydrocarbon moiety having, in addition to carbon atoms, from one to
five heteroatoms, that may be straight-chain (i.e., unbranched),
branched, or cyclic ("heterocyclic") and may be completely
saturated or may contain one or more units of unsaturation, but
which is not aromatic. Unless otherwise specified, heteroaliphatic
groups contain 1-6 carbon atoms wherein 1-3 carbon atoms are
optionally and independently replaced with heteroatoms selected
from oxygen, nitrogen and sulfur. In some embodiments,
heteroaliphatic groups contain 1-4 carbon atoms, wherein 1-2 carbon
atoms are optionally and independently replaced with heteroatoms
selected from oxygen, nitrogen and sulfur. In yet other
embodiments, heteroaliphatic groups contain 1-3 carbon atoms,
wherein 1 carbon atom is optionally and independently replaced with
a heteroatom selected from oxygen, nitrogen and sulfur. Suitable
heteroaliphatic groups include, but are not limited to, linear or
branched, heteroalkyl, heteroalkenyl, and heteroalkynyl groups.
[0021] Heteroaralkyl--As used herein, the term "heteroaralkyl"
refers to an alkyl group substituted by a heteroaryl, wherein the
alkyl and heteroaryl portions independently are optionally
substituted.
[0022] Heteroaryl--As used herein, the term "heteroaryl" used alone
or as part of a larger moiety, e.g., "heteroaralkyl", or
"heteroaralkoxy", refers to an optionally substituted group having
5 to 10 ring atoms, preferably 5, 6, or 9 ring atoms; having 6, 10,
or 14.pi. electrons shared in a cyclic array; and having, in
addition to carbon atoms, from one to five heteroatoms. Heteroaryl
groups include, without limitation, thienyl, furanyl, pyrrolyl,
imidazolyl, pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl,
oxadiazolyl, thiazolyl, isothiazolyl, thiadiazolyl, pyridyl,
pyridazinyl, pyrimidinyl, pyrazinyl, indolizinyl, purinyl,
naphthyridinyl, and pteridinyl. The terms "heteroaryl" and
"heteroar-", as used herein, also include groups in which a
heteroaromatic ring is fused to one or more aryl, carbocyclic, or
heterocyclic rings, where the radical or point of attachment is on
the heteroaromatic ring. Non limiting examples include indolyl,
isoindolyl, benzothienyl, benzofuranyl, dibenzofuranyl, indazolyl,
benzimidazolyl, benzthiazolyl, quinolyl, isoquinolyl, cinnolinyl,
phthalazinyl, quinazolinyl, quinoxalinyl, 4H-quinolizinyl,
carbazolyl, acridinyl, phenazinyl, phenothiazinyl, phenoxazinyl,
tetrahydroquinolinyl, and tetrahydroisoquinolinyl. A heteroaryl
group may be mono- or bicyclic. The term "heteroaryl" may be used
interchangeably with the terms "heteroaryl ring", "heteroaryl
group", or "heteroaromatic", any of which terms include rings that
are optionally substituted.
[0023] Heteroatom--As used herein, the term "heteroatom" refers to
nitrogen, oxygen, or sulfur, and includes any oxidized form of
nitrogen or sulfur, and any quaternized form of a basic nitrogen.
The term "nitrogen" also includes a substituted nitrogen.
[0024] Heterocyclic--As used herein, the terms "heterocycle",
"heterocyclyl", "heterocyclic radical", and "heterocyclic ring" are
used interchangeably and refer to a stable optionally substituted
5- to 7-membered monocyclic or 7- to 10-membered bicyclic
heterocyclic moiety that is either saturated or partially
unsaturated, and having, in addition to carbon atoms, one or more
heteroatoms, as defined above. A heterocyclic ring can be attached
to its pendant group at any heteroatom or carbon atom that results
in a stable structure and any of the ring atoms can be optionally
substituted. Examples of such saturated or partially unsaturated
heterocyclic radicals include, without limitation,
tetrahydrofuranyl, tetrahydrothienyl, pyrrolidinyl, pyrrolidonyl,
piperidinyl, pyrrolinyl, tetrahydroquinolinyl,
tetrahydroisoquinolinyl, decahydroquinolinyl, oxazolidinyl,
piperazinyl, dioxanyl, dioxolanyl, diazepinyl, oxazepinyl,
thiazepinyl, morpholinyl, and quinuclidinyl. The terms
"heterocycle", "heterocyclyl", "heterocyclyl ring", "heterocyclic
group", "heterocyclic moiety", and "heterocyclic radical", are used
interchangeably herein, and also include groups in which a
heterocyclyl ring is fused to one or more aryl, heteroaryl, or
carbocyclic rings, such as indolinyl, 3H-indolyl, chromanyl,
phenanthridinyl, or tetrahydroquinolinyl, where the radical or
point of attachment is on the heterocyclyl ring. A heterocyclyl
group may be mono- or bicyclic. The term "heterocyclylalkyl" refers
to an alkyl group substituted by a heterocyclyl, wherein the alkyl
and heterocyclyl portions independently are optionally
substituted.
[0025] Unsaturated--As used herein, the term "unsaturated", means
that a moiety has one or more double or triple bonds.
[0026] Partially unsaturated--As used herein, the term "partially
unsaturated" refers to a ring moiety that includes at least one
double or triple bond. The term "partially unsaturated" is intended
to encompass rings having multiple sites of unsaturation, but is
not intended to include aryl or heteroaryl moieties, as herein
defined.
[0027] Optionally substituted--As described herein, compounds of
the invention may contain "optionally substituted" moieties. In
general, the term "substituted", whether preceded by the term
"optionally" or not, means that one or more hydrogens of the
designated moiety are replaced with a suitable substituent. Unless
otherwise indicated, an "optionally substituted" group may have a
suitable substituent at each substitutable position of the group,
and when more than one position in any given structure may be
substituted with more than one substituent selected from a
specified group, the substituent may be either the same or
different at every position. Combinations of substituents
envisioned by this invention are preferably those that result in
the formation of stable or chemically feasible compounds. The term
"stable", as used herein, refers to compounds that are not
substantially altered when subjected to conditions to allow for
their production, detection, and, in certain embodiments, their
recovery, purification, and use for one or more of the purposes
disclosed herein.
[0028] Suitable monovalent substituents on a substitutable carbon
atom of an "optionally substituted" group are independently
halogen; --(CH.sub.2).sub.0-4R.degree.;
--(CH.sub.2).sub.0-4OR.degree.;
--O--(CH.sub.2).sub.0-4C(O)OR.degree.;
--(CH.sub.2).sub.0-4CH(OR.degree.).sub.2;
--(CH.sub.2).sub.0-4SR.degree.; --(CH.sub.2).sub.0-4Ph, which may
be substituted with R.degree.;
--(CH.sub.2).sub.0-4O(CH.sub.2).sub.0-1Ph which may be substituted
with R.degree.; --CH.dbd.CHPh, which may be substituted with
R.degree.; --NO.sub.2; --CN; --N.sub.3;
--(CH.sub.2).sub.0-4N(R.degree.).sub.2;
--(CH.sub.2).sub.0-4N(R.degree.)C(O)R.degree.;
--N(R.degree.)C(S)R.degree.;
--(CH.sub.2).sub.0-4N(R.degree.C(O)NR.degree..sub.2;
--N(R.degree.)C(S)NR.degree..sub.2;
--(CH.sub.2).sub.0-4N(R.degree.)C(O)OR.degree.;
--N(R.degree.)N(R.degree.)C(O)R.degree.;
--N(R.degree.)N(R.degree.)C(O)NR.degree..sub.2;
--N(R.degree.)N(R.degree.)C(O)OR.degree.;
--(CH.sub.2).sub.0-4C(O)R.degree.; --C(S)R.degree.;
--(CH.sub.2).sub.0-4C(O)OR.degree.;
--(CH.sub.2).sub.0-4C(O)SR.degree.;
--(CH.sub.2).sub.0-4C(O)OSiR.degree..sub.3;
--(CH.sub.2).sub.0-4OC(O)R.degree.; --OC(O)(CH.sub.2).sub.0-4SR--,
SC(S)SR.degree.; --(CH.sub.2).sub.0-4SC(O)R.degree.;
--(CH.sub.2).sub.0-4C(O)NR.degree..sub.2; --C(S)NR.degree..sub.2;
--C(S)SR.degree.; --SC(S)SR.degree.,
--(CH.sub.2).sub.0-4OC(O)NR.degree..sub.2;
--C(O)N(OR.degree.)R.degree.; --C(O)C(O)R.degree.;
--C(O)CH.sub.2C(O)R.degree.; --C(NOR.degree.)R.degree.;
--(CH.sub.2).sub.0-4SSR.degree.;
--(CH.sub.2).sub.0-4S(O).sub.2R.degree.;
--(CH.sub.2).sub.0-4S(O).sub.2OR.degree.;
--(CH.sub.2).sub.0-4OS(O).sub.2R.degree.;
--S(O).sub.2NR.degree..sub.2; --(CH.sub.2).sub.0-4S(O)R.degree.;
--N(R.degree.)S(O).sub.2NR.degree..sub.2;
--N(R.degree.)S(O).sub.2R.degree.; --N(OR.degree.)R.degree.;
--C(NH)NR.degree..sub.2; --P(O).sub.2R.degree.;
--P(O)R.degree..sub.2; --OP(O)R.degree..sub.2;
--OP(O)(OR.degree.).sub.2; SiR.degree..sub.3; --(C.sub.1-4 straight
or branched)alkylene)O--N(R.degree.).sub.2; or --(C.sub.1-4
straight or branched)alkylene)C(O)O--N(R.degree.).sub.2, wherein
each R.degree. may be substituted as defined below and is
independently hydrogen, C.sub.1-6 aliphatic, --CH.sub.2Ph,
--O(CH.sub.2).sub.0-1Ph, or a 5-6-membered saturated, partially
unsaturated, or aryl ring having 0-4 heteroatoms independently
selected from nitrogen, oxygen, or sulfur, or, notwithstanding the
definition above, two independent occurrences of R.degree., taken
together with their intervening atom(s), form a 3-12-membered
saturated, partially unsaturated, or aryl mono- or bicyclic ring
having 0-4 heteroatoms independently selected from nitrogen,
oxygen, or sulfur, which may be substituted as defined below.
[0029] Suitable monovalent substituents on R.degree. (or the ring
formed by taking two independent occurrences of R.degree. together
with their intervening atoms), are independently halogen,
--(CH.sub.2).sub.0-2R.sup..cndot., -(haloR.sup..cndot.),
--(CH.sub.2).sub.0-2OH, --(CH.sub.2).sub.0-2OR.sup..cndot.,
--(CH.sub.2).sub.0-2CH(OR.sup..cndot.).sub.2;
--O(haloR.sup..cndot.), --CN, --N.sub.3,
--(CH.sub.2).sub.0-2C(O)R.sup..cndot., --(CH.sub.2).sub.0-2C(O)OH,
--(CH.sub.2).sub.0-2C(O)OR.sup..cndot.,
--(CH.sub.2).sub.0-2SR.sup..cndot., --(CH.sub.2).sub.0-2SH,
--(CH.sub.2).sub.0-2NH.sub.2, --(CH.sub.2).sub.0-2NHR.sup..cndot.,
--(CH.sub.2).sub.0-2NR.sup..cndot..sub.2, --NO.sub.2,
--SiR.sup..cndot..sub.3, --OSiR.sup..cndot..sub.3,
--C(O)SR.sup..cndot., --(C.sub.1-4 straight or branched
alkylene)C(O)OR.sup..cndot., or --SSR.sup..cndot. wherein each
R.sup..cndot. is unsubstituted or where preceded by "halo" is
substituted only with one or more halogens, and is independently
selected from C.sub.1-4 aliphatic, --CH.sub.2Ph,
--O(CH.sub.2).sub.0-1Ph, or a 5-6-membered saturated, partially
unsaturated, or aryl ring having 0-4 heteroatoms independently
selected from nitrogen, oxygen, or sulfur. Suitable divalent
substituents on a saturated carbon atom of R.degree. include .dbd.O
and .dbd.S.
[0030] Suitable divalent substituents on a saturated carbon atom of
an "optionally substituted" group include the following: .dbd.O,
.dbd.S, .dbd.NNR*.sub.2, .dbd.NNHC(O)R*, .dbd.NNHC(O)OR*,
.dbd.NNHS(O).sub.2R*, .dbd.NR*, .dbd.NOR*,
--O(C(R*.sub.2)).sub.2-3O--, or --S(C(R*.sub.2)).sub.2-3S--,
wherein each independent occurrence of R* is selected from
hydrogen, C.sub.1-6 aliphatic which may be substituted as defined
below, or an unsubstituted 5-6-membered saturated, partially
unsaturated, or aryl ring having 0-4 heteroatoms independently
selected from nitrogen, oxygen, or sulfur. Suitable divalent
substituents that are bound to vicinal substitutable carbons of an
"optionally substituted" group include: --O(CR*.sub.2).sub.2-3O--,
wherein each independent occurrence of R* is selected from
hydrogen, C.sub.1-6 aliphatic which may be substituted as defined
below, or an unsubstituted 5-6-membered saturated, partially
unsaturated, or aryl ring having 0-4 heteroatoms independently
selected from nitrogen, oxygen, or sulfur.
[0031] Suitable substituents on the aliphatic group of R* include
halogen, --R.sup..cndot., -(haloR.sup..cndot.), --OH,
--OR.sup..cndot., --O(haloR.sup..cndot.), --CN, --C(O)OH,
--C(O)OR.sup..cndot., --NH.sub.2, --NHR.sup..cndot.,
--NR.sup..cndot..sub.2, or --NO.sub.2, wherein each R.sup..cndot.
is unsubstituted or where preceded by "halo" is substituted only
with one or more halogens, and is independently C.sub.1-4
aliphatic, --CH.sub.2Ph, --O(CH.sub.2).sub.0-1Ph, or a 5-6-membered
saturated, partially unsaturated, or aryl ring having 0-4
heteroatoms independently selected from nitrogen, oxygen, or
sulfur.
[0032] Suitable substituents on a substitutable nitrogen of an
"optionally substituted" group include --R.sup..dagger.,
--NR.sup..dagger..sub.2, --C(O)R.sup..dagger.,
--C(O)OR.sup..dagger., --C(O)C(O)R.sup..dagger.,
--C(O)CH.sub.2C(O)R.sup..dagger., --S(O).sub.2R.sup..dagger.,
--S(O).sub.2NR.sup..dagger..sub.2, --C(S)NR.sup..dagger..sub.2,
--C(NH)NR.sup..dagger..sub.2, or
--N(R.sup..dagger.)S(O).sub.2R.sup..dagger.; wherein each
R.sup..dagger. is independently hydrogen, C.sub.1-6 aliphatic which
may be substituted as defined below, unsubstituted --OPh, or an
unsubstituted 5-6-membered saturated, partially unsaturated, or
aryl ring having 0-4 heteroatoms independently selected from
nitrogen, oxygen, or sulfur, or, notwithstanding the definition
above, two independent occurrences of R.sup..dagger., taken
together with their intervening atom(s) form an unsubstituted
3-12-membered saturated, partially unsaturated, or aryl mono- or
bicyclic ring having 0-4 heteroatoms independently selected from
nitrogen, oxygen, or sulfur.
[0033] Suitable substituents on the aliphatic group of
R.sup..dagger. are independently halogen, --R.sup..cndot.,
-(haloR.sup..cndot.), --OH, --OR.sup..cndot.,
--O(haloR.sup..cndot.), --CN, --C(O)OH, --C(O)OR.sup..cndot.,
--NH.sub.2, --NHR.sup..cndot., --NR.sup..cndot..sub.2, or
--NO.sub.2, wherein each R.sup..cndot. is unsubstituted or where
preceded by "halo" is substituted only with one or more halogens,
and is independently C.sub.1-4 aliphatic, --CH.sub.2Ph,
--O(CH.sub.2).sub.0-1Ph, or a 5-6-membered saturated, partially
unsaturated, or aryl ring having 0-4 heteroatoms independently
selected from nitrogen, oxygen, or sulfur.
[0034] Suitable protecting group--As used herein, the term
"suitable protecting group," refers to amino protecting groups or
hydroxyl protecting groups depending on its location within the
compound and includes those described in detail in Protecting
Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts,
3.sup.rd edition, John Wiley & Sons, 1999.
[0035] Suitable amino-protecting groups include methyl carbamate,
ethyl carbamante, 9-fluorenylmethyl carbamate (Fmoc),
9-(2-sulfo)fluorenylmethyl carbamate,
9-(2,7-dibromo)fluoroenylmethyl carbamate,
2,7-di-t-butyl-[9-(10,10-dioxo-10,10,10,10-tetrahydrothioxanthyl)]methyl
carbamate (DBD-Tmoc), 4-methoxyphenacyl carbamate (Phenoc),
2,2,2-trichloroethyl carbamate (Troc), 2-trimethylsilylethyl
carbamate (Teoc), 2-phenylethyl carbamate (hZ),
1-(1-adamantyl)-1-methylethyl carbamate (Adpoc),
1,1-dimethyl-2-haloethyl carbamate, 1,1-dimethyl-2,2-dibromoethyl
carbamate (DB-t-BOC), 1,1-dimethyl-2,2,2-trichloroethyl carbamate
(TCBOC), 1-methyl-1-(4-biphenylyl)ethyl carbamate (Bpoc),
1-(3,5-di-t-butylphenyl)-1-methylethyl carbamate (t-Bumeoc), 2-(2'-
and 4'-pyridyl)ethyl carbamate (Pyoc),
2-(N,N-dicyclohexylcarboxamido)ethyl carbamate, t-butyl carbamate
(BOC), 1-adamantyl carbamate (Adoc), vinyl carbamate (Voc), allyl
carbamate (Alloc), 1-isopropylallyl carbamate (Ipaoc), cinnamyl
carbamate (Coc), 4-nitrocinnamyl carbamate (Noc), 8-quinolyl
carbamate, N-hydroxypiperidinyl carbamate, alkyldithio carbamate,
benzyl carbamate (Cbz), p-methoxybenzyl carbamate (Moz),
p-nitobenzyl carbamate, p-bromobenzyl carbamate, p-chlorobenzyl
carbamate, 2,4-dichlorobenzyl carbamate, 4-methylsulfinylbenzyl
carbamate (Msz), 9-anthrylmethyl carbamate, diphenylmethyl
carbamate, 2-methylthioethyl carbamate, 2-methylsulfonylethyl
carbamate, 2-(p-toluenesulfonyl)ethyl carbamate,
[2-(1,3-dithianyl)]methyl carbamate (Dmoc), 4-methylthiophenyl
carbamate (Mtpc), 2,4-dimethylthiophenyl carbamate (Bmpc),
2-phosphonioethyl carbamate (Peoc), 2-triphenylphosphonioisopropyl
carbamate (Ppoc), 1,1-dimethyl-2-cyanoethyl carbamate,
m-chloro-p-acyloxybenzyl carbamate, p-(dihydroxyboryl)benzyl
carbamate, 5-benzisoxazolylmethyl carbamate,
2-(trifluoromethyl)-6-chromonylmethyl carbamate (Tcroc),
m-nitrophenyl carbamate, 3,5-dimethoxybenzyl carbamate,
o-nitrobenzyl carbamate, 3,4-dimethoxy-6-nitrobenzyl carbamate,
phenyl(o-nitrophenyl)methyl carbamate, phenothiazinyl-(10)-carbonyl
derivative, N'-p-toluenesulfonylaminocarbonyl derivative,
N'-phenylaminothiocarbonyl derivative, t-amyl carbamate, S-benzyl
thiocarbamate, p-cyanobenzyl carbamate, cyclobutyl carbamate,
cyclohexyl carbamate, cyclopentyl carbamate, cyclopropylmethyl
carbamate, p-decyloxybenzyl carbamate, 2,2-dimethoxycarbonylvinyl
carbamate, o-(N,N-dimethylcarboxamido)benzyl carbamate,
1,1-dimethyl-3-(N,N-dimethylcarboxamido)propyl carbamate,
1,1-dimethylpropynyl carbamate, di(2-pyridyl)methyl carbamate,
2-furanylmethyl carbamate, 2-iodoethyl carbamate, isoborynl
carbamate, isobutyl carbamate, isonicotinyl carbamate,
p-(p'-methoxyphenylazo)benzyl carbamate, 1-methylcyclobutyl
carbamate, 1-methylcyclohexyl carbamate,
1-methyl-1-cyclopropylmethyl carbamate,
1-methyl-1-(3,5-dimethoxyphenyl)ethyl carbamate,
1-methyl-1-1-(p-phenylazophenyl)ethyl carbamate,
1-methyl-1-phenylethyl carbamate, 1-methyl-1-(4-pyridyl)ethyl
carbamate, phenyl carbamate, p-(phenylazo)benzyl carbamate,
2,4,6-tri-t-butylphenyl carbamate, 4-(trimethylammonium)benzyl
carbamate, 2,4,6-trimethylbenzyl carbamate, formamide, acetamide,
chloroacetamide, trichloroacetamide, trifluoroacetamide,
phenylacetamide, 3-phenylpropanamide, picolinamide,
3-pyridylcarboxamide, N-benzoylphenylalanyl derivative, benzamide,
p-phenylbenzamide, o-nitophenylacetamide, o-nitrophenoxyacetamide,
acetoacetamide, (N'-dithiobenzyloxycarbonylamino)acetamide,
3-(p-hydroxyphenyl)propanamide, 3-(o-nitrophenyl)propanamide,
2-methyl-2-(o-nitrophenoxy)propanamide,
2-methyl-2-(o-phenylazophenoxy)propanamide, 4-chlorobutanamide,
3-methyl-3-nitrobutanamide, o-nitrocinnamide, N-acetylmethionine
derivative, o-nitrobenzamide, o-(benzoyloxymethyl)benzamide,
4,5-diphenyl-3-oxazolin-2-one, N-phthalimide, N-dithiasuccinimide
(Dts), N-2,3-diphenylmaleimide, N-2,5-dimethylpyrrole,
N-1,1,4,4-tetramethyldisilylazacyclopentane adduct (STABASE),
5-substituted 1,3-dimethyl-1,3,5-triazacyclohexan-2-one,
5-substituted 1,3-dibenzyl-1,3,5-triazacyclohexan-2-one,
1-substituted 3,5-dinitro-4-pyridone, N-methylamine, N-allylamine,
N-[2-(trimethylsilyl)ethoxy]methylamine (SEM),
N-3-acetoxypropylamine,
N-(1-isopropyl-4-nitro-2-oxo-3-pyroolin-3-yl)amine, quaternary
ammonium salts, N-benzylamine, N-di(4-methoxyphenyl)methylamine,
N-5-dibenzosuberylamine, N-triphenylmethylamine (Tr),
N-[(4-methoxyphenyl)diphenylmethyl]amine (MMTr),
N-9-phenylfluorenylamine (PhF),
N-2,7-dichloro-9-fluorenylmethyleneamine, N-ferrocenylmethylamino
(Fcm), N-2-picolylamino N'-oxide, N-1,1-dimethylthiomethyleneamine,
N-benzylideneamine, N-p-methoxybenzylideneamine,
N-diphenylmethyleneamine, N-[(2-pyridyl)mesityl]methyleneamine,
N--(N',N'-dimethylaminomethylene)amine, N,N'-isopropylidenediamine,
N-p-nitrobenzylideneamine, N-salicylideneamine,
N-5-chlorosalicylideneamine,
N-(5-chloro-2-hydroxyphenyl)phenylmethyleneamine,
N-cyclohexylideneamine, N-(5,5-dimethyl-3-oxo-1-cyclohexenyl)amine,
N-borane derivative, N-diphenylborinic acid derivative,
N-[phenyl(pentacarbonylchromium- or tungsten)carbonyl]amine,
N-copper chelate, N-zinc chelate, N-nitroamine, N-nitrosoamine,
amine N-oxide, diphenylphosphinamide (Dpp),
dimethylthiophosphinamide (Mpt), diphenylthiophosphinamide (Ppt),
dialkyl phosphoramidates, dibenzyl phosphoramidate, diphenyl
phosphoramidate, benzenesulfenamide, o-nitrobenzenesulfenamide
(Nps), 2,4-dinitrobenzenesulfenamide,
pentachlorobenzenesulfenamide, 2-nitro-4-methoxybenzenesulfenamide,
triphenylmethylsulfenamide, 3-nitropyridinesulfenamide (Npys),
p-toluenesulfonamide (Ts), benzenesulfonamide,
2,3,6,-trimethyl-4-methoxybenzenesulfonamide (Mtr),
2,4,6-trimethoxybenzenesulfonamide (Mtb),
2,6-dimethyl-4-methoxybenzenesulfonamide (Pme),
2,3,5,6-tetramethyl-4-methoxybenzenesulfonamide (Mte),
4-methoxybenzenesulfonamide (Mbs),
2,4,6-trimethylbenzenesulfonamide (Mts),
2,6-dimethoxy-4-methylbenzenesulfonamide (iMds),
2,2,5,7,8-pentamethylchroman-6-sulfonamide (Pmc),
methanesulfonamide (Ms), .beta.-trimethylsilylethanesulfonamide
(SES), 9-anthracenesulfonamide,
4-(4',8'-dimethoxynaphthylmethyl)benzenesulfonamide (DNMBS),
benzylsulfonamide, trifluoromethylsulfonamide, and
phenacylsulfonamide.
[0036] Suitable hydroxyl protecting groups include methyl,
methoxylmethyl (MOM), methylthiomethyl (MTM), t-butylthiomethyl,
(phenyldimethylsilyl)methoxymethyl (SMOM), benzyloxymethyl (BOM),
p-methoxybenzyloxymethyl (PMBM), (4-methoxyphenoxy)methyl (p-AOM),
guaiacolmethyl (GUM), t-butoxymethyl, 4-pentenyloxymethyl (POM),
siloxymethyl, 2-methoxyethoxymethyl (MEM),
2,2,2-trichloroethoxymethyl, bis(2-chloroethoxy)methyl,
2-(trimethylsilyl)ethoxymethyl (SEMOR), tetrahydropyranyl (THP),
3-bromotetrahydropyranyl, tetrahydrothiopyranyl,
1-methoxycyclohexyl, 4-methoxytetrahydropyranyl (MTHP),
4-methoxytetrahydrothiopyranyl, 4-methoxytetrahydrothiopyranyl
S,S-dioxide,
1-[(2-chloro-4-methyl)phenyl]-4-methoxypiperidin-4-yl(CTMP),
1,4-dioxan-2-yl, tetrahydrofuranyl, tetrahydrothiofuranyl,
2,3,3a,4,5,6,7,7a-octahydro-7,8,8-trimethyl-4,7-methanobenzofuran-2-yl,
1-ethoxyethyl, 1-(2-chloroethoxy)ethyl, 1-methyl-1-methoxyethyl,
1-methyl-1-benzyloxyethyl, 1-methyl-1-benzyloxy-2-fluoroethyl,
2,2,2-trichloroethyl, 2-trimethylsilylethyl,
2-(phenylselenyl)ethyl, t-butyl, allyl, p-chlorophenyl,
p-methoxyphenyl, 2,4-dinitrophenyl, benzyl, p-methoxybenzyl,
3,4-dimethoxybenzyl, o-nitrobenzyl, p-nitrobenzyl, p-halobenzyl,
2,6-dichlorobenzyl, p-cyanobenzyl, p-phenylbenzyl, 2-picolyl,
4-picolyl, 3-methyl-2-picolyl N-oxido, diphenylmethyl,
p,p'-dinitrobenzhydryl, 5-dibenzosuberyl, triphenylmethyl,
.alpha.-naphthyldiphenylmethyl, p-methoxyphenyldiphenylmethyl,
di(p-methoxyphenyl)phenylmethyl, tri(p-methoxyphenyl)methyl,
4-(4'-bromophenacyloxyphenyl)diphenylmethyl,
4,4',4''-tris(4,5-dichlorophthalimidophenyl)methyl,
4,4',4''-tris(levulinoyloxyphenyl)methyl,
4,4',4''-tris(benzoyloxyphenyl)methyl,
3-(imidazol-1-yl)bis(4',4''-dimethoxyphenyl)methyl,
1,1-bis(4-methoxyphenyl)-1'-pyrenylmethyl, 9-anthryl,
9-(9-phenyl)xanthenyl, 9-(9-phenyl-10-oxo)anthryl,
1,3-benzodithiolan-2-yl, benzisothiazolyl S,S-dioxido,
trimethylsilyl (TMS), triethylsilyl (TES), triisopropylsilyl
(TIPS), dimethylisopropylsilyl (IPDMS), diethylisopropylsilyl
(DEIPS), dimethylthexylsilyl, t-butyldimethylsilyl (TBDMS),
t-butyldiphenylsilyl (TBDPS), tribenzylsilyl, tri-p-xylylsilyl,
triphenylsilyl, diphenylmethylsilyl (DPMS),
t-butylmethoxyphenylsilyl (TBMPS), formate, benzoylformate,
acetate, chloroacetate, dichloroacetate, trichloroacetate,
trifluoroacetate, methoxyacetate, triphenylmethoxyacetate,
phenoxyacetate, p-chlorophenoxyacetate, 3-phenylpropionate,
4-oxopentanoate (levulinate), 4,4-(ethylenedithio)pentanoate
(levulinoyldithioacetal), pivaloate, adamantoate, crotonate,
4-methoxycrotonate, benzoate, p-phenylbenzoate,
2,4,6-trimethylbenzoate (mesitoate), alkyl methyl carbonate,
9-fluorenylmethyl carbonate (Fmoc), alkyl ethyl carbonate, alkyl
2,2,2-trichloroethyl carbonate (Troc), 2-(trimethylsilyl)ethyl
carbonate (TMSEC), 2-(phenylsulfonyl)ethyl carbonate (Psec),
2-(triphenylphosphonio)ethyl carbonate (Peoc), alkyl isobutyl
carbonate, alkyl vinyl carbonate alkyl allyl carbonate, alkyl
p-nitrophenyl carbonate, alkyl benzyl carbonate, alkyl
p-methoxybenzyl carbonate, alkyl 3,4-dimethoxybenzyl carbonate,
alkyl o-nitrobenzyl carbonate, alkyl p-nitrobenzyl carbonate, alkyl
S-benzyl thiocarbonate, 4-ethoxy-1-napththyl carbonate, methyl
dithiocarbonate, 2-iodobenzoate, 4-azidobutyrate,
4-nitro-4-methylpentanoate, o-(dibromomethyl)benzoate,
2-formylbenzenesulfonate, 2-(methylthiomethoxy)ethyl,
4-(methylthiomethoxy)butyrate, 2-(methylthiomethoxymethyl)benzoate,
2,6-dichloro-4-methylphenoxyacetate,
2,6-dichloro-4-(1,1,3,3-tetramethylbutyl)phenoxyacetate,
2,4-bis(1,1-dimethylpropyl)phenoxyacetate, chlorodiphenylacetate,
isobutyrate, monosuccinoate, (E)-2-methyl-2-butenoate,
o-(methoxycarbonyl)benzoate, .alpha.-naphthoate, nitrate, alkyl
N,N,N',N'-tetramethylphosphorodiamidate, alkyl N-phenylcarbamate,
borate, dimethylphosphinothioyl, alkyl 2,4-dinitrophenylsulfenate,
sulfate, methanesulfonate (mesylate), benzylsulfonate, and tosylate
(Ts). For protecting 1,2- or 1,3-diols, the protecting groups
include methylene acetal, ethylidene acetal, 1-t-butylethylidene
ketal, 1-phenylethylidene ketal, (4-methoxyphenyl)ethylidene
acetal, 2,2,2-trichloroethylidene acetal, acetonide,
cyclopentylidene ketal, cyclohexylidene ketal, cycloheptylidene
ketal, benzylidene acetal, p-methoxybenzylidene acetal,
2,4-dimethoxybenzylidene ketal, 3,4-dimethoxybenzylidene acetal,
2-nitrobenzylidene acetal, methoxymethylene acetal, ethoxymethylene
acetal, dimethoxymethylene ortho ester, 1-methoxyethylidene ortho
ester, 1-ethoxyethylidine ortho ester, 1,2-dimethoxyethylidene
ortho ester, .alpha.-methoxybenzylidene ortho ester,
1-(N,N-dimethylamino)ethylidene derivative,
.alpha.-(N,N'-dimethylamino)benzylidene derivative,
2-oxacyclopentylidene ortho ester, di-t-butylsilylene group (DTBS),
1,3-(1,1,3,3-tetraisopropyldisiloxanylidene) derivative (TIPDS),
tetra-t-butoxydisiloxane-1,3-diylidene derivative (TBDS), cyclic
carbonates, cyclic boronates, ethyl boronate, and phenyl
boronate.
[0037] Agglutinated--When two or more cells are "agglutinated" by a
cross-linking agent as described herein, they are each physically
associated with the cross-linking agent in a cell-agent-cell
complex. Typically, agglutination only occurs once the
cross-linking agent concentration reaches a threshold
concentration. This concentration is referred to as the minimum
agglutination concentration (MAC). The MAC for a given
cross-linking agent is commonly measured using a spectrophotometric
plate reader that can quantify changes in solution absorbance.
[0038] Associated--As used herein, two entities are physically
"associated" with one another when they are bound by direct
non-covalent interactions. Desirable non-covalent interactions
include those of the type which occur between an immunoglobulin
molecule and an antigen for which the immunoglobulin is specific,
for example, ionic interactions, hydrogen bonds, van der Waals
interactions, hydrophobic interactions, etc. The strength, or
affinity of the physical association can be expressed in terms of
the dissociation constant (K.sub.d) of the interaction, wherein a
smaller K.sub.d represents a greater affinity. For example, the
association properties of a selected cross-linking agent and target
molecule can be quantified using methods well known in the art.
[0039] Biodegradable--As used herein, the term "biodegradable"
refers to molecules that degrade (i.e., lose at least some of their
covalent structure) under physiological or endosomal conditions.
Biodegradable molecules are not necessarily hydrolytically
degradable and may require enzymatic action to degrade.
[0040] Biomolecule--As used herein, the term "biomolecule" refers
to molecules (e.g., polypeptides, amino acids, polynucleotides,
nucleotides, polysaccharides, sugars, lipids, nucleoproteins,
glycoproteins, lipoproteins, steroids, metabolites, etc.) whether
naturally-occurring or artificially created (e.g., by synthetic or
recombinant methods) that are commonly found in cells and tissues.
Specific classes of biomolecules include, but are not limited to,
enzymes, receptors, neurotransmitters, hormones, cytokines, cell
response modifiers such as growth factors and chemotactic factors,
antibodies, vaccines, haptens, toxins, interferons, ribozymes,
anti-sense agents, plasmids, DNA, and RNA.
[0041] Drug--As used herein, the term "drug" refers to small
molecules or biomolecules that alter, inhibit, activate, or
otherwise affect a biological event. For example, drugs may
include, but are not limited to, anti-AIDS substances, anti-cancer
substances, antibiotics, anti-diabetic substances,
immunosuppressants, anti-viral substances, enzyme inhibitors,
neurotoxins, opioids, hypnotics, anti-histamines, lubricants,
tranquilizers, anti-convulsants, muscle relaxants and
anti-Parkinson substances, anti-spasmodics and muscle contractants
including channel blockers, miotics and anti-cholinergics,
anti-glaucoma compounds, anti-parasite and/or anti-protozoal
compounds, modulators of cell-extracellular matrix interactions
including cell growth inhibitors and anti-adhesion molecules,
vasodilating agents, inhibitors of DNA, RNA or protein synthesis,
anti-hypertensives, analgesics, anti-pyretics, steroidal and
non-steroidal anti-inflammatory agents, anti-angiogenic factors,
anti-secretory factors, anticoagulants and/or anti-thrombotic
agents, local anesthetics, ophthalmics, prostaglandins,
anti-depressants, anti-psychotic substances, anti-emetics, and
imaging agents. A more complete listing of exemplary drugs suitable
for use in the present invention may be found in "Pharmaceutical
Substances: Syntheses, Patents, Applications" by Axel Kleemann and
Jurgen Engel, Thieme Medical Publishing, 1999; the "Merck Index: An
Encyclopedia of Chemicals, Drugs, and Biologicals", edited by Susan
Budavari et al., CRC Press, 1996, and the United States
Pharmacopeia-25/National Formulary-20, published by the United
States Pharmcopeial Convention, Inc., Rockville Md., 2001.
[0042] Hyperbranched--As used herein, a "hyperbranched" structure
is a covalent structure that includes at least one branched branch
(e.g., a dendrimeric structure). A hyperbranched structure may
include polymeric and/or non-polymeric substructures.
[0043] Lectin--As used herein, a "lectin" is a protein that binds
with specificity to saccharides and polysaccharides. A lectin can
be of any origin (e.g., plant, animal or other). In certain
embodiments a lectin can be isolated from a natural source. In
other embodiments a lectin can be produced synthetically or
recombinantly. A lectin can be composed of one or more subunits
under physiological conditions. In preferred embodiments a lectin
is composed of two or more subunits under physiological conditions
(e.g., four subunits). The subunits may be the same or
different.
[0044] Mitogenic lectin--A "mitogenic lectin" is a lectin that
stimulates the proliferation of T-cells as measured by a thymidine
uptake assay using peripheral blood mononuclear cells (PBMC) from
one or more healthy patients. Generally a mitogenic lectin will
produce a detectable level of thymidine uptake at concentrations of
1 ug/ml. Exemplary mitogenic lectins include, but are not limited
to, artocarpus integrifolia agglutinin (Jacalin), bauhinia purpurea
agglutinin (BPA), concanavalin A (Con A), succinyl-concanavalin A
(s-Con A), erythrina corallodendron agglutinin (ECorA), euonymus
europaeus agglutinin (EEA), glycine max agglutinin (SBA), Lens
culinaris agglutinin (LcH), maackia amurensis agglutinin (MAA),
phaseolus vulgaris agglutinin (PHA), pokeweed mitogen (PWM), wheat
germ agglutinin (WGA), and vicia faba agglutinin (VFA) all of which
are available from Sigma-Aldrich of St. Louis, Mo. It is to be
understood that the terms "mitogenic lectin" include derivatives of
native lectins that retain the ability to stimulate the
proliferation of T-cells (e.g., derivatives that include amino acid
substitutions, deletions or additions). Exemplary derivatives are
those into which amino acid residues have been introduced by
site-directed mutagenesis (e.g., in order to provide additional
reactive groups for chemical modification). Generally, suitable
derivatives will have at least 90% sequence homology with a native
lectin as determined using standard methods known in the art (e.g.,
using Blast with default settings). Preferably the derivatives will
have at least 95% sequence homology, more preferably 99% sequence
homology with a native lectin. Without limitation, exemplary
derivatives may induce a level of T-cell proliferation that is at
least 90% that of their native counterparts. More preferably, the
level is at least 95%, even more preferably at least 99%.
[0045] Native lectin--As used herein, a "native lectin" is a
protein with the chemical composition of a lectin that is found in
nature.
[0046] Percentage homology--As used herein, the terms "percentage
homology" refer to the percentage of sequence identity between two
sequences after optimal alignment as defined in the present
disclosure. For example, two nucleotide sequences are said to be
"identical" if the sequence of nucleotides in the two sequences is
the same when aligned for maximum correspondence as described
below. Sequence comparisons between two nucleotide sequences are
typically performed by comparing sequences of two optimally aligned
sequences over a region or "comparison window" to identify and
compare regions of sequence similarity. Optimal alignment of
sequences for comparison may be conducted by the local homology
algorithm of Smith and Waterman, Ad. App. Math. 2:482 (1981), by
the homology alignment algorithm of Neddleman and Wunsch, J. Mol.
Biol. 48:443 (1970), by the search for similarity method of Pearson
and Lipman, Proc. Natl. Acad. Sci. USA 85:2444 (1988), by
computerized implementation of these algorithms, or by visual
inspection.
[0047] Percentage of sequence identity--"Percentage of sequence
identity" is determined by comparing two optimally aligned
sequences over a comparison window, where the portion of the
nucleotide sequence in the comparison window may comprise additions
or deletions (i.e., gaps) as compared to the reference sequence
(which does not comprise additions or deletions) for optimal
alignment of the two sequences. The percentage is calculated by
determining the number of positions at which the identical
nucleotide residue occurs in both sequences to yield the number of
matched positions, dividing the number of matched positions by the
total number of positions in the window of comparison and
multiplying the result by 100 to yield the percentage of sequence
identity. This definition of sequence identity given above is the
definition that would be used by one of ordinary skill in the art.
The definition by itself does not need the help of any algorithm.
The algorithms are only helpful to facilitate the optimal
alignments of sequences, rather than calculate sequence identity.
From this definition, it follows that there is a well defined and
only one value for the sequence identity between two compared
sequences which value corresponds to the value obtained for the
optimal alignment.
[0048] Physiological conditions--As used herein, "physiological
conditions" are those conditions that are found in the arterial
blood of a typical patient. Generally, the patient is a mammal,
e.g., a human, dog, cat, mouse, etc. In human patients, the pH
under physiological conditions is typically between about 7.35 and
about 7.45 (preferably about 7.40). Human physiological
temperatures range from about 36.4 to about 37.4 C (preferably
about 36.9 C).
[0049] Polymer--As used herein, a "polymer" or "polymeric
structure" is a structure that includes a string of covalently
bound monomers. A polymer can be made from one type of monomer or
more than one type of monomer. The term "polymer" therefore
encompasses copolymers, including block-copolymers in which
different types of monomer are grouped separately within the
overall polymer. A polymer can be linear or branched.
[0050] Polynucleotide--As used herein, a "polynucleotide" is a
polymer of nucleotides. The terms "polynucleotide", "nucleic acid",
and "oligonucleotide" may be used interchangeably. The polymer may
include natural nucleosides (i.e., adenosine, thymidine, guanosine,
cytidine, uridine, deoxyadenosine, deoxythymidine, deoxyguanosine,
and deoxycytidine), nucleoside analogs (e.g., 2-aminoadenosine,
2-thiothymidine, inosine, pyrrolo-pyrimidine, 3-methyl adenosine,
5-methylcytidine, C5-bromouridine, C5-fluorouridine,
C5-iodouridine, C5-propynyl-uridine, C5-propynyl-cytidine,
C5-methylcytidine, 7-deazaadenosine, 7-deazaguanosine,
8-oxoadenosine, 8-oxoguanosine, O(6)-methylguanine,
4-acetylcytidine, 5-(carboxyhydroxymethyl)uridine, dihydrouridine,
methylpseudouridine, 1-methyl adenosine, 1-methyl guanosine,
N6-methyl adenosine, and 2-thiocytidine), chemically modified
bases, biologically modified bases (e.g., methylated bases),
intercalated bases, modified sugars (e.g., 2'-fluororibose, ribose,
2'-deoxyribose, 2'-O-methylcytidine, arabinose, and hexose), or
modified phosphate groups (e.g., phosphorothioates and
5'-N-phosphoramidite linkages).
[0051] Polypeptide--As used herein, a "polypeptide" is a polymer of
amino acids. The terms "polypeptide", "protein", "oligopeptide",
and "peptide" may be used interchangeably. Polypeptides may contain
natural amino acids, non-natural amino acids (i.e., compounds that
do not occur in nature but that can be incorporated into a
polypeptide chain) and/or amino acid analogs as are known in the
art. Also, one or more of the amino acid residues in a polypeptide
may be modified, for example, by the addition of a chemical entity
such as a carbohydrate group, a phosphate group, a farnesyl group,
an isofarnesyl group, a fatty acid group, a linker for conjugation,
functionalization, or other modification, etc. These modifications
may include cyclization of the peptide, the incorporation of
D-amino acids, etc.
[0052] Polysaccharide--As used herein, a "polysaccharide" is a
polymer of saccharides. The terms "polysaccharide", "carbohydrate",
and "oligosaccharide", may be used interchangeably. The polymer may
include natural saccharides (e.g., arabinose, lyxose, ribose,
xylose, ribulose, xylulose, allose, altrose, galactose, glucose,
gulose, idose, mannose, talose, fructose, psicose, sorbose,
tagatose, mannoheptulose, sedoheptulose, octolose, and sialose)
and/or modified saccharides (e.g., 2'-fluororibose, 2'-deoxyribose,
and hexose). Exemplary disaccharides include sucrose, lactose,
maltose, trehalose, gentiobiose, isomaltose, kojibiose,
laminaribiose, mannobiose, melibiose, nigerose, rutinose, and
xylobiose.
[0053] Small molecule--As used herein, the term "small molecule"
refers to molecules, whether naturally-occurring or artificially
created (e.g., via chemical synthesis), that have a relatively low
molecular weight. Typically, small molecules are monomeric and have
a molecular weight of less than about 1500 g/mol. Preferred small
molecules are biologically active in that they produce a local or
systemic effect in animals, preferably mammals, more preferably
humans. In certain preferred embodiments, the small molecule is a
drug. Preferably, though not necessarily, the drug is one that has
already been deemed safe and effective for use by the appropriate
governmental agency or body. For example, drugs for human use
listed by the FDA under 21 C.F.R. .sctn..sctn.330.5, 331 through
361, and 440 through 460; drugs for veterinary use listed by the
FDA under 21 C.F.R. .sctn..sctn.500 through 589, are all considered
acceptable for use in accordance with the present invention.
[0054] Treat--As used herein, the term "treat" (or "treating",
"treated", "treatment", etc.) refers to the administration of a
material of the present disclosure to a subject in need thereof
with the purpose to alleviate, relieve, alter, ameliorate, improve
or affect a condition (e.g., diabetes), a symptom or symptoms of a
condition (e.g., hyperglycemia), or the predisposition toward a
condition.
BRIEF DESCRIPTION OF THE DRAWINGS
[0055] FIG. 1: Comparison between RP-HPLC chromatograms obtained
for (a) exemplary conjugate synthesized using TSAT-C6 as the
scaffold, AEM as the affinity ligand, and
NH2-B1-BOC2(A1,B29)-insulin as the drug and (b) an insulin-glycogen
conjugate synthesized according to Example 32.
[0056] FIG. 2: Accelerated stability testing (AST) aggregation
assay for Conjugate 1 (.quadrature.), Conjugate 2 (.DELTA.), and
RHI (.diamond-solid.) in PBS buffer. The conjugates demonstrate
greatly enhanced stability over pharmaceutical grade RHI.
[0057] FIG. 3(a): Accelerated stability testing (AST) chemical
stability results (a) RP-HPLC AST conjugate stability.
[0058] FIG. 3(b): Accelerated stability testing (AST) chemical
stability results (b) LC/MS data on AST conjugates.
[0059] FIG. 4: In vivo bioactivity in (n=4) non-diabetic, male
Sprague-Dawley (SD) rats for fresh conjugate (.tangle-solidup.) and
72 hr AST conjugate (.largecircle.). The 72 hr AST conjugate
bioactivity was indistinguishable from that of the fresh conjugate
(p>0.21 for all timepoints).
[0060] FIG. 5: Blood glucose depression profile in non-diabetic,
male SD rats (n=3) for subcutaneously injected (.tangle-solidup.)
insulin-dextran (70 K) at a dose of .about.20 U of insulin
equivalents/kg.
[0061] FIG. 6: Blood glucose depression profile in non-diabetic,
male SD rats (n=3) for subcutaneously injected (.box-solid.)
insulin-glycogen (Type II oyster) at a dose of .about.2.5 U of
insulin equivalents/kg.
[0062] FIG. 7: Blood glucose levels resulting from a 3.5 U
equivalent insulin/kg subcutaneous dose of (.diamond-solid.)
TSAT-C6-AEM-2 insulin conjugate and (.quadrature.) soluble
recombinant human insulin (RHI) in male non-diabetic SD rats. Each
set of data represents the average and standard deviation for n=6
rats.
[0063] FIG. 8: Serum insulin concentrations resulting from a 3.5 U
equivalent insulin/kg subcutaneous dose of (.diamond-solid.)
TSAT-C6-AEM-2 insulin conjugate and (.quadrature.) soluble
recombinant human insulin (RHI) in male non-diabetic SD rats. Each
set of data represents the average and standard deviation for n=6
rats.
[0064] FIG. 9: Plot of (.diamond-solid.) serum insulin and
(.largecircle.) blood glucose levels following subcutaneous
injection in non-diabetic, male SD rats at time 0 with
TSAT-C6-AEM-2 (B29-substituted) insulin conjugate (5 U/kg). Data
represents the average and standard deviation for n=3 rats.
[0065] FIG. 10: Chemical structures of AEG, AEM, AEBM and AETM. The
affinity of these sugar based affinity ligands for Con A increases
as shown.
[0066] FIG. 11: Chemical structures of some exemplary
non-dendrimeric conjugates.
[0067] FIG. 12: Plot of serum insulin (left) and blood glucose
(right) levels following subcutaneous injection in non-diabetic,
male SD rats at time 0 with TSAT-C6-AEM-2 insulin conjugate
(.diamond-solid.), soluble recombinant human insulin,
(.largecircle.) and insulin lispro (.DELTA.) (all 3.5 U/kg). Data
represents the average and standard deviation for n=6 rats.
[0068] FIG. 13: Plot of blood glucose levels following subcutaneous
injection in non-diabetic, male SD rats (n=3 for each formulation)
at time 0 with TSAT-C6 based insulin conjugates with the different
affinity ligands as shown. The glucose lowering response decreases
as the affinity of the affinity ligand increases.
[0069] FIG. 14: Plot of serum insulin (left) and blood glucose
(right) levels following subcutaneous injection in non-diabetic,
male SD rats (n=3) at time 0 with TSAT-C6-AEM-2 conjugate (3.5
U/kg).
[0070] FIG. 15: Plot of serum insulin (left) and blood glucose
(right) levels following subcutaneous injection in non-diabetic,
male SD rats (n=3) at time 0 with TSAT-C6-AEBM-2 conjugate (5
U/kg).
[0071] FIG. 16: Plot of serum insulin (left) and blood glucose
(right) levels following subcutaneous injection in non-diabetic,
male SD rats (n=3) at time 0 with TSAT-C6-AEBM-1 AETM-1 conjugate
(5 U/kg).
[0072] FIG. 17: Comparison of minimum agglutinating concentrations
(MAC) for lectins modified with different affinity ligands.
[0073] FIG. 18: Plot of (.diamond-solid.) serum insulin and
(.largecircle.) blood glucose levels following subcutaneous
injection in non-diabetic SD rats at time 0 with
(TSAT-C6-AEBM-2-insulin/DEM-photoaffinity-modified Con A)
glucose-responsive materials. An i.p. injection of glucose was
administered at 120 min as indicated by the *.
[0074] FIG. 19: Plot of (.diamond-solid.) serum insulin and
(.largecircle.) blood glucose levels following subcutaneous
injection in non-diabetic SD rats at time 0 with
(TSAT-C6-AETM-2-insulin/DEM-photoaffinity-modified Con A)
glucose-responsive materials. An i.p. injection of glucose was
administered at 120 min as indicated by the *.
[0075] FIG. 20: Amount of glucose-responsive,
insulin-glycogen-based material remaining insoluble as a function
of glucose concentration after six hours of incubation at
37.degree. C. in the presence of (.diamond-solid.) porcine serum,
(.box-solid.) human serum, (.tangle-solidup.) rat serum, and (x)
1.times.PBS buffer.
[0076] FIG. 21: Digestion activity of 1:8 dilutions of porcine
(solid line), rat (long dash line), and human (short dash line)
serum in PBS as measured by production of colorimetric signal
(A405) for (a) amylase activity (4-Nitrophenyl
.alpha.-D-penta-(1.fwdarw.4)-glucopyranoside reporter) and (b)
glucosidase activity (4-Nitrophenyl .alpha.-D-glucopyranoside
reporter).
[0077] FIG. 22: Left: image taken after one hour of precipitation
as a function of glucose concentration. Right: Plot of the amount
of light blocked by each of the wells as measured by the absorbance
at 450 nm (A450) as a function of glucose concentration after one
hour of mixing the conjugate and modified lectin.
[0078] FIG. 23: Amount of glucose-responsive material constructed
(using an exemplary insulin conjugate) remaining insoluble as a
remaining insoluble as a function of glucose concentration after
six hours of incubation at 37.degree. C. in the presence of
(.diamond-solid.) porcine serum, (.box-solid.) human serum,
(.tangle-solidup.) rat serum, and (x) 1.times.PBS buffer.
[0079] FIG. 24: (a) Plot of (.diamond-solid.) serum insulin and
(.largecircle.) blood glucose levels following subcutaneous
injection in non-diabetic SD rats at time 0 with glucose-responsive
materials constructed from exemplary conjugate X and ACA. An i.p.
injection of glucose was administered at 120 min as indicated by
the *. (b) Serum insulin plots of (.diamond-solid.)
glucose-responsive materials constructed from exemplary conjugate X
and ACA and (.largecircle.) endogenous rat pancreatic insulin as a
function of time in response to an i.p. injection of glucose
administered at 120 min as indicated by the *. Each set of data
represents the average and standard deviation for n=3 rats.
[0080] FIG. 25: Plot of (.diamond-solid.) serum insulin and
(.largecircle.) blood glucose levels following subcutaneous
injection in non-diabetic SD rats at time 0 with recombinant human
insulin (RHI). An i.p. injection of glucose was administered at 120
min as indicated by the *.
[0081] FIG. 26: Plot of (.upsilon.) serum insulin and
(.quadrature.) blood glucose concentration from glucose clamp
studies following the subcutaneous injection of an exemplary
glucose-responsive material (TSAT-C6-AEM-2-insulin/ACA) in n=4
non-diabetic rats. Following injection, the glucose levels were
maintained at 100 mg/dl for 120 min using an i.v. glucose infusion
after which the glucose levels were ramped up to and maintained at
400 mg/dl for the last 120 min. The data represent the average and
standard deviation for n=4 rats.
[0082] FIG. 27: Plot of (.diamond-solid.) serum insulin and
(.largecircle.) blood glucose concentration from glucose clamp
studies following the subcutaneous injection of an exemplary
glucose-responsive material (TSAT-C6-AEM-2-insulin/ACA) in n=4
non-diabetic pigs. Following injection, the glucose levels were
maintained at 65 mg/dl for 120 min using an i.v. glucose infusion
after which the glucose levels were ramped up to and maintained at
400 mg/dl for the last 120 min. The data represent the average and
standard deviation for n=4 pigs.
[0083] FIG. 28: Schematic of a multivalent lectin 20 with at least
two binding sites 30 for glucose, wherein the lectin 20 includes at
least one covalently linked affinity ligand 40 which is capable of
competing with glucose for binding with at least one of said
binding sites 30.
[0084] FIG. 29: Schematic of a cross-linked material 10 that
includes multivalent lectins 20 of FIG. 28 (for simplicity the at
least one covalently linked affinity ligand 40 which is capable of
competing with glucose for binding with at least one of said
binding sites 30 is not shown in the main schematic of FIG. 29);
and conjugates 50 that include two or more separate affinity
ligands 60 bound to a conjugate framework 70, wherein the two or
more affinity ligands 60 compete with glucose for binding with the
lectins 20 at said binding sites 30 and wherein conjugates 50 are
cross-linked within the material 10 as a result of non-covalent
interactions between lectins 20 and affinity ligands 60 on
different conjugates 50.
[0085] FIG. 30: Structure of wild-type human insulin.
DETAILED DESCRIPTION OF VARIOUS EMBODIMENTS
[0086] This application refers to a number of documents including
patent and non-patent documents. The entirety of each of these
documents is incorporated herein by reference.
[0087] In one aspect and as shown in FIGS. 28 and 29, the
disclosure provides a cross-linked material 10 that includes
multivalent lectins 20 with at least two binding sites 30 for
glucose, wherein the lectins 20 include at least one covalently
linked affinity ligand 40 which is capable of competing with
glucose for binding with at least one of said binding sites 30; and
conjugates 50 that include two or more separate affinity ligands 60
bound to a conjugate framework 70, wherein the two or more affinity
ligands 60 compete with glucose for binding with the lectins 20 at
said binding sites 30 and wherein conjugates 50 are cross-linked
within the material 10 as a result of non-covalent interactions
between lectins 20 and affinity ligands 60 on different conjugates
50. These materials are designed to release amounts of conjugate in
response to desired concentrations of glucose. Depending on the end
application, in various embodiments, the conjugates may also
include a drug and/or a detectable label. The drug, detectable
label and affinity ligands may be covalently or non-covalently
bound to the conjugate framework. The disclosure also provides
methods of using these materials and methods of making these
materials. In another aspect, the disclosure provides exemplary
chemically modified lectins for use in glucose responsive materials
instead of native lectins such as Con A.
[0088] The lectins of the present disclosure bind glucose and are
multivalent. The conjugates include a conjugate framework with two
or more separate affinity ligands that compete with glucose for
binding with the lectins. When lectins and conjugates are combined
in the absence of glucose, a non-covalently cross-linked material
is formed. When the material is placed in the presence of free
glucose these compete for the interactions between the lectins and
the conjugates. Above a certain concentration of free glucose, the
level of competition becomes such that the material begins to
degrade by releasing conjugates. As a result, conjugates are
released from the material in a manner which is directly tied to
the local concentration of glucose.
Multivalent Lectins
[0089] Lectins in a cross-linked material of the present disclosure
include at least two binding sites for glucose (i.e., they are
multivalent). In addition, the lectins include at least one
covalently linked affinity ligand which is capable of associating
with one of these binding sites. In various embodiments, the
lectins may include just one covalently linked affinity ligand. In
various embodiments, the lectins may include one covalently linked
affinity ligand per binding site. Typically a multivalent lectin
will include 2 or 4 binding sites (e.g., a dimer or tetramer of a
monovalent lectin) but the present disclosure also encompasses
lectins with 3, 5 or more binding sites. The present disclosure
also encompasses lectins with more than one covalently linked
affinity ligand per binding site. The present disclosure further
encompasses materials which include a mixture of lectins that
include different numbers of covalently linked affinity ligands
and/or that include unmodified lectins.
Lectins
[0090] The methods of the present disclosure may be applied to any
lectin. Lectins have been isolated from a variety of natural
sources including seeds, roots, bark, fungi, bacteria, seaweed,
sponges, mollusks, fish eggs, body fluids of invertebrates and
lower vertebrates, and mammalian cell membranes (e.g., see The
Lectins: Properties, Functions, and Applications in Biology and
Medicine, Edited by Liener et al., Academic Press, 1986). A number
of lectins have also been produced recombinantly (e.g., see
Streicher and Sharon, Methods Enzymol. 363:47-77, 2003 and U.S.
Patent Publication No. 20060247154). As noted above, lectins bind
saccharides and polysaccharides with a high degree of specificity.
For example, some lectins will bind only to mannose or glucose
residues, while others only recognize galactose residues. Some
lectins require that the particular residue be in a terminal
position, while others bind to residues within a polysaccharide
chain. Some lectins require specific anomeric structures and yet
others recognize specific sugar sequences. The structures and
properties of lectins have been extensively described in the
literature. For recent reviews and a list of lectins see Lectins,
Edited by Sharon and Lis, Kluwer Academic Publishers, 2003;
Handbook of Animal Lectins: Properties and Biomedical Applications,
Edited by Kilpatrick, Wiley, 2000; and Handbook of Plant Lectins:
Properties and Biomedical Applications, Edited by Van Damme et al.,
Wiley, 1998. Exemplary glucose-binding lectins include calnexin,
calreticulin, N-acetylglucosamine receptor, selectin,
asialoglycoprotein receptor, collectin (mannose-binding lectin),
mannose receptor, aggrecan, versican, pisum sativum agglutinin
(PSA), vicia faba lectin, lens culinaris lectin, soybean lectin,
peanut lectin, lathyrus ochrus lectin, sainfoin lectin, sophora
japonica lectin, bowringia milbraedii lectin, concanavalin A (Con
A), and pokeweed mitogen. In various embodiments, human analogs of
plant lectins may be used. These include, without limitation, human
mannan binding protein (MBP, also called mannan binding lectin,
Sheriff et al., Structural Biology, 1:789-794 (1994);
Dumestre-Perard et al., Molecular Immunology, 39:465-473 (2002)),
human pulmonary surfactant protein A (SP-A, Allen, et al.,
Infection and Immunity, 67:4563-4569 (1999)), human pulmonary
surfactant protein D (SP-D, Persson et al., The Journal of
Biological Chemistry, 265:5755-5760 (1990)), CL-43 (a human serum
protein), and conglutinin.
Generating Multivalent Cross-Linking Agents
[0091] Some lectins are multivalent, e.g., as a result of forming
multimers under physiological conditions. Multivalent lectins can
also be generated by covalently or non-covalently linking two or
more monovalent lectins into a single construct. Typically, two or
more lectins (which may have the same or different sequences) may
be linked directly to one another (e.g., via a coupling agent) or
indirectly through a framework. In various embodiments 2, 3, 4 or
more monovalent lectins may be combined into a single construct. In
various embodiments the 2, 3, 4 or more monovalent lectins may have
the same sequence. It will be appreciated that either one of these
approaches may require the lectins to be chemically modified (e.g.,
to include pendant reactive groups) prior to coupling. It will also
be appreciated that the multivalent cross-linking agents of the
present disclosure are not limited to a particular coupling
reaction or framework (e.g., they can be prepared using frameworks
that include polymeric and/or non-polymeric structures). It will
further be appreciated that the frameworks may be linear, branched,
dendrimeric and/or a combination of these. Exemplary frameworks and
coupling chemistries are described below in the context of the
conjugates.
[0092] In various embodiments the monovalent lectins are covalently
linked to each other or a framework. In such embodiments, the
lectins can be directly linked (i.e., with no intervening chemical
groups) or indirectly linked through a spacer (e.g., a coupling
agent or covalent chain that provides some physical separation
between the lectins or between the lectins and framework). As
discussed below in the context of the conjugates it is to be
understood that lectins may be covalently linked to each other or a
framework through any number of chemical linkages, including but
not limited to amide, ester, ether, isourea, and imine bonds.
[0093] In various embodiments, two or more monovalent lectins can
be non-covalently linked to each other or to a framework. In
certain embodiments, the dissociation constant (K.sub.d) of the
non-covalent linkage in human serum is less than 1 pmol/L. For
example, lectins may be non-covalently linked to each other or a
framework via a non-covalent ligand-receptor pair as is well known
in the art (e.g., without limitation a biotin-avidin based pair).
In such an embodiment, one member of the ligand receptor-pair is
covalently linked to one lectin while the other member of the pair
is covalently linked to the other lectin or framework. When the
lectins (or lectins and framework) are combined, the strong
non-covalent interaction between the ligand and its receptor causes
the ligands to become non-covalently bound to each other (or the
framework). Typical ligand/receptor pairs include protein/co-factor
and enzyme/substrate pairs. Besides the commonly used biotin/avidin
pair, these include without limitation, biotin/streptavidin,
digoxigenin/anti-digoxigenin, FK506/FK506-binding protein (FKBP),
rapamycin/FKBP, cyclophilin/cyclosporin and glutathione/glutathione
transferase pairs. Other suitable ligand/receptor pairs would be
recognized by those skilled in the art, e.g., monoclonal antibodies
paired with a epitope tag such as, without limitation,
glutathione-S-transferase (GST), c-myc, FLAG.RTM. and further those
described in Kessler pp. 105-152 of Advances in Mutagenesis" Ed. by
Kessler, Springer-Verlag, 1990; "Affinity Chromatography: Methods
and Protocols (Methods in Molecular Biology)" Ed. by Pascal
Baillon, Humana Press, 2000; and "Immobilized Affinity Ligand
Techniques" by Hermanson et al., Academic Press, 1992.
Affinity Ligands
[0094] Any affinity ligand can be used as long as it can associate
with a binding site of the lectin once covalently linked to the
lectin. Typically an affinity ligand will include a recognition
element which interacts with the lectin binding site and a reactive
linker which enables the affinity ligand to become covalently
attached to the lectin once the recognition element is bound within
the binding site.
Recognition Element
[0095] Any recognition element that can compete for binding with
the lectin's cognate ligand (e.g., glucose or mannose in the case
of Con A) could be used in an affinity ligand of the present
disclosure. In various embodiments, the recognition element
includes a saccharide. In certain embodiments the saccharide is a
natural saccharide (e.g., glucose, fructose, galactose, mannose,
arabinose, ribose, xylose, etc.). In certain embodiments the
saccharide is a modified saccharide (e.g., 2'-fluororibose,
2'-deoxyribose, hexose, etc.). In certain embodiments the
recognition element is glucose, sucrose, maltose, mannose,
derivatives of these (e.g., glucosamine, mannosamine,
methylglucose, methylmannose, ethylglucose, ethylmannose, etc.)
and/or higher order combinations of these (e.g., a bimannose, a
linear and/or branched trimannose, etc.). Other exemplary
saccharides will be recognized by those skilled in the art. In
particular, it is to be understood that depending on the
application any one of the saccharides that are described below in
the context of the conjugate affinity ligands may be used (e.g.,
any one of the saccharides of formula IIIa or IIIb). In certain
embodiments, the recognition element includes a monosaccharide. In
certain embodiments, the recognition element includes a
disaccharide. In certain embodiments, the recognition element
includes a trisaccharide. In some embodiments, the recognition
element includes a saccharide and one or more amine groups. In some
embodiments, the recognition element is aminoethylglucose (AEG). In
some embodiments, the recognition element is aminoethylmannose
(AEM). In some embodiments, the recognition element is
aminoethylbimannose (AEBM). In some embodiments, the recognition
element is aminoethyltrimannose (AETM). In some embodiments, the
recognition element is .beta.-aminoethyl-N-acetylglucosamine
(AEGA). In some embodiments, the recognition element is
aminoethylfucose (AEF). In other embodiments, the recognition
element is D-glucosamine (GA).
[0096] In various embodiments, the recognition element includes a
polysaccharide, glycopeptide or glycolipid. In certain embodiments,
the recognition element includes from 2-10 saccharide moieties,
e.g., 2, 3, 4, 5, 6, 7, 8, 9 or 10 moieties. The terminal and/or
internal residues of the polysaccharide, glycopeptide or glycolipid
may be selected based on the saccharide specificity of the lectin
in question (e.g., see Goldstein et al., Biochem. Biophys. Acta
317:500-504, 1973 and Lis et al., Ann. Rev. Biochem. 55:35-67,
1986).
[0097] As is well known in the art, certain polysaccharides can be
prepared synthetically (e.g., see Lee et al., J. Biol. Chem.
258:199-202, 1983). Polysaccharides can also be prepared from
natural sources (e.g., other polysaccharides, glycoproteins,
glycolipids, etc.). For example, in certain embodiments,
polysaccharides can be prepared by enzymatic cleavage of
glycoproteins using endoglycosidases such as endoglycosidase D,
endoglycosidase F, endoglycosidase H and/or N-endoglycosidase F
(also called N-glycanase) (e.g., see Hirani et al., Anal. Biochem.
162:485-492, 1987). Endoglycosidases can be obtained from any
source, including commercial sources (e.g., from QA-Bio, ProZyme,
Roche, Sigma-Aldrich, New England Biolabs, Glyko, etc.).
Alternatively or additionally, endoglycosidases can be isolated
and/or purified from a cellular source (e.g., bacteria, yeast,
plant, etc.). Polysaccharides that are linked to a glycoprotein via
alkaline borohydride-labile bonds (O-glycosidic linkages) can be
cleaved from the glycoprotein by treatment with 0.1 N NaOH
containing 0.8 M NaBH.sub.4 at 37 C for 68 hours according to the
method of Spiro et al., J. Biol. Chem. 249:5704-5717, 1974.
Polysaccharides can also be released by hydrazinolysis using
standard chemical methods described by Takasaki et al., Methods
Enzymol. 83:263-268, 1982.
[0098] It will also be appreciated that prior to or after cleavage
from a glycoprotein any of these polysaccharides can be further
trimmed using one or more exoglycosidases (e.g., sialidases,
galactosidases, hexosaminidases, fucosidases, and mannosidases).
One skilled in the art can readily determine procedures for removal
of undesired terminal saccharide moieties in order to expose the
desired terminal saccharide moieties appropriate for various
lectins. Alternatively, in certain embodiments it may be
advantageous to enzymatically add a desired terminal saccharide
moiety. For example, without limitation, the enzyme UDP-galactose:
N-acetyl glucosamine-.beta.-1,4-galactosyltransferase is capable of
transferring galactose from UDP-galactose to N-acetyl-D-glucosamine
or to other polysaccharides with a terminal N-acetyl-D-glucosamine.
Addition of galactose or other saccharide residues to
polysaccharides may also be accomplished synthetically, e.g., as
described by Lee et al., Methods Enzymol. 138:424-429, 1987.
[0099] In various embodiments, the recognition element for a
particular lectin/glucose combination may be selected empirically.
According to such embodiments one or more recognition elements are
screened based on their relative binding affinities for the lectin
as compared to glucose. In certain embodiments a library of
saccharides and/or polysaccharides are screened in this manner. A
suitable recognition element will exhibit a detectable level of
competition with glucose but will not compete so strongly that it
prevents all binding between the lectin and glucose. In certain
embodiments, different recognition elements may be screened by
testing the effect of different affinity ligands on relevant lectin
properties (e.g., based on their ability to inhibit agglutination
and/or their material set points as discussed in more detail below
and in the Examples). In certain embodiments, the recognition
element will be selected in view of the conjugate that the modified
lectin is to be combined with (e.g., so that the conjugate is able
to displace the recognition element from the binding site and
thereby form a cross-linked material).
Reactive Linker
[0100] Affinity ligands may be covalently linked to a lectin in any
manner. Most methods will involve allowing the recognition element
of the ligand to associate with the lectin binding site and then
causing the reactive linker to react with the lectin. In certain
embodiments, the reactive linker may be attached to the recognition
element at a position that does not substantially interfere with
the binding properties of the recognition element. For example,
when the recognition element is a saccharide or polysaccharide the
linker may be attached to the C1, C2 or C6 position of a terminal
saccharide. In certain embodiments, the linker may be attached to
the C1 position. The C1 position is also referred to as the
anomeric carbon and may be connected to the linker in the alpha or
beta conformation. In certain embodiments, the linker is attached
to the C1 position as the alpha anomer.
[0101] In certain embodiments, photoactivatable linkers may be
used. For example, Beppu et al., J. Biochem. 78:1013-1019, 1975,
described a method in which an arylazido linker was activated using
ultraviolet light to form a covalent bond between concanavalin A
and a sugar derivative within the binding site. Similar results
were recorded by Fraser et al., Proc. Natl. Acad. Sci. (USA)
73:790-794, 1976 using succinylated concanavalin A. A similar
procedure has also been employed using ricin and a photoactivatable
derivative of galactose as described by Houston, J. Biol. Chem.
258:7208-7212, 1983. Photoactivatable derivatives of complex
glycopeptide ligands having a higher affinity for lectins than
saccharides and disaccharides have also been described by Baenziger
et al., J. Biol. Chem. 257:4421-4425, 1982. These derivatives were
made by covalently linking a photoactivatable group to the peptide
portion of the glycopeptide ligand.
[0102] In general, any photoactivatable linker may be used such as
an aryl, purine, pyrimidine, or alkyl azide, a diazo or diazirine
group, a benzophenone, or a nitrobenzene. A more comprehensive list
of potentially useful photoactivatable linkers may be found in
Fleming, Tetrahedron 51:12479-12520, 1995 as well as Brunner, Annu.
Rev. Biochem. 62:483-514, 1993 and Wong, S. S. "Chemistry of
Protein Conjugation and Cross-Linking", (1993), CRC Press, New
York, pp. 168-194 which are incorporated herein by reference.
[0103] In various embodiments, the photoactivatable linker may
include a diazirine group. Photoactivation of diazirine groups with
ultraviolet (UV) light creates reactive carbene intermediates that
can form covalent bonds through addition reactions with any amino
acid side chain or peptide backbone within range of the linker Long
wavelength UV-light (about 320-370 nm, preferably about 345 nm) is
typically used to activate diazirines (e.g., see Suchanek et al.,
Nat. Methods 2:261-268, 2005).
[0104] In various embodiments, the photoactivatable linker may
include an aryl azide group. When aryl azide groups are exposed to
UV-light they form nitrene groups that can initiate addition
reactions with double bonds, insertion into C--H and N--H sites, or
subsequent ring expansion to react as a nucleophile with primary
amines. The latter reaction path predominates when primary amines
are present in the sample. Without limitation, long wavelength
UV-light (about 320-370 nm, preferably about 366 nm) is thought to
be most efficient for substituted aryl azides (e.g., with hydroxy
or nitro groups) while shorter wavelengths are thought to be most
efficient for unsubstituted aryl azides. Suitable UV-light sources
are available commercially, e.g., from Pierce, Rockford, Ill.
[0105] For example, in various embodiments the affinity ligand may
be of the general formula (I): R.sub.e-L.sup.1 where R.sub.e is a
recognition element and -L.sup.1 is a reactive linker. In certain
embodiments R.sub.e is a saccharide moiety. In certain embodiments
R.sub.e is a glucose or mannose moiety which is covalently bonded
to the linker at the C1 position.
[0106] In certain embodiments -L.sup.1 may be of the general
formula (IIa):
##STR00001##
[0107] where:
[0108] R.sup.3 is independently selected from the group consisting
of hydrogen, --OH, --NO.sub.2, and halogen (e.g., F or Cl);
[0109] X.sup.L is a covalent bond or a bivalent, straight or
branched, saturated or unsaturated, optionally substituted
C.sub.1-20 hydrocarbon chain wherein one or more methylene units of
X.sup.L are optionally and independently replaced by --O--, --S--,
--N(R')--, --C(O)--, --C(O)O--, --OC(O)--, --N(R')C(O)--,
--C(O)N(R')--, --S(O)--, --S(O).sub.2--, --N(R')SO.sub.2--,
--SO.sub.2N(R')--, a heterocyclic group, an aryl group, or a
heteroaryl group; and
[0110] each occurrence of R' is independently hydrogen, a suitable
protecting group, or an acyl moiety, arylalkyl moiety, aliphatic
moiety, aryl moiety, heteroaryl moiety, or heteroaliphatic
moiety.
[0111] In any case where a chemical variable is shown attached to a
bond that crosses a bond of ring (for example as shown for R.sup.3
above), this means that one or more such variables are optionally
attached to the ring having the crossed bond. Each R.sup.3 group on
such a ring can be attached at any suitable position, this is
generally understood to mean that the group is attached in place of
a hydrogen atom on the parent ring. This includes the possibility
that two R.sup.3 groups can be attached to the same ring atom.
Furthermore, when more than one R.sup.3 group is present on a ring,
each may be the same or different than other R.sup.3 groups
attached thereto, and each group is defined independently of other
groups that may be attached elsewhere on the same molecule, even
though they may be represented by the same identifier.
[0112] In certain embodiments, the --N.sub.3 group is in the meta
position. In certain embodiments, the --N.sub.3 group is in the
ortho position. In certain embodiments, the --N.sub.3 group is in
the para position.
[0113] In certain embodiments, one, two, three, four, or five
methylene units of X.sup.L are optionally and independently
replaced. In certain embodiments, X.sup.L is constructed from a
C.sub.1-10, C.sub.1-8, C.sub.1-6, C.sub.1-4, C.sub.2-12,
C.sub.4-12, C.sub.6-12, C.sub.8-12, or C.sub.10-12 hydrocarbon
chain wherein one or more methylene units of X.sup.L are optionally
and independently replaced by --O--, --S--, --N(R')--, --C(O)--,
--C(O)O--, --OC(O)--, --N(R')C(O)--, --C(O)N(R')--, --S(O)--,
--S(O).sub.2--, --N(R')SO.sub.2--, --SO.sub.2N(R')--, a
heterocyclic group, an aryl group, or a heteroaryl group. In some
embodiments, one or more methylene units of X.sup.L is replaced by
a heterocyclic group. In some embodiments, one or more methylene
units of X.sup.L is replaced by a triazole moiety. In certain
embodiments, one or more methylene units of X.sup.L is replaced by
--C(O)--. In certain embodiments, one or more methylene units of
X.sup.L is replaced by --C(O)N(R')--. In certain embodiments, one
or more methylene units of X.sup.L is replaced by --O--.
[0114] In some embodiments, X.sup.L is
##STR00002##
[0115] In some embodiments, X.sup.L is
##STR00003##
[0116] In some embodiments, X.sup.L is
##STR00004##
[0117] In some embodiments, X.sup.L is
##STR00005##
[0118] In some embodiments, X.sup.L is
##STR00006##
[0119] In some embodiments, X.sup.L is
##STR00007##
[0120] In certain embodiments -L.sup.1 may be of the general
formula (IIb):
##STR00008##
[0121] where X.sup.L is as defined above for formula IIa; and
[0122] R.sup.4 is hydrogen, C.sub.1-C.sub.6 alkyl or
--CF.sub.3.
[0123] In certain embodiments, non-photoactivatable linkers may be
used. For example, U.S. Pat. Nos. 5,239,062 and 5,395,924 describe
linkers that can be activated by changes in pH or temperature.
Exemplary reactive linkers which are discussed include those which
can be introduced into an affinity ligand using reagents such as
cyanuric chloride (Kay et al., Nature 216:514-515, 1967) or
dichloro-S-triazines such as 2-amino-4,6-dichloro-S-triazine (Kay
et al., Biochim. Biophys. Acta 198:276-285, 1970) and
2,4-dichloro-6-methoxy-S-triazine (Lang et al., J. Chem. Soc.
Perkin 1:2189-2194, 1977). Reactive linkers with NHS-esters or
aldehydes that would react primarily with terminal amines such as
those found on lysines could also be used.
[0124] In various embodiments, the reactive linker for a particular
lectin/target molecule combination may be selected empirically.
According to such embodiments several affinity ligands with the
same recognition element and different linkers (e.g., linkers of
different lengths, linkers with different reactive groups, linkers
with different hydrophobicity, etc.) are screened based on their
effect on relevant lectin properties (e.g., based on their ability
to inhibit agglutination and/or their material set points as
discussed in more detail below and in the Examples).
Purification of Modified Lectins
[0125] In various embodiments, modified lectins can be further
processed in order to improve their properties. Thus, in certain
embodiments, compositions comprising multivalent lectins can be
purified in order to remove protein fragments, unmodified
components, etc. In general, these separations can be achieved on
the basis of physical properties (e.g., electrical charge;
molecular weight; and/or size) and/or chemical properties (e.g.,
binding affinity for glucose or mannose). In certain embodiments
optimal removal may be achieved by combining two or more methods
that rely on these differential properties. In one embodiment,
these separations are performed under denaturing conditions. For
example, unmodified or partially modified lectins can be removed on
the basis of their net charge by ion-exchange chromatography.
Gel-filtration chromatography may be used to discriminate between
differentially modified lectins on the basis of size. Affinity
chromatography is another method that may be used to remove
unmodified or partially modified lectins. This approach takes
advantage of the differential binding affinity of modified,
partially modified and unmodified lectins for a specific target
molecule (e.g., glucose or mannose).
Characterization of Modified Lectins
[0126] In various embodiments, modified lectins can be screened or
further tested in order to confirm or characterize their
properties. Representative assays include: affinity assays,
agglutination assays, T-cell mitogenicity assays, T-cell viability
assays, antigenicity assays, etc.
[0127] Affinity assays may involve passing the modified lectins
over an affinity column (e.g., a resin with the target molecule)
and determining the elution conditions required to remove the
lectin from the column. Equilibrium dialysis can also be used as is
known in the art. Set point assays in which the modified lectins
are combined with one or more conjugates of the present disclosure
and then contacted with varying concentrations of the glucose may
also be used. Preferably the binding affinity of the modified
lectins is at least 75% that of the unmodified lectins. More
preferably the binding affinity is at least 85% and yet more
preferably at least 95% that of the unmodified lectins.
[0128] In certain embodiments, an agglutination assay may be used
to determine the minimum agglutinating concentration (MAC) of a
modified lectin. For example, in certain embodiments the MAC may be
determined using rabbit erythrocytes as described in US
2007-0110811. We have found that higher MAC values correlate
strongly with reduced mitogenicity in the case of modified lectins.
In certain embodiments a modified lectin may have a MAC that is
higher than the unmodified lectin. Preferably the MAC is 25 times
that of the unmodified lectin. More preferably the MAC is 50 times
and yet more preferably more than 100 times that of the unmodified
lectin. In certain embodiments, the modified lectin exhibits a MAC
with a 2% v/v suspension of formaldehyde-stabilized rabbit
erythrocytes that is greater than 4 ug/ml. Preferably the MAC is
greater than 6 ug/ml, more preferably greater than 10 ug/ml, even
more preferably greater than 25 ug/ml.
[0129] Mitogenicity assays will typically involve contacting the
compositions of interest with a T-cell culture (e.g., PBMC cells)
for a period of time and then measuring the level of T-cell
proliferation. Various methods for measuring cell proliferation are
known. In one embodiment the cell density may be measured
spectrophotometrically at 450 nm. In another embodiment an indirect
measure can obtained by detecting the reduction of MTT at 570 nm
(e.g., see Ohno et al., J. Immunol. Methods 145:199-203, 1991). In
preferred embodiments, the level of cell proliferation is
determined using a tritiated thymidine uptake assay. Those skilled
in the art will recognize that other suitable methods may be used
and that the invention is in no way limited to a specific
proliferation assay. In certain embodiments, the T-cell
mitogenicity of a modified lectin is less than 50% the T-cell
mitogenicity of the unmodified lectin. The reduction in T-cell
mitogenicity may be assessed by performing a comparative thymidine
uptake assay across a range cross-linking agent concentrations,
e.g., 0.01, 0.1, 1, 10, 100 and 1000 ug/ml. In preferred
embodiments, the thymidine uptake assay is performed with samples
that include approximately 500,000 PBMCs. The mitogenicity of the
test composition (e.g., a modified composition) is then expressed
as the % maximal unmodified mitogenicity. The % maximal unmodified
mitogenicity is obtained by dividing the maximal CPM (counts per
minute) value for the test composition over all measured
concentrations by the maximal CPM value of the unmodified
composition over all measured concentrations. Preferably, the test
composition with reduced mitogenicity induces a level of T-cell
proliferation that is at least 50% lower than the unmodified
composition. More preferably, the level is at least 75% lower, even
more preferably at least 90%, 95% or 99% lower.
[0130] T-cell viability can be measured using a similar experiment
by adding Trypan Blue to the T-cell culture and counting a
representative sample of the cells (noting those that either take
up the trypan or still exclude the trypan, i.e., those that become
blue vs. those that do not). The % viability is then calculated by
dividing the number of cells that exclude the trypan (alive, "not
blue") by the total number of cells counted (dead, "blue," plus
live, "not blue"). Those skilled in the art will recognize that
other suitable methods may be used and that the invention is in no
way limited to a specific viability assay. In certain embodiments,
a modified lectin exhibits a percentage cell viability at 100 ug/ml
that is greater than 10% when assayed using PBMCs at a
concentration of 500,000 cells/ml. Preferably the percentage cell
viability is greater than 25%, more preferably greater than 50%,
even more preferably greater than 90%.
Conjugates
[0131] The conjugates include two or more separate affinity ligands
bound to a conjugate framework. The two or more separate affinity
ligands compete with the target molecule for binding with the
modified lectin. Depending on the end application, the conjugates
may also include a drug and/or a detectable label. The affinity
ligands, drug, and/or detectable label may be covalently or
non-covalently bound to the conjugate framework.
Affinity Ligands
[0132] The two or more separate affinity ligands may have the same
or different chemical structures. The two or more separate affinity
ligands may have the same chemical structure as the target molecule
itself or may be a chemically related species of the target
molecule. The only requirement is that they compete with the target
molecule for binding with the modified lectin. In certain
embodiments, the relative affinity of the conjugate and target
molecule for the modified lectin is in the range of 1:1 to 100:1
(where a relative affinity of 100:1 means that, in an equilibrium
mixture of conjugate, target molecule and modified lectin (in pH 7
HEPES buffered saline at 37 C), the modified lectin will bind about
equal molar amounts of conjugate and target molecule if the
concentration of target molecule is 100.times. the concentration of
conjugate). In certain embodiments, the relative affinity is in the
range of 1:1 to 50:1, 1:1 to 10:1, 1:1 to 5:1 or 1:1 to 2:1. In
various embodiments it may be advantageous for the affinity ligands
to have a different chemical structure from the target molecule,
e.g., in order to fine tune the relative affinity of the modified
lectin for the conjugates and the target molecule. For example,
when the target molecule is glucose one might use a saccharide or a
polysaccharide as one or more of affinity ligands. For example,
when the target molecule is glucose the affinity ligands may
include a saccharide. Thus, in certain embodiments, the affinity
ligands are capable of competing with glucose for binding to a
multivalent glucose binding molecule (e.g., without limitation Con
A, mannan-binding lectin or MBL, etc.).
[0133] In certain embodiments, the affinity ligand is of formula
(IIIa) or (IIIb):
##STR00009##
wherein: [0134] each R.sup.1 is independently hydrogen, --OR.sup.y,
--N(R.sup.y).sub.2, --SR.sup.y, --O--Y, -G-Z, or --CH.sub.2R.sup.x;
[0135] each R.sup.x is independently hydrogen, --OR.sup.y,
--N(R.sup.y).sub.2, --SR.sup.y, or --O--Y; [0136] each R.sup.y is
independently --R.sup.2, --SO.sub.2R.sup.2, --S(O)R.sup.2,
--P(O)(OR.sup.2).sub.2, --C(O)R.sup.2, --CO.sub.2R.sup.2, or
--C(O)N(R.sup.2).sub.2; [0137] each Y is independently a
monosaccharide, disaccharide, or trisaccharide; [0138] each G is
independently a covalent bond or an optionally substituted
C.sub.1-9 alkylene, wherein one or more methylene units of G is
optionally replaced by --O--, --S--, --N(R.sup.2)--, --C(O) --,
--OC(O)--, --C(O)O--, --C(O)N(R.sup.2)--, --N(R.sup.2)C(O)--,
--N(R.sup.2)C(O)N(R.sup.2)--, --SO.sub.2--, --SO.sub.2N(R.sup.2)--,
--N(R.sup.2)SO.sub.2--, or --N(R.sup.2)SO.sub.2N(R.sup.2)--; [0139]
each Z is independently halogen, --N(R.sup.2).sub.2, --OR.sup.2,
--SR.sup.2, --N.sub.3, --C.ident.CR.sup.2, --CO.sub.2R.sup.2,
--C(O)R.sup.2, or --OSO.sub.2R.sup.2; and [0140] each R.sup.2 is
independently hydrogen or an optionally substituted group selected
from C.sub.1-6 aliphatic, phenyl, a 4-7 membered heterocyclic ring
having 1-2 heteroatoms selected from nitrogen, oxygen, or sulfur,
or a 5-6 membered monocyclic heteroaryl ring having 1-4 heteroatoms
selected from nitrogen, oxygen, or sulfur.
[0141] In certain embodiments, the affinity ligand of formula
(IIIa) or (IIIb) is a monosaccharide. In certain embodiments, the
affinity ligand is a disaccharide. In certain embodiments, the
affinity ligand is a trisaccharide. In certain embodiments, the
affinity ligand is a tetrasaccharide. In certain embodiments, the
affinity ligand comprises no more than four saccharide
moieties.
[0142] As defined generally above, each R.sup.1 is independently
hydrogen, --OR.sup.y, --N(R.sup.y).sub.2, --SR.sup.y, --O--Y, -G-Z,
or --CH.sub.2R.sup.x. In certain embodiments, R.sup.1 is hydrogen.
In certain embodiments, R.sup.1 is --OH. In other embodiments,
R.sup.1 is --NHC(O)CH.sub.3. In certain embodiments, R.sup.1 is
--O--Y. In certain other embodiments, R.sup.1 is -G-Z. In some
embodiments, R.sup.1 is --CH.sub.2OH. In other embodiments, R.sup.1
is --CH.sub.2--O--Y. In yet other embodiments, R.sup.1 is
--NH.sub.2. One of ordinary skill in the art will appreciate that
each R.sup.1 substituent in formula (IIIa) or (IIIb) may be of (R)
or (S) stereochemistry.
[0143] As defined generally above, each R.sup.x is independently
hydrogen, --OR.sup.y, --N(R.sup.y).sub.2, --SR.sup.y, or --O--Y. In
some embodiments, R.sup.x is hydrogen. In certain embodiments,
R.sup.x is --OH. In other embodiments, R.sup.x is --O--Y.
[0144] As defined generally above, each R.sup.y is independently
--R.sup.2, --SO.sub.2R.sup.2, --S(O)R.sup.2,
--P(O)(OR.sup.2).sub.2, --C(O)R.sup.2, --CO.sub.2R.sup.2, or
--C(O)N(R.sup.2).sub.2. In some embodiments, R.sup.y is hydrogen.
In other embodiments, R.sup.y is --R.sup.2. In some embodiments,
R.sup.y is --C(O)R.sup.2. In certain embodiments, R.sup.y is
acetyl. In other embodiments, R.sup.y is --SO.sub.2R.sup.2,
--S(O)R.sup.2, --P(O)(OR.sup.2).sub.2, --CO.sub.2R.sup.2, or
--C(O)N(R.sup.2).sub.2.
[0145] As defined generally above, Y is a monosaccharide,
disaccharide, or trisaccharide. In certain embodiments, Y is a
monosaccharide. In some embodiments, Y is a disaccharide. In other
embodiments, Y is a trisaccharide. In some embodiments, Y is
mannose, glucose, fructose, galactose, rhamnose, or xylopyranose.
In some embodiments, Y is sucrose, maltose, turanose, trehalose,
cellobiose, or lactose. In certain embodiments, Y is mannose. In
certain embodiments, Y is D-mannose. One of ordinary skill in the
art will appreciate that the saccharide Y is attached to the oxygen
group of --O--Y through anomeric carbon to form a glycosidic bond.
The glycosidic bond may be of an alpha or beta configuration.
[0146] As defined generally above, each G is independently a
covalent bond or an optionally substituted C.sub.1-9 alkylene,
wherein one or more methylene units of G is optionally replaced by
--O--, --S--, --N(R.sup.2)--, --C(O)--, --OC(O)--, --C(O)O--,
--C(O)N(R.sup.2)--, --N(R.sup.2)C(O)--,
--N(R.sup.2)C(O)N(R.sup.2)--, --SO.sub.2--, --SO.sub.2N(R.sup.2)--,
--N(R.sup.2)SO.sub.2--, or --N(R.sup.2)SO.sub.2N(R.sup.2)--. In
some embodiments, G is a covalent bond. In certain embodiments, G
is --O--C.sub.1-8 alkylene. In certain embodiments, G is
--OCH.sub.2CH.sub.2--.
[0147] As defined generally above, each Z is independently halogen,
--N(R.sup.2).sub.2, --OR.sup.2, --SR.sup.2, --N.sub.3,
--C.ident.CR.sup.2, --CO.sub.2R.sup.2, --C(O)R.sup.2, or
--OSO.sub.2R.sup.2. In some embodiments, Z is a halogen or
--OSO.sub.2R.sup.2. In other embodiments, Z is --N.sub.3 or
--C.ident.CR.sup.2. In certain embodiments, Z is
--N(R.sup.2).sub.2, --OR.sup.2, or --SR.sup.2. In certain
embodiments, Z is --SH. In certain embodiments, Z is --NH.sub.2. In
certain embodiments, -G-Z is --OCH.sub.2CH.sub.2NH.sub.2.
[0148] In some embodiments, the R.sup.1 substituent on the C1
carbon of formula (IIIa) is -G-Z to give a compound of formula
(IIIa-i):
##STR00010##
wherein R.sup.1, G, and Z are as defined and described herein.
[0149] In some embodiments, the ligand is of formula (IIIa-ii):
##STR00011##
[0150] wherein R.sup.1, R.sup.x, G, and Z are as defined and
described herein.
[0151] In certain embodiments where the target molecule is glucose,
it may be advantageous for the affinity ligands to have a different
chemical structure from glucose, e.g., in order to fine tune the
response of a glucose-responsive material. For example, in certain
embodiments, one might use an affinity ligand that includes one or
more of the following: glucose, sucrose, maltose, mannose,
derivatives of these (e.g., glucosamine, mannosamine,
methylglucose, methylmannose, ethylglucose, ethylmannose, etc.)
and/or higher order combinations of these (e.g., a bimannose, a
linear and/or branched trimannose, etc.). In certain embodiments,
the affinity ligand includes a monosaccharide. In certain
embodiments, the affinity ligand includes a disaccharide. In
certain embodiments, the affinity ligand includes a trisaccharide.
In certain embodiments, the affinity ligand includes a
polysaccharide. In some embodiments, the affinity ligand includes a
saccharide and one or more amine groups. In some embodiments, the
affinity ligand is aminoethylglucose (AEG). In some embodiments,
the affinity ligand is aminoethylmannose (AEM). In some
embodiments, the affinity ligand is aminoethylbimannose (AEBM). In
some embodiments, the affinity ligand is aminoethyltrimannose
(AETM). In some embodiments, the affinity ligand is
.beta.-aminoethyl-N-acetylglucosamine (AEGA). In some embodiments,
the affinity ligand is aminoethylfucose (AEF). In other
embodiments, the affinity ligand is D-glucosamine (GA). In certain
embodiments, a saccharide ligand is of the "D" configuration. In
other embodiments, a saccharide ligand is of the "L" configuration.
Below we show the structures of these exemplary affinity ligands.
Other exemplary affinity ligands will be recognized by those
skilled in the art.
##STR00012##
[0152] In various embodiments, the affinity ligand is a
polysaccharide, glycopeptide or glycolipid. In certain embodiments,
the affinity ligand includes from 2-10 saccharide moieties, e.g.,
2, 3, 4, 5, 6, 7, 8, 9 or 10 moieties. The terminal and/or internal
residues of the polysaccharide, glycopeptide or glycolipid may be
selected based on the saccharide specificity of the lectin in
question (e.g., see Goldstein et al., Biochem. Biophys. Acta
317:500-504, 1973 and Lis et al., Ann. Rev. Biochem. 55:35-67,
1986).
[0153] In various embodiments, the affinity ligands for a
particular conjugate/modified lectin combination may be selected
empirically. According to such embodiments one or more affinity
ligands are screened based on their relative binding affinities for
the modified lectin as compared to glucose. In certain embodiments
a library of saccharides and/or polysaccharides are screened in
this manner. A suitable affinity ligand will exhibit a detectable
level of competition with glucose but will not compete so strongly
that it prevents all binding between the modified lectin and
glucose.
[0154] Other exemplary target molecule/affinity ligand combinations
will be recognized by those skilled in the art. In general, an
affinity ligand can be generated for any target molecule using the
target molecule itself and/or by generating derivatives of the
target molecule (e.g., by making chemical and/or stereochemical
modifications to the target molecule and then screening the
resulting derivative for its relative affinity to the modified
lectin in question).
[0155] As discussed in more detail below, the affinity ligands may
be naturally present within the framework of the conjugate (e.g.,
as part of a polymer backbone or as a side group of a monomer).
Alternatively (or additionally) affinity ligands may be
artificially incorporated into the conjugate framework (e.g., in
the form of a chemical group that is synthetically added to a
conjugate framework). In certain embodiments, a conjugate may
include a framework which comprises 5 or more, 10 or more, 20 or
more, 25 or more, 50 or more, or 100 or more affinity ligands. In
certain embodiments, a conjugate may include a framework which
comprises 2-5, 2-10, 2-20, 2-25, 2-50 or 2-100 affinity ligands. In
certain embodiments, a conjugate may include a framework which
comprises as few as 2, 3 or 4 separate affinity ligands.
[0156] Methods for conjugating affinity ligands to a conjugate
framework are discussed in more detail below. In certain
embodiments, when the affinity ligands include a saccharide, the
conjugation (whether direct or indirect) involves the C1, C2 or C6
position of the saccharide. In certain embodiments, the conjugation
involves the C1 position. The C1 position is also referred to as
the anomeric carbon and may be connected to the conjugate framework
in the alpha or beta conformation. In certain embodiments, the C1
position is configured as the alpha anomer. In other embodiments,
the C1 position is configured as the beta anomer.
Drug
[0157] As noted above, in various embodiments, a conjugate may
comprise a drug. For example, a drug may be included when the
material is to be used for therapeutic purposes, e.g., to
controllably deliver a drug in a patient. It is to be understood
that a conjugate can comprise any drug. A conjugate can comprise
more than one copy of the same drug and/or can comprise more than
one type of drug. The conjugates are not limited to any particular
drug and may include small molecule drugs or biomolecular drugs. In
general, the drug(s) used will depend on the disease or disorder to
be treated.
[0158] For example, without limitation, in various embodiments a
conjugate can comprise any one of the following drugs: diclofenac,
nifedipine, rivastigmine, methylphenidate, fluoroxetine,
rosiglitazone, prednison, prednisolone, codeine, ethylmorphine,
dextromethorphan, noscapine, pentoxiverine, acetylcysteine,
bromhexine, epinephrine, isoprenaline, orciprenaline, ephedrine,
fenoterol, rimiterol, ipratropium, cholinetheophyllinate,
proxiphylline, bechlomethasone, budesonide, deslanoside, digoxine,
digitoxin, disopyramide, proscillaridin, chinidine, procainamide,
mexiletin, flecainide, alprenolol, proproanolol, nadolol, pindolol,
oxprenolol, labetalol, tirnolol, atenolol,
pentaeritrityltetranitrate, isosorbiddinitrate,
isosorbidmononitrate, niphedipin, phenylamine, verapamil,
diltiazem, cyclandelar, nicotinylalcholhol, inositolnicotinate,
alprostatdil, etilephrine, prenalterol, dobutamine, dopamine,
dihydroergotamine, guanetidine, betanidine, methyldopa, reserpine,
guanfacine, trimethaphan, hydralazine, dihydralazine, prazosine,
diazoxid, captopril, nifedipine, enalapril, nitroprusside,
bendroflumethiazide, hydrochlorthiazide, metychlothiazide,
polythiazide, chlorthalidon, cinetazon, clopamide, mefruside,
metholazone, bumetanide, ethacrynacide, spironolactone, amiloride,
chlofibrate, nicotinic acid, nicheritrol, brompheniramine,
cinnarizine, dexchlorpheniramine, clemastine, antazoline,
cyproheptadine, proethazine, cimetidine, ranitidine, sucralfat,
papaverine, moxaverine, atropin, butylscopolamin, emepron,
glucopyrron, hyoscyamine, mepensolar, methylscopolamine,
oxiphencyclimine, probanteline, terodilin, sennaglycosides,
sagradaextract, dantron, bisachodyl, sodiumpicosulfat, etulos,
diphenolxylate, loperamide, salazosulfapyridine, pyrvin,
mebendazol, dimeticon, ferrofumarate, ferrosuccinate,
ferritetrasemisodium, cyanochobalamine, folid acid heparin, heparin
co-factor, diculmarole, warfarin, streptokinase, urokinase, factor
VIII, factor IX, vitamin K, thiopeta, busulfan, chlorambucil,
cyclophosphamid, melfalan, carmustin, mercatopurin, thioguanin,
azathioprin, cytarabin, vinblastin, vinchristin, vindesin,
procarbazine, dacarbazine, lomustin, estramustin, teniposide,
etoposide, cisplatin, amsachrin, aminogluthetimid, phosphestrol,
medroxiprogresterone, hydroxiprogesterone, megesterol,
noretisteron, tamoxiphen, ciclosporin, sulfosomidine,
bensylpenicillin, phenoxymethylpenicillin, dicloxacillin,
cloxacillin, flucoxacillin, ampicillin, amoxicillin, pivampicillin,
bacampicillin, piperacillin, meziocillin, mecillinam,
pivmecillinam, cephalotin, cephalexin, cephradin, cephydroxil,
cephaclor, cefuroxim, cefotaxim, ceftazidim, cefoxitin, aztreonam,
imipenem, cilastatin, tetracycline, lymecycline, demeclocycline,
metacycline, oxitetracycline, doxycycline, chloramphenicol,
spiramycin, fusidic acid, lincomycin, clindamycin, spectinomycin,
rifampicin, amphotericin B, griseofulvin, nystatin, vancomycin,
metronidazole, tinidazole, trimethoprim, norfloxacin,
salazosulfapyridin, aminosalyl, isoniazid, etambutol,
nitrofurantoin, nalidixic acid, metanamine, chloroquin,
hydroxichloroquin, tinidazol, ketokonazol, acyclovir, interferon
idoxuridin, retinal, tiamin, dexpantenol, pyridoxin, folic acid,
ascorbic acid, tokoferol, phytominadion, phenfluramin,
corticotropin, tetracosactid, tyrotropin, somatotoprin, somatrem,
vasopressin, lypressin, desmopressin, oxytocin,
chloriongonadotropin, cortison, hydrocortisone, fluodrocortison,
prednison, prednisolon, fluoximesteron, mesterolon, nandrolon,
stanozolol, oximetolon, cyproteron, levotyroxin, liotyronin,
propylthiouracil, carbimazol, tiamazol, dihydrotachysterol,
alfacalcidol, calcitirol, insulin, tolbutamid, chlorpropamid,
tolazamid, glipizid, glibenclamid, phenobarbital, methyprylon,
pyrityidion, meprobamat, chlordiazepoxid, diazepam, nitrazepam,
baclofen, oxazepam, dikaliumclorazepat, lorazepam, flunitrazepam,
alprazolam, midazolam, hydroxizin, dantrolene, chlomethiazol,
propionmazine, alimemazine, chlorpromazine, levomepromazine,
acetophenazine, fluphenazine, perphenazine, prochlorperazine,
trifluoperazine, dixyrazine, thiodirazine, periciazin,
chloprothixene, tizanidine, zaleplon, zuclopentizol, flupentizol,
thithixen, haloperidol, trimipramin, opipramol, chlomipramin,
desipramin, lofepramin, amitriptylin, nortriptylin, protriptylin,
maptrotilin, caffeine, cinnarizine, cyclizine, dimenhydinate,
meclozine, prometazine, thiethylperazine, metoclopramide,
scopolamine, phenobarbital, phenytoine, ethosuximide, primidone,
carbamazepine, chlonazepam, orphenadrine, atropine, bensatropine,
biperiden, metixene, procylidine, levodopa, bromocriptin,
amantadine, ambenon, pyridostigmine, synstigmine, disulfuram,
morphine, codeine, pentazocine, buprenorphine, pethidine,
phenoperidine, phentanyl, methadone, piritramide,
dextropropoxyphene, ketobemidone, acetylsalicylic acid, celecoxib,
phenazone, phenylbutazone, azapropazone, piroxicam, ergotamine,
dihydroergotamine, cyproheptadine, pizitifen, flumedroxon,
allopurinol, probenecid, sodiummaurothiomalate auronofin,
penicillamine, estradiol, estradiolvalerianate, estriol,
ethinylestradiol, dihydrogesteron, lynestrenol,
medroxiprogresterone, noretisterone, cyclophenile, clomiphene,
levonorgestrel, mestranol, ornidazol, tinidazol, ekonazol,
chlotrimazol, natamycine, miconazole, sulbentin, methylergotamine,
dinoprost, dinoproston, gemeprost, bromocriptine,
phenylpropanolamine, sodiumchromoglicate, azetasolamide,
dichlophenamide, betacarotene, naloxone, calciumfolinate, in
particular clonidine, thephylline, dipyradamol, hydrochlothiazade,
scopolamine, indomethacine, furosemide, potassium chloride,
morphine, ibuprofen, salbutamol, terbutalin, calcitonin, etc. It is
to be understood that this list is intended to be exemplary and
that any drug, whether known or later discovered, may be used in a
conjugate of the present disclosure.
[0159] In various embodiments, a conjugate may include a hormonal
drug which may be peptidic or non-peptidic, e.g., adrenaline,
noradrenaline, angiotensin, atriopeptin, aldosterone,
dehydroepiandrosterone, androstenedione, testosterone,
dihydrotestosterone, calcitonin, calcitriol, calcidiol,
corticotropin, cortisol, dopamine, estradiol, estrone, estriol,
erythropoietin, follicle-stimulating hormone, gastrin, ghrelin,
glucagon, gonadotropin-releasing hormone, growth hormone, growth
hormone-releasing hormone, human chorionic gonadotropin, histamine,
human placental lactogen, insulin, insulin-like growth factor,
inhibin, leptin, a leukotriene, lipotropin, melatonin, orexin,
oxytocin, parathyroid hormone, progesterone, prolactin,
prolactin-releasing hormone, a prostglandin, renin, serotonin,
secretin, somatostatin, thrombopoietin, thyroid-stimulating
hormone, thyrotropin-releasing hormone (or thyrotropin),
thyrotropin-releasing hormone, thyroxine, triiodothyronine,
vasopressin, etc. In certain embodiments, the hormone may be
selected from glucagon, insulin, insulin-like growth factor,
leptin, thyroid-stimulating hormone, thyrotropin-releasing hormone
(or thyrotropin), thyrotropin-releasing hormone, thyroxine, and
triiodothyronine. It is to be understood that this list is intended
to be exemplary and that any hormonal drug, whether known or later
discovered, may be used in a conjugate of the present
disclosure.
[0160] In various embodiments, a conjugate may include a thyroid
hormone.
[0161] In various embodiments, a conjugate may include an
anti-diabetic drug (i.e., a drug which has a beneficial effect on
patients suffering from diabetes).
[0162] In various embodiments, a conjugate may include an insulin
molecule. By "an insulin molecule" we intend to encompass both
wild-type and modified forms of insulin as long as they are
bioactive (i.e., capable of causing a detectable reduction in
glucose when administered in vivo). Wild-type insulin includes
insulin from any species whether in purified, synthetic or
recombinant form (e.g., human insulin, porcine insulin, bovine
insulin, rabbit insulin, sheep insulin, etc.). A number of these
are available commercially, e.g., from Sigma-Aldrich (St. Louis,
Mo.). A variety of modified forms of insulin are known in the art
(e.g. see Crotty and Reynolds, Pediatr. Emerg. Care. 23:903-905,
2007 and Gerich, Am. J. Med. 113:308-16, 2002 and references cited
therein). Modified forms of insulin may be chemically modified
(e.g., by addition of a chemical moiety such as a PEG group or a
fatty acyl chain as described below) and/or mutated (i.e., by
addition, deletion or substitution of one or more amino acids). In
general, a bioactive mutant form of insulin will typically differ
from wild-type insulin by 1-10 (e.g., from 1-5 or 1-2) amino acid
substitutions, additions or deletions. The wild-type sequence of
human insulin (A-chain and B-chain) is shown below and in FIG.
30.
TABLE-US-00001 A-Chain (SEQ ID NO: 1): GIVEQCCTSICSLYQLENYCN
B-Chain (SEQ ID NO: 2): FVNQHLCGSHLVEALYLVCGERGFFYTPKT
[0163] Human insulin differs from rabbit, porcine, bovine, and
sheep insulin only in amino acids A8, A9, A10, and B30 (see table
below).
TABLE-US-00002 Amino Acid Position Insulin A8 A9 A10 B30 human Thr
Ser Ile Thr rabbit Thr Ser Ile Ser porcine Thr Ser Ile Ala bovine
Ala Ser Val Ala sheep Ala Gly Val Ala
[0164] In various embodiments, an insulin molecule of the present
disclosure is mutated at the B28 and/or B29 positions of the
B-peptide sequence. For example, insulin lispro (HUMALOG.RTM.) is a
rapid acting insulin mutant in which the penultimate lysine and
proline residues on the C-terminal end of the B-peptide have been
reversed (Lys.sup.B28Pro.sup.B29-human insulin). This modification
blocks the formation of insulin multimers. Insulin aspart
(NOVOLOG.RTM.) is another rapid acting insulin mutant in which
proline at position B28 has been substituted with aspartic acid
(Asp.sup.B28-human insulin). This mutant also prevents the
formation of multimers. In some embodiments, mutation at positions
B28 and/or B29 is accompanied by one or more mutations elsewhere in
the insulin polypeptide. For example, insulin glulisine
(APIDRA.RTM.) is yet another rapid acting insulin mutant in which
aspartic acid at position B3 has been replaced by a lysine residue
and lysine at position B29 has been replaced with a glutamic acid
residue (Lys.sup.B3Glu.sup.B29-human insulin).
[0165] In various embodiments, an insulin molecule of the present
disclosure has an isoelectric point that is shifted relative to
human insulin. In some embodiments, the shift in isoelectric point
is achieved by adding one or more arginine residues to the
N-terminus of the insulin A-peptide and/or the C-terminus of the
insulin B-peptide. Examples of such insulin polypeptides include
Arg.sup.A0-human insulin, Arg.sup.B31Arg.sup.B32-human insulin,
Gly.sup.A21Arg.sup.B31Arg.sup.B32-human insulin,
Arg.sup.A0Arg.sup.B31Arg.sup.B32-human insulin, and
Arg.sup.A0Gly.sup.A21Arg.sup.B31Arg.sup.B32-human insulin. By way
of further example, insulin glargine (LANTUS.RTM.) is an exemplary
long acting insulin mutant in which Asp.sup.A21 has been replaced
by glycine, and two arginine residues have been added to the
C-terminus of the B-peptide. The effect of these changes is to
shift the isoelectric point, producing a solution that is
completely soluble at pH 4. Thus, in some embodiments, an insulin
molecule of the present disclosure comprises an A-peptide sequence
wherein A21 is Gly and B-peptide sequence wherein B31 is Arg-Arg.
It is to be understood that the present disclosure encompasses all
single and multiple combinations of these mutations and any other
mutations that are described herein (e.g., Gly.sup.A21-human
insulin, Gly.sup.A21Arg.sup.B31-human insulin,
Arg.sup.B31Arg.sup.B32-human insulin, Arg.sup.B31-human
insulin).
[0166] In various embodiments, an insulin molecule of the present
disclosure is truncated. For example, in certain embodiments, a
B-peptide sequence of an insulin polypeptide of the present
disclosure is missing B1, B2, B3, B26, B27, B28, B29 and/or B30. In
certain embodiments, combinations of residues are missing from the
B-peptide sequence of an insulin polypeptide of the present
disclosure. For example, the B-peptide sequence may be missing
residues B(1-2), B(1-3), B(29-30), B(28-30), B(27-30) and/or
B(26-30). In some embodiments, these deletions and/or truncations
apply to any of the aforementioned insulin molecules (e.g., without
limitation to produce des(B30)-insulin lispro, des(B30)-insulin
aspart, des(B30)-insulin glulisine, des(B30)-insulin glargine,
etc.).
[0167] In some embodiments, an insulin molecule contains additional
amino acid residues on the N- or C-terminus of the A or B-peptide
sequences. In some embodiments, one or more amino acid residues are
located at positions A0, A21, B0 and/or B31. In some embodiments,
one or more amino acid residues are located at position A0. In some
embodiments, one or more amino acid residues are located at
position A21. In some embodiments, one or more amino acid residues
are located at position B0. In some embodiments, one or more amino
acid residues are located at position B31. In certain embodiments,
an insulin molecule does not include any additional amino acid
residues at positions A0, A21, B0 or B31.
[0168] In certain embodiments, an insulin molecule of the present
disclosure is mutated such that one or more amidated amino acids
are replaced with acidic forms. For example, asparagine may be
replaced with aspartic acid or glutamic acid. Likewise, glutamine
may be replaced with aspartic acid or glutamic acid. In particular,
Asn.sup.A18, Asn.sup.A21, or Asn.sup.B3, or any combination of
those residues, may be replaced by aspartic acid or glutamic acid.
Gln.sup.A15 or Gln.sup.B4, or both, may be replaced by aspartic
acid or glutamic acid. In certain embodiments, an insulin molecule
has aspartic acid at position A21 or aspartic acid at position B3,
or both.
[0169] One skilled in the art will recognize that it is possible to
mutate yet other amino acids in the insulin molecule while
retaining biological activity. For example, without limitation, the
following modifications are also widely accepted in the art:
replacement of the histidine residue of position B10 with aspartic
acid (His.sup.B10.fwdarw.Asp.sup.B10) replacement of the
phenylalanine residue at position B1 with aspartic acid
(Phe.sup.B1.fwdarw.Asp.sup.B1); replacement of the threonine
residue at position B30 with alanine
(Thr.sup.B30.fwdarw.Ala.sup.B30); replacement of the tyrosine
residue at position B26 with alanine
(Tyr.sup.B26.fwdarw.Ala.sup.B26); and replacement of the serine
residue at position B9 with aspartic acid
(Ser.sup.B9.fwdarw.Asp.sup.B9).
[0170] In various embodiments, an insulin molecule of the present
disclosure has a protracted profile of action. Thus, in certain
embodiments, an insulin molecule of the present disclosure may be
acylated with a fatty acid. That is, an amide bond is formed
between an amino group on the insulin molecule and the carboxylic
acid group of the fatty acid. The amino group may be the
alpha-amino group of an N-terminal amino acid of the insulin
molecule, or may be the epsilon-amino group of a lysine residue of
the insulin molecule. An insulin molecule of the present disclosure
may be acylated at one or more of the three amino groups that are
present in wild-type insulin or may be acylated on lysine residue
that has been introduced into the wild-type sequence. In certain
embodiments, an insulin molecule may be acylated at position B1. In
certain embodiments, an insulin molecule may be acylated at
position B29. In certain embodiments, the fatty acid is selected
from myristic acid (C14), pentadecylic acid (C15), palmitic acid
(C16), heptadecylic acid (C17) and stearic acid (C18). For example,
insulin detemir (LEVEMIR.RTM.) is a long acting insulin mutant in
which Thr.sup.B30 has been deleted, and a C14 fatty acid chain
(myristic acid) has been attached to Lys.sup.B29.
[0171] In some embodiments, the N-terminus of the A-peptide, the
N-terminus of the B-peptide, the epsilon-amino group of Lys at
position B29 or any other available amino group in an insulin
molecule of the present disclosure is covalently linked to a fatty
acid moiety of general formula:
##STR00013##
wherein R.sup.F is hydrogen or a C.sub.1-30 alkyl group. In some
embodiments, R.sup.F is a C.sub.1-20 alkyl group, a C.sub.3-19
alkyl group, a C.sub.5-18 alkyl group, a C.sub.6-17 alkyl group, a
C.sub.8-16 alkyl group, a C.sub.10-15 alkyl group, or a C.sub.12-14
alkyl group. In certain embodiments, the insulin polypeptide is
conjugated to the moiety at the A1 position. In certain
embodiments, the insulin polypeptide is conjugated to the moiety at
the B1 position. In certain embodiments, the insulin polypeptide is
conjugated to the moiety at the epsilon-amino group of Lys at
position B29. In certain embodiments, position B28 of the insulin
molecule is Lys and the epsilon-amino group of Lys.sup.B28 is
conjugated to the fatty acid moiety. In certain embodiments,
position B3 of the insulin molecule is Lys and the epsilon-amino
group of Lys.sup.B3 is conjugated to the fatty acid moiety. In some
embodiments, the fatty acid chain is 8-20 carbons long. In some
embodiments, the fatty acid is octanoic acid (C8), nonanoic acid
(C9), decanoic acid (C10), undecanoic acid (C11), dodecanoic acid
(C12), or tridecanoic acid (C13). In certain embodiments, the fatty
acid is myristic acid (C14), pentadecanoic acid (C15), palmitic
acid (C16), heptadecanoic acid (C17), stearic acid (C18),
nonadecanoic acid (C19), or arachidic acid (C20). For example,
insulin detemir (LEVEMIR.RTM.) is a long acting insulin mutant in
which Thr.sup.B30 has been deleted, and a C14 fatty acid chain
(myristic acid) is attached to Lys.sup.B29.
[0172] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
Lys.sup.B28Pro.sup.B29-human insulin (insulin lispro),
Asp.sup.B28-human insulin (insulin aspart),
Lys.sup.B3Glu.sup.B29-human insulin (insulin glulisine),
Arg.sup.B31Arg.sup.B32-human insulin (insulin glargine),
N.sup..epsilon.B29-myristoyl-des(B 30)-human insulin (insulin
detemir), Ala.sup.B26-human insulin, Asp.sup.B1-human insulin,
Arg.sup.A0-human insulin, Asp.sup.B1Glu.sup.B13-human insulin,
Gly.sup.A21-human insulin, Gly.sup.A21Arg.sup.B31Arg.sup.B32-human
insulin, Arg.sup.A0Arg.sup.B31Arg.sup.B32-human insulin,
Arg.sup.A0Gly.sup.A21Arg.sup.B31Arg.sup.B32-human insulin,
des(B30)-human insulin, des(B27)-human insulin, des(B28-B30)-human
insulin, des(B1)-human insulin, des(B1-B3)-human insulin. In
certain embodiments, an insulin molecule of the present disclosure
comprises the mutations and/or chemical modifications of one of the
following insulin molecules: N.sup..epsilon.B29-palmitoyl-human
insulin, N.sup..epsilon.B29-myrisotyl-human insulin,
N.sup..epsilon.B28-palmitoyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..epsilon.B28-myristoyl-Lys.sup.B28Pro.sup.B29-human
insulin.
[0173] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B29-palmitoyl-des(B30)-human insulin,
N.sup..epsilon.B30-myristoyl-Thr.sup.B29Lys.sup.B30-human insulin,
N.sup..epsilon.B30-palmitoyl-Thr.sup.B29Lys.sup.B30-human insulin,
N.sup..epsilon.B29-(N-palmitoyl-.gamma.-glutamyl)-des(B30)-human
insulin,
N.sup..epsilon.B29-(N-lithocolyl-.gamma.-glutamyl)-des(B30)-human
insulin,
N.sup..epsilon.B29-(.omega.-carboxyheptadecanoyl)-des(B30)-human
insulin, N.sup..epsilon.B29-(.omega.-carboxyheptadecanoyl)-human
insulin.
[0174] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B29-octanoyl-human insulin,
N.sup..epsilon.B29-myristoyl-Gly.sup.A21Arg.sup.B31Arg.sup.B31-h-
uman insulin,
N.sup..epsilon.B29-myristoyl-Gly.sup.A21Gln.sup.B3Arg.sup.B31Arg.sup.B32--
human insulin,
N.sup..epsilon.B29-myristoyl-Arg.sup.A0Gly.sup.A21Arg.sup.B31Arg.sup.B32--
human insulin,
N.sup..epsilon.B29-Arg.sup.A0Gly.sup.A21Gln.sup.B3Arg.sup.B31Arg.sup.B32--
human insulin,
N.sup..epsilon.B29-myristoyl-Arg.sup.A0Gly.sup.A21Asp.sup.B3Arg.sup.B31Ar-
g.sup.B32-human insulin,
N.sup..epsilon.B29-myristoyl-Arg.sup.B31Arg.sup.B32-human insulin,
N.sup..epsilon.B29-myristoyl-Arg.sup.A0Arg.sup.B31Arg.sup.B32-human
insulin,
N.sup..epsilon.B29-octanoyl-Gly.sup.A21Arg.sup.B31Arg.sup.B32-hu-
man insulin,
N.sup..epsilon.B29-octanoyl-Gly.sup.A21Gln.sup.B3Arg.sup.B31Arg.sup.B32-h-
uman insulin,
N.sup..epsilon.B29-octanoyl-Arg.sup.A0Gly.sup.A21Arg.sup.B31Arg.sup.B32-h-
uman insulin,
N.sup..epsilon.B29-octanoyl-Arg.sup.A0Gly.sup.A21Gln.sup.B3Arg.sup.B31Arg-
.sup.B32-human insulin,
N.sup..epsilon.B29-octanoyl-Arg.sup.B0Gly.sup.A21Asp.sup.B3Arg.sup.B31Arg-
.sup.B32-human insulin,
N.sup..epsilon.B29-octanoyl-Arg.sup.B31Arg.sup.B32-human insulin,
N.sup..epsilon.B29-octanoyl-Arg.sup.A0Arg.sup.B31Arg.sup.B32-human
insulin.
[0175] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin polypeptides:
N.sup..epsilon.B28-myristoyl-Gly.sup.A21Lys.sup.B28Pro.sup.B29Arg.sup.B31-
Arg.sup.B32-human insulin,
N.sup..epsilon.B28-myristoyl-Gly.sup.A21Gln.sup.B3Lys.sup.B28Pro.sup.B30A-
rg.sup.B31Arg.sup.B32-human insulin,
N.sup..epsilon.B28-myristoyl-Arg.sup.A0Gly.sup.A21Lys.sup.B28Pro.sup.B29A-
rg.sup.B31Arg.sup.B32-human insulin,
N.sup..epsilon.B28-myristoyl-Arg.sup.A0Gly.sup.A21Gln.sup.B3Lys.sup.B28Pr-
o.sup.B29Arg.sup.B31Arg.sup.B32-human insulin,
N.sup..epsilon.B28-myristoyl-Arg.sup.A0Gly.sup.A21Asp.sup.B3Lys.sup.B28Pr-
o.sup.B29Arg.sup.B31Arg.sup.B32-human insulin,
N.sup..epsilon.B28-myristoyl-Lys.sup.B28Pro.sup.B29Arg.sup.B31Arg.sup.B32-
-human insulin,
N.sup..epsilon.B28-myristoyl-arg.sup.A0Lys.sup.B28Pro.sup.B29Arg.sup.B31A-
rg.sup.B32-human insulin,
N.sup..epsilon.B28-octanoyl-Gly.sup.A21Lys.sup.B28Pro.sup.B29Arg.sup.B31A-
rg.sup.B32-human insulin.
[0176] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B28-octanoyl-Gly.sup.A21Gln.sup.B3Lys.sup.B28Pro.sup.B29Ar-
g.sup.B31Arg.sup.B32-human insulin,
N.sup..epsilon.B28-octanoyl-Arg.sup.A0Gly.sup.A21Lys.sup.B28Pro.sup.B29Ar-
g.sup.B31Arg.sup.B32-human insulin,
N.sup..epsilon.B28-octanoyl-Arg.sup.A0Gly.sup.A21Gln.sup.B3Lys.sup.B28Pro-
.sup.B29Arg.sup.B31Arg.sup.B32-human insulin,
N.sup..epsilon.B28-octanoyl-Arg.sup.A0Gly.sup.A21Asp.sup.B3Lys.sup.B28Pro-
.sup.B29Arg.sup.B31Arg.sup.B32-human insulin,
N.sup..epsilon.B28-octanoyl-Lys.sup.B28Pro.sup.B29Arg.sup.B31Arg.sup.B32--
human insulin,
N.sup..epsilon.B28-octanoyl-Arg.sup.A0Lys.sup.B28Pro.sup.B29Arg.sup.B31Ar-
g.sup.B32-human insulin.
[0177] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B29-tridecanoyl-des(B30)-human insulin,
N.sup..epsilon.B29-tetradecanoyl-des(B30)-human insulin,
N.sup..epsilon.B29-decanoyl-des(B30)-human insulin,
N.sup..epsilon.B29-dodecanoyl-des(B30)-human insulin,
N.sup..epsilon.B29-tridecanoyl-Gly.sup.A21-des(B30)-human insulin,
N.sup..epsilon.B29-tetradecanoyl-Gly.sup.A21-des(B30)-human
insulin, N.sup..epsilon.B29-decanoyl-Gly.sup.A21-des(B30)-human
insulin, N.sup..epsilon.B29-dodecanoyl-Gly.sup.A21-des(B30)-human
insulin,
N.sup..epsilon.B29-tridecanoyl-Gly.sup.A21Gln.sup.B3-des(B30)-human
insulin,
N.sup..epsilon.B29-tetradecanoyl-Gly.sup.A21Gln.sup.B3-des(B30)--
human insulin,
N.sup..epsilon.B29-decanoyl-Gly.sup.A21-Gln.sup.B3-des(B30)-human
insulin,
N.sup..epsilon.B29-dodecanoyl-Gly.sup.A21-Gln.sup.B3-des(B30)-hu-
man insulin,
N.sup..epsilon.B29-tridecanoyl-Ala.sup.A21-des(B30)-human insulin,
N.sup..epsilon.B29-tetradecanoyl-Ala.sup.A21-des(B30)-human
insulin, N.sup..epsilon.B29-decanoyl-Ala.sup.A21-des(B30)-human
insulin, N.sup..epsilon.B29-dodecanoyl-Ala.sup.A21-des (B30)-human
insulin,
N.sup..epsilon.B29-tridecanoyl-Ala.sup.A21-Gln.sup.B3-des(B30)-human
insulin,
N.sup..epsilon.B29-tetradecanoyl-Ala.sup.A21Gln.sup.B3-des(B30)--
human insulin,
N.sup..epsilon.B29-decanoyl-Ala.sup.A21Gln.sup.B3-des(B30)-human
insulin,
N.sup..epsilon.B29-dodecanoyl-Ala.sup.A21Gln.sup.B3-des(B30)-human
insulin, N.sup..epsilon.B29-tridecanoyl-Gln.sup.B3-des(B30)-human
insulin, N.sup..epsilon.B29-tetradecanoyl-Gln.sup.B3-des(B30)-human
insulin, N.sup..epsilon.B29-decanoyl-Gln.sup.B3-des(B30)-human
insulin, N.sup..epsilon.B29-dodecanoyl-Gln.sup.B3-des(B30)-human
insulin.
[0178] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B29-tridecanoyl-Gly.sup.A21-human insulin,
N.sup..epsilon.B29-tetradecanoyl-Gly.sup.A21-human insulin,
N.sup..epsilon.B29-decanoyl-Gly.sup.A21-human insulin,
N.sup..epsilon.B29-dodecanoyl-Gly.sup.A21-human insulin,
N.sup..epsilon.B29-tridecanoyl-Ala.sup.A21-human insulin,
N.sup..epsilon.B29-tetradecanoyl-Ala.sup.A21-human insulin,
N.sup..epsilon.B29-decanoyl-Ala.sup.A21-human insulin,
N.sup..epsilon.B29-dodecanoyl-Ala.sup.A21-human insulin.
[0179] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B29-tridecanoyl-Gly.sup.A21Gln.sup.B3-human insulin,
N.sup..epsilon.B29-tetradecanoyl-Gly.sup.A21Gln.sup.B3-human
insulin, N.sup..epsilon.B29-decanoyl-Gly.sup.A21Gln.sup.B3-human
insulin, N.sup..epsilon.B29-dodecanoyl-Gly.sup.A21Gln.sup.B3-human
insulin, N.sup..epsilon.B29-tridecanoyl-Ala.sup.A21Gln.sup.B3-human
insulin,
N.sup..epsilon.B29-tetradecanoyl-Ala.sup.A21Gln.sup.B3-human
insulin, N.sup..epsilon.B29-decanoyl-Ala.sup.A21Gln.sup.B3-human
insulin, N.sup..epsilon.B29-dodecanoyl-Ala.sup.A21Gln.sup.B3-human
insulin.
[0180] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B29-tridecanoyl-Gln.sup.B3-human insulin,
N.sup..epsilon.B29-tetradecanoyl-Gln.sup.B3-human insulin,
N.sup..epsilon.B29-decanoyl-Gln.sup.B3-human insulin,
N.sup..epsilon.B29-dodecanoyl-Gln.sup.B3-human insulin.
[0181] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B29-tridecanoyl-Glu.sup.B30-human insulin,
N.sup..epsilon.B29-tetradecanoyl-Glu.sup.B30-human insulin,
N.sup..epsilon.B29-decanoyl-Glu.sup.B30-human insulin,
N.sup..epsilon.B29-dodecanoyl-Glu.sup.B30-human insulin.
[0182] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B29-tridecanoyl-Gly.sup.A21Glu.sup.B30-human
insulin,
N.sup..epsilon.B29-tetradecanoyl-Gly.sup.A21Glu.sup.B30-human
insulin, N.sup..epsilon.B29-decanoyl-Gly.sup.A21Glu.sup.B30-human
insulin, N.sup..epsilon.B29-dodecanoyl-Gly.sup.A21Glu.sup.B30-human
insulin.
[0183] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B29-tridecanoyl-Gly.sup.A21Gln.sup.B3Glu.sup.B30-human
insulin,
N.sup..epsilon.B29-tetradecanoyl-Gly.sup.A21Gln.sup.B3Glu.sup.B3-
0-human insulin,
N.sup..epsilon.B29-decanoyl-Gly.sup.A21Gln.sup.B3Glu.sup.B30-human
insulin,
N.sup..epsilon.B29-dodecanoyl-Gly.sup.A21Gln.sup.B3Glu.sup.B30-h-
uman insulin,
N.sup..epsilon.B29-tridecanoyl-Ala.sup.A21Glu.sup.B30-human
insulin,
N.sup..epsilon.B29-tetradecanoyl-Ala.sup.A21Glu.sup.B30-human
insulin, N.sup..epsilon.B29-decanoyl-Ala.sup.A21Glu.sup.B30-human
insulin, N.sup..epsilon.B29-dodecanoyl-Ala.sup.A21Glu.sup.B30-human
insulin,
N.sup..epsilon.B29-tridecanoyl-Ala.sup.A21Gln.sup.B3Glu.sup.B30--
human insulin,
N.sup..epsilon.B29-tetradecanoyl-Ala.sup.A21Gln.sup.B3Glu.sup.B30-human
insulin,
N.sup..epsilon.B29-decanoyl-Ala.sup.A21Gln.sup.B3Glu.sup.B30-hum-
an insulin,
N.sup..epsilon.B29-dodecanoyl-Ala.sup.A21Gln.sup.B3Glu.sup.B30-human
insulin.
[0184] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B29-tridecanoyl-Gln.sup.B3Glu.sup.B30-human insulin,
N.sup..epsilon.B29-tetradecanoyl-Gln.sup.B3Glu.sup.B30-human
insulin, N.sup..epsilon.B29-decanoyl-Gln.sup.B3Glu.sup.B30-human
insulin, N.sup..epsilon.B29-dodecanoyl-Gln.sup.B3Glu.sup.B30-human
insulin.
[0185] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B29-formyl-human insulin,
N.sup..alpha.B1-formyl-human insulin, N.sup..alpha.A1-formyl-human
insulin, N.sup..epsilon.B29-formyl-N.sup..alpha.B1-formyl-human
insulin, N.sup..epsilon.B29-formyl-N.sup..alpha.A1-formyl-human
insulin, N.sup..alpha.A1-formyl-N.sup..alpha.B1-formyl-human
insulin,
N.sup..epsilon.B29-formyl-N.sup..alpha.A1-formyl-N.sup..alpha.B1-formyl-h-
uman insulin.
[0186] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B29-acetyl-human insulin,
N.sup..alpha.B1-acetyl-human insulin, N.sup..alpha.A1-acetyl-human
insulin, N.sup..epsilon.B29-acetyl-N.sup..alpha.B1-acetyl-human
insulin, N.sup..epsilon.B29-acetyl-N.sup..alpha.A1-acetyl-human
insulin, N.sup..alpha.A1-acetyl-N.sup..alpha.B1-acetyl-human
insulin,
N.sup..epsilon.B29-acetyl-N.sup..alpha.A1-acetyl-N.sup..alpha.B1-acetyl-h-
uman insulin.
[0187] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B29-propionyl-human insulin,
N.sup..alpha.B1-propionyl-human insulin,
N.sup..alpha.A1-propionyl-human insulin,
N.sup..epsilon.B29-acetyl-N.sup..alpha.B1-propionyl-human insulin,
N.sup..epsilon.B29-propionyl-N.sup..alpha.A1-propionyl-human
insulin N.sup..alpha.A1-propionyl-N.sup..alpha.B1-propionyl-human
insulin,
N.sup..epsilon.B29-propionyl-N.sup..alpha.A1-propionyl-N.sup..alpha.B1-pr-
opionyl-human insulin.
[0188] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B29-butyryl-human insulin,
N.sup..alpha.B1-butyryl-human insulin,
N.sup..alpha.A1-butyryl-human insulin,
N.sup..epsilon.B29-butyryl-N.sup..alpha.B1-butyryl-human insulin,
N.sup..epsilon.B29-butyryl-N.sup..alpha.A1-butyryl-human insulin,
N.sup..alpha.A1-butyryl-N.sup..alpha.B1-butyryl-human insulin,
N.sup..epsilon.B29-butyryl-N.sup..alpha.A1-butyryl-N.sup..alpha.B1-butyry-
l-human insulin.
[0189] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B29-pentanoyl-human insulin,
N.sup..alpha.B1-pentanoyl-human insulin,
N.sup..alpha.A1-pentanoyl-human insulin,
N.sup..epsilon.B29-pentanoyl-N.sup..alpha.B1-pentanoyl-human
insulin,
N.sup..epsilon.B29-pentanoyl-N.sup..alpha.A1-pentanoyl-human
insulin, N.sup..alpha.A1-pentanoyl-N.sup..alpha.B1-pentanoyl-human
insulin,
N.sup..epsilon.B29-pentanoyl-N.sup..alpha.A1-pentanoyl-N.sup..alpha.B1-pe-
ntanoyl-human insulin.
[0190] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B29-hexanoyl-human insulin,
N.sup..alpha.B1-hexanoyl-human insulin,
N.sup..alpha.A1-hexanoyl-human insulin,
N.sup..epsilon.B29-hexanoyl-N.sup..alpha.B1-hexanoyl-human insulin,
N.sup..epsilon.B29-hexanoyl-N.sup..alpha.A1-hexanoyl-human insulin,
N.sup..alpha.A1-hexanoyl-N.sup..alpha.B1-hexanoyl-human insulin,
N.sup..epsilon.B29-hexanoyl-N.sup..alpha.A1-hexanoyl-N.sup..alpha.B1-hexa-
noyl-human insulin.
[0191] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B29-heptanoyl-human insulin,
N.sup..alpha.B1-heptanoyl-human insulin,
N.sup..alpha.A1-heptanoyl-human insulin,
N.sup..epsilon.B29-heptanoyl-N.sup..alpha.B1-heptanoyl-human
insulin,
N.sup..epsilon.B29-heptanoyl-N.sup..alpha.A1-heptanoyl-human
insulin, N.sup..alpha.A1-heptanoyl-N.sup..alpha.B1-heptanoyl-human
insulin,
N.sup..epsilon.B29-heptanoyl-N.sup..alpha.A1-heptanoyl-N.sup..alpha.B1-he-
ptanoyl-human insulin.
[0192] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..alpha.A1-octanoyl-human insulin,
N.sup..alpha.A1-octanoyl-human insulin,
N.sup..epsilon.B29-octanoyl-N.sup..alpha.B1-octanoyl-human insulin,
N.sup..epsilon.B29-octanoyl-N.sup..alpha.A1-octanoyl-human insulin,
N.sup..alpha.A1-octanoyl-N.sup..alpha.B1-octanoyl-human insulin,
N.sup..epsilon.B29-octanoyl-N.sup..alpha.A1-octanoyl-N.sup..alpha.B1-octa-
noyl-human insulin.
[0193] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B29-nonanoyl-human insulin,
N.sup..alpha.B1-nonanoyl-human insulin,
N.sup..alpha.A1-nonanoyl-human insulin,
N.sup..epsilon.B29-nonanoyl-N.sup..alpha.B1-nonanoyl-human insulin,
N.sup..epsilon.B29-nonanoyl-N.sup..alpha.A1-nonanoyl-human insulin,
N.sup..alpha.A1-nonanoyl-N.sup..alpha.B1-nonanoyl-human insulin,
N.sup..epsilon.B29-nonanoyl-N.sup..alpha.A1-nonanoyl-N.sup..alpha.B1-nona-
noyl-human insulin.
[0194] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B29-decanoyl-human insulin,
N.sup..alpha.B1-decanoyl-human insulin,
N.sup..alpha.A1-decanoyl-human insulin,
N.sup..epsilon.B29-decanoyl-N.sup..alpha.B1-decanoyl-human insulin,
N.sup..epsilon.B29-decanoyl-N.sup..alpha.A1-decanoyl-human insulin,
N.sup..alpha.A1-decanoyl-N.sup..alpha.B1-decanoyl-human insulin,
N.sup..epsilon.B29-decanoyl-N.sup..alpha.A1-decanoyl-N.sup..alpha.B1-deca-
noyl-human insulin.
[0195] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B28-formyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..alpha.B1-formyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..alpha.A1-formyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..epsilon.B28-formyl-N.sup..alpha.B1-formyl-Lys.sup.B28Pro.sup.B29-h-
uman insulin,
N.sup..epsilon.B28-formyl-N.sup..alpha.A1-formyl-Lys.sup.B28Pro.sup.B29-h-
uman insulin,
N.sup..alpha.A1-formyl-N.sup..alpha.B1-formyl-Lys.sup.B28Pro.sup.B29-huma-
n insulin,
N.sup..epsilon.B28-formyl-N.sup..alpha.A1-formyl-N.sup..alpha.B-
1-formyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..epsilon.B29-acetyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..alpha.B1-acetyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..alpha.A1-acetyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..epsilon.B28-acetyl-N.sup..alpha.B1-acetyl-Lys.sup.B28Pro.sup.B29-h-
uman insulin.
[0196] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B28-acetyl-N.sup..alpha.A1-acetyl-Lys.sup.B28Pro.sup.B29-h-
uman insulin,
N.sup..alpha.A1-acetyl-N.sup..alpha.B1-acetyl-Lys.sup.B28Pro.sup.B29-huma-
n insulin,
N.sup..epsilon.B28-acetyl-N.sup..alpha.A1-acetyl-N.sup..alpha.B-
1-acetyl-Lys.sup.B28Pro.sup.B29-human insulin.
[0197] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B28-propionyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..alpha.B1-propionyl-Lys.sup.B.infin.Pro.sup.B29-human
insulin, N.sup..alpha.A1-propionyl-Lys.sup.B28Pro.sup.B29-human
insulin,
N.sup..epsilon.B28-propionyl-N.sup..alpha.B1-propionyl-Lys.sup.B28Pro.sup-
.B29-human insulin,
N.sup..epsilon.B28-propionyl-N.sup..alpha.A1-propionyl-Lys.sup.B28Pro.sup-
.B29-human insulin,
N.sup..alpha.A1-propionyl-N.sup..alpha.B1-propionyl-Lys.sup.B28Pro.sup.B2-
9-human insulin,
N.sup..epsilon.B28-propionyl-N.sup..alpha.A1-propionyl-N.sup..alpha.B1-pr-
opionyl-Lys.sup.B28Pro.sup.B29-human insulin.
[0198] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B28-butyryl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..alpha.B1-butyryl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..alpha.A1-butyryl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..epsilon.B28-butyryl-N.sup..alpha.B1-butyryl-Lys.sup.B28Pro.sup.B29-
-human insulin,
N.sup..epsilon.B28-butyryl-N.sup..alpha.A1-butyryl-Lys.sup.B28Pro.sup.B29-
-human insulin,
N.sup..alpha.A1-butyryl-N.sup..alpha.B1-butyryl-Lys.sup.B28Pro.sup.B29-hu-
man insulin,
N.sup..epsilon.B28-butyryl-N.sup..alpha.A1-butyryl-N.sup..alpha.B1-butyry-
l-Lys.sup.B28Pro.sup.B29-human insulin.
[0199] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B28-pentanoyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..alpha.B1-pentanoyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..alpha.A1-pentanoyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..epsilon.B28-pentanoyl-N.sup..alpha.B1-pentanoyl-Lys.sup.B28Pro.sup-
.B29-human insulin,
N.sup..epsilon.B28-pentanoyl-N.sup..alpha.A1-pentanoyl-Lys.sup.B28Pro.sup-
.B29-human insulin,
N.sup..alpha.A1-pentanoyl-N.sup..alpha.B1-pentanoyl-Lys.sup.B28Pro.sup.B2-
9-human insulin,
N.sup..epsilon.B28-pentanoyl-N.sup..alpha.A1-pentanoyl-N.sup..alpha.B1-pe-
ntanoyl-Lys.sup.B28Pro.sup.B29-human insulin.
[0200] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B28-hexanoyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..alpha.B1-hexanoyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..alpha.A1-hexanoyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..epsilon.B28-hexanoyl-N.sup..alpha.B1-hexanoyl-Lys.sup.B28Pro.sup.B-
29-human insulin,
N.sup..epsilon.B28-hexanoyl-N.sup..alpha.A1-hexanoyl-Lys.sup.B28Pro.sup.B-
29-human insulin,
N.sup..alpha.A1-hexanoyl-N.sup..alpha.B1-hexanoyl-Lys.sup.B28Pro.sup.B29--
human insulin,
N.sup..epsilon.B28-hexanoyl-N.sup..alpha.A1-hexanoyl-N.sup..alpha.B1-hexa-
noyl-Lys.sup.B28Pro.sup.B29-human insulin.
[0201] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B28-heptanoyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..alpha.B1-heptanoyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..alpha.A1-heptanoyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..epsilon.B28-heptanoyl-N.sup..alpha.B1-heptanoyl-Lys.sup.B28Pro.sup-
.B29-human insulin,
N.sup..epsilon.B28-heptanoyl-N.sup..alpha.A1-heptanoyl-Lys.sup.B28Pro.sup-
.B29-human insulin,
N.sup..alpha.A1-heptanoyl-N.sup..alpha.B1-heptanoyl-Lys.sup.B28Pro.sup.B2-
9-human insulin,
N.sup..epsilon.B28-heptanoyl-N.sup..alpha.A1-heptanoyl-N.sup..alpha.B1-he-
ptanoyl-Lys.sup.28Pro.sup.B29-human insulin.
[0202] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B28-octanoyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..alpha.B1-octanoyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..alpha.A1-octanoyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..epsilon.B28-octanoyl-N.sup..alpha.B1-octanoyl-Lys.sup.B28Pro.sup.B-
29-human insulin,
N.sup..epsilon.B28-octanoyl-N.sup..alpha.A1-octanoyl-Lys.sup.B28Pro.sup.B-
29-human insulin,
N.sup..alpha.A1-octanoyl-N.sup..alpha.B1-octanoyl-Lys.sup.B28Pro.sup.B29--
human insulin,
N.sup..epsilon.B28-octanoyl-N.sup..alpha.A1-octanoyl-N.sup..alpha.B1-octa-
noyl-Lys.sup.B28Pro.sup.B29-human insulin.
[0203] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B28-nonanoyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..alpha.B1-nonanoyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..alpha.A1-nonanoyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..epsilon.B28-nonanoyl-N.sup..alpha.B1-nonanoyl-Lys.sup.B28Pro.sup.B-
29-human insulin,
N.sup..epsilon.B28-nonanoyl-N.sup..alpha.A1-nonanoyl-Lys.sup.B28Pro.sup.B-
29-human insulin,
N.sup..alpha.A1-nonanoyl-N.sup..alpha.B1-nonanoyl-Lys.sup.B28Pro.sup.B29--
human insulin,
N.sup..epsilon.B28-nonanoyl-N.sup..alpha.A1-nonanoyl-N.sup..alpha.B1-nona-
noyl-Lys.sup.B28Pro.sup.B29-human insulin.
[0204] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B28-decanoyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..alpha.B1-decanoyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..alpha.A1-decanoyl-Lys.sup.B28Pro.sup.B29-human insulin,
N.sup..epsilon.B28-decanoyl-N.sup..alpha.B1-decanoyl-Lys.sup.B28Pro.sup.B-
29-human insulin,
N.sup..epsilon.B28-decanoyl-N.sup..alpha.A1-decanoyl-Lys.sup.B28Pro.sup.B-
29-human insulin,
N.sup..alpha.A1-decanoyl-N.sup..alpha.B1-decanoyl-Lys.sup.B28Pro.sup.B29--
human insulin,
N.sup..epsilon.B28-decanoyl-N.sup..alpha.A1-decanoyl-N.sup..alpha.B1-deca-
noyl-Lys.sup.B28Pro.sup.B29-human insulin.
[0205] In certain embodiments, an insulin molecule of the present
disclosure comprises the mutations and/or chemical modifications of
one of the following insulin molecules:
N.sup..epsilon.B29-pentanoyl-Gly.sup.A21Arg.sup.B31Arg.sup.B32-human
insulin,
N.sup..alpha.B1-hexanoyl-Gly.sup.A21Arg.sup.B31Arg.sup.B32-human
insulin,
N.sup..alpha.A1-heptanoyl-Gly.sup.A21Arg.sup.B31Arg.sup.B32-huma- n
insulin,
N.sup..epsilon.B29-octanoyl-N.sup..alpha.B1-octanoyl-Gly.sup.A2-
1Arg.sup.B31Arg.sup.B32-human insulin,
N.sup..epsilon.B29-propionyl-N.sup..alpha.A1-propionyl-Gly.sup.A21Arg.sup-
.B31Arg.sup.B32-human insulin,
N.sup..alpha.A1-acetyl-N.sup..alpha.B1-acetyl-Gly.sup.A21Arg.sup.B31Arg.s-
up.B32-human insulin,
N.sup..epsilon.B29-formyl-N.sup..alpha.A1-formyl-N.sup..alpha.B1-formyl-G-
ly.sup.A21Arg.sup.B31Arg.sup.B32-human insulin,
N.sup..epsilon.B29-formyl-des(B26)-human insulin,
N.sup..alpha.B1-acetyl-Asp.sup.B28-human insulin,
N.sup..epsilon.B29-propionyl-N.sup..alpha.A1-propionyl-N.sup..alpha.B1-pr-
opionyl-Asp.sup.B1Asp.sup.B3AspB.sup.21-human insulin,
N.sup..epsilon.B29-pentanoyl-Gly.sup.A21-human insulin,
N.sup..alpha.B1-hexanoyl-Gly.sup.A21-human insulin,
N.sup..alpha.A1-heptanoyl-Gly.sup.A21-human insulin,
N.sup..epsilon.B29-octanoyl-N.sup..alpha.B1-octanoyl-Gly.sup.A21-human
insulin,
N.sup..epsilon.B29-propionyl-N.sup..alpha.A1-propionyl-Gly.sup.A-
21-human insulin,
N.sup..alpha.A1-acetyl-N.sup..alpha.B1-acetyl-Gly.sup.A21-human
insulin,
N.sup..epsilon.B29-formyl-N.sup..alpha.A1-formyl-N.sup..alpha.B1-formyl-G-
ly.sup.A21-human insulin, N.sup..epsilon.B29-butyryl-des(B
30)-human insulin, N.sup..alpha.B1-butyryl-des(B 30)-human insulin,
N.sup..alpha.A1-butyryl-des(B30)-human insulin,
N.sup..epsilon.B29-butyryl-N.sup..alpha.B1-butyryl-des(B30)-human
insulin, N.sup..epsilon.B29-butyryl-N.sup..alpha.A1-butyryl-des(B
30)-human insulin,
N.sup..alpha.A1-butyryl-N.sup..alpha.B1-butyryl-des(B 30)-human
insulin,
N.sup..epsilon.B29-butyryl-N.sup..alpha.A1-butyryl-N.sup..alpha.B1-butyry-
l-des(B 30)-human insulin.
[0206] The present disclosure also encompasses modified forms of
non-human insulins (e.g., porcine insulin, bovine insulin, rabbit
insulin, sheep insulin, etc.) that comprise any one of the
aforementioned mutations and/or chemical modifications.
[0207] These and other modified insulin molecules are described in
detail in U.S. Pat. Nos. 6,906,028; 6,551,992; 6,465,426;
6,444,641; 6,335,316; 6,268,335; 6,051,551; 6,034,054; 5,952,297;
5,922,675; 5,747,642; 5,693,609; 5,650,486; 5,547,929; 5,504,188;
5,474,978; 5,461,031; and 4,421,685; and in U.S. Pat. Nos.
7,387,996; 6,869,930; 6,174,856; 6,011,007; 5,866,538; and
5,750,497, the entire disclosures of which are hereby incorporated
by reference.
[0208] In various embodiments, an insulin molecule of the present
disclosure includes the three wild-type disulfide bridges (i.e.,
one between position 7 of the A-chain and position 7 of the
B-chain, a second between position 20 of the A-chain and position
19 of the B-chain, and a third between positions 6 and 11 of the
A-chain).
[0209] Methods for conjugating drugs including insulin molecules
are described below. In certain embodiments, an insulin molecule is
conjugated to the conjugate framework via the A1 amino acid
residue. In certain embodiments the A1 amino acid residue is
glycine. It is to be understood however, that the present
disclosure is not limited to N-terminal conjugation and that in
certain embodiments an insulin molecule may be conjugated via a
non-terminal A-chain amino acid residue. In particular, the present
disclosure encompasses conjugation via the epsilon-amine group of a
lysine residue present at any position in the A-chain (wild-type or
introduced by site-directed mutagenesis). It will be appreciated
that different conjugation positions on the A-chain may lead to
different reductions in insulin activity. In certain embodiments,
an insulin molecule is conjugated to the conjugate framework via
the B1 amino acid residue. In certain embodiments the B1 amino acid
residue is phenylalanine. It is to be understood however, that the
present disclosure is not limited to N-terminal conjugation and
that in certain embodiments an insulin molecule may be conjugated
via a non-terminal B-chain amino acid residue. In particular, the
present disclosure encompasses conjugation via the epsilon-amine
group of a lysine residue present at any position in the B-chain
(wild-type or introduced by site-directed mutagenesis). For
example, in certain embodiments an insulin molecule may be
conjugated via the B29 lysine residue. In the case of insulin
glulisine, conjugation to the conjugate framework via the B3 lysine
residue may be employed. It will be appreciated that different
conjugation positions on the B-chain may lead to different
reductions in insulin activity.
[0210] In certain embodiments, the ligands are conjugated to more
than one conjugation point on a drug such as an insulin molecule.
For example, an insulin molecule can be conjugated at both the A1
N-terminus and the B29 lysine. In some embodiments, amide
conjugation takes place in carbonate buffer to conjugate at the B29
and A1 positions, but not at the B1 position. In other embodiments,
an insulin molecule can be conjugated at the A1 N-terminus, the B1
N-terminus, and the B29 lysine. In yet other embodiments,
protecting groups are used such that conjugation takes place at the
B1 and B29 or B1 and A1 positions. It will be appreciated that any
combination of conjugation points on an insulin molecule may be
employed. In some embodiments, at least one of the conjugation
points is a mutated lysine residue, e.g., Lys.sup.A3.
[0211] In various embodiments, a conjugate may include an insulin
sensitizer (i.e., a drug which potentiates the action of insulin).
Drugs which potentiate the effects of insulin include biguanides
(e.g., metformin) and glitazones. The first glitazone drug was
troglitazone which turned out to have severe side effects. Second
generation glitazones include pioglitazone and rosiglitazone which
are better tolerated although rosiglitazone has been associated
with adverse cardiovascular events in certain trials.
[0212] In various embodiments, a conjugate may include an insulin
secretagogue (i.e., a drug which stimulates insulin secretion by
beta cells of the pancreas). For example, in various embodiments, a
conjugate may include a sulfonylurea. Sulfonylureas stimulate
insulin secretion by beta cells of the pancreas by sensitizing them
to the action of glucose. Sulfonylureas can, moreover, inhibit
glucagon secretion and sensitize target tissues to the action of
insulin. First generation sulfonylureas include tolbutamide,
chlorpropamide and carbutamide. Second generation sulfonylureas
which are active at lower doses include glipizide, glibenclamide,
gliclazide, glibornuride and glimepiride. In various embodiments, a
conjugate may include a meglitinide. Suitable meglitinides include
nateglinide, mitiglinide and repaglinide. Their hypoglycemic action
is faster and shorter than that of sulfonylureas. Other insulin
secretagogues include glucagon-like peptide 1 (GLP-1) and GLP-1
analogs (i.e., a peptide with GLP-1 like bioactivity that differs
from GLP-1 by 1-10 amino acid substitutions, additions or deletions
and/or by a chemical modification). GLP-1 reduces food intake by
inhibiting gastric emptying, increasing satiety through central
actions and by suppressing glucagon release. GLP-1 lowers plasma
glucose levels by increasing pancreas islet cell proliferation and
increases insulin production following food consumption. GLP-1 may
be chemically modified, e.g., by lipid conjugation as in
liraglutide to extend its in vivo half-life. Yet other insulin
secretagogues include exendin-4 and exendin-4 analogs (i.e., a
peptide with exendin-4 like bioactivity that differs from exendin-4
by 1-10 amino acid substitutions, additions or deletions and/or by
a chemical modification). Exendin-4, found in the venom of the Gila
Monster, exhibits GLP-1 like bioactivity. It has a much longer
half-life than GLP-1 and, unlike GLP-1, it can be truncated by 8
amino acid residues at its N-terminus without losing bioactivity.
The N-terminal region of GLP-1 and exendin-4 are almost identical,
a significant difference being the second amino acid residue,
alanine in GLP-1 and glycine in exendin-4, which gives exendin-4
its resistance to in vivo digestion. Exendin-4 also has an extra 9
amino acid residues at its C-terminus as compared to GLP-1. Mann et
al. Biochem. Soc. Trans. 35:713-716, 2007 and Runge et al.,
Biochemistry 46:5830-5840, 2007 describe a variety of GLP-1 and
exendin-4 analogs which may be used in a conjugate of the present
disclosure. The short half-life of GLP-1 results from enzymatic
digestion by dipeptidyl peptidase IV (DPP-IV). In certain
embodiments, the effects of endogenous GLP-1 may be enhanced by
administration of a DPP-IV inhibitor (e.g., vildagliptin,
sitagliptin, saxagliptin, linagliptin or alogliptin).
[0213] In various embodiments, a conjugate may include amylin or an
amylin analog (i.e., a peptide with amylin like bioactivity that
differs from amylin by 1-10 amino acid substitutions, additions or
deletions and/or by a chemical modification). Amylin plays an
important role in glucose regulation (e.g., see Edelman and Weyer,
Diabetes Technol. Ther. 4:175-189, 2002). Amylin is a
neuroendocrine hormone that is co-secreted with insulin by the beta
cells of the pancreas in response to food intake. While insulin
works to regulate glucose disappearance from the bloodstream,
amylin works to help regulate glucose appearance in the bloodstream
from the stomach and liver. Pramlintide acetate (SYMLIN.RTM.) is an
exemplary amylin analog. Since native human amylin is
amyloidogenic, the strategy for designing pramlintide involved
substituting certain residues with those from rat amylin, which is
not amyloidogenic. In particular, proline residues are known to be
structure-breaking residues, so these were directly grafted from
the rat sequence into the human sequence. Glu-10 was also
substituted with an asparagine.
[0214] In various embodiments, a pre-conjugated drug may contain
one or more reactive moieties (e.g., carboxyl or reactive ester,
amine, hydroxyl, aldehyde, sulfhydryl, maleimidyl, alkynyl, azido,
etc. moieties). As discussed below, these reactive moieties may, in
certain embodiments, facilitate the conjugation process. Specific
examples include peptidic drugs bearing alpha-terminal amine and/or
epsilon-amine lysine groups. It will be appreciated that any of
these reactive moieties may be artificially added to a known drug
if not already present. For example, in the case of peptidic drugs
a suitable amino acid (e.g., a lysine) may be added or substituted
into the amino acid sequence. In addition, as discussed in more
detail below, it will be appreciated that the conjugation process
may be controlled by selectively blocking certain reactive moieties
prior to conjugation.
[0215] As discussed above, the present disclosure is not limited to
any particular combination of drug and target molecule.
[0216] In various embodiments, a material of the present disclosure
may be exploited to manipulate a natural feedback mechanism. For
example, there are many natural feedback mechanisms (including most
hormonal control mechanisms) in which the level of two endogenous
substances are interrelated (e.g., glucose and insulin where the
level of insulin increases as the level of glucose increases and
the level of glucose decreases as the level of insulin increases).
In such embodiments one of the endogenous substances can become the
target molecule (e.g., glucose) while the other becomes the drug
(e.g., insulin). Alternatively, in various embodiments, the drug
can be a molecule that (a) has the same function as the other
endogenous substance (e.g., reduces glucose levels), (b) stimulates
the production of the other endogenous substance and/or (c)
potentiates the effect(s) of the other endogenous substance. For
example, when glucose is the target molecule one could use an
insulin secretagogue or an insulin sensitizer instead of insulin as
the drug.
[0217] Other non-limiting examples of artificial feedback systems,
include, a material which releases glucagon conjugates in response
to high levels of insulin, a material which releases anticoagulant
conjugates (e.g., coumarines such as warfarin, acenocoumarol,
phenprocoumon and phenindione, heparin, direct thrombin inhibitors
such as argatroban, lepirudin, bivalirudin, and dabigatran, etc.)
in response to thrombosis indicators; a material which releases
lactate-lowering drug conjugates (e.g., dichloroacetate) in
response to increased lactate levels; etc.
[0218] In various embodiments, a material can be designed to
release conjugates which include a drug with a function that is not
directly related to the target molecule. Without limitation, a
material which responds to a target molecule which increases in
concentration after a meal (e.g., glucose) may be used to provide
long-term, mealtime dosing of a drug. Any drug which needs to be
dosed periodically and/or with food would benefit from such a
delivery system. As is well known in the art, many traditional
drugs need to be administered with food or at mealtimes. For
example, drugs which inhibit the absorption of fats (e.g.,
orlistat) are advantageously present during mealtime. Similarly,
drugs which lower lipid levels, e.g., lovastatin, attorvastatin, or
simvastatin, or triglyceride levels, e.g., gemfibrozil, may also be
advantageously released at mealtimes.
Detectable Label
[0219] As noted above, in various embodiments, a conjugate may
comprise a detectable label. For example, a detectable label may be
included in order to detect the location of conjugates within an
organism, tissue or cell; when the conjugates are used in a sensor;
etc. It is to be understood that a conjugate can comprise any
detectable label known in the art. A conjugate can comprise more
than one copy of the same label and/or can comprise more than one
type of label. In general, the label(s) used will depend on the end
application and the method used for detection.
[0220] The detectable label may be directly detectable or
indirectly detectable, e.g., through combined action with one or
more additional members of a signal producing system. Examples of
directly detectable labels include radioactive, paramagnetic,
fluorescent, light scattering, absorptive and colorimetric labels.
Fluorescein isothiocyanate, rhodamine, phycoerythrin phycocyanin,
allophycocyanin, .gamma.-phthalaldehyde, fluorescamine, etc. are
all exemplary fluorescent labels. Chemiluminescent labels, i.e.,
labels that are capable of converting a secondary substrate to a
chromogenic product are examples of indirectly detectable labels.
For example, horseradish peroxidase, alkaline phosphatase,
glucose-6-phosphate dehydrogenase, malate dehydrogenase,
staphylococcal nuclease, delta-V-steroid isomerase, yeast alcohol
dehydrogenate, .alpha.-glycerophosphate dehydrogenase, triose
phosphate isomerase, asparaginase, glucose oxidase,
.beta.-galactosidase, ribonuclease, urease, catalase, glucoamylase,
acetylcholinesterase, luciferin, luciferase, aequorin and the like
are all exemplary protein based chemiluminescent labels. Luminol,
isoluminol, theromatic acridinium ester, imidazole, acridinium
salt, oxalate ester, etc. are exemplary non-protein based
chemiluminescent labels. Another non-limiting and commonly used
example of an indirectly detectable label is an affinity ligand,
i.e., a label with strong affinity for a secondary binding partner
(e.g., an antibody or aptamer) which may itself be directly or
indirectly detectable.
[0221] In general, a detectable label may be visualized or detected
in a variety of ways, with the particular manner of detection being
chosen based on the particular detectable label, where
representative detection means include, e.g., scintillation
counting, autoradiography, measurement of paramagnetism,
fluorescence measurement, light absorption measurement, measurement
of light scattering and the like.
[0222] In various embodiments, a pre-conjugated label may contain
one or more reactive moieties (e.g., carboxyl or reactive ester,
amine, hydroxyl, aldehyde, sulfhydryl, maleimidyl, alkynyl, azido,
etc. moieties). As discussed below, these reactive moieties may, in
certain embodiments, facilitate the conjugation process. Specific
examples include peptidic labels bearing alpha-terminal amine
and/or epsilon-amine lysine groups. It will be appreciated that any
of these reactive moieties may be artificially added to a known
label if not already present. For example, in the case of peptidic
labels a suitable amino acid (e.g., a lysine) may be added or
substituted into the amino acid sequence. In addition, as discussed
in more detail below, it will be appreciated that the conjugation
process may be controlled by selectively blocking certain reactive
moieties prior to conjugation.
Conjugate Framework
[0223] Conjugates can be prepared from frameworks that naturally
include affinity ligands (e.g., polysaccharides such as glycogen
and dextran naturally include glucose affinity ligands) and/or by
artificially incorporating affinity ligands into a natural or
synthetic framework. It is to be understood that the conjugates of
the present disclosure are not limited to a particular framework.
For example, conjugates may be prepared using frameworks that
include polymeric and/or non-polymeric structures. It is also to be
understood that the conjugate frameworks may be linear, branched,
hyperbranched and/or a combination of these. The following section
describes some exemplary conjugate frameworks.
[0224] In various embodiments, a conjugate may be prepared from a
framework that includes a polymeric structure. For example, a
polymer with pendant reactive groups (e.g., carboxyl or reactive
ester, amine, hydroxyl, aldehyde, sulfhydryl, maleimidyl, alkynyl,
azido, etc.) may be employed. It will be appreciated that different
pendant groups may be mixed in a single framework (e.g., by
co-polymerizing appropriate monomers in desired ratios to produce a
polymeric framework). As discussed below, these reactive groups may
be used to attach affinity ligands, drugs and/or detectable labels
to the framework. Co-polymers, mixtures, and adducts of different
frameworks may also be used. Such combinations may be useful for
optimizing the mechanical and chemical properties of a
material.
[0225] In various embodiments, frameworks having carboxyl (or
reactive ester) pendant groups (--COOH bearing frameworks, or CBFs)
may be used. Such frameworks may naturally include carboxyl groups
or may be modified to include them. Exemplary polymeric CBFs
include but are not limited to carboxylated polysaccharides (CPS)
such as alginate (Ag), carboxymethylated-D-manno-D-glucan (CMMG,
available from Daiichi Pharmaceutical Co.), carboxymethyldextran
(CMDex), carboxymethylchitin (CMCh, available from Katakura
Chikkalin Co.), N-desulfated N-acetylated heparin (DSH), and
hyaluronic acid (HA). DSH and CMDex may be synthesized according to
Sugahara, et al., Biol. Pharm. Bull., 24, 535-543 (2001). In
general, hydroxylated frameworks may be carboxylated through
reaction with chloroacetic acid under basic conditions. In the case
of a polymeric framework the degree of carboxyl substitution with
respect to monomer may vary between 1 and 100 mol %. Naturally
occurring carboxylated polymers include but are not limited to
carboxylated poly(amino acids) (CPAA) such as poly-L-glutamate and
poly-L-aspartate. The carboxylate content may be varied between 1
and 100% mol COOH/mol AA residue by copolymerizing carboxylated
amino acids (e.g., amino acids with a carboxyl group in addition to
the carboxyl group which becomes part of the polymer backbone) with
non-carboxylated amino acids (e.g., amino acids whose only carboxyl
group becomes part of the polymer backbone).
[0226] In various embodiments, frameworks having amine pendant
groups (--NH.sub.2 bearing frameworks, or NBFs) may be used. Such
frameworks may be naturally occurring or may be chemically modified
to include a primary amine. The latter include but are not limited
to polymeric frameworks, e.g., amine pendant polysaccharides (NPS)
such as deacetylated chitosan (Ch) (Sigma Aldrich, Milwaukee, Wis.)
and diethylaminoethyl ether dextran (DEAEDex), MW 500,000 g/mol
(Polysciences, Warrington, Pa.). In the case of such polymeric
frameworks the degree of amine substitution with respect to monomer
may vary between 1 and 100 mol %. Other suitable NBFs include, but
are not limited to, polynucleotides where one or more of the purine
bases has been derivatized with an amine group at the 2' location.
Naturally occurring aminated polymers include but are not limited
to poly(amino acids) such as poly-L-lysine (PLL) and its
enantiomer. The amine content may be varied between 1 and 100% mol
NH.sub.2/mol amino acid residue by copolymerizing an aminated amino
acid (e.g., an amino acid with an amine in addition to the amine
group that eventually becomes part of the polymer backbone) with
non-aminated amino acids (e.g., an amino acid whose only amine is
that which eventually becomes part of the polymer backbone).
[0227] In various embodiments, polymers having hydroxyl pendant
groups (--OH bearing frameworks, or OBFs) may be used. Such
frameworks may be naturally hydroxylated or may be chemically
modified to include a hydroxyl group. In addition to dextran,
naturally occurring polymeric OBFs include but are not limited to
polysaccharides such as yeast mannan (Mn), pullulan (Pl), amylose
(Am), amylopectin (AmP), glycogen (Gl), cellulose (Cl), hyaluronate
(Hy), chondroitin (ChD), and dextrin (Dx), all of which may be
obtained commercially from Sigma Aldrich. In addition, poly(amino
acids) such as poly(serine), poly(threonine), poly(tyrosine), and
poly(4-hydroxyproline) may also be employed as hydroxylated
polymers. The hydroxyl content of the poly(amino acids) may be
varied between 1 and 100% mol --OH/mol amino acid residue by
co-polymerizing hydroxylated amino acids with non-hydroxylated
amino acids. Of course, carboxyl (or reactive ester), amino, and
hydroxyl pendant groups may be mixed in a single polymer by
co-polymerizing the appropriate amino acids in desired ratios.
[0228] In various embodiments, frameworks having sulfhydryl pendant
groups (--SH bearing frameworks, or SBFs) may be used. SBFs may be
naturally sulfhydrylated or may be chemically modified using
standard organic chemistry techniques to include a sulfhydryl
group. In other embodiments, frameworks having aldehyde,
maleimidyl, alkynyl, azido, etc. pendant groups may be used.
[0229] In addition to the aforementioned classes of frameworks,
some exemplary polymers that may be used include poly(lactic acid)
(PLA), poly(glycolic acid) (PGA), PLA-PGA co-polymers (PLGA),
poly(anhydrides), poly(hydroxy acids), poly(ortho esters),
poly(propylfumerates), poly(caprolactones), polyamides,
polyacetals, biodegradable polycyanoacrylates and biodegradable
polyurethanes.
[0230] In various embodiments, conjugates of the following general
formula (IV) may be employed:
##STR00014##
[0231] Various embodiments of the conjugates of formula (IV) are
described in more detail in Example 57; however, in general it is
to be understood that [0232] R.sup.x is hydrogen or optionally
substituted C.sub.1-6 alkyl; [0233] Z.sup.1 is an optionally
substituted bivalent C.sub.1-10 hydrocarbon chain, wherein 1, 2, 3,
4 or 5 methylene units of Z.sup.1 are optionally and independently
replaced with one or more groups selected from --S--, --O--,
--NR.sup.a--, --(C.dbd.NR.sup.a)--, --(C.dbd.O)--, --(S.dbd.O)--,
--S(.dbd.O).sub.2--, --(CR.sup.b.dbd.CR.sup.b)--, --(N.dbd.N)--, an
optionally substituted arylene moiety or an optionally substituted
heteroarylene moiety, wherein R.sup.a is hydrogen, optionally
substituted aliphatic, optionally substituted heteroaliphatic,
optionally substituted aryl, optionally substituted heteroaryl, or
a suitable amino protecting group; and R.sup.b is hydrogen,
optionally substituted aliphatic, optionally substituted
heteroaliphatic, optionally substituted aryl, or optionally
substituted heteroaryl; [0234] each occurrence of X.sup.1 is
independently --OR' or --N(R.sup.d).sub.2, wherein R.sup.c is
hydrogen, optionally substituted aliphatic, optionally substituted
heteroaliphatic, optionally substituted aryl, optionally
substituted heteroaryl, a suitable hydroxyl protecting group, a
cation group, or an affinity ligand, and each R.sup.d is,
independently, hydrogen, optionally substituted aliphatic,
optionally substituted heteroaliphatic, optionally substituted
aryl, optionally substituted heteroaryl, a suitable amino
protecting group, or an affinity ligand, with the proviso that at
least two occurrences of X.sup.1 include an affinity ligand; [0235]
Y.sup.1 is hydrogen, halogen, optionally substituted aliphatic,
optionally substituted heteroaliphatic, optionally substituted
aryl, optionally substituted heteroaryl, --OR.sup.e or --SR.sup.e
wherein R.sup.e is hydrogen, optionally substituted aliphatic,
optionally substituted heteroaliphatic, optionally substituted
aryl, or optionally substituted heteroaryl; [0236] r is an integer
between 5-25, inclusive; [0237] W.sup.1 is a drug or detectable
label; and [0238] corresponds to a single or double covalent
bond.
[0239] In various embodiments, conjugates of the following general
formula (V) may be employed:
##STR00015##
wherein: [0240] each occurrence of
##STR00016##
[0240] represents a potential branch within the conjugate; [0241]
each occurrence of
##STR00017##
[0241] represents a potential repeat within a branch of the
conjugate; [0242] each occurrence of is independently a covalent
bond, a carbon atom, a heteroatom, or an optionally substituted
group selected from the group consisting of acyl, aliphatic,
heteroaliphatic, aryl, heteroaryl, and heterocyclic; [0243] each
occurrence of T is independently a covalent bond or a bivalent,
straight or branched, saturated or unsaturated, optionally
substituted C.sub.1-30 hydrocarbon chain wherein one or more
methylene units of T are optionally and independently replaced by
--O--, --S--, --N(R)--, --C(O)--, --C(O)O--, --OC(O)--,
--N(R)C(O)--, --C(O)N(R)--, --S(O)--, --S(O).sub.2--,
--N(R)SO.sub.2--, --SO.sub.2N(R)--, a heterocyclic group, an aryl
group, or a heteroaryl group; [0244] each occurrence of R is
independently hydrogen, a suitable protecting group, or an acyl
moiety, arylalkyl moiety, aliphatic moiety, aryl moiety, heteroaryl
moiety, or heteroaliphatic moiety; [0245] --B is -T-L.sup.B-X;
[0246] each occurrence of X is independently an affinity ligand;
[0247] each occurrence of L.sup.B is independently a covalent bond
or a group derived from the covalent conjugation of a T with an X;
[0248] -D is -T-L.sup.D-W; [0249] each occurrence of W is
independently a drug or a detectable label; [0250] each occurrence
of L.sup.D is independently a covalent bond or a group derived from
the covalent conjugation of a T with a W; [0251] k is an integer
from 2 to 11, inclusive, defining at least two k-branches within
the conjugate; [0252] q is an integer from 1 to 4, inclusive;
[0253] k+q is an integer from 3 to 12, inclusive; [0254] each
occurrence of p is independently an integer from 1 to 5, inclusive;
and [0255] each occurrence of n is independently an integer from 0
to 5, inclusive; and [0256] each occurrence of m is independently
an integer from 1 to 5, inclusive; and [0257] each occurrence of v
is independently an integer from 0 to 5, inclusive, with the
proviso that within each k-branch at least one occurrence of n is
.gtoreq.1 and at least one occurrence of v is .gtoreq.1.
[0258] It is to be understood that general formula (V) (and other
formulas herein) does not expressly list every hydrogen. For
example, if the central is a C.sub.6 aryl group and k+q<6 it
will be appreciated that the open position(s) on the C.sub.6 aryl
ring include a hydrogen.
[0259] In general, it will be appreciated that each occurrence of
represents a potential branching node and that the number of
branches at each node are determined by the values of k for the
central and n for non-central occurrences of . Since k.gtoreq.2 the
conjugate will always include at least two k-branches. One of
ordinary skill will appreciate that because each occurrence of n
may be an integer from 0 to 5, the present disclosure contemplates
both branched and hyperbranched (e.g., dendrimer-like) embodiments
of these conjugates. The proviso which requires that within each
k-branch at least one occurrence of n is .gtoreq.1 and at least one
occurrence of v is .gtoreq.1 ensures that every conjugate includes
at least two separate k-branches with an occurrence of B (i.e., an
affinity ligand).
[0260] In certain embodiments, each occurrence of in a p-bracketed
moiety is substituted by a number of n-bracketed moieties
corresponding to a value of n.gtoreq.1. For example, when k=2 and
p=2 in both k-branches, the conjugate may be of the formula
(Va):
##STR00018##
In other embodiments, only terminal occurrences of in a p-bracketed
moiety are substituted by a number of n-bracketed moieties
corresponding to a value of n.gtoreq.1. For example, when k=2 and
p=2 in both k-branches (and n=0 for the first p-bracketed moiety in
both k-branches), the conjugate may be of the formula (Vb):
##STR00019##
In certain embodiments, each occurrence of in an m-bracketed moiety
is substituted by a number of B moieties corresponding to the value
of v.gtoreq.1. For example, when k=2, each occurrence of p=1, and
each occurrence of m=2, the conjugate may be of the formula
(Vc):
##STR00020##
In other embodiments, only terminal occurrences of in an
m-bracketed moiety are substituted by a number of B moieties
corresponding to a value of v.gtoreq.1. For example, when k=2, each
occurrence of p=1, and each occurrence of m=2 (and v=0 for the
first m-bracketed moiety in each n-branch), the conjugate may be of
the formula (Vd):
##STR00021##
By way of further example, when q=1 and n=1 in both k-branches of
the previous formula, the conjugate may be of the formula (Ve):
##STR00022##
Alternatively, when q=1 and n=2 in both k-branches of the previous
formula, the conjugate may be of the formula (Vf):
##STR00023##
[0261] In various embodiments, the present disclosure also provides
conjugates which include affinity ligands and/or a drug or
detectable label which are non-covalently bound the conjugate
framework.
[0262] For example, in some embodiments, the present disclosure
provides conjugates of any of the foregoing formulas, wherein:
[0263] each of , T, D, k, q, k+q, p, n, m and v is defined as
described above and herein; [0264] --B is -T-LRP.sup.B--X; [0265]
each occurrence of X is independently an affinity ligand; and
[0266] each occurrence of LRP.sup.B is independently a
ligand-receptor pair which forms a non-covalent bond between T and
X with a dissociation constant in human serum of less than 1
pmol/L.
[0267] In yet other embodiments, the present disclosure provides
conjugates of any of the foregoing formulas, wherein: [0268] each
of , T, B, k, q, k+q, p, n, m and v is defined as described above
and herein; [0269] -D is -T-LRP.sup.D--W; [0270] each occurrence of
W is independently a drug or a detectable label; and [0271] each
occurrence of LRP.sup.D is independently a ligand-receptor pair
which forms a non-covalent bond between T and W with a dissociation
constant in human serum of less than 1 pmol/L.
[0272] In other embodiments, the present disclosure provides
conjugates of any of the foregoing formulas wherein: [0273] each of
, T, k, q, k+q, p, n, m and v is defined as described above and
herein; [0274] --B is -T-LRP.sup.B--X; [0275] each occurrence of X
is independently an affinity ligand; [0276] each occurrence of
LRP.sup.B is independently a ligand-receptor pair which forms a
non-covalent bond between T and X with a dissociation constant in
human serum of less than 1 pmol/L. [0277] -D is -T-LRP.sup.D--W;
[0278] each occurrence of W is independently a drug or a detectable
label; and [0279] each occurrence of LRP.sup.D is independently a
ligand-receptor pair which forms a non-covalent bond between T and
W with a dissociation constant in human serum of less than 1
pmol/L.
[0280] In various embodiments, a conjugate of the present
disclosure may have the general formula (VI):
##STR00024##
wherein , B, T, D, v, m, n, and p are as defined and described
herein, k is an integer from 1 to 11, inclusive, and j is 1-4.
Conjugates of formula (VI) may have multiple sites of conjugation
of ligand to drug. It will be appreciated that, when q is 1, the
subgenera described above (formulae Va-Vf) apply to conjugates of
formula (VI) when j is 1. Likewise, similar subgenera can be
contemplated by one skilled in the art for conjugates wherein j is
2, 3, or 4.
[0281] For purposes of exemplification and for the avoidance of
confusion it is to be understood that an occurrence of:
##STR00025##
in a conjugate of formula (VI) (i.e., when j is 2) could be
represented as:
##STR00026##
(when the drug is covalently bound to the conjugate framework)
or
##STR00027##
(when the drug is non-covalently bound to the conjugate
framework).
Description of Exemplary Groups
(Node)
[0282] In certain embodiments, each occurrence of is independently
an optionally substituted group selected from the group consisting
of acyl, aliphatic, heteroaliphatic, aryl, heteroaryl, and
heterocyclic. In some embodiments, each occurrence of is the same.
In some embodiments, the central is different from all other
occurrences of . In certain embodiments, all occurrences of are the
same except for the central . In some embodiments, is an optionally
substituted aryl or heteroaryl group. In some embodiments, is
6-membered aryl. In certain embodiments, is phenyl. In certain
embodiments, is a heteroatom selected from N, O, or S. In some
embodiments, is nitrogen atom. In some embodiments, is an oxygen
atom. In some embodiments, is sulfur atom. In some embodiments, is
a carbon atom.
T (Spacer)
[0283] In certain embodiments, each occurrence of T is
independently a bivalent, straight or branched, saturated or
unsaturated, optionally substituted C.sub.1-20 hydrocarbon chain
wherein one or more methylene units of T are optionally and
independently replaced by --O--, --S--, --N(R)--, --C(O)--,
--C(O)O--, --OC(O)--, --N(R)C(O)--, --C(O)N(R)--, --S(O)--,
--S(O).sub.2--, --N(R)SO.sub.2--, --SO.sub.2N(R)--, a heterocyclic
group, an aryl group, or a heteroaryl group. In certain
embodiments, one, two, three, four, or five methylene units of T
are optionally and independently replaced. In certain embodiments,
T is constructed from a C.sub.1-10, C.sub.1-8, C.sub.1-6,
C.sub.1-4, C.sub.2-12, C.sub.4-12, C.sub.6-12, C.sub.8-12, or
C.sub.10-12 hydrocarbon chain wherein one or more methylene units
of T are optionally and independently replaced by --O--, --S--,
--N(R)--, --C(O)--, --C(O)O--, --OC(O)--, --N(R)C(O)--,
--C(O)N(R)--, --S(O)--, --S(O).sub.2--, --N(R)SO.sub.2--,
--SO.sub.2N(R)--, a heterocyclic group, an aryl group, or a
heteroaryl group. In some embodiments, one or more methylene units
of T is replaced by a heterocyclic group. In some embodiments, one
or more methylene units of T is replaced by a triazole moiety. In
certain embodiments, one or more methylene units of T is replaced
by --C(O)--. In certain embodiments, one or more methylene units of
T is replaced by --C(O)N(R)--. In certain embodiments, one or more
methylene units of T is replaced by --O--.
[0284] In some embodiments, T is
##STR00028##
[0285] In some embodiments, T is
##STR00029##
[0286] In some embodiments, T is
##STR00030##
[0287] In some embodiments, T is
##STR00031##
[0288] In some embodiments, T is
##STR00032##
[0289] In some embodiments, T is
##STR00033##
[0290] In certain embodiments, each occurrence of T is the
same.
[0291] In certain embodiments, each occurrence of T (outside groups
B and D) is a covalent bond and the conjugate is of the general
formula (VII) or (VIII):
##STR00034##
wherein , B, D, v, m, n, p, k, and j are as defined and described
for formula (V) or (VI), respectively.
[0292] In certain embodiments of general formulae (VII) and (VIII),
each occurrence of except for the central is a covalent bond, each
occurrence of v=1, and the conjugate is of the formula (IX) or
(X):
##STR00035##
wherein , B, D, q, k, and j are as defined and described for
formula (V) or (VI), respectively.
[0293] In certain such embodiments for formula (IX), k=2 and
q=1.
[0294] In other embodiments, k=3 and q=1.
[0295] In other embodiments, k=2 and q=2.
[0296] In certain such embodiments for formula (X), k=1 and
j=2.
[0297] In other embodiments, k=2 and j=2.
[0298] In other embodiments, k=3 and j=2.
[0299] In other embodiments, k=1 and j=3.
[0300] In other embodiments, k=2 and j=3.
[0301] In other embodiments, k=3 and j=3.
[0302] In some embodiments, the present disclosure provides
conjugates of general formula (IXa):
##STR00036##
wherein B and D are as defined and described herein.
[0303] For example, in some embodiments, the present disclosure
provides conjugates of formula:
##STR00037##
wherein W and X is as defined and described herein.
[0304] In some embodiments, the present disclosure provides
conjugates of general formula (IXb):
##STR00038##
wherein B and D are as defined and described herein.
[0305] For example, in some embodiments, the present disclosure
provides conjugates of formula:
##STR00039##
wherein W and X are as defined and described herein.
[0306] In some embodiments, the present disclosure provides
conjugates of general formula (IXc):
##STR00040##
wherein B and D are as defined and described herein.
[0307] For example, in some embodiments, the present disclosure
provides conjugates of formula:
##STR00041##
wherein W and X are as defined and described herein.
[0308] It will be appreciated that similar subgenera to those of
formulae (VIIa), (VIIb), and (VIIc), and species thereof, can be
contemplated by one skilled in the art for conjugates of formula
(VIII) wherein j is 2, 3, or 4. For example, when j is 2, in
certain embodiments, the present disclosure provides conjugates of
formula:
##STR00042##
wherein B and D are as defined and described herein.
[0309] In certain embodiments, the present disclosure provides
conjugates of formula:
##STR00043##
[0310] wherein W, X, and j are as defined and described herein.
B (Ligand)
[0311] In various embodiments, --B is -T-L.sup.B-X where X is a
ligand; and L.sup.B is a covalent bond or a group derived from the
covalent conjugation of an X with a T. Exemplary ligands were
described above.
D (Drug)
[0312] In various embodiments, -D is -T-L.sup.D-W where W is a drug
and L.sup.D is a covalent bond or a group derived from the covalent
conjugation of a W with a T. Exemplary drugs were described
above.
D (Detectable Label)
[0313] As noted above, in various embodiments, the W in D is a
detectable label. For example, a detectable label may be included
in order to detect the location of conjugates within an organism,
tissue or cell; when the conjugates are used in a sensor; etc. It
is to be understood that a conjugate can comprise any detectable
label known in the art. A conjugate can comprise more than one copy
of the same label and/or can comprise more than one type of label.
In general, the label(s) used will depend on the end application
and the method used for detection.
[0314] The detectable label may be directly detectable or
indirectly detectable, e.g., through combined action with one or
more additional members of a signal producing system. Examples of
directly detectable labels include radioactive, paramagnetic,
fluorescent, light scattering, absorptive and colorimetric labels.
Fluorescein isothiocyanate, rhodamine, phycoerythrin phycocyanin,
allophycocyanin, .gamma.-phthalaldehyde, fluorescamine, etc. are
all exemplary fluorescent labels. Chemiluminescent labels, i.e.,
labels that are capable of converting a secondary substrate to a
chromogenic product are examples of indirectly detectable labels.
For example, horseradish peroxidase, alkaline phosphatase,
glucose-6-phosphate dehydrogenase, malate dehydrogenase,
staphylococcal nuclease, delta-V-steroid isomerase, yeast alcohol
dehydrogenate, .alpha.-glycerophosphate dehydrogenase, triose
phosphate isomerase, asparaginase, glucose oxidase,
.beta.-galactosidase, ribonuclease, urease, catalase, glucoamylase,
acetylcholinesterase, luciferin, luciferase, aequorin and the like
are all exemplary protein based chemiluminescent labels. Luminol,
isoluminol, theromatic acridinium ester, imidazole, acridinium
salt, oxalate ester, etc. are exemplary non-protein based
chemiluminescent labels. Another non-limiting and commonly used
example of an indirectly detectable label is an affinity ligand,
i.e., a label with strong affinity for a secondary binding partner
(e.g., an antibody or aptamer) which may itself be directly or
indirectly detectable.
[0315] In general, a detectable label may be visualized or detected
in a variety of ways, with the particular manner of detection being
chosen based on the particular detectable label, where
representative detection means include, e.g., scintillation
counting, autoradiography, measurement of paramagnetism,
fluorescence measurement, light absorption measurement, measurement
of light scattering and the like.
[0316] In various embodiments, a pre-conjugated label may contain
one or more reactive moieties (e.g., carboxyl or reactive ester,
amine, hydroxyl, aldehyde, sulfhydryl, maleimidyl, alkynyl, azido,
etc. moieties). As discussed below, these reactive moieties may, in
certain embodiments, facilitate the conjugation process. Specific
examples include peptidic labels bearing alpha-terminal amine
and/or epsilon-amine lysine groups. It will be appreciated that any
of these reactive moieties may be artificially added to a known
label if not already present. For example, in the case of peptidic
labels a suitable amino acid (e.g., a lysine) may be added or
substituted into the amino acid sequence. In addition, as discussed
in more detail below, it will be appreciated that the conjugation
process may be controlled by selectively blocking certain reactive
moieties prior to conjugation.
L.sup.B and L.sup.D (Covalent Conjugation)
[0317] One of ordinary skill will appreciate that a variety of
conjugation chemistries may be used to covalently conjugate an X
with a T and/or a W with a T (generally "components"). Such
techniques are widely known in the art, and exemplary techniques
are discussed below. Components can be directly bonded (i.e., with
no intervening chemical groups) or indirectly bonded through a
spacer (e.g., a coupling agent or covalent chain that provides some
physical separation between the conjugated element and the
remainder of the conjugate framework). It is to be understood that
components may be covalently bound to a conjugate framework through
any number of chemical bonds, including but not limited to amide,
amine, ester, ether, thioether, isourea, imine, etc. bonds. In
certain embodiments, L.sup.B and/or L.sup.D (generally "L" for the
purposes of this section) is a covalent bond. In some embodiments,
L is an optionally substituted moiety derived from conjugating an
optionally substituted carbonyl-reactive, thiol-reactive,
amine-reactive, or hydroxyl-reactive moiety of T with a carboxyl,
thiol, amine, or hydroxyl group of X or W. In some embodiments, L
is an optionally substituted moiety derived from conjugating an
optionally substituted carboxyl-reactive, thiol-reactive,
amine-reactive, or hydroxyl-reactive moiety of X or W with a
carboxyl, thiol, amine, or hydroxyl group of T. In some
embodiments, L is
##STR00044##
In some embodiments, L is a succinimide moiety.
[0318] In various embodiments, components may be covalently bound
to a conjugate framework using "click chemistry" reactions as is
known in the art. These include, for example, cycloaddition
reactions, nucleophilic ring-opening reactions, and additions to
carbon-carbon multiple bonds (e.g., see Kolb and Sharpless, Drug
Discovery Today 8:1128-1137, 2003 and references cited therein as
well as Dondoni, Chem. Asian J. 2:700-708, 2007 and references
cited therein). As discussed above, in various embodiments, the
components may be bound to a conjugate framework via natural or
chemically added pendant groups. In general, it will be appreciated
that the first and second members of a pair of reactive groups
(e.g., a carboxyl group and an amine group which react to produce
an amide bond) can be present on either one of the component and
framework (i.e., the relative location of the two members is
irrelevant as long as they react to produce a conjugate). Exemplary
linkages are discussed in more detail below. In various
embodiments, carboxyl (or reactive ester) bearing components can be
conjugated to --OH bearing frameworks (OBFs) using the procedure
outlined by Kim et al., Biomaterials 24:4843-4851 (2003). Briefly,
the OBF is dissolved in DMSO along with the carboxyl bearing
component and reacted by means of N',N'-dicyclohexylcarbodiimide
(DCC) and 4-dimethylaminopyridine (DMAP) as catalysts under a dry
atmosphere. Carboxyl bearing components can be conjugated to
--NH.sub.2 bearing frameworks (NBFs) using a carbodiimide (EDAC)
coupling procedure. Using this procedure, the carboxyl bearing
component is functionalized by reaction with EDAC in a pH 5 buffer
followed by the addition of the NBF. In either of these cases (and
in any of the following cases), the resulting products may be
purified by any number of means available to those skilled in the
art including, but not limited to, size exclusion chromatography,
reversed phase chromatography, silica gel chromatography, ion
exchange chromatography, ultrafiltration, and selective
precipitation.
[0319] In various embodiments, amine bearing components can be
coupled to --COOH bearing frameworks (CBFs). CBFs using activated
ester moieties (e.g., see Hermanson in Bioconjugate Techniques,
2.sup.nd edition, Academic Press, 2008 and references cited
therein). Briefly, a CBF with terminal activated carboxylic acid
esters such as --NHS, --SSC, --NPC, etc. is dissolved in an
anhydrous organic solvent such as DMSO or DMF. The desired number
of equivalents of amine bearing component are then added and mixed
for several hours at room temperature. Amine bearing components can
also be conjugated to CBFs to produce a stable amide bond as
described by Baudys et al., Bioconj. Chem. 9:176-183, 1998. This
reaction can be achieved by adding tributylamine (TBA) and
isobutylchloroformate to a solution of the CBF and an amine bearing
component in dimethylsulfoxide (DMSO) under anhydrous conditions.
Amine bearing components can alternatively be coupled to OBFs
through cyanalation using reagents including, but not limited to,
cyanogen bromide (CNBr), N-cyanotriethylammonium tetrafluoroborate
(CTEA), 1-Cyano-4-(Dimethylamino)-pyridinium tetrafluorborate
(CDAP), and p-nitrophenylcyanate (pNPC). CNBr reactions can be
carried out at mildly basic pH in aqueous solution. CDAP reactions
are carried out in a mixture of DMSO and water at mildly basic pH
using triethylamine (TEA) as a catalyst. In certain embodiments,
amine bearing components can be conjugated to NBFs, e.g., through
glutaraldehyde coupling in aqueous buffered solutions containing
pyridine followed by quenching with glycine. In certain
embodiments, amine bearing components can be conjugated to aldehyde
bearing frameworks using a Schiff Base coupling procedure followed
by reduction (e.g., see Hermanson in Bioconjugate Techniques,
2.sup.nd edition, Academic Press, 2008 and references cited therein
as well as Mei et al. in Pharm. Res. 16: 1680-1686, 1999 and
references cited therein). Briefly, a framework with terminal
activated aldehydes (e.g., acetaldehyde, propionaldehyde,
butyraldehyde, etc.) is dissolved in an aqueous buffer with the pH
at or below neutral to prevent unwanted aldehyde hydrolysis. The
desired number of equivalents of an amine bearing component are
then added and mixed at room temperature followed by addition of an
excess of suitable reducing agent (e.g., sodium borohydride, sodium
cyanobrohydride, sodium triacetoxyborohydride pyridine borane,
triethylamine borane, etc.).
[0320] In various embodiments, hydroxyl bearing components can be
conjugated to OBFs according to the divinylsulfone (DVS) procedure.
Using this procedure, the OBF is added to a pH 11.4 bicarbonate
buffer and activated with DVS followed by addition of a hydroxyl
bearing component after which glycine is added to neutralize and
quench the reaction. Hydroxyl bearing components may also be
coupled to OBFs using activated ester moieties as described above
to produce ester bonds.
[0321] In various embodiments, sulfhydryl bearing components can be
coupled to maleimide bearing frameworks (MBFs) using a relatively
mild procedure to produce thioether bonds (e.g., see Hermanson in
Bioconjugate Techniques, 2.sup.nd edition, Academic Press, 2008 and
references cited therein). Because the maleimide group is much less
susceptible to hydrolysis than activated esters, the reaction can
be carried out under aqueous conditions. Briefly, an MBF is
dissolved in a buffered aqueous solution at pH 6.5-7.5 followed by
the desired number of equivalents of sulfhydryl bearing component.
After mixing at room temperature for several hours, the thioether
coupled conjugate may be purified. Sulfhydryl bearing components
can also be conjugated to NBFs according to a method described by
Thoma et al., J. Am. Chem. Soc. 121:5919-5929, 1999. This reaction
involves suspending the NBF in anhydrous dimethylformamide (DMF)
followed by the addition of 2,6-lutidine and acid anhydride and
subsequent purification of the reactive intermediate. A sulfhydryl
bearing component is then added to a solution of the intermediate
in DMF with triethylamine.
[0322] In various embodiments, azide bearing components can be
coupled to an alkyne bearing framework (ABF) using the
copper(I)-catalyzed modern version of the Huisgen-type azide-alkyne
cycloaddition to give a 1,4-di-substituted 1,2,3-triazole (e.g.,
see Dondoni, Chem. Asian J. 2:700-708, 2007 and references cited
therein as well as Dedola et al., Org. Biomol. Chem. 5: 1006-1017,
2007). This reaction, commonly referred to as a "click" reaction,
may be carried out for example in neat THF using
N,N-diisopropylethylamine and Cu(PPh.sub.3).sub.3Br as the catalyst
system (e.g., see Wu et al., Chem. Commun. 5775-5777, 2005). The
reaction may also be carried out in a 3:1 (THF:water) mixture using
sodium ascorbate and CuSO.sub.4.5H.sub.2O as the catalyst system
(e.g., see Wu et al., supra). In either case, the azide bearing
component is added to the ABF at the desired number of equivalents
followed by mixing for 12-48 hours at room temperature.
Alternatively, alkyne bearing components may be conjugated to an
azide bearing framework using exactly the same conditions described
above.
[0323] Certain components may naturally possess more than one of
the same chemically reactive moiety. In some examples, it is
possible to choose the chemical reaction type and conditions to
selectively react the component at only one of those sites. For
example, in the case where insulin is conjugated through reactive
amines, in certain embodiments, the N-terminal .alpha.-Phe-B1 is a
preferred site of attachment over the N-terminal .alpha.-Gly-A1 and
.epsilon.-Lys-B29 to preserve insulin bioactivity (e.g., see Mei et
al., Pharm. Res. 16: 1680-1686, 1999 and references cited therein
as well as Tsai et al., J. Pharm. Sci. 86: 1264-1268, 1997). In an
exemplary reaction between insulin with hexadecenal (an
aldehyde-terminated molecule), researchers found that mixing the
two components overnight in a 1.5M pH 6.8 sodium salicylate aqueous
solution containing 54% isopropanol at a ratio of 1:6
(insulin:aldehyde mol/mol) in the presence of sodium
cyanoborohydride resulted in over 80% conversion to the
single-substituted Phe-B1 secondary amine-conjugated product (Mei
et al., Pharm. Res. 16:1680-1686, 1999). Their studies showed that
the choice of solvent, pH, and insulin:aldehyde ratio all affected
the selectivity and yield of the reaction. In most cases, however,
achieving selectivity through choice of chemical reaction
conditions is difficult. Therefore, in certain embodiments it may
be advantageous to selectively protect the component (e.g.,
insulin) at all sites other than the one desired for reaction
followed by a deprotection step after the material has been reacted
and purified. For example, there are numerous examples of selective
protection of insulin amine groups available in the literature
including those that may be deprotected under acidic (BOC),
slightly acidic (citraconic anhydride), and basic (MSC) conditions
(e.g., see Tsai et al., J. Pharm. Sci. 86: 1264-1268, 1997; Dixon
et al., Biochem. J. 109: 312-314, 1968; and Schuettler et al., D.
Brandenburg Hoppe Seyler's Z. Physiol. Chem. 360: 1721, 1979). In
one example, the Gly-A1 and Lys-B29 amines may be selectively
protected with tert-butoxycarbonyl (BOC) groups which are then
removed after conjugation by incubation for one hour at 4 C in a
90% trifluoroacetic acid (TFA)/10% anisole solution. In one
embodiment, a dry powder of insulin is dissolved in anhydrous DMSO
followed by an excess of triethylamine. To this solution,
approximately two equivalents of di-tert-butyl dicarbonate solution
in THF is added slowly and the solution allowed to mix for 30-60
minutes. After reaction, the crude solution is poured in an excess
of acetone followed by dropwise addition of dilute HCl to
precipitate the reacted insulin. The precipitated material is
centrifuged, washed with acetone and dried completely under vacuum.
The desired di-BOC protected product may be separated from
unreacted insulin, undesired di-BOC isomers, and mono-BOC and
tri-BOC byproducts using preparative reverse phase HPLC or ion
exchange chromatography (e.g., see Tsai et al., J. Pharm. Sci. 86:
1264-1268, 1997). In the case of reverse phase HPLC, a solution of
the crude product in 70% water/30% acetonitrile containing 0.1% TFA
is loaded onto a C8 column and eluted with an increasing
acetonitrile gradient. The desired di-BOC peak is collected,
rotovapped to remove acetonitrile, and lyophilized to obtain the
pure product.
LRP.sup.13 and LRP.sup.D (Non-Covalent Conjugation)
[0324] One of ordinary skill will appreciate that a variety of
conjugation chemistries may be used to non-covalently conjugate an
X with a T and/or a W with a T (generally "components"). Such
techniques are widely known in the art, and exemplary techniques
are discussed below. In certain embodiments, the dissociation
constant (K.sub.d) of the non-covalent linkage in human serum is
less than 1 pmol/L. For example, a component may be non-covalently
bound to a conjugate framework via a non-covalent ligand-receptor
pair as is well known in the art (e.g., without limitation a
biotin-avidin based pair). In such an embodiment, one member of the
ligand receptor-pair is covalently bound to the component while the
other member of the pair is covalently bound to the conjugate
framework. When the component and conjugate framework are combined,
the strong non-covalent interaction between the ligand and its
receptor causes the component to become non-covalently bound to the
conjugate framework. Typical ligand/receptor pairs include
protein/co-factor and enzyme/substrate pairs. Besides the commonly
used biotin/avidin pair, these include without limitation,
biotin/streptavidin, digoxigenin/anti-digoxigenin,
FK506/FK506-binding protein (FKBP), rapamycin/FKBP,
cyclophilin/cyclosporin and glutathione/glutathione transferase
pairs. Other suitable ligand/receptor pairs would be recognized by
those skilled in the art, e.g., monoclonal antibodies paired with a
epitope tag such as, without limitation, glutathione-S-transferase
(GST), c-myc, FLAG.RTM. and further those described in Kessler pp.
105-152 of Advances in Mutagenesis" Ed. by Kessler,
Springer-Verlag, 1990; "Affinity Chromatography: Methods and
Protocols (Methods in Molecular Biology)" Ed. by Pascal Baillon,
Humana Press, 2000; and "Immobilized Affinity Ligand Techniques" by
Hermanson et al., Academic Press, 1992.
k and q
[0325] For conjugates of general formula (V), k is an integer from
2 to 11, inclusive, defining at least two k-branches within the
conjugate. In certain embodiments, k=2 or 3. q is an integer from 1
to 4, inclusive, and defines the number of D groups which are bound
to the central group. In certain embodiments, q=1. In some
embodiments, q=2. k+q is an integer from 3 to 6, inclusive. In
certain embodiments, k+q=3 or 4.
[0326] For conjugates of general formula (VI), when j is 2, 3, or
4, k is an integer from 1 to 11, inclusive. In certain embodiments,
k is 1, 2, or 3. q is an integer from 1 to 4, inclusive, and
defines the number of D groups which are bound to the central
group. In certain embodiments, q=1. In some embodiments, q=2. k+q
is an integer from 3 to 6, inclusive. In certain embodiments, k+q=3
or 4.
p and m
[0327] Each occurrence of p is independently an integer from 1 to
5, inclusive. In certain embodiments, each occurrence of p is the
same. In certain embodiments, p=1, 2 or 3. In certain embodiments,
p=1.
[0328] Each occurrence of m is independently an integer from 1 to
5, inclusive. In certain embodiments, each occurrence of m is the
same. In certain embodiments, m=1, 2 or 3. In certain embodiments,
m=1.
n and v
[0329] Each occurrence of n is independently an integer from 0 to
5, inclusive, with the proviso that within each k-branch at least
one occurrence of n is .gtoreq.1. Branches within a given k-branch
are referred to herein as n-branches.
[0330] In certain embodiments, each occurrence of in a p-bracketed
moiety is substituted by a number of n-bracketed moieties
corresponding to a value of n.gtoreq.1, e.g., see formula (Va)
above. In some such embodiments, each occurrence of n in the
conjugate is the same. In some of these embodiments, n=1 or 2.
[0331] In other embodiments, only terminal occurrences of in a
p-bracketed moiety are substituted by a number of n-bracketed
moieties corresponding to a value of n.gtoreq.1, e.g., see formula
(Vb) above. In certain embodiments, each k-branch includes just one
occurrence of n.gtoreq.1 (i.e., all other occurrences of n=0). In
some such embodiments, each occurrence of n in the conjugate is the
same. In some of these embodiments, n=1 or 2.
[0332] Each occurrence of v is independently an integer from 0 to
5, inclusive, with the proviso that within each k-branch at least
one occurrence of v is .gtoreq.1.
[0333] In certain embodiments, each occurrence of in an m-bracketed
moiety is substituted by a number of B moieties corresponding to
the value of v.gtoreq.1, e.g., see formula (Vc) above. In some such
embodiments, each occurrence of v in the conjugate is the same. In
some of these embodiments, v=1 or 2.
[0334] In other embodiments, only terminal occurrences of in an
m-bracketed moiety are substituted by a number of B moieties
corresponding to a value of v.gtoreq.1, e.g., see formula (Vd)
above. In certain embodiments, each k-branch includes just one
occurrence of v.gtoreq.1 (i.e., all other occurrences of v=0). In
some such embodiments, each occurrence of v in the conjugate is the
same. In some of these embodiments, v=1 or 2. In certain
embodiments, each n-branch includes at least one occurrence of
v.gtoreq.1. In certain embodiment, each n-branch includes just one
occurrence of v.gtoreq.1 (i.e., all other occurrences of v=0). In
some such embodiments, each occurrence of v in the conjugate is the
same. In some of these embodiments, v=1 or 2.
j
[0335] j of formula (VI) is an integer from 1 to 4, inclusive, and
defines the number of conjugations to the D group. In certain
embodiments, j=1. In certain embodiments, j=2. In some embodiments,
j=3. In other embodiments, j=4.
Loading Levels
[0336] In general, the amount of drug (or detectable label) that is
loaded onto a conjugate will depend on the molecular weight of the
drug and can be controlled by adjusting the molecular weight of the
conjugate framework and/or the level of chemical activation (i.e.,
when pendant groups are added to the framework). In various
embodiments, the drug and/or detectable label loading level may be
in the range of 5 to 99% w/w of drug and/or detectable label to
conjugate (e.g., including drug). In various embodiments, loading
levels within the narrower range of 50 to 99% may be used, e.g., in
the range of 80 to 99%.
Other
[0337] In various embodiments, a biodegradable framework may be
used. In various embodiments, a non-biodegradable framework may be
used, e.g., when biodegradability is not relevant to the
application and/or when the resulting framework or conjugate is
sufficiently well excreted that biodegradability is not necessary.
In various embodiments, the conjugate framework (or spacer when
present, e.g., between a drug and framework) is susceptible to
digestion by an enzyme. In various embodiments, the enzyme is
present at the site of administration. One skilled in the art will
recognize that a number of enzymes are present in patients that
could cleave a conjugate framework. Without limitation, these
include saccharidases, peptidases, and nucleases. Exemplary
saccharidases include, but are not limited to, maltase, sucrase,
amylase, glucosidase, glucoamylase, and dextranase. Exemplary
peptidases include, but are not limited to, dipeptidyl
peptidase-IV, prolyl endopeptidase, prolidase, leucine
aminopeptidase, and glicyl glycine dipeptidase. Exemplary nucleases
include, but are not limited to, deoxyribonuclease I, ribonuclease
A, ribonuclease T1, and nuclease S1.
[0338] One skilled in the art will also recognize that, depending
on the choice of enzyme, there are a number of conjugate frameworks
that are susceptible to enzymatic cleavage. For example, in cases
where saccharidase degradation is desired, frameworks which include
polysaccharides can be used (e.g., without limitation, a conjugate
that includes a polysaccharide comprising repeating chains of
1,4-linked alpha-D-glucose residues will be degraded by
alpha-amylases). Without limitation, suitable polysaccharides
include glycogen and partially digested glycogen derived from any
number of sources, including but not limited to, sweet corn,
oyster, liver (human, bovine, rabbit, rat, horse), muscle (rabbit
leg, rabbit abdominal, fish, rat), rabbit hair, slipper limpet,
baker's yeast, and fungus. Other polysaccharide polymers and
spacers that one could use include carboxylated polysaccharides,
--NH.sub.2 pendant polysaccharides, hydroxylated polysaccharides,
alginate, collagen-glycosaminoglycan, collagen, mannan, amylose,
amylopectin, cellulose, hyaluronate, chondroitin, dextrin,
chitosan, etc. In cases where peptidase cleavage is desired,
polypeptides that contain amino acid sequences recognized by the
cleaving enzyme can be used (e.g., without limitation, a conjugate
that includes a [-Glycine-Proline-] sequence will be degraded by
prolidase). In certain embodiments one could use co-polymers of
aminated and non-aminated amino acids, co-polymers of hydroxylated
and non-hydroxylated amino acids, co-polymers of carboxylated and
non-carboxylated amino acids, co-polymers of the above or adducts
of the above. In cases where nuclease degradation is desired,
polynucleotides can be used (e.g., without limitation, a conjugate
that includes a polynucleotide containing an oligomer of sequential
adenosine residues will be degraded by ribonuclease A).
[0339] In various embodiments, the pharmacokinetic and/or
pharmacodynamic behavior of a conjugate (i.e., conjugated drug
and/or drug which has been released from a conjugate by chemical or
enzymatic degradation) may be substantially the same as the
corresponding unconjugated drug (e.g., when both are administered
subcutaneously). For example, from a pharmacokinetic (PK)
perspective, the serum concentration curve may be substantially the
same as when an equivalent amount of unconjugated drug is
administered. Additionally or alternatively, the serum T.sub.max,
serum C.sub.max, mean serum residence time (MRT), mean serum
absorption time (MAT) and/or serum half-life may be substantially
the same as when the unconjugated drug is administered. From a
pharmacodynamic (PD) perspective, the conjugate may act on
substances within the body in substantially the same way as the
unconjugated drug. For example, in the case of an insulin
conjugate, the conjugate may affect blood glucose levels in
substantially the same way as unconjugated insulin. In this case,
substantially similar pharmacodynamic behavior can be observed by
comparing the time to reach minimum blood glucose concentration
(T.sub.nadir), the duration over which the blood glucose level
remains below a certain percentage of the initial value (e.g., 70%
of initial value or T.sub.70%BGL), etc. It will be appreciated that
these PK and PD characteristics can be determined according to any
of a variety of published pharmacokinetic and pharmacodynamic
methods (e.g., see Baudys et al., Bioconjugate Chem. 9:176-183,
1998 for methods suitable for subcutaneous delivery).
[0340] In one embodiment, a conjugate (i.e., in isolated form
without modified lectin) produces pharmacokinetic (PK) parameters
such as time to reach maximum serum drug concentration (T.sub.max),
mean drug residence time (MRT), serum half-life, and mean drug
absorption time (MAT) that are within 40% of those values
determined for the unconjugated drug. In various embodiments, a
conjugate produces PK parameters that are within 35%, 30%, 25%,
20%, 15% or even 10% of those produced by the unconjugated drug. In
some embodiments, a conjugate produces PK parameters that are
within 20% of those produce by the unconjugated drug. For example,
in embodiments involving an insulin conjugate for subcutaneous
delivery the conjugate may produce an insulin T.sub.max between
15-30 minutes, a mean insulin residence time (MRT) of less than 50
minutes, or a mean insulin absorption time (MAT) of less than 40
minutes, all of which are within 20% of those values determined
from the human recombinant insulin treatment group. In certain
embodiments, the conjugate may produce an insulin T.sub.max between
20-25 minutes, a mean insulin residence time (MRT) of less than 45
minutes, and a mean insulin absorption time (MAT) of less than 35
minutes. In certain embodiment, the conjugate may produce a serum
half-life of less than 120 minutes, e.g., less than 100
minutes.
[0341] In one embodiment, an inventive conjugate produces
pharmacodynamic (PD) parameters such as time to reach
minimum/maximum blood concentration of a substance
(T.sub.nadir/T.sub.max) or duration over which the blood level of
the substance remains below/above 70%/130% of the initial value
(T.sub.70%BL/T.sub.130%AL). For example, in embodiments involving
an insulin conjugate for subcutaneous delivery the conjugate may
produce a glucose T.sub.nadir between 45-60 minutes and a glucose
T.sub.70%BGL of less than 180 minutes, both of which are within 20%
of those determined from the human recombinant insulin treatment
group. In certain embodiments the conjugate may produce a glucose
T.sub.nadir between 50-55 minutes and a glucose T.sub.70%BGL of
less than 160 minutes. In various embodiments, a conjugate produces
PD parameters that are within 40%, 35%, 30%, 25%, 20%, 15% or even
10% of those produced by the unconjugated drug. In some
embodiments, a conjugate produces PD parameters that are within 20%
of those produce by the unconjugated drug.
Intermediates for Preparing Conjugates
[0342] In one aspect, the invention provides reagents for preparing
conjugates of the present disclosure. Thus, in various embodiments,
a compound of general formula (V) is provided wherein: [0343] each
of , T, D, k, q, k+q, p, n, m and v is defined as described above
and herein;
[0344] B is -T-L.sup.B'; and [0345] each occurrence of L.sup.B' is
independently hydrogen, an alkyne-containing moiety, an
azide-containing moiety, or an optionally substituted
carbonyl-reactive, thiol-reactive, amine-reactive, or
hydroxyl-reactive moiety.
[0346] In other embodiments, a compound of general formula (V) is
provided wherein: [0347] each of , T, B, k, q, k+q, p, n, m and v
is defined as described above and herein; [0348] D is -T-L.sup.D';
and [0349] each occurrence of L.sup.D' is independently hydrogen,
an alkyne-containing moiety, an azide-containing moiety, or an
optionally substituted carbonyl-reactive, thiol-reactive,
amine-reactive, or hydroxyl-reactive moiety.
Methods for Preparing Conjugates
[0350] We have exemplified methods for preparing the aforementioned
conjugates using insulin as an exemplary drug and aminoethylglucose
(AEG), aminoethylmannose (AEM), aminoethylbimannose (AEBM), and/or
aminoethyltrimannose (AETM) as exemplary affinity ligands. Without
limitation, conjugates with two affinity ligands and one drug
molecule and with short distances between all framework components
may be prepared using tris(hydroxymethyl)aminomethane (Tris),
Tris-succinimidyl aminotriacetate (TSAT),
tris-Succinimidyl-1,3,5-benzenetricarboxylate (TSB), and
Benzene-1,3,5-tricarboxy-(N-4-butyric-NHS-ester)amide (TSB-C4) as
conjugate frameworks. If more space between framework components is
desired then Succinimidyl (6-aminocaproyl)aminotriacetate
(TSAT-C6), Succinimidyl (6-amino(PEO-6))aminotriacetate
(TSAT-PEO-6), Benzene-1,3,5-tricarboxy-(N-6-aminocaproic-NHS
ester)amide (TSB-C6), and
Benzene-1,3,5-tricarboxy-(N-10-aminodecanoic-NHS ester)amide
(TSB-C10) may be used. The TSAT-C6 spacer arm chemistry imparts
more hydrophobic character to the conjugate as compared to
TSAT-PEO-6. For example, for purposes of illustration, in one
embodiment, both the affinity ligand (e.g., AEG, AEM, AEMB and
AETM) and insulin may be reacted to a TSAT-C6 framework through the
terminal activated esters to produce insulin-TSAT-C6-AEG-2,
insulin-TSAT-C6-AEM-2, insulin-TSAT-C6-AEMB-2, and
insulin-TSAT-C6-AETM-2 conjugates. The various affinity ligands are
synthesized ahead of time as discussed in the Examples. In
addition, the A1 and B29 amino groups of insulin are BOC-protected
as described in the Examples so that each insulin can only react at
the Phe-B1 .alpha.-amino group. Approximately one equivalent of
BOC-insulin as a 40-50 mg/ml solution in DMSO is added at room
temperature to a 50 mg/ml solution of TSAT-C6 in DMSO containing
excess triethylamine and allowed to react for approximately one
hour. Next, an excess of AEG, AEM, AEBM, and/or AETM (2-10
equivalents) as a 100 mg/ml solution in DMSO is added and allowed
to react for an additional 2 hours. After reaction, the DMSO
solution is superdiluted by 10.times. into a pH 5 saline buffer
after which the pH is adjusted to 8.0 and the solution passed
through a Biogel P2 column to remove low molecular reactants and
salts. The material eluting in the void fraction is concentrated
using a 3K ultrafiltration apparatus after which it is injected on
a prep scale reverse phase HPLC column (C8, acetonitrile/water
mobile phase containing 0.1% TFA) to purify the desired product
from unreacted BOC2-insulin. The desired elution peak is collected
pooled and rotovapped to remove acetonitrile followed by
lyophilization to obtain a dry powder. Finally, the BOC protecting
groups are removed by dissolving the lyophilized powder in 90%
TFA/10% anisole for one hour at 4 C followed by 10.times.
superdilution in HEPES pH 8.2 buffer containing 0.150M NaCl. The pH
is adjusted to between 7.0 and 8.0 using NaOH solution after which
the material is passed through a Biogel P2 column to remove
anisole, BOC, and any other contaminating salts. The deprotected,
purified aqueous conjugate solution is then concentrated to the
desired level and stored at 4 C until needed.
[0351] It will be appreciated that this exemplary procedure may be
used to produce other conjugates with different affinity ligands
and drugs, different conjugation chemistries, different separations
between framework components, and/or different valencies by
substituting the TSAT-C6 framework with a different framework as
described below.
[0352] For example, if yet more distance is required between
framework components and/or a preserved charge is required at the
site of conjugation, then an appropriately-sized amine-bearing
diethyl acetal (e.g., aminopropionaldehyde diethyl acetal (APDA) or
aminobutyraldehyde diethyl acetal (ABDA)) may be conjugated to one
of the reactive groups on the frameworks listed here followed by
complete reaction of the remaining reactive groups with the
affinity ligand of interest (e.g. AEM, AEBM, or AETM). A reactive
aldehyde group can then be revealed from the diethyl acetal under
acidic conditions followed by a reductive amination with insulin to
complete the drug conjugation step then ABDA-TSAT, ABDA-LCTSAT,
etc. may be employed. In yet another example,
tetrakis-(N-succinimidyl carboxypropyl)pentaerythritol (TSPE), may
be used to attach three affinity ligands and one drug molecule for
increased multivalency. It will also be appreciated by those
skilled in the art that any of the above teachings may be used to
produce hyperbranched (e.g., dendrimer-like) conjugates with even
higher order valencies. For example, Rockendorf and Lindhorst
provide a comprehensive review of current approaches for producing
hyperbranched structures in Topics in Current Chemistry. 217:
202-238, 2001.
[0353] Furthermore, ligands already containing a predetermined
degree of multivalency may again be reacted according to the
procedures described above to produce even higher orders of ligand
multiplicity. For example, a divalent AEM-2, AEBM-2, or AETM-2
molecule containing a terminal reactive amine may be prepared by
conjugating two of each affinity ligand to a suitable framework to
which a reactive amine is also conjugated. A trivalent AEM-3,
AEBM-3, or AETM-3 molecule containing a terminal reactive amine may
be prepared by conjugating three of each affinity ligand to a
suitable framework to which a reactive amine is also conjugated.
The NH.sub.2-divalent sugars may be reacted with the same
frameworks described above to produce drug conjugates with 4 and 6
ligands per drug molecule. The NH.sub.2-trivalent sugars may be
reacted with the same frameworks described above to produce drug
conjugates with 6 and 9 ligands per drug molecule.
[0354] In all cases, it should be recognized that a mixture of
different ligands may be conjugated to the same drug via a
multivalent framework by adjusting the framework chemistry,
valency, and the ligand:framework stoichiometry. For example,
Insulin-AEM-1-AEBM-1, Insulin-AEBM-1-AETM-1, Insulin AEM-2-AETM-2,
and Insulin AEM-1-AETM-2 may all be synthesized according to this
mixed ligand method.
[0355] Finally, in some cases, it may be desirable to conjugate the
affinity ligand to the framework through a different means than the
drug. For example, a divalent maleimide/monovalent activate ester
functionalized framework (e.g., succinimidyl-3,5-dimaleimidophenyl
benzoate (SDMB)) may be used to conjugate two sulfhydryl
functionalized affinity ligands and one amine-functionalized drug
in separate steps. For example, insulin or another amine-containing
drug may be conjugated to the activated ester portion of the
framework using methods described herein. In a separate step, the
aminoethylsugar (AEM, AEBM, AETM) may be converted to a terminal
sulfhydryl-bearing ligand by reaction with 4-iminothiolane.
Finally, the framework-di-maleimide-insulin conjugate may be mixed
with an excess of sulfhydryl-functionalized sugar to produce the
resulting divalent-sugar-insulin conjugate.
Cross-Linked Materials
[0356] When conjugates and cross-linking agents are combined in the
absence of the target molecule, a non-covalently cross-linked
material is formed. In various embodiments, the material may be
prepared in aqueous solution through self-assembly by mixing
solutions of the cross-linking agent and conjugate. In various
embodiments, particles of the material may be prepared by reverse
emulsion. As described in more detail in U.S. Patent Application
Publication No. 2004-0202719, this can be achieved by adding the
aforementioned aqueous solution to a mixture of a hydrophobic
liquid and a surfactant and agitating the mixture.
[0357] Once formed, the cross-linked material can be used for a
variety of applications. When the material is placed in the
presence of free target molecules these compete for the
interactions between the cross-linking agents and the conjugates.
Above a certain concentration of free target molecule, the level of
competition becomes such that the material begins to degrade by
releasing conjugates from the surface. In various embodiments, the
extent and/or rate of release increases as the concentration of
target molecule increases. As a result, conjugates are released
from the material in a manner which is directly tied to the local
concentration of the target molecule.
[0358] In general, the release properties of the material will
depend on the nature of the cross-linking agents, conjugates,
target molecule and conditions (e.g., pH, temperature, etc.). If
the affinity of the cross-linking agents for the conjugates is much
greater than for the target molecule then the material will only
release conjugates at high concentrations of target molecule. As
the relative affinity of the cross-linking agents for the
conjugates is decreased, release of conjugates from the material
will occur at lower target molecule concentrations. The release
properties of the material can also be adjusted by varying the
relative amounts of cross-linking agent to conjugate. Higher ratios
of cross-linking agent to conjugate will lead to materials that
release conjugates at higher target molecule concentrations. Lower
ratios of cross-linking agent to conjugate will lead to materials
that release conjugates at lower target molecule concentrations. It
will be appreciated that, depending on the application, these
variables will enable one to produce materials which respond to a
wide variety of target molecule concentrations.
[0359] In various embodiments, the cross-linked material is
insoluble when placed in pH 7 HEPES buffered saline at 37 C (25 mM
HEPES containing 150 mM NaCl). In various embodiments, the
cross-linked material remains substantially insoluble when target
molecule is added to the buffer up to a threshold concentration
called the set point. Above the set point, the cross-linked
material exhibits an increase in the extent and rate of release of
conjugates. It will be appreciated that this transition may occur
sharply or may occur gradually over a range of concentrations
around the set point. In general, the desired set point and
transition will depend on the nature of the target molecule and the
intended application for the material. In particular, when the
material is designed to respond to an increase in the level of a
particular target molecule, the desired set point may be determined
based on the normal physiological range of concentrations of the
target molecule. It is to be understood that the amount of target
molecule present in a patient may fluctuate based on internal
and/or external factors. For example, in certain embodiments, the
amount of target molecule may fluctuate naturally over time, e.g.,
in response to changes in hormonal cycles or metabolic pathways
(lactate increasing during an endurance event, etc.). In certain
embodiments, the fluctuations may result from an external event,
e.g., an increase in glucose following a meal. In various
embodiments, external factors may be used to artificially trigger
the release of conjugates from a material of the present
disclosure. For example, if release of conjugate is sensitive to an
increase in glucose one could artificially release conjugates for a
short period of time by ingesting a high-glucose drink.
[0360] In various embodiments, the target molecule is glucose. The
normal physiological range of glucose concentrations in humans is
60 to 200 mg/dL. Glucose concentrations below 60 mg/dL are
considered hypoglycemic. Glucose concentrations above 200 mg/dL are
considered hyperglycemic. In various embodiments, a material of the
present disclosure may remain substantially insoluble when placed
in pH 7 HEPES buffered saline containing 20, 30, 40, 50, 60, 70,
80, 90, or 100 mg/dL glucose at 37 C for six hours using USP
dissolution test method II at 50 rpm. In various embodiments, less
than 1, 2, 4, 6, 8, or 10% of the material dissolves when placed in
pH 7 HEPES buffered saline with 20, 30, 40, 50, 60, 70, 80, 90, or
100 mg/dL glucose at 37 C for six hours using USP dissolution test
method II at 50 rpm. In various embodiments, at least 10, 20, 30,
40, 50, 60, 70, 80, 90 or 100% of a material of the present
disclosure dissolves when it is placed in pH 7 HEPES buffered
saline with 100, 150, 200, 250, 300, 350 or 400 mg/dL glucose at 37
C for six hours using USP dissolution test method II at 50 rpm.
[0361] The following tables provide normal physiological ranges for
other exemplary target molecules:
TABLE-US-00003 Low High Unit Metabolites Urea 7 18 mg/dL Creatinine
- male 0.7 1.3 mg/dL Creatinine - female 0.6 1.1 mg/dL Hormones
Thyroid stimulating hormone (TSH) 0.4 4.7 mIU/L Free thyroxine
(FT4) 9 24 pmol/L Free triiodothyronine (FT3) 2.5 5.3 pmol/L
Adrenocorticotropic hormone (ACTH) 1.3 15 pmol/L Cortisol (morning)
250 850 nmol/L Cortisol (afternoon) 110 390 nmol/L Prolactin (male)
n/a 450 mIU/L Prolactin (female) n/a 580 mIU/L Testosterone (male
post-puberty) 8 38 nmol/L Testosterone (male pre-puberty) 0.1 0.5
nmol/L Testosterone (female) 0.3 2.5 nmol/L
[0362] It will be appreciated that the desired set point for these
and other target molecules can be readily determined for a variety
of different applications. It will also be appreciated that the set
point may need to be adjusted for certain patients (e.g., based on
patient gender, patients with abnormally low or high levels of a
target molecule, etc.) or applications (e.g., a drug delivery
system designed to release on a more frequent basis may require a
lower threshold concentration than a system designed to release
less frequently).
[0363] It will be appreciated that a material having a desired set
point may be generated via routine experimentation using the
materials and methods described herein. For example, the same
cross-linking agent and conjugate can be combined to produce a
series of materials with a gradually increasing ratio of
cross-linking agent to conjugate (w/w). These materials will cover
a spectrum of set points. Once a lead material with a suitable set
point has been identified the process can be repeated with a finer
resolution to yield an optimized material. Alternatively (or
additionally) the same conjugate can be combined with a plurality
of different cross-linking agents that have gradually increasing
affinities for the conjugate. This will yield a plurality of
materials with a spectrum of set points that can be further refined
(e.g., by varying the w/w ratio of cross-linking agent to
conjugate). Alternatively one could initiate the process by
combining the same cross-linking agent with a plurality of
different conjugates. In various embodiments, the conjugates may
have varying affinities for the cross-linking agent (e.g., as a
result of including different affinity ligands). In various
embodiments, the conjugates may include the same affinity ligands
but have different molecular weights (e.g., as a result of
different conjugate frameworks).
Uses
[0364] In another aspect, the present disclosure provides methods
of using the materials. In general, the materials can be used to
controllably release conjugates in response to a target molecule.
As discussed below, the material can be brought into contact with
the target molecule in vitro or in vivo.
[0365] In various embodiments, a material may be used as a
component of an in vitro or in vivo chemical sensor. This aspect is
described below in the context of glucose sensors; however, it will
be appreciated from the foregoing that other chemical sensors may
be prepared by simply using a different target molecule.
[0366] For example, in various embodiments, a material of the
present disclosure may be used in glucose sensors that are based on
fluorescence resonance energy transfer (FRET). FRET is based on the
fact that when two different fluorophores are brought closely
together this allows for energy transfer between the two
fluorophores, resulting in a decrease in the fluorescence of one or
both of the fluorophores, which is called fluorescence quenching
(Ballerstadt et al., Anal. Chim. Acta 345:203-212, 1997). For
example, in certain embodiments, in the absence of glucose, a
mixture of a fluorescently labeled cross-linking agent and a
fluorescently labeled conjugate will form an insoluble cross-linked
material and the neighboring fluorophores will undergo FRET. In the
presence of glucose, the average distance between the fluorescently
labeled cross-linking agent and the fluorescently labeled conjugate
will increase causing the level of FRET to decrease and thereby
leading to an increase in the individual fluorescence signals. The
level of fluorescence can thereby be directly correlated with the
level of glucose. It is to be understood that alternative pairs of
labels that produce a measurable response when brought in close
proximity may be used instead of a pair of fluorescent labels.
Thus, in certain embodiments, the invention provides a method
comprising steps of: (I) mixing: (a) multivalent lectins with at
least two binding sites for glucose, wherein the lectins include at
least one covalently linked affinity ligand which is capable of
competing with glucose for binding with at least one of said
binding sites and the lectins include a first label which generates
a measurable response when in close proximity to a second label;
(b) conjugates that comprise an affinity ligand and the second
label; (II) exposing a sample to the mixture of multivalent lectins
and conjugates, wherein: (a) if glucose is absent from the sample,
the conjugates form a cross-linked material with the lectins
through affinity binding to the multivalent lectins to produce a
measurable response; (b) if glucose is present in the sample, the
response is reduced because formation of cross-linked material is
inhibited as a result of glucose from the sample competing with the
conjugates for the binding sites on the multivalent lectins; and
(III) detecting and optionally measuring the response with a sensor
to determine the presence and optionally the amount of glucose in
the sample. In certain embodiments, the first and second labels are
fluorescent labels and the response is a fluorescent signal.
[0367] In certain embodiments, the two labels (e.g., fluorescent
labels) may be located on different molecules that are brought into
proximity by binding to the same multivalent lectin. Thus, in
certain embodiments, the invention provides a method comprising
steps of: (I) mixing: (a) multivalent lectins with at least two
binding sites for glucose, wherein the lectins include at least one
covalently linked affinity ligand which is capable of competing
with glucose for binding with at least one of said binding sites;
(b) a first group of molecules that comprise an affinity ligand and
a first label which generates a measurable response when in close
proximity to a second label; and (c) a second group of molecules
that comprise an affinity ligand and the second label; (II)
exposing a sample to the mixture of multivalent lectins, and the
first and second groups of molecules, wherein: (a) if glucose is
absent from the sample, members of the first and second group of
molecules are brought in close proximity through affinity binding
to the multivalent lectins to produce a binding complex and a
measurable response; (b) if glucose is present in the sample, the
response is reduced because fewer of said binding complexes form as
a result of glucose from the sample competing with the first and
second molecules for the binding sites on the multivalent lectins;
and (III) detecting and optionally measuring the response with a
sensor to determine the presence and optionally the amount of
glucose in the sample. In certain embodiments, the first and second
labels are fluorescent labels and the response is a fluorescent
signal.
[0368] In other exemplary embodiments, materials of the present
disclosure may be used in viscosity-based glucose sensors (e.g.,
see U.S. Pat. Nos. 6,267,002; 6,477,891; and 6,938,463). Conjugates
and cross-linking agents are again combined to form a cross-linked
material. Addition of glucose to the material now causes a
concentration dependent reduction in viscosity which can be
measured (e.g., as a function of shear rate using a microviscometer
set up in a cone-and-plate geometry). The viscosity of the sample
can thereby be directly correlated with the level of glucose. It
will be appreciated that these two exemplary glucose sensors do not
require any drug to be present within the conjugates. It will also
be appreciated that a viscosity-based sensor does not require a
detectable label to be present within the conjugates.
[0369] In certain embodiments, the invention provides a method
comprising steps of: (I) providing: (a) conjugates that comprises a
plurality of affinity ligands, (b) multivalent lectins with at
least two binding sites for glucose, wherein the lectins include at
least one covalently linked affinity ligand which is capable of
competing with glucose for binding with at least one of said
binding sites; (II) mixing the conjugates and lectins, wherein the
viscosity of the resulting mixture is due to the binding between
the conjugates and lectins; (III) contacting the mixture with a
sample containing glucose which displaces conjugates from the
lectins and causes a concentration dependent reduction in
viscosity; and (IV) detecting and optionally measuring the
resulting change in viscosity to determine the presence and
optionally the amount of glucose in the sample.
[0370] In various embodiments, a material may be used to
controllably deliver a drug to a patient. The invention encompasses
treating a disease or condition by administering a material of the
present disclosure. Although the materials can be used to treat any
patient (e.g., dogs, cats, cows, horses, sheep, pigs, mice, etc.),
they are most preferably used in the treatment of humans. A
material can be administered to a patient by any route. In general
the most appropriate route of administration will depend upon a
variety of factors including the nature of the disease or condition
being treated, the nature of the drug, the nature of the target
molecule, the condition of the patient, etc. In general, the
present disclosure encompasses administration by oral, intravenous,
intramuscular, intra-arterial, subcutaneous, intraventricular,
transdermal, rectal, intravaginal, intraperitoneal, topical (as by
powders, ointments, or drops), buccal, or as an oral or nasal spray
or aerosol. General considerations in the formulation and
manufacture of pharmaceutical compositions for these different
routes may be found, for example, in Remington's Pharmaceutical
Sciences, 19.sup.th ed., Mack Publishing Co., Easton, Pa.,
1995.
[0371] In various embodiments, the material may be administered
subcutaneously, e.g., by injection. The material can be dissolved
in a carrier for ease of delivery. For example, the carrier can be
an aqueous solution including, but not limited to, sterile water,
saline or buffered saline. In general, a therapeutically effective
amount of a drug in the form of a conjugate will be administered.
By a "therapeutically effective amount" of a drug is meant a
sufficient amount of the drug to treat (e.g., to ameliorate the
symptoms of, delay progression of, prevent recurrence of, delay
onset of, etc.) the disease or condition at a reasonable
benefit/risk ratio, which involves a balancing of the efficacy and
toxicity of the drug. In general, therapeutic efficacy and toxicity
may be determined by standard pharmacological procedures in cell
cultures or with experimental animals, e.g., by calculating the
ED.sub.50 (the dose that is therapeutically effective in 50% of the
treated subjects) and the LD.sub.50 (the dose that is lethal to 50%
of treated subjects). The ED.sub.50/LD.sub.50 represents the
therapeutic index of the drug. Although in general drugs having a
large therapeutic index are preferred, as is well known in the art,
a smaller therapeutic index may be acceptable in the case of a
serious disease or condition, particularly in the absence of
alternative therapeutic options. Ultimate selection of an
appropriate range of doses for administration to humans is
determined in the course of clinical trials.
[0372] In various embodiments, the drug is insulin and the average
daily dose of insulin is in the range of 10 to 200 U, e.g., 25 to
100 U (where 1 Unit of insulin is .about.0.04 mg). In certain
embodiments, an amount of material with these insulin doses is
administered on a daily basis. In certain embodiments, an amount of
material with 5 to 10 times these insulin doses is administered on
a weekly basis. In certain embodiments, an amount of material with
10 to 20 times these insulin doses is administered on a bi-weekly
basis. In certain embodiments, an amount of material with 20 to 40
times these insulin doses is administered on a monthly basis. Those
skilled in the art will be recognize that this same approach may be
extrapolated to other approved drugs with known dose ranges, e.g.,
any of the approved insulin sensitizers and insulin secretagogues
described herein.
[0373] It will be understood that the total daily usage of a drug
for any given patient will be decided by the attending physician
within the scope of sound medical judgment. The specific
therapeutically effective amount for any particular patient will
depend upon a variety of factors including the disease or condition
being treated; the activity of the specific drug employed; the
specific composition employed; the age, body weight, general
health, sex and diet of the patient; the time of administration,
route of administration and rate of excretion of the specific drug
employed; the duration of the treatment; drugs used in combination
or coincidental with the specific drug employed; and like factors
well known in the medical arts. In various embodiments, a material
of the present disclosure may be administered on more than one
occasion. For example, the present disclosure specifically
encompasses methods in which a material is administered by
subcutaneous injection to a patient on a continuous schedule (e.g.,
once a day, once every two days, once a week, once every two weeks,
once a month, etc.).
[0374] In certain embodiments, a material of the present disclosure
may be used to treat hyperglycemia in a patient (e.g., a mammalian
patient). In certain embodiments, the patient is diabetic. However,
the present methods are not limited to treating diabetic patients.
For example, in certain embodiments, a material may be used to
treat hyperglycemia in a patient with an infection associated with
impaired glycemic control. In certain embodiments, a material may
be used to treat diabetes.
[0375] In various embodiments, a material of the present disclosure
may be administered to a patient who is receiving at least one
additional therapy. In various embodiments, the at least one
additional therapy is intended to treat the same disease or
disorder as the administered material. In various embodiments, the
at least one additional therapy is intended to treat a side-effect
of the primary drug. The two or more therapies may be administered
within the same, overlapping or non-overlapping timeframes as long
as there is a period when the patient is receiving a benefit from
both therapies. The two or more therapies may be administered on
the same or different schedules as long as there is a period when
the patient is receiving a benefit from both therapies. The two or
more therapies may be administered within the same or different
formulations as long as there is a period when the patient is
receiving a benefit from both therapies. In certain embodiments, a
single material of the present disclosure may include more than one
drug for treating the same disease or disorder. In certain
embodiments, two or more separate materials of the present
disclosure may be administered (as a mixture or separately) that
include different drugs for treating the same disease or disorder.
In certain embodiments, an unconjugated secondary drug may be
included in a material of the present disclosure (i.e., a drug
which is simply mixed with the components of the material and not
covalently bound to the cross-linked material). For example, in
certain embodiments, any of these approaches may be used to
administer more than one anti-diabetic drug to a subject. Certain
exemplary embodiments of this approach are described in more detail
below in the context of insulin-related therapies; however, it will
be appreciated from the foregoing that other therapies will benefit
from such combination approaches.
[0376] Insulin sensitizers (e.g., biguanides such as metformin,
glitazones) act by increasing a patient's response to a given
amount of insulin. A patient receiving an insulin sensitizer will
therefore require a lower dose of an insulin-based material of the
present disclosure than an otherwise identical patient would. Thus,
in certain embodiments, a material comprising insulin conjugates
may be administered to a patient who is also being treated with an
insulin sensitizer. In various embodiments, the material of the
present disclosure may be administered at up to 75% of the normal
dose required in the absence of the insulin sensitizer. In various
embodiments, up to 50, 40, 30 or 20% of the normal dose may be
administered.
[0377] Insulin resistance is a disorder in which normal amounts of
insulin are inadequate to produce a normal insulin response. For
example, insulin-resistant patients may require high doses of
insulin in order to overcome their resistance and provide a
sufficient glucose-lowering effect. In these cases, insulin doses
that would normally induce hypoglycemia in less resistant patients
fail to even exert a glucose-lowering effect in highly resistant
patients. Similarly, the materials of the present disclosure are
only effective for this subclass of patients when they release high
levels of insulin-conjugates in a suitable timeframe. In certain
embodiments, the treatment of this subclass of patients may be
facilitated by combining the two approaches. Thus in certain
embodiments, a traditional insulin-based therapy is used to provide
a baseline level of insulin and a material of the present invention
is administered to provide a controlled supplement of insulin when
needed by the patient. Thus, in certain embodiments, a material
comprising insulin conjugates may be administered to a patient who
is also being treated with insulin. In various embodiments, the
insulin may be administered at up to 75% of the normal dose
required in the absence of the material of the present disclosure.
In various embodiments, up to 50, 40, 30 or 20% of the normal dose
may be administered. It will be appreciated that this combination
approach may also be used with insulin resistant patients who are
receiving an insulin secretagogue (e.g., a sulfonylurea, GLP-1,
exendin-4, etc.) and/or an insulin sensitizer (e.g., a biguanide
such as metformin, a glitazone).
Kits
[0378] In another aspect the present disclosure provides kits that
include modified lectins and conjugates and other reagents for
preparing a material. For example, a kit may include separate
containers that include a plurality of conjugates and a plurality
of modified lectins. When the conjugates and modified lectins of
the kit are mixed a cross-linked material is formed. In various
embodiments, the material is designed for subcutaneous delivery and
the kit includes a syringe or pen. In various embodiments, a kit
may include a syringe or pen which is pre-filled with a
cross-linked material. The kit may also include instructions for
mixing the conjugates and modified lectins to produce the
cross-linked material.
[0379] In yet another aspect, the present disclosure provides
libraries of conjugates and/or modified lectins. These libraries
may be particularly useful for generating materials with a desired
set point. In various embodiments, a library may include a
plurality of modified lectins which produce different set points
with the same conjugate. In various embodiments, a library may
further include one or more conjugates which form cross-linked
materials with modified lectins in the library. When the library
includes more than one such conjugate, the different conjugates may
have different molecular weights, a different number of affinity
ligands per conjugate molecule and/or different affinity ligands.
In various embodiments, a library may include one or more of the
conjugates that include more than one type of affinity ligand. In
various embodiments, a library may include a plurality of
conjugates which produce different set points with the same
modified lectin. In various embodiments, a library may further
include one or more modified lectins which form cross-linked
materials with conjugates in the library.
[0380] In yet another aspect, the present disclosure provides a kit
that comprises: (a) a first container that includes modified
lectins that include a first label which generates a measurable
response when in close proximity to a second label; and (b) a
second container that includes conjugates that comprise the second
label.
[0381] In yet another aspect, the present disclosure provides a kit
that comprises: (a) a first container that includes modified
lectins; (b) a second container that includes a first group of
molecules that comprise an affinity ligand and a first label which
generates a measurable response when in close proximity to a second
label; and (c) a third container that includes a second group of
molecules that comprise an affinity ligand and the second label. In
certain embodiments, the first and second molecules are in the same
container.
EXAMPLES
I. Methods of Making Exemplary Conjugates
[0382] This first set of examples describes various methods for
making exemplary conjugates. The examples also include assays for
purifying and assaying the starting ingredients and final products.
It is to be understood that these methods can be modified to
produce other conjugates that fall within the scope of the
invention.
Example 1
Synthesis of Azidoethylglucose (AzEG)
[0383] a. Synthesis of Bromoethyleglucose
[0384] DOWEX 50W.times.4 resin (Alfa Aesar, Ward Hill, Mass.) was
washed with deionized water to remove color. A mixture of 225 gm
D-glucose (1.25 mol; 1 equiv., Alfa Aesar) and 140 gm DOWEX
50W.times.4 was treated with 2.2 L 2-bromoethanol (30.5 mol, 25
equiv.; 124.97 gm/mol; 1.762 gm/mL; BP=150 C; Alfa Aesar) and the
stirred mixture heated to 80 C for 4 hours. The reaction was
monitored by TLC (20% methanol/dichloromethane (DCM)). Reaction was
complete after about four hours, and it was allowed to cool to room
temperature. The solution was filtered to remove the resin, and the
resin washed with ethyl acetate and DCM. The resulting filtrate was
stripped to an amber oil in a rotory evaporator. A total of 400 gm
after stripping.
[0385] The amber oil was purified on silica gel (4 kg silica packed
in DCM) in the following manner. The crude was dissolved in DCM and
loaded onto the column, and then eluted with 2.times.4 L 10%
methanol/DCM; 2.times.4 L 15% methanol/DCM; and 3.times.4 L 20%
methanol/DCM. Product containing fractions (on the basis of TLC)
were pooled and stripped to dryness to afford 152 gm of
1-.alpha.-bromoethyl-glucose (42%).
[0386] b. Conversion of Bromoethylglucose to Azidoethylglucose
(AzEM)
[0387] A 5 L round bottom three-necked flask, equipped with a
heating mantle, an overhead stirrer, and a thermometer, was charged
with 150 gm bromoethylglucose (525 mmol). The oil was dissolved in
2 L water and treated with 68.3 gm sodium azide (1.05 mol, 2
equiv.; 65 gm/mol; Alfa-Aesar) followed by 7.9 gm sodium iodide
(52.5 mmol, 0.08 equiv.; 149.89 gm/mol; Alfa-Aesar) and the
solution warmed to 50 C and stirred overnight. The solution was
cooled to room temperature and concentrated to dryness on the
rotovap. The solid residue was digested with 3.times.500 mL of 5:1
vol. CHCl.sub.3:MeOH at 40 C. The combined organic portions were
filtered and evaporated to dryness to afford azidoethylglucose (86
gm) as an off-white solid. TLC (20% MeOH/DCM; char with
H.sub.2SO.sub.4): single spot, indistinguishable from the starting
material.
[0388] c. Repurification of Azidoethylglucose
[0389] 32 gm of azidoethylglucose was taken into 100 mL water. The
turbid solution was filtered through a glass microfibre filter
(Whatman GF/B). The golden filtrate was evaporated to a solid on a
rotovapor. The solid was taken into methanol (100 mL) and the
turbid solution was again filtered through a glass microfibre
filter. The resulting pale yellow filtrate was stripped to a solid
under vacuum.
[0390] The solid was taken into a minimum of methanol (50 mL) and
ethyl acetate (150 mL) was added slowly with stirring. The heavy
slurry was cooled and filtered. The solid was air dried
(hygroscopic) and put in a 60 C oven overnight. TLC has very little
origin material. Yield 15.4 gm. The Mother Liquor was evaporated
under vacuum to a yellow gum. No attempt was made to further purify
this material at this time.
Example 2
Synthesis of Azidoethylmannose (AzEM)
[0391] a. Synthesis of Bromoethylmannose
[0392] DOWEX 50W.times.4 resin (Alfa Aesar, Ward Hill, Mass.) is
washed with deionized water to remove color. A mixture of 225 gm
D-mannose (1.25 mol; 1 equiv., Alfa Aesar) and 140 gm DOWEX
50W.times.4 is treated with 2.2 L 2-bromoethanol (30.5 mol, 25
equiv.; 124.97 gm/mol; 1.762 gm/mL; BP=150 C; Alfa Aesar) and the
stirred mixture heated to 80 C for 4 hours. The reaction is
monitored by TLC (20% methanol/dichloromethane (DCM)). Reaction is
complete after about four hours, and then allowed to cool to room
temperature. The solution is filtered to remove the resin, and the
resin washed with ethyl acetate and DCM. The resulting filtrate is
stripped to an amber oil in a rotory evaporator.
[0393] The amber oil is purified on silica gel (4 kg silica packed
in DCM) in the following manner. The crude is dissolved in DCM and
loaded onto the column, and then eluted with 2.times.4 L 10%
methanol/DCM; 2.times.4 L 15% methanol/DCM; and 3.times.4 L 20%
methanol/DCM. Product containing fractions (on the basis of TLC)
are pooled and stripped to dryness to afford 152 gm of
1-.alpha.-bromoethyl-mannose (42%).
[0394] b. Conversion of Bromoethylmannose to Azidoethylmannose
(AzEM)
[0395] A 5 L round bottom three-necked flask, equipped with a
heating mantle, an overhead stirrer, and a thermometer, is charged
with 150 gm bromoethylmannose (525 mmol). The oil is dissolved in 2
L water and treated with 68.3 gm sodium azide (1.05 mol, 2 equiv.;
65 gm/mol; Alfa-Aesar) followed by 7.9 gm sodium iodide (52.5 mmol,
0.08 equiv.; 149.89 gm/mol; Alfa-Aesar) and the solution warmed to
50 C and stirred overnight. The solution is cooled to room
temperature and concentrated to dryness on the rotovap. The solid
residue is digested with 3.times.500 mL of 5:1 vol. CHCl.sub.3:MeOH
at 40 C. The combined organic portions are filtered and evaporated
to dryness to afford azidoethylmannose as an off-white solid.
[0396] c. Repurification of Azidoethylmannose
[0397] 32 gm of azidoethylmannose is taken into 100 mL water. The
turbid solution is filtered through a glass microfibre filter
(Whatman GF/B). The filtrate is evaporated to a solid on a
rotovapor. The solid is taken into Methanol (100 mL) and the turbid
solution is again filtered through a glass microfibre filter. The
resulting pale yellow filtrate is stripped to a solid under
vacuum.
[0398] The solid is taken into a minimum of methanol (50 mL) and
ethyl acetate (150 mL) is added slowly with stirring. The heavy
slurry is cooled and filtered. The solid is air dried (hygroscopic)
and put in a 60 C oven overnight. The Mother Liquor is evaporated
under vacuum to a yellow gum.
Example 3
Synthesis of Azidoethylmannobiose (AzEBM)
[0399] The AzEM compound from Example 2 is selectively protected
using benzene dimethyl ether, purified by column chromatography and
subsequently reacted with benzyl bromide to give
1-.alpha.-(2-azidoethyl)-4,6-benzaldehyde
diacetal-3-benzyl-mannopyranoside. The product is subsequently
glycosylated with
1-.alpha.-bromo-2,3,4,6-tetrabenzoylmannopyranoside using silver
triflate chemistry under rigorously anhydrous conditions to give
the protected-azidoethylmannobiose product. The intermediate
product is then deprotected to remove the benzoyl groups to give
AzEBM.
Example 4
Synthesis of Azidoethylmannotriose (AzETM)
a. 1-.alpha.-bromo-2,3,4,6-tetrabenzoyl-mannose
[0400] To a 500 mL 3-neck flask containing a stir bar and nitrogen
inlet was added 40 gm (60.9 mmole) of pentabenzoylmannose and 80 mL
methylene chloride. The resulting solution was cooled in an ice
bath to <5 C, and 80 mL 33% HBr-acetic acid solution was added
via an addition funnel at such a rate to maintain the reaction
temperature <10 C. Upon complete addition (.about.30 min.) the
ice bath was removed and stirring was continued for 3 hours.
[0401] The reaction solution was diluted with an equal volume (160
mL) of DCM and extracted successively with water (2.times.500 mL),
saturated bicarbonate (2.times.50 mL) and Brine (1.times.50 mL),
dried over magnesium sulfate and the solvent evaporated to give 41
gm of solid foam. (Theoretical yield 40.1 gm) and was stored under
N.sub.2 in a freezer. This material was used without further
purification. The reaction was monitored by TLC: silica gel
(Hexane/Ethyl Acetate, 7/3) starting material R.sub.f 0.65, product
R.sub.f 0.8 UV visualization. .sup.1H NMR (CDCl.sub.3) .delta. 8.11
(d, 2H), 8.01 (m, 4H), 7.84 (d, 2H), 7.58 (m, 4H), 7.41 (m, 6H),
7.28 (t, 2H), 6.58 (s, 1H), 6.28 (m, 2H), 5.8 (m, 1H), 4.75 (dd,
1H) 4.68 (dd, 1H) 4.5 (dd, 1H).
b. 1-Azidoethyl-2,4-dibenzoylinannose
[0402] To a 1.0 L, 3-neck flask containing a stir bar, nitrogen
inlet and 300 mL of anhydrous acetonitrile was added 25 gm
1-azidoethylmannose (100.4 mmole), and 50 mL triethyl orthobenzoate
(220 mmole, 2.2 equiv.). The resulting slurry was stirred at room
temperature and 0.8 mL (10 mmole) trifluoroacetic acid (TFA) was
added neat. The solution cleared within 10 minutes and stirring was
continued for an additional two hours, then 25 mL of 10% aqueous
TFA was added and stirring was continued for an additional 2 hours
to hydrolyze the intermediate to the ester isomers. The solvent was
evaporated under vacuum to a viscous oil, which was triturated with
50 mL DCM and again evaporated to a viscous oil.
[0403] Toluene (70 mL) was added to the residue and the viscous
solution was seeded with 2,4-dibenzoylazidoethylmannose. A fine
precipitate formed within 15 minutes and stirring was continued
overnight at room temperature. The resulting heavy suspension was
set in the freezer for 2-4 hours, then filtered and the solid
washed with ice cold toluene (2.times.10 mL). The solid was air
dried to a constant weight to give 21 gm (TY 22.85 gm @ 50%
isomeric purity) of .about.95% isomeric purity. The product was
taken into 40 mL toluene, stirred for 1 hour and then set in the
freezer for an additional 2 hours. The solid was filtered and
washed (2.times.10 mL) with ice cold toluene and air dried to a
constant weight to give 18.5 gm of the single isomer product
2,4-dibenzoylazidoethylmannose in 83% yield. The mother liquors
contained the undesired isomer and a small amount of the desired
isomer. The reaction was monitored by TLC: SG (Hexane/Ethyl Acetate
7/3) Starting Material R.sub.f 0.0, orthoester intermediate R.sub.f
0.9. (Hexane/Ethyl Acetate: 8/2) SM R.sub.f 0.8, desired isomer
R.sub.f 0.4, un-desired isomer R.sub.f 0.2. .sup.1H NMR 300 MHz
(CDCl.sub.3) .delta. 8.12 (t, 4H), 7.66 (t, 2H), 7.5 (m, 4H), 5.56
(t, 1H), 5.48 (m, 1H), 5.14 (m, 1H), 4.5 (dd, 1H), 4.0 (m, 2H), 3.8
(m, 3H), 3.56 (m, 1H), 3.44 (m, 1H).
c.
Perbenzoylated-man(.alpha.-1,3)-man(.alpha.-1.6)-.alpha.-1-azidoethylin-
annopyranoside
[0404] To a 1.0 L 3-neck flask with a stir bar, nitrogen inlet was
added 41 gm crude 1-bromo-tetrabenzoymannose (60.9 mmole,
.about.2.5 equiv.) in 185 mL DCM. To this was added 11.2 gm
2,4-dibenzoylazidoethylmannose (24.5 mmole) followed by 11.2 gm 4 A
sieves. The slurry was stirred a room temperature for 10 minutes
and cooled to -15.degree. C. in a methanol/ice bath.
In a separate dark vessel was added 190 mL toluene followed by 15.1
gm silver-triflluoromethanesulfonate (AgOTf) (58.8 mmole, 2.4
equiv.) and was stirred into solution in the dark. This solution
was transferred to a large addition funnel, and added drop-wise to
the stirring suspension while protecting the reaction from light.
The reaction temperature was maintained <-10 C by adjusting the
AgOTf addition rate. Upon complete addition (.about.30 minutes) the
cold bath was removed and the reaction stirred for an additional 2
hours until a single product remained by TLC (SG, Hexane/Ethyl
Acetate: 7/3, Bromo R.sub.f 0.9, azido R.sub.f 0.4, trios product
R.sub.f 0.5, uv visualization).
[0405] Triethylamine (7 mL, 5.0 equiv.) was added followed by 200
mL DCM. The resulting slurry was filtered through a pad of silica
gel and celite and washed with 2.times.75 mL DCM. The solvent was
evaporated under vacuum and the residue taken into ethyl acetate
and washed sequentially with water (2.times.100 mL), bicarb
(2.times.50 mL), brine (1.times.75 mL) and dried over magnesium
sulfate. The solvent was evaporated under vacuum to give 39 gm of
solid foam (TY 39.5 gm). .sup.1H NMR 300 MHz (CDCl.sub.3) .delta.
8.3 (d, 2H), 8.2 (m, 8H), 7.85 (d, 4H), 7.75 (dd, 4H), 7.3-7.65 (m,
30H), 7.2 (t, 2H), 6.05 (m, 4H), 5.9 (t, 2H), 5.63 (m, 2H), 5.38
(s, 2H), 5.18 (d, 1H), 4.65 (m, 4H), 4.5 (m, 2H), 4.35 (m, 4H), 3.8
(m, 2H), 3.54 (m, 2H).
d.
Man(.alpha.-1,3)-man(.alpha.-1.6)-.alpha.-1-azidoethylmannopyranoside
[0406] To a stirring suspension of 3.0 gm perbenzoylated-man
(.alpha.-1,3)-man(.alpha.-1.6)-.alpha.-1-azidoethylmannopyranoside
(1.86 mmole) in 40 mL methanol was added 0.2 mL 4.28M sodium
methoxide in methanol. The resulting suspension was stirred 20
hours at room temperature giving a clear solution. The completion
of the reaction was monitored by TLC, (SG, hexane/ethyl acetate:
8/2 SM R.sub.f 0.4, product R.sub.f 0.0).
[0407] The methanol was evaporated under vacuum giving an oily
semi-solid. The residue was taken into ethyl acetate (50 mL) and
stirred for 3 hours. The solid was filtered, washed with fresh
ethyl acetate (2.times.20 mL) and air dried to a constant weight to
give 1.09 gm (TY 1.07 gm) of product. The mother liquors contained
residual methyl benzoate, the de-protection by-product.
Example 5
Synthesis of Aminoethyl-Sugars (AEG, AEM, AEBM, AETM) from
Azidoethyl-Sugars (AzEG, AzEM, AzEBM, AzETM)
[0408] The azido-terminated compounds from Examples 1-4 are readily
hydrogenated at room temperature by using palladium/carbon
catalyst, a small amount of acetic acid, and ethanol as a solvent
to give the corresponding amine-terminated compounds. FIG. 10 shows
the chemical structures of AEG, AEM, AEBM, AETM. The process is
identical to the one described for AETM below, except that those
skilled in the art will understand that the amounts of reagents,
solvents, etc. should be scaled to the number of moles of
sugar-ligand to be hydrogenated.
a. Man
(.alpha.-1,3)-Man(.alpha.-1.6)-.alpha.-1-aminoethylmannopyranoside
("aminoethyltritnannose", AETM)
[0409] To a solution of 5.3 gm (9.25 mmole)
man(.alpha.-1,3)-man(.alpha.-1.6)-.alpha.-1-azidoethylmannopyranoside
in 100 mL water and 50 mL ethanol was added 0.8 gm 5% Pd/C. The
vigorously stirring suspension was hydrogenated at 30-40 psi for 48
hours or until no starting material was apparent by TLC(SG,
Methanol, SM R.sub.f 0.75, Pdt R.sub.f 0.0, PMA vis.). The
suspension was filtered over celite, which was rinsed with ethanol
(2.times.50 mL) and the filtrate concentrated under vacuum.
[0410] HPLC of this material (C18, 3% Acetonitrile/97% 0.1%
H.sub.3P0.sub.4, 220 nm, 2 ml/min) gave uv adsorption of the
injection column void material, Rt 2.5 minutes, indicative of
benzoate ester.
[0411] The filtrate was diluted with 70 mL water and 12 mL of 1N
NaOH and the solution stirred overnight at room temperature (HPLC:
no uv material at column void Rt 2.5 min., uv material at Rt 10.5
minutes co-eluting with benzoic acid). 2 gm of decolorizing
charcoal were added and the stirring suspension heated to 80 C,
cooled to room temperature and filtered over celite. The filtrate
pH was adjusted to 8.0 with 2N HCl and the colorless solution
concentrated under vacuum to about 50% volume.
[0412] The solution was loaded onto a resin column (Dowex 50W, 50
gm) and washed with water until eluting fractions were neutral to
pH (6.times.75 mL) removing any residual acid by-products. The
amine product was washed off the column with 0.25N ammonium
hydroxide (6.times.75 mL) and the fractions containing the amine
product-ninhydrin detection were combined and concentrated to 25-30
mL under vacuum. This concentrated solution was added drop-wise to
300 mL stirring ethanol and stirring continued for an additional 2
hours. The product was filtered, washed with fresh ethanol
(2.times.50 mL) and air dried to a constant weight. The resulting
white amorphous solid was dried further in a vacuum oven at 80 C
for 5 hours to give 4.1 gm of a white granular solid (TY 5.1 gm).
The NMR was clean of any aromatic protons. .sup.1H NMR 300 MHz
(D.sub.2O) .delta. 5.08 (s, 1H), 4.87 (s, 1H), 4.81 (s, 1H),
4.8-3.6 (m, 18H), 2.9 (m, 2H).
Example 6
Dipropargyl Sugar Synthesis and Production of AE-Ligand
a. Synthesis of Diethyl Diproparglymalonate
[0413] Diethylmalonate (122.5 g, 0.7648 mol) was added to absolute
ethanol (800 ml) containing sodium ethoxide (prepared from sodium
metal, 38.5 g, 1.67 mol). After 30 min, propargyl bromide (200 g,
1.68 mol) was slowly added to the stirred suspension, keeping the
temperature under 60 C. The mixture was refluxed overnight (15
hours). The precipitated salts were removed by filtration and
washed with ethanol. Solvent was removed in vacuo, and the residue
diluted with water and extracted with ethanol (2.times.200 ml). The
combined extracts were dried over MgSO.sub.4, filtered, washed with
Et20 and the solvent removed in vacuo to afford a golden colored
oil. The oil was placed on high vacuum (40 C) for 3 hours and
allowed to stand. Solids began to crystallize forming an oily
solid. Let stand overnight (16 hours). Cyclohexane was charged to
flask, solids broken-up, filtered, and washed with cyclohexane to
afford white crystalline product (81 gm, 44.8% yield). Reaction was
followed by GC.
b. Synthesis of Dipropargylmalonic Acid
[0414] Diethyl dipropargyl malonate (80 gm, 0.339 mol) was refluxed
in 600 ml of 10% alcoholic potassium hydroxide overnight (15
hours). Solvent was removed in vacuo and the residue was acidified
with 3N HCl. The residue was extracted with Et20 (2.times.300 ml).
The combined extracts were dried over MgSO.sub.4, filtered, washed
with Et20 and concentrated in vacuo to an oil. Placed on high vac
(40 C) for 2 hours and let stand to afford dipropargylmalonic acid
as an oil (46 gm, 75.4% yield). Reaction was followed by GC.
c. Synthesis of Dipropargylacetic Acid
[0415] The dipropargylmalonic acid (26 gm, 0.443 mol) was heated
neat at 135 C until CO.sub.2 stopped evolving. It was then allowed
to cool to an oil. The oil was distilled at 0.5 psi. The remaining
oily residue in the distillation flask and solid were combined
(15.7 gm, 79.9% yield) and was used as is in the next step.
d. Synthesis of [2-(3-prop-2-ynyl-hex-5-ynoylamino)-ethyl]-carbamic
acid t-butyl ester
[0416] N-boc-ethylenediamine (18.3 gm, 0.1143 mol) in 50 ml of
CH.sub.3CN was added slowly via an addition funnel to a stirred
solution containing dipropargylacetic acid (15.56 gm, 0.1143 mol),
TBTU (36.74 gm, 0.114 mol) and DIPEA (29.6 gm, 0.229 mol) in 300 ml
of CH.sub.3CN at 0 C. Precipitation occurred. The ice bath was
removed and the product was stirred at ambient temperature
overnight (16 hours). The reaction was now totally homogeneous. The
solution was concentrated in vacuo and the residue was diluted with
800 ml of water. The resulting solids were filtered, washed
copiously with water, and vacuum dried to give 14.3 gm of crude
product. Re-crystallization (2.times.) from DCM, filtration and
washing with hexanes affords the product (9.85 gm, 31% yield, 98%
purity by HPLC (214 nm)).
e. Click reaction of azidosugar to
[2-(3-prop-2-ynyl-hex-5-ynoylamino)-ethyl]-carbamic acid t-butyl
ester
[0417] To 1,1 dipropargyl-acetyl-(-1N,2N-BOC-1,2-diaminoethyl)amide
(DP, 418 mg, 1.5 mmole) in DCM (20 mL) was added drop-wise TFA (4
mL) over 5 minutes at 0 C. The darkening solution was stirred at
room temperature overnight. The volatiles were evaporated under
reduced pressure. Toluene (20 mL) was added to the residue and
stripped under reduced pressure two times. The resulting dark oil
was used without further purification.
[0418] To this residue was added THF (20 mL) and water (20 mL) with
stirring for 15 minutes. Copper Sulfate (225 mg, 0.9 mmole) was
added followed by sodium ascorbate (180 mg, 0.9 mmole). The
resulting mixture was heated to 55-60 C for 6 hours and then
stirred at room temperature for 18 hours. The solution was
evaporated under reduced pressure to approx. half volume and
filtered through a microfibre glass filter. The resulting clear
solution was placed on a resin column (Dowex 50X-2) which was
washed with water (6.times.75 mL) until neutral pH, and then washed
with 10% NH.sub.4OH (8.times.75 mL). The fractions staining
positive with Ninhydrin were combined and evaporated under reduced
pressure to a glassy solid. The glass residue was taken into water
(250 mL) and treated with 0.5 gm charcoal and heated to reflux. The
cooled slurry was filtered over celite and a microfibre filter. The
resulting pale yellow solution was evaporated to a glassy solid
under reduced pressure and methanol was added and evaporated
(2.times.) to give a off white foam (0.9 gm, TY 1.0 gm).
Example 7
Tripropargyl Sugar Synthesis and Production of AE-Ligand
a.
2-(2-BOC-aminoethyl)thioacetamide-tris[(propargyloxy)methyl]aminomethan-
e
[0419] To a solution of t-butyl N-(2-mercaptoethyl)carbamate
(Frontrun Organix, Ipswich, MA; 177.26 mg, 1 mmole) in ethanol (5
mL) was added NaOH (1.1 mmole) with stirring at room temperature.
To this solution was added
2-bromoacetamide-tris[(propargyloxy)methyl]aminomethane (356 mg,
1.0 mmole, see J. Org. Chem. 73, 5602, 2008) and stirring was
continued for 20 hours (TLC SG 8/2 hexane/ethyl acetate, pdt
R.sub.f 0.4). The solvent was evaporated under vacuum and the
residue was taken into ethyl acetate (40 mL) and washed
successively with water (25 mL), 0.5 N NaOH (25 mL) and Brine (25
mL), dried over Na.sub.2SO.sub.4 filtered and concentrated to an
oil (360 mg, TY 452.3 mg). NMR CDCl.sub.3, (ppm): 7.05 (s, 1H,
N--H); 5.25 ((s, 1H, N--H); 4.85 (s, 6H); 3.85 (s, 6H); 3.3 (m,
2H); 3.15 (s, 2H); 2.7 (m, 2H); 2.42 (s, 3H); 1.22 (s, 9H).
b. 2-(2-aminoethyl)thioacetamide-tris[(triazolo-1-(2-ethylinannose)
4-methoxy)methyl]aminomethane
[0420] To a stirring solution of
2-(2-BOC-aminoethyl)thioacetamide-tris[(propargyloxy)methyl]aminomethane
(1 gm, 2.21 mmole) in DCM (40 mL) at room temperature was added TFA
(4 mL) dropwise. The resulting solution was stirred overnight. The
solvents were removed under vacuum and the residue taken into
toluene (15 mL) and evaporated to dryness.
[0421] The residue was taken into THF (40 mL), water (40 mL) and
stirred into solution. Azidoethylmannose (3.75 eq., 2.0 gm, 8.3
mmole) was added followed by copper sulfate (500 mg, 2.0 mmole) and
sodium ascorbate (400 mg, 2.0 mmole) and the resultant mixture
stirred at 55-60 C (oil bath) for 6 hours, cooled to room
temperature and stirred overnight. The resulting mixture was
concentrated under vacuum to one half volume and filtered thru a
micro-glass filter. The filtrate was loaded on a resin column
(Dowex 50w 50.times.4-100) and eluted with water (6.times.75 mL)
until neutral. The column was then eluted with 15% Ammonium
Hydroxide (10.times.75 mL) and the fractions positive to ninhydrin
were pooled and concentrated to a glassy foam (1.29 gm, TY (MW 1099
g/mol), 53% over two steps).
Example 8
Synthesis of NH.sub.2--B1-BOC2(A1,B29)-Insulin
[0422] In a typical synthesis, 4 g of powdered insulin (Sigma
Aldrich, St. Louis, Mo.) is dissolved in 100 ml of anhydrous DMSO
at room temperature followed by the addition of 4 ml of
triethylamine (TEA). The solution is stirred for 30 minutes at room
temperature. Next, 1.79 ml (2.6 equivalents) of
di-tert-butyl-dicarbonate/THF solution (Sigma Aldrich, St. Louis,
Mo.) is slowly added to the insulin-TEA solution and mixed for
approximately one hour. The reaction is quenched via the addition
of 4 ml of a stock solution containing 250 ul of ethanolamine in 5
ml of DMSO followed by mixing for five minutes. After quenching,
the entire solution is poured into 1600 ml of acetone and mixed
briefly with a spatula. Next, 8.times.400 .mu.l aliquots of a 18.9%
HCl:water solution are added dropwise over the surface of the
mixture to precipitate the reacted insulin. The precipitated
material is then centrifuged and the supernatant decanted into a
second beaker while the precipitate cake is set aside. To the
supernatant solution, another 8.times.400 .mu.A aliquots of a 18.9%
HCl:water solution are added dropwise over the surface of the
mixture to obtain a second precipitate of reacted insulin. This
second precipitate is centrifuged and the supernatant is discarded.
The combined centrifuge cakes from the two precipitation steps are
washed once with acetone followed by drying under vacuum at room
temperature to yield the crude powder which typically contains 60%
of the desired BOC2 product and 40% of the BOC3 material.
[0423] A preparative reverse phase HPLC method is used to isolate
the pure BOC2-insulin from the crude powder. Buffer A is deionized
water containing 0.1% TFA and Buffer B is acetonitrile containing
0.1% TFA. The crude powder is dissolved at 25 mg/ml in a 70% A/30%
B mixture and syringe filtered prior to injection on the column.
Before purification, the column (Waters SymmetryPrep C18, 7 um,
19.times.150 mm) is equilibrated at 15 ml/minutes with a 70% A/30%
B mobile phase using a Waters DeltraPrep 600 system. Approximately
5 ml of the crude powder solution is injected onto the column at a
flow rate of 15 ml/minutes over the course of 5 minutes after which
a linear gradient is employed from 70% A/30% B to 62% A/38% B over
the course of the next 3.5 minutes and held there for an additional
2.5 minutes. Using this method, the desired BOC2 peak elutes at
approximately 10.6 minutes followed closely by the BOC3 peak. Once
collected, the solution is rotovapped to remove acetonitrile and
lyophilized to obtain pure BOC2-insulin powder. Identity is
verified by LC-MS (HT Laboratories, San Diego, Calif.) and site of
conjugation determined by N-terminal sequencing (Western
Analytical, St. Louis, Mo.).
Example 9
Synthesis of benzene-1,3,5-tricarboxy-(N-.omega.-aminoacid-NHS
ester) amide frameworks
[0424] A solution of 1,3,5-benzenetricarbonyl chloride (1 gm, 3.8
mmole) in dichloromethane (DCM) (5 mL) is added drop-wise to a
vigorously stirring solution of an .omega.-aminoacid (3.1
equivalents) in 1N NaOH (25 mL) in an ice bath. The ice bath is
removed and stirring is continued for 4 hours at room temperature.
2N HCl (.about.15 mL) is added dropwise to approximately pH 2 and
the resulting slurry is stirred for an additional 2 hours. The
precipitate is filtered, washed with cold water (2.times.20 mL) and
dried in air under vacuum and then in a 60 C oven overnight. The
resulting white solid is used without further purification. Yield
for each .omega.-aminoacid (4-aminobutyric acid: yield 1.6 gm, 91%;
6-aminocaproic acid: yield 1.9 gm, 92%)
[0425] The above material is taken into DMSO (5 mL) containing
N-hydroxysuccinimide (3.1 mmole, 3.1 equiv.) and
N-(3-dimethylaminopropyl)-N'-ethylcarbodiimide (EDCI, 3.6 mmole,
3.6 equiv.) is added at room temperature. The resulting solution is
stirred for 24 hours, diluted with water (125 mL) and extracted
with ethyl acetate (3.times.50 mL). The combined organic phase is
washed with water (2.times.50 mL), brine (1.times.50 mL) and dried
over MgSO.sub.4. The solvent is evaporated and the semi-solid
residue triturated with acetonitrile (10 mL). The solid is filtered
and washed with cold solvent, dried in air under vacuum and then in
a 60 C oven overnight. The product is free of urea bi-product.
Benzene-1,3,5-tricarboxy-(N-6-aminocaproic-NHS ester)amide
(TSB-C6): 304 mg, 36%, mp 140-142 C.
Benzene-1,3,5-tricarboxy-(N-4-butyric-NHS-ester)amide (TSB-C4): 245
mg, 45%, mp 182-184 C.
Example 10
Dendritic Framework Synthesis
[0426] a. Hydrogenation of Nitro-Group Containing,
Alkyne-Terminally Functionalized Dendrons
[0427] Dendrons containing either n=2, 4, or 8 terminal alkynes and
a nitropropionic acid core are obtained (e.g., from Polymer
Factory, Sweden) and used without further purification. The dendron
is dissolved in 100 mL a 50:50 vol. mixture of DCM and ethanol, and
0.8 gm of 5% Pd/C is added. The vigorously stirring suspension is
hydrogenated at 30-40 psi for 48 hours or until no starting
material is apparent by TLC. The suspension is filtered over
celite, which is rinsed with ethanol (2.times.50 mL) and the
filtrate concentrated under vacuum.
[0428] The filtrate is diluted with 70 mL water and 12 mL of 1N
NaOH and the solution stirred overnight at room temperature. 2 gm
of decolorizing charcoal are added and the stirring suspension
heated to 80 C, cooled to room temperature and filtered over
celite. The filtrate pH is adjusted to 8.0 with 2N HCl and the
colorless solution concentrated under vacuum to about 50%
volume.
[0429] The solution is loaded onto a resin column (Dowex 50W, 50
gm) and washed with water until eluting fractions are neutral to pH
(6.times.75 mL) removing any residual acid by-products. The amine
product is washed off the column with 0.25N ammonium hydroxide
(6.times.75 mL) and the fractions containing the amine product
(ninhydrin detection) are combined and evaporated to vacuum using a
rotary evaporator.
[0430] b. Reaction of Dendron (Amine, Alkyne-4) with Azidoethyl
Mannose
[0431] The dendron product containing the amino core and four
terminal alkyne groups obtained after hydrogenation (8.3 mmol) is
taken into THF (40 mL), water (40 mL) and stirred into solution.
Azidoethylmannose (4.75 eq., 2.53 gm, 10.51 mmole) is added
followed by copper sulfate (500 mg, 2.0 mmole) and sodium ascorbate
(400 mg, 2.0 mmole) and the resultant mixture stirred at 55-60 C
(oil bath) for 6 hours, cooled to room temperature and stirred
overnight. The resulting mixture is concentrated under vacuum to
one half volume and filtered thru a micro-glass filter. The
filtrate is loaded on a resin column (Dowex 50w 50.times.4-100) and
eluted with water (6.times.75 mL) until neutral. The column is then
eluted with 15% ammonium hydroxide (10.times.75 mL) and the
fractions positive to ninhydrin are pooled and concentrated to a
glassy foam.
Example 11
Amine-Functionalized Drug Conjugation with Multivalent Activated
Esters in Organic Solvent (Drug Added First)
[0432] A framework containing N-terminal activated esters is
dissolved at 60 mM in 1.0 ml of anhydrous DMSO followed by the
addition of 400 ul (excess) of triethylamine (TEA). The solution is
stirred rapidly for 10 minutes at room temperature. The
amine-bearing drug is then dissolved separately in 7.9 ml of DMSO
at a concentration of 7.4 mM. Once dissolved, the entire drug
solution is added dropwise over the course of 10 minutes to the
framework/DMSO/TEA solution followed by room temperature mixing for
two hours. The remaining activated esters are then reacted with
amine-functionalized affinity ligands in the following manner. A
370 mM solution of affinity ligand is prepared in an appropriate
volume of dry DMSO. Once dissolved, enough solution is added to
provide a number of reactive equivalents equal to three times the
number of initial activated ester groups, N, minus one. For
example, if there are N=3 initial activated ester groups per
framework, then (3.times.(3-1).times.60 mM/370 mM)=0.973 ml of
affinity ligand solution are added. If there are N=4 initial
activated ester groups per framework, then (3.times.(4-1).times.60
mM/370 mM)=1.46 ml of affinity ligand solution are added, and so
on. After the affinity ligand solution is added, the solution is
stirred for one more hour at room temperature to ensure complete
reaction.
[0433] The resulting solution is then superdiluted by 10.times.
into a 20 mM pH 5.0 HEPES buffered saline solution containing 0.150
M NaCl followed by pH adjustment with dilute HCl to a final pH of
8.0. The aqueous solution is first purified by size exclusion using
an appropriate solid phase for the desired separation of conjugated
and unconjugated materials. The solution passing through the column
void volume is then concentrated using an appropriately sized
ultrafiltration membrane to approximately 10 ml. This solution is
further purified to obtain the desired product using preparative
reverse phase HPLC on a Waters C8, 7 um, 19.times.150 mm column.
Buffer A is deionized water containing 0.1% TFA and Buffer B is
acetonitrile containing 0.1% TFA. Before purification, the column
is equilibrated at 15 ml/minutes with a 80% A/20% B mobile phase
using a Waters DeltraPrep 600 system. Approximately 5 ml of the
crude solution is injected onto the column over the course of 2
minutes at a flow rate of 15 ml/minutes after which a linear
gradient is employed from 80% A/20% B to 75% A/25% B over the next
5 minutes followed by a slower linear gradient from 75% A/25% B to
62% A/38% B over the next 22 minutes. The retention time of the
desired peak will vary depending on the drug, framework, and
affinity ligand used. Once collected, the solution is rotovapped to
remove acetonitrile and lyophilized to obtain pure conjugate whose
identity may be verified by LC-MS (HT Laboratories, San Diego,
Calif.).
Example 12
B1-Insulin Conjugates with Multivalent Sugars-Homogeneous
Ligand
[0434] Using the method described in Example 11 and the
amine-bearing drug, NH.sub.2--B1-BOC2(A1,B29)-insulin (MW=6,008
g/mol) of Example 8, drug conjugates were prepared with the
following frameworks and affinity ligands.
Tris-Succinimidyl-1,3,5-benzenetricarboxylate (TSB),
tris-Succinimidyl aminotriacetate (TSAT), tris-Succinimidyl
(6-aminocaproyl)aminotriacetate (TSAT-C6), and
tetrakis-(N-succinimidyl carboxypropyl)pentaerythritol TSPE
activated ester frameworks were purchased from Molecular
Biosciences (Boulder, Colo.) and used without further purification.
The TSB-C4 and TSB-C6 frameworks were synthesized according to
Example 9. The AEM, AEBM, and AETM affinity ligands were
synthesized according to Examples 1-4. The appropriately sized size
exclusion medium is Biogel P2 (Bio-Rad Laboratories, Hercules,
Calif.), and the appropriately sized ultrafiltration membrane
molecular weight cutoff is 3 kD.
[0435] In all cases, the BOC protecting groups were removed by
dissolving the lyophilized powder obtained according to Example 11
in 90% TFA/10% anisole for one hour at 4 C followed by 10.times.
superdilution in 25 mM HEPES pH 8.2 buffer containing 0.150M NaCl.
The pH was adjusted to between 7.0 and 8.0 using NaOH solution
after which the material is passed through a Biogel P2 column to
remove anisole, BOC and other low MW byproducts of deprotection, as
well as any other contaminating salts. The deprotected, purified
aqueous conjugate solution was then concentrated using Amicon 3K
membranes (Millipore, Billerica, Mass.) to approximately 58 U of
insulin/ml (based on A280 measurements) and stored at 4 C until
needed. Because the starting NH.sub.2--B1-BOC2(A1,B29)-insulin
material only possesses one free amine group at the Phe-B1
terminus, the Phe-B1 is the only site of insulin conjugation to the
framework as verified in each deprotected final product by
N-terminal sequencing.
TABLE-US-00004 Synthesis Conditions Product Characterization
Framework Affinity AE-sugar Purity MW Sugar/ Framework MW ligand MW
(HPLC) (LC-MS) Insulin TSB 501 AEM 223 97% 6410 2.0 TSB 501 AEBM
385 94% 6734 2.0 TSB 501 AETM 547 96% 7057 2.0 TSB-C4 755 AEM 223
95% 6665 2.0 TSB-C4 755 AEBM 385 97% 6989 2.0 TSB-C4 755 AETM 547
95% 7313 2.0 TSB-C6 882 AEM 223 99% 6791 2.0 TSB-C6 882 AEBM 385
99% 7114 2.0 TSB-C6 882 AETM 547 95% 7438 2.0 TSAT 482 AEM 223 98%
6390 2.0 TSAT 482 AEBM 385 95% 6714 2.0 TSAT 482 AETM 547 94% 7038
2.0 TSAT-C6 822 AEM 223 97% 6730 2.0 TSAT-C6 822 AEBM 385 99% 7054
2.0 TSAT-C6 822 AETM 547 97% 7378 2.0 TSPE 813 AEM 223 98% 6829 3.0
TSPE 813 AEBM 385 97% 7314 3.0 TSPE 813 AETM 547 94% 7802 3.0
Example 13
B1-Insulin Conjugates with Multivalent Sugars-Mixed Ligands
[0436] Using the method described in Example 11 and the
amine-bearing drug, NH.sub.2--B1-BOC2(A1,B29)-Insulin (MW=6,008
g/mol) of Example 8, insulin conjugates were prepared which
possessed a mixture of sugar affinity ligands connected to the
framework. The TSAT-C6 and TSPE activated ester frameworks were
purchased from Molecular Biosciences (Boulder, Colo.) and used
without further purification. The AEM, AEBM, and AETM were
synthesized according to Examples 1-4. The appropriately sized size
exclusion medium is Biogel P2 (Bio-Rad Laboratories, Hercules,
Calif.), and the appropriately sized ultrafiltration membrane
molecular weight cutoff is 3 kD.
[0437] In all cases, the BOC protecting groups were removed by
dissolving the lyophilized powder obtained according to Example 11
in 90% TFA/10% anisole for one hour at 4 C followed by 10.times.
superdilution in 25 mM HEPES pH 8.2 buffer containing 0.150M NaCl.
The pH was adjusted to between 7.0 and 8.0 using NaOH solution
after which the material was passed through a Biogel P2 column to
remove anisole, BOC and other low MW byproducts of deprotection, as
well as any other contaminating salts. The deprotected, purified
aqueous conjugate solution was then concentrated using Amicon 3K
membranes (Millipore, Billerica, Mass.) to the desired level and
stored at 4 C until needed. Because the starting
NH.sub.2--B1-BOC2(A1,B29)-insulin material only possesses one free
amine group at the Phe-B1 terminus, the Phe-B1 is the only site of
insulin conjugation to the framework as verified in each
deprotected final product by N-terminal sequencing.
TABLE-US-00005 Framework Purity MW Framework MW Mixed Affinity
ligand AE-sugar MW (HPLC) (LC-MS) Sugar/Insulin TSPE 813 AEM/AETM
223/547 94% 7478 1.0 AEM, (33/67 mol/mol) 2.0 AETM TSPE 813
AEM/AETM 223/547 94% 7152 2.0 AEM, (67/33 mol/mol) 1.0 AETM TSAT-C6
822 AEM/AEBM 223/385 96% 6892 1.0 AEM, (50/50 mol/mol) 1.0 AEBM
TSAT-C6 822 AEBM/AETM 385/547 95% 7216 1.0 AEBM, (50/50 mol/mol)
1.0 AETM
Example 14
B1-Insulin Conjugates with Multivalent Sugars Using Premade
Multivalent Sugars
[0438] Using the method described in Example 11 and the
amine-bearing drug, NH.sub.2--B1-BOC2(A1,B29)-insulin (MW=6,008
g/mol) of Example 8, the following insulin conjugates are prepared
from pre-synthesized multivalent amine-containing affinity ligands.
The disuccinimidyl suberate (DSS) and TSAT-C6 activated ester
frameworks are purchased from Molecular Biosciences (Boulder,
Colo.) and used without further purification. Divalent AEM-2,
AEBM-2, and AETM-2 molecules containing a terminal reactive amine
are prepared by conjugating two of each affinity ligand to a
suitable framework to which a reactive amine is also conjugated.
Trivalent AEM-3, AEBM-3, and AETM-3 molecules containing a terminal
reactive amine are prepared by conjugating three of each affinity
ligand to a suitable framework to which a reactive amine is also
conjugated. The appropriately sized size exclusion medium is Biogel
P2 (Bio-Rad Laboratories, Hercules, Calif.), and the appropriately
sized ultrafiltration membrane molecular weight cutoff is 3 kD.
[0439] In all cases, the BOC protecting groups are removed by
dissolving the lyophilized powder obtained according to Example 11
in 90% TFA/10% anisole for one hour at 4 C followed by 10.times.
superdilution in 25 mM HEPES pH 8.2 buffer containing 0.150M NaCl.
The pH is adjusted to between 7.0 and 8.0 using NaOH solution after
which the material is passed through a Biogel P2 column to remove
anisole, BOC and other low MW byproducts of deprotection, as well
as any other contaminating salts. The deprotected, purified aqueous
conjugate solution is then concentrated using Amicon 3K membranes
(Millipore, Billerica, Mass.) to the desired level and stored at 4
C until needed. Because the starting
NH.sub.2--B1-BOC2(A1,B29)-Insulin material only possesses one free
amine group at the Phe-B1 terminus, the Phe-B1 is the only site of
insulin conjugation to the framework as verified in each
deprotected final product by N-terminal sequencing.
TABLE-US-00006 Expected Product Synthesis Conditions
Characterization Framework Affinity AE-sugar MW Sugar/ Framework MW
Ligand MW (LC-MS) Insulin DSS 368 AEM-2 676 6621 2.0 AEM DSS 368
AEBM-2 1000 6945 2.0 AEBM DSS 368 AETM-2 1324 7269 2.0 AETM DSS 368
AEM-3 1085 7031 3.0 AEM DSS 368 AEBM-3 1571 7517 3.0 AEBM DSS 368
AETM-3 2057 8003 3.0 AETM TSAT-C6 822 AEM-2 676 7637 4.0 AEM
TSAT-C6 822 AEBM-2 1000 8285 4.0 AEBM TSAT-C6 822 AETM-2 1324 8933
4.0 AETM TSAT-C6 822 AEM-3 1085 8046 6.0 AEM TSAT-C6 822 AEBM-3
1571 9018 6.0 AEBM TSAT-C6 822 AETM-3 2057 9990 6.0 AETM
Example 15
B1-Insulin Conjugates with Multivalent Sugars Using Dendritic
Framework-Homogeneous Ligand
[0440] 0.1 gm (0.098 mmol) dendron containing an amino core and
four terminal alkyne groups prepared in Example 10b is dissolved at
100 mg/ml in anhydrous DMSO. The solution is added dropwise to a
solution containing disuccinimidyl suberate (DSS, Molecular
Biosciences, 0.098 mmol) and triethylamine (400 uL) and allowed to
react for 1 hour at room temperature. This mixture is then added
dropwise to a 50 mg/ml solution containing the
NH.sub.2--B1-BOC2(A1,B29)-insulin (MW=6,008 g/mol) of Example 8
(0.588 g, 0.098 mmol) and allowed to react for 2 hours.
[0441] The resulting conjugate is superdiluted in water, and the pH
adjusted to 8.0. The solution is desalted using BioGel P2, followed
by concentration using Amicon 3 k ultrafiltration devices. The
resulting solution is purified by reverse phase chromatography,
rotovapped to remove acetonitrile, and lyophilized. The BOC
protecting groups are removed by dissolving the lyophilized powder
in 90% TFA/10% anisole for one hour at 4 C followed by 10.times.
superdilution in 25 mM HEPES pH 8.2 buffer containing 0.150M NaCl.
The pH is adjusted to between 7.0 and 8.0 using NaOH solution after
which the material is passed through a Biogel P2 column to remove
anisole, BOC and other low MW byproducts of deprotection, as well
as any other contaminating salts. The deprotected, purified aqueous
conjugate solution is then concentrated using Amicon 3K membranes
(Millipore, Billerica, Mass.) to the desired level and stored at 4
C until needed. Because the starting
NH.sub.2--B1-BOC2(A1,B29)-insulin material only possesses one free
amine group at the Phe-B1 terminus, the Phe-B1 is the only site of
insulin conjugation to the framework and is verified in each
deprotected final product by N-terminal sequencing.
Example 16
Synthesis of NH.sub.2--B29-BOC2(A1,B1)-Insulin
[0442] a. Fmoc-1-(B29)-Insulin
[0443] In a typical synthesis, 4 gm of powdered insulin (Sigma
Aldrich, St. Louis, Mo.) is dissolved in 100 ml of anhydrous DMSO
at room temperature followed by the addition of 4 ml of
triethylamine (TEA). The solution is stirred for 30 minutes at room
temperature. Next, 1.2 equivalents of 9-fluorenylmethyl
N-succinimidyl carbonate (Fmoc-NHS) (Sigma Aldrich, St. Louis, Mo.)
is slowly added to the insulin-TEA solution as a 1.0 M solution of
the Fmoc-NHS in THF. The reaction is mixed for approximately one
hour. The reaction is quenched via the addition of 4 ml of a stock
solution containing 250 ul of ethanolamine in 5 ml of DMSO followed
by mixing for five minutes. After quenching, the entire solution is
poured into 1600 ml of acetone and mixed briefly with a spatula.
Next, 8.times.400 .mu.l aliquots of a 18.9% HCl:water solution are
added dropwise over the surface of the mixture to precipitate the
reacted insulin. The precipitated material is then centrifuged and
the supernatant decanted into a second beaker while the precipitate
cake is set aside. To the supernatant solution, another 8.times.400
.mu.A aliquots of a 18.9% HCl:water solution are added dropwise
over the surface of the mixture to obtain a second precipitate of
reacted insulin. This second precipitate is centrifuged and the
supernatant is discarded. The combined centrifuge cakes from the
two precipitation steps are washed once with acetone followed by
drying under vacuum at room temperature to yield the crude powder
which typically contains 20% of the Fmoc1 product, 65% of the Fmoc2
product, and 15% of unreacted insulin.
[0444] A preparative reverse phase HPLC method is used to isolate
the pure desired Fmoc1-insulin from the crude powder. Buffer A is
deionized water containing 0.1% TFA and Buffer B is acetonitrile
containing 0.1% TFA. The crude powder is dissolved at 25 mg/ml in a
70% A/30% B mixture and syringe filtered prior to injection on the
column. Before purification, the column (Waters SymmetryPrep C18, 7
um, 19.times.150 mm) is equilibrated at 15 ml/minutes with a 70%
A/30% B mobile phase using a Waters DeltraPrep 600 system.
Approximately 5 ml of the crude powder solution is injected onto
the column at a flow rate of 15 ml/minutes over the course of 5
minutes after which a linear gradient is employed from 70% A/30% B
to 62% A/38% B over the course of the next 3.5 minutes and held
there for an additional 2.5 minutes. Using this method, the desired
Fmoc1 peak elutes at approximately 3 minutes after the unreacted
RHI peak, followed closely by the Fmoc2-insulin peak. Once
collected, the solution is rotovapped to remove acetonitrile and
lyophilized to obtain pure Fmoc1-insulin powder. Identity is
verified by LC-MS (HT Laboratories, San Diego, Calif.) and site of
conjugation determined by N-terminal sequencing (Western
Analytical, St. Louis, Mo.).
[0445] b. BOC2(A1,B1)-Fmoc-(B29)-Insulin
[0446] In a typical synthesis, 1 g of Fmoc1-(B29)-insulin is
dissolved in 25 ml of anhydrous DMSO at room temperature followed
by the addition of 1 ml of triethylamine (TEA). The solution is
stirred for 30 minutes at room temperature. Next, 0.379 ml (2.2
equivalents) of di-tert-butyl-dicarbonate/THF solution (Sigma
Aldrich, St. Louis, Mo.) is slowly added to the insulin-TEA
solution and mixed for approximately one hour. The reaction is
quenched via the addition of 1 ml of a stock solution containing
250 ul of ethanolamine in 5 ml of DMSO followed by mixing for five
minutes. After quenching, the entire solution is poured into 400 ml
of acetone and mixed briefly with a spatula. Next, 8.times.100
.mu.l aliquots of a 18.9% HCl:water solution are added dropwise
over the surface of the mixture to precipitate the reacted insulin.
The precipitated material is then centrifuged and the supernatant
decanted into a second beaker while the precipitate cake is set
aside. To the supernatant solution, another 8.times.100 .mu.l
aliquots of a 18.9% HCl:water solution are added dropwise over the
surface of the mixture to obtain a second precipitate of reacted
insulin. This second precipitate is centrifuged and the supernatant
is discarded. The combined centrifuge cakes from the two
precipitation steps are washed once with acetone followed by drying
under vacuum at room temperature to yield the crude powder which
typically contains greater than 90% of the desired BOC2-Fmoc-1
product.
[0447] A preparative reverse phase HPLC method is used to isolate
the pure BOC2-Fmoc-1-insulin from the crude powder. Buffer A is
deionized water containing 0.1% TFA and Buffer B is acetonitrile
containing 0.1% TFA. The crude powder is dissolved at 25 mg/ml in a
70% A/30% B mixture and syringe filtered prior to injection on the
column. Before purification, the column (Waters SymmetryPrep C18, 7
um, 19.times.150 mm) is equilibrated at 15 ml/minutes with a 70%
A/30% B mobile phase using a Waters DeltraPrep 600 system.
Approximately 5 ml of the crude powder solution is injected onto
the column at a flow rate of 15 ml/minutes over the course of 5
minutes after which a linear gradient is employed from 70% A/30% B
to 62% A/38% B over the course of the next 3.5 minutes and held
there for an additional 2.5 minutes. Using this method, the desired
BOC2-Fmoc-1 peak elutes at approximately 5 minutes after the
Fmoc1-insulin starting material. Once collected, the solution is
rotovapped to remove acetonitrile and lyophilized to obtain pure
BOC2(A1,B1)-Fmoc(B29)-insulin powder. Identity is verified by LC-MS
(HT Laboratories, San Diego, Calif.) and site of conjugation
determined by N-terminal sequencing (Western Analytical, St. Louis,
Mo.).
[0448] c. NH.sub.2--(B29)-BOC2(A1,B1)-Insulin
[0449] The Fmoc protecting group of the BOC2(A1,B1)-Fmoc(B29) is
removed by dissolving the lyophilized powder obtained according to
the previous step in 20% piperidine in dimethylformamide (DMF) for
30 minutes at 4 C followed by 10.times. superdilution in 25 mM
HEPES pH 8.2 buffer containing 0.150M NaCl. The pH is adjusted to
between 7.0 and 8.0 using NaOH solution after which the material is
passed through a Biogel P2 column to remove Fmoc, DMF, and any
other contaminating salts. The NH.sub.2--(B29)-BOC2(A1,B1)-insulin
is lyophilized into a powder if needed or used directly in aqueous
solution if desired.
Example 17
Synthesis of NH.sub.2--B29-BOC2(A1,B1)-Insulin Conjugates
[0450] All of the multivalent-affinity ligand-drug conjugates
described in previous examples using the
NH.sub.2--B1-BOC2(A1,B29)-insulin of Example 8 may be prepared
instead using the NH.sub.2--B29-BOC2(A1,B1)-insulin of Example 16.
All of the resulting conjugates will possess the same MW and degree
of substitution characteristics, but the site of conjugation to the
insulin molecule will be at the epsilon B29 amino group and not the
N-terminal Phe-B1. This can be confirmed by N-terminal
sequencing.
Example 18
Amine-Functionalized Drug Conjugation with Multivalent Activated
Esters in Organic Solvent (Drug Added Last)
[0451] This example describes an alternative to the method
described in Example 11 in which the drug is added to the framework
before the affinity ligand(s). In this example the affinity
ligand(s) are added to the framework before the drug.
[0452] A framework containing N terminal activated esters is
dissolved at 60 mM in 1 ml of anhydrous DMSO followed by the
addition of 400 ul (excess) of triethylamine (TEA). The solution is
stirred rapidly for 10 minutes at room temperature. In parallel, a
122 mM solution of affinity ligand is prepared in an appropriate
volume of anhydrous DMSO. Once dissolved, enough affinity ligand
solution is added dropwise over the course of ten minutes to
provide a number of reactive equivalents equal to exactly the
number of activated ester groups on the framework, N, minus one.
For example, if there are N=3 activated ester groups on the
framework, then (1.times.(3-1).times.60 mM/122 mM)=0.98 ml of
affinity ligand solution are added. If there are N=4 activated
ester groups on the framework, then (1.times.(4-1).times.60 mM/122
mM)=1.5 ml of affinity ligand solution are added, and so on. After
the affinity ligand solution is added, the solution is stirred for
two hours at room temperature.
[0453] The amine-bearing drug is then dissolved separately in 7.5
ml of anhydrous DMSO at a concentration of 8.1 mM. Once dissolved,
the entire drug solution is added over the course of one minute to
the framework/DMSO/affinity ligand/TEA solution followed by room
temperature mixing for an additional two hours to ensure complete
reaction.
[0454] The resulting solution is then superdiluted by 10.times.
into a 20 mM pH 5.0 HEPES buffered saline solution containing 0.150
M NaCl followed by pH adjustment with dilute HCl to a final pH of
8.0. The aqueous solution is first purified by size exclusion using
an appropriate solid phase for the desired separation of conjugated
and unconjugated materials. The solution passing through the column
void volume is then concentrated using an appropriately sized
ultrafiltration membrane to approximately 10 ml. This solution is
further purified to obtain the desired product using preparative
reverse phase HPLC on a Waters SymmetryPrep C18, 7 um column,
19.times.150 mm. Buffer A is deionized water containing 0.1% TFA
and Buffer B is acetonitrile containing 0.1% TFA. Before
purification, the column is equilibrated at 15 ml/minutes with a
80% A/20% B mobile phase using a Waters DeltraPrep 600 system.
Approximately 5 ml of the crude solution is injected onto the
column over the course of 2 minutes at a flow rate of 15 ml/minutes
after which a linear gradient is employed from 80% A/20% B to 75%
A/25% B over the next 5 minutes followed by a slower linear
gradient from 75% A/25% B to 62% A/38% B over the next 22 minutes.
The retention time of the desired peak will vary depending on the
drug, framework, and affinity ligand used. Once collected, the
solution is rotovapped to remove acetonitrile and lyophilized to
obtain pure conjugate whose identity may be verified by LC-MS (HT
Laboratories, San Diego, Calif.).
Example 19
B29-Insulin Conjugates with Multivalent Sugars Produced in Organic
Solvent From Unprotected Insulin
[0455] This example makes use of the fact that in the unprotected
insulin case, the Lys-B29 epsilon-amino moiety is the most reactive
amine, followed by the A1 and then the B1. Therefore, when
unprotected insulin is used as the amine-containing drug the
resulting conjugate should be predominantly substituted at the
Lys-B29 position. Using the method described in Example 18 and
recombinant human insulin (MW=5808 Da, Sigma Aldrich, St. Louis,
Mo.) as the amine-containing drug, the following insulin conjugates
were prepared using the TSAT-C6 activated ester framework purchased
from Molecular Biosciences (Boulder, Colo.). The AEM and AETM were
synthesized as described previously. The appropriately sized size
exclusion medium was Biogel P2 (Bio-Rad Laboratories, Hercules,
Calif.), and the appropriately sized ultrafiltration membrane
molecular weight cutoff was 3 kDa.
TABLE-US-00007 Synthesis Conditions Product Characterization
Framework Affinity AE-sugar Purity MW Sugar/ Framework MW ligand MW
(HPLC) (LC-MS) Insulin TSAT-C6 822 AEM 223 85% 6729 2.0 TSAT-C6 822
AETM 547 85% 7378 2.0
[0456] According to N-terminal sequencing, approximately 85% of the
AEM-containing framework was conjugated to insulin via the Lys-B29
and approximately 87% of the AETM-containing framework was
conjugated to insulin via the Lys-B29.
Example 20
Amine-Functionalized Drug Conjugation with Multivalent Activated
Esters in Aqueous Solvent (Drug Added Last)
[0457] This example describes an alternative to the method
described in Example 18 in which the reaction is performed in
aqueous solvent instead of organic solvent.
[0458] The framework containing N terminal activated esters is
dissolved at 60 mM in 6.25 ml of anhydrous DMSO followed by the
addition of 2 ml (excess) of triethylamine (TEA). The solution is
stirred rapidly for 10 minutes at room temperature. In parallel, a
448 mM solution of affinity ligand is prepared in an appropriate
volume of anhydrous DMSO. Once dissolved, enough affinity ligand
solution is added dropwise over the course of ten minutes to
provide a number of reactive equivalents equal to 1.5 times the
number of activated ester groups on the framework, N, minus one.
For example, if there are N=3 activated ester groups on the
framework, then (1.5.times.(3-1).times.60 mM/448 mM).times.6.25
ml=2.5 ml of affinity ligand solution are added. If there are N=4
activated ester groups on the framework, then
(1.5.times.(4-1).times.60 mM/448 mM).times.6.25 ml=3.8 ml of
affinity ligand solution are added, and so on. After the affinity
ligand solution is added, the solution is stirred for one hour at
room temperature.
[0459] The amine-bearing drug is then dissolved separately at 17.2
mM in 2.67 ml of a 0.1M, pH 11 sodium carbonate buffer and the pH
subsequently adjusted to 10.8 with 1.0N sodium hydroxide. Once
dissolved, the entire framework/DMSO/affinity ligand/TEA solution
is added dropwise over the course of 75 minutes to the
drug/carbonate buffer solution. During the addition, the pH of the
resulting mixture is adjusted every 5 minutes to 10.8 if necessary
using dilute HCl or NaOH. The solution is allowed to stir for an
additional 15 minutes after the dropwise addition to ensure
complete reaction.
[0460] The resulting solution is then superdiluted by 10.times.
into a 20 mM pH 5.0 HEPES buffered saline solution containing 0.150
M NaCl followed by pH adjustment with dilute HCl to a final pH of
8.0. The aqueous solution is first purified by size exclusion using
an appropriate solid phase for the desired separation of conjugated
and unconjugated materials. The solution passing through the column
void volume is then concentrated using an appropriately sized
ultrafiltration membrane to approximately 40 ml. This solution is
further purified to obtain the desired product using preparative
reverse phase HPLC on a Waters SymmetryPrep C18, 7 um, 19.times.150
mm column. Buffer A is deionized water containing 0.1% TFA and
Buffer B is acetonitrile containing 0.1% TFA. Before purification,
the column is equilibrated at 15 ml/minutes with a 80% A/20% B
mobile phase using a Waters DeltraPrep 600 system. Approximately 5
ml of the crude solution is injected onto the column over the
course of 2 minutes at a flow rate of 15 ml/minutes after which a
linear gradient is employed from 80% A/20% B to 75% A/25% B over
the next 5 minutes followed by a slower linear gradient from 75%
A/25% B to 62% A/38% B over the next 22 minutes. The retention time
of the desired peak will vary depending on the drug, framework, and
affinity ligand used. Once collected, the solution is rotovapped to
remove acetonitrile and lyophilized to obtain pure conjugate whose
identity may be verified by LC-MS (HT Laboratories, San Diego,
Calif.).
Example 21
B29-AEM-2-Insulin Conjugate Synthesized in Aqueous Solvent from
Unprotected Insulin
[0461] This example makes use of the fact that in the unprotected
insulin case, the Lys-B29 epsilon-amino moiety is the most reactive
amine, followed by the A1 and then the B1. Therefore, when
unprotected insulin is used as the amine-containing drug the
resulting conjugate should be predominantly substituted at the
Lys-B29 position. Using the method described in Example 20 and
recombinant human insulin (MW=5808, Sigma Aldrich, St. Louis, Mo.)
as the amine-containing drug, an AEM-2 insulin conjugate was
prepared using the TSAT-C6 activated ester framework purchased from
Molecular Biosciences (Boulder, Colo.). The AEM used as the insulin
analog was synthesized as described previously. The appropriately
sized size exclusion medium was Biogel P2 (Bio-Rad Laboratories,
Hercules, Calif.), and the appropriately sized ultrafiltration
membrane molecular weight cutoff was 3 kD. The final product (95%
pure by HPLC) was found to have the desired MW of 6729 g/mol
(LC-MS), representing a total of 2.0 AEM molecules conjugated per
insulin, with greater than 85% of the conjugate molecules
conjugated at the Lys-B29 site (N-terminal sequencing).
Example 22
Generalized Amine-Functionalized Drug Conjugation with
Aldehyde-Containing Framework
[0462] a. Framework Functionalized with More than One Affinity
Ligand and One Terminal Aldehyde
[0463] First, a framework containing N terminal activated esters is
dissolved at 60 mM in 27.0 ml of anhydrous DMSO followed by the
addition of 800 ul (excess) of triethylamine (TEA). The solution is
stirred rapidly for 10 minutes at room temperature. A stock
solution of amine-bearing diethyl acetal is prepared at 580 mM in 5
ml of anhydrous DMSO. Once dissolved, 2.9 ml of the diethyl acetal
solution are added dropwise over the course of 5 minutes to the
framework/DMSO/TEA solution followed by room temperature mixing for
an additional 15 minutes. The remaining activated esters are then
reacted with amine-functionalized affinity ligands in the following
manner. A 370 mM solution of affinity ligand is prepared in an
appropriate volume of dry DMSO. Once dissolved, enough solution is
added to provide a number of reactive equivalents equal to 1.5
times the number of initial activated ester groups, N, minus one.
For example, if there are N=3 initial activated ester groups per
framework, then (1.5.times.(3-1).times.60 mM.times.27/370 mM)=13 ml
of affinity ligand solution are added. If there are N=4 initial
activated ester groups per framework, then
(1.5.times.(4-1).times.60 mM.times.27/370 mM)=20 ml of affinity
ligand solution are added, and so on. After the affinity ligand
solution is added, the solution is stirred for an additional hour
and 45 minutes at room temperature to ensure complete reaction.
After reaction, the entire solution is diluted by a factor of ten
with diethyl ether, mixed vigorously, and centrifuged to separate
the dense bottom phase containing the desired material from the
supernatant. After discarding the supernatant, the same volume of
ethanol is added to generate a solid precipitated mass. After
centrifuging and discarding the supernatant, the material is washed
extensively with ethanol and ether and then dried under vacuum to
yield the crude framework containing multiple affinity ligands and
a diethyl acetal group.
[0464] b. Conjugation of Amine-Functionalized Drug with Terminal
Aldehyde
[0465] Once dried, the aldehyde group is generated from the diethyl
acetal by dissolving the collected material in 60 ml of DI water
with the solution pH adjusted to 1.0. The solution is mixed for 30
minutes after which 6 ml of a 200 mM HEPES pH 8.2 buffer containing
1.5 M NaCl is added and the solution pH adjusted to 6.5 using
dilute NaOH solution. 48 mmol of the amine containing drug are
added to the solution and the pH readjusted to 6.5 if necessary.
Separately, a stock solution of reducing agent is prepared by
dissolving 1.5 g of sodium cyanoborohydride (Sigma Aldrich, St.
Louis, Mo.) in 15 ml of a 20 mM HEPES pH 7.0 buffer containing
0.150 M NaCl and the pH carefully adjusted to 6.5 with dilute HCl
solution. 13 ml of the cyanoborohydride stock solution are added to
the drug/framework/aldehyde solution and allowed to react overnight
at room temperature.
[0466] The resulting aqueous solution is first purified by size
exclusion using an appropriate solid phase for the desired
separation of conjugated and unconjugated materials. The solution
passing through the column void volume is then concentrated using
an appropriately sized ultrafiltration membrane to approximately 10
ml. This solution is further purified to obtain the desired product
using preparative reverse phase HPLC on a Waters SymmetryPrep C18,
7 um column, 19.times.150 mm. Buffer A is deionized water
containing 0.1% TFA and Buffer B is acetonitrile containing 0.1%
TFA. Before purification, the column is equilibrated at 15
ml/minutes with a 80% A/20% B mobile phase using a Waters
DeltraPrep 600 system. Approximately 5 ml of the crude solution is
injected onto the column over the course of 2 minutes at a flow
rate of 15 ml/minutes after which a linear gradient is employed
from 80% A/20% B to 75% A/25% B over the next 5 minutes followed by
a slower linear gradient from 75% A/25% B to 62% A/38% B over the
next 22 minutes. The retention time of the desired peak will vary
depending on the drug, framework, and affinity ligand used. Once
collected, the solution is rotovapped to remove acetonitrile and
lyophilized to obtain pure conjugate whose identity may be verified
by LC-MS (HT Laboratories, San Diego, Calif.).
Example 23
AEM-2-Framework Containing a Terminal Reactive Aldehyde Group and
Subsequent Insulin Conjugation at B1
[0467] a. TSAT Functionalized with 2 AEM and 1 Aminobutyraldehyde
Diethyl Acetal (ABDA)
[0468] This material is synthesized according to the method
described in Example 22a using TSAT (Molecular Biosciences,
Boulder, Colo.) as the multivalent activated ester framework and
4-aminobutyraldehyde diethyl acetal (Sigma Aldrich, St. Louis, Mo.)
as the amine-bearing diethyl acetal. AEM (MW=223 g/mol),
synthesized as described previously was used as the affinity
ligand.
[0469] b. Conjugation of TSAT-AEM-2-ABDA with
NH.sub.2--B1-BOC2(A1,B29)-Insulin
[0470] This material was synthesized using the method described in
Example 22b and the TSAT-AEM-2-ABDA produced in (a) above along
with the amine-bearing drug, NH.sub.2--B1-BOC2(A1,B29)-insulin
(MW=6,008 g/mol), synthesized according to Example 8. The
appropriately sized size exclusion medium is Biogel P2 (Bio-Rad
Laboratories, Hercules, Calif.), and the appropriately sized
ultrafiltration membrane molecular weight cutoff is 3 kD. Because
the starting NH.sub.2--B1-BOC2(A1,B29)-insulin material only
possesses one free amine group at the Phe-B1 terminus, the Phe-B1
is the only site of insulin conjugation to the framework. The BOC
protecting groups are removed by dissolving the lyophilized powder
in 90% TFA/10% anisole for one hour at 4 C followed by 10.times.
superdilution in 25 mM HEPES pH 8.2 buffer containing 0.150M NaCl.
The pH is adjusted to between 7.0 and 8.0 using NaOH solution after
which the material is passed through a Biogel P2 column to remove
anisole, BOC and other low MW byproducts of deprotection, as well
as any other contaminating salts. The deprotected, purified aqueous
conjugate solution is then concentrated using Amicon 3K membranes
(Millipore, Billerica, Mass.) to the desired level and stored at 4
C until needed.
[0471] The final product (95% pure by HPLC) was found to have the
desired MW of 6462 g/mol (LC-MS), representing a total of 2.0 AEM
molecules conjugated per insulin, 99% of which were conjugated at
the Phe-B1 site (N-terminal sequencing).
Example 24
AEM-3-Framework Containing a Terminal Reactive Aldehyde Group and
Subsequent Insulin Conjugation at B1
[0472] a. TSPE Functionalized with 3 AEM and 1 Aminobutyraldehyde
Diethyl Acetal (ABDA)
[0473] This material is synthesized according to the method
described in Example 22a using TSPE (Molecular Biosciences,
Boulder, Colo.) as the multivalent activated ester framework and
4-aminobutyraldehyde diethyl acetal (Sigma Aldrich, St. Louis, Mo.)
as the amine-bearing diethyl acetal. AEM (MW=223 g/mol),
synthesized as described previously, was used as the affinity
ligand.
[0474] b. Conjugation of TSPE-AEM-3-ABDA with
N.sub.2--B1-BOC2(A1,B29)-Insulin
[0475] This material was synthesized using the method described in
Example 22b and the TSPE-AEM-3-ABDA produced in (a) above along
with the amine-bearing drug, NH.sub.2--B1-BOC2(A1,B29)-insulin
(MW=6,008 g/mol), synthesized according to Example 8. The
appropriately sized size exclusion medium is Biogel P2 (Bio-Rad
Laboratories, Hercules, Calif.), and the appropriately sized
ultrafiltration membrane molecular weight cutoff is 3 kD. Because
the starting NH.sub.2--B1-BOC2(A1,B29)-insulin material only
possesses one free amine group at the Phe-B1 terminus, the Phe-B1
is the only site of insulin conjugation to the framework. The BOC
protecting groups are removed by dissolving the lyophilized powder
in 90% TFA/10% anisole for one hour at 4 C followed by 10.times.
superdilution in 25 mM HEPES pH 8.2 buffer containing 0.150M NaCl.
The pH is adjusted to between 7.0 and 8.0 using NaOH solution after
which the material is passed through a Biogel P2 column to remove
anisole, BOC and other low MW byproducts of deprotection, as well
as any other contaminating salts. The deprotected, purified aqueous
conjugate solution is then concentrated using Amicon 3K membranes
(Millipore, Billerica, Mass.) to the desired level and stored at 4
C until needed.
[0476] The final product (95% pure by HPLC) was found to have the
desired MW of 6897 g/mol (LC-MS), representing a total of 3.0 AEM
molecules conjugated per insulin, 99% of which were conjugated at
the Phe-B1 site (N-terminal sequencing).
Example 25
AEM-3-Scaffold Containing a Terminal Reactive Aldehyde Group and
Subsequent Insulin Conjugation at B1 Using Unprotected Insulin
[0477] a. TSPE Functionalized with 3 AEM and 1 Aminobutyraldehyde
Diethyl Acetal (ABDA)
[0478] This material is synthesized according to the method
described in Example 22a using TSPE (Molecular Biosciences,
Boulder, Colo.) as the multivalent activated ester scaffold and
4-aminobutyraldehyde diethyl acetal (Sigma Aldrich, St. Louis, Mo.)
as the amine-bearing diethyl acetal. AEM (MW=223 g/mol),
synthesized as described previously, was used as the indicator
analog.
[0479] b. Conjugation of TSPE-AEM-3-ABDA with
NH.sub.2--B1-BOC2(A1,B29)-Insulin
[0480] This material was synthesized using the method described in
Example 22b and the TSPE-AEM-3-ABDA produced in (a) above along
with the amine-bearing drug, unmodified insulin (MW=5,808 g/mol,
Sigma-Aldrich, St. Louis, Mo.). The appropriately sized size
exclusion medium is Biogel P2 (Bio-Rad Laboratories, Hercules,
Calif.), and the appropriately sized ultrafiltration membrane
molecular weight cutoff is 3 kD. Although the starting unprotected
insulin material possesses three free amine groups, the Phe-B1 is
the predominant site of insulin conjugation to the scaffold due to
the fact that the Phe-B1 (pKa .about.6.8) is the most reactive
amine at pH 6.5. The lyophilized powder is dissolved in 25 mM HEPES
pH 8.2 buffer containing 0.150M NaCl. The pH is adjusted to between
7.0 and 8.0 using NaOH solution after which the material is then
concentrated using Amicon 3K membranes (Millipore, Billerica,
Mass.) to the desired level and stored at 4 C until needed.
[0481] The final product (95% pure by HPLC) was found to have the
desired MW of 6897 g/mol (LC-MS), representing a total of 3.0 AEM
molecules conjugated per insulin, >85% of which were conjugated
at the Phe-B1 site (N-terminal sequencing).
Example 26
Mixed Framework Chemistry and Corresponding Separate Conjugation of
Drug and Affinity Ligands
[0482] Succinimidyl-3,5-dimaleimidophenyl benzoate (SDMB) can be
purchased from Molecular Biosciences (Boulder, Colo.) and used in
the following example without further purification. SDMB is
dissolved at 60 mM in 1.0 ml of anhydrous DMSO followed by the
addition of 400 ul (excess) of triethylamine (TEA). The solution is
stirred rapidly for 10 minutes at room temperature. The
amine-bearing drug is then dissolved separately in 7.5 ml of
anhydrous DMSO at a concentration of 8.1 mM. Once dissolved, the
entire SDMB solution is added dropwise over the course of ten
minutes to the DMSO-drug solution followed by room temperature
mixing for an additional two hours to ensure complete reaction.
[0483] The resulting solution is then superdiluted by 10.times.
into a 20 mM pH 5.0 HEPES buffered saline solution containing 0.150
M NaCl followed by pH adjustment with dilute HCl to a final pH of
8.0. The aqueous solution is first purified by size exclusion using
an appropriate solid phase for the desired separation of conjugated
and unconjugated materials. The solution passing through the column
void volume is then concentrated using an appropriately sized
ultrafiltration membrane to approximately 10 ml.
[0484] Separately, 6.0 mmol of an amine-containing affinity ligand
is dissolved in a 20 mM pH 8.2 HEPES buffered saline solution
containing 0.150 M NaCl at a concentration of 450 mM. To this
solution, 6.6 mmol of iminothiolane (Sigma-Aldrich, St. Louis, Mo.)
is added and allowed to react at pH 8.2 for 30 minutes at room
temperature to convert the amine-terminal groups to terminal
sulfhydryl groups. The resulting material is mixed with the 10 ml
solution of drug-framework-di-maleimide conjugate produced in the
previous step. The maleimide groups are allowed to react with the
indicator-anolog sulfydryl groups at pH 8.2 for 2 hours to ensure
complete reaction. The resulting solution is then purified by size
exclusion using an appropriate solid phase for the desired
separation of conjugated and unconjugated materials. The solution
passing through the column void volume is then concentrated using
an appropriately sized ultrafiltration membrane to approximately 10
ml.
[0485] Finally, this solution is further purified to obtain the
desired product using preparative reverse phase HPLC on a Waters
SymmetryPrep C18, 7 um column, 19.times.150 mm. Buffer A is
deionized water containing 0.1% TFA and Buffer B is acetonitrile
containing 0.1% TFA. Before purification, the column is
equilibrated at 15 ml/minutes with a 80% A/20% B mobile phase using
a Waters DeltraPrep 600 system. Approximately 5 ml of the crude
solution is injected onto the column over the course of 2 minutes
at a flow rate of 15 ml/minutes after which a linear gradient is
employed from 80% A/20% B to 75% A/25% B over the next 5 minutes
followed by a slower linear gradient from 75% A/25% B to 62% A/38%
B over the next 22 minutes. The retention time of the desired peak
will vary depending on the drug, framework, and affinity ligand
used. Once collected, the solution is rotovapped to remove
acetonitrile and lyophilized to obtain pure conjugate whose
identity may be verified by LC-MS (HT Laboratories, San Diego,
Calif.).
Example 27
Insulin-Conjugated to Aminoethylsugars Using Mixed Framework
Chemistry
[0486] Using the method described in Example 26 and the
amine-bearing drug, NH.sub.2--B1-BOC2(A1,B29)-insulin (MW=6,008
g/mol), synthesized according to Example 8, the following specific
drug conjugates are obtained. AEM (MW=223 g/mol), AEBM (MW=385
g/mol), and AETM (MW=547 g/mol) were synthesized as previously
described and used as the affinity ligands in the synthesis. The
appropriately sized size exclusion medium is Biogel P2 (Bio-Rad
Laboratories, Hercules, Calif.), and the appropriately sized
ultrafiltration membrane molecular weight cutoff is 3 kD.
[0487] In all cases, the BOC protecting groups are removed by
dissolving the lyophilized powder obtained according to Example 26
in 90% TFA/10% anisole for one hour at 4 C followed by 10.times.
superdilution in 25 mM HEPES pH 8.2 buffer containing 0.150M NaCl.
The pH is adjusted to between 7.0 and 8.0 using NaOH solution after
which the material is passed through a Biogel P2 column to remove
anisole, BOC and other low MW byproducts of deprotection, as well
as any other contaminating salts. The deprotected, purified aqueous
conjugate solution is then concentrated using Amicon 3K membranes
(Millipore, Billerica, Mass.) to approximately 58 U of insulin/ml
(based on A280 measurements) and stored at 4 C until needed.
Because the starting NH.sub.2--B1-BOC2(A1,B29)-insulin material
only possesses one free amine group at the Phe-B1 terminus, the
Phe-B1 will be the only site of insulin conjugation to the
framework. This can be verified in each deprotected final product
by N-terminal sequencing.
TABLE-US-00008 Expected Product Synthesis Conditions
Characterization Affinity AE-sugar AE-iminothiolane MW Sugar/
Ligand MW intermediate MW (LC-MS) Insulin AEM 223 360 6822 2.0 AEM
AEBM 385 522 7146 2.0 AEBM AETM 547 684 7470 2.0 AETM
Example 28
Generalized Click Chemistry for Drug Conjugation with Complementary
Frameworks
[0488] A framework (8.3 mmol) containing at least one amino
functionality and one or more terminal alkyne groups is taken into
THF (40 mL), water (40 mL) and stirred into solution. An azidoethyl
group-bearing drug (10.51 mmole) is added followed by copper
sulfate (500 mg, 2.0 mmole) and sodium ascorbate (400 mg, 2.0
mmole). The resulting mixture is stirred at 55-60 C (oil bath) for
6 hours, cooled to room temperature, stirred overnight and
concentrated under vacuum to one half volume and filtered thru a
micro-glass filter. The filtrate is loaded on a resin column (Dowex
50w 50.times.4-100) and eluted with water (6.times.75 mL) until
neutral. The column is then eluted with 15% ammonium hydroxide
(10.times.75 mL) and the fractions positive to ninhydrin are pooled
and concentrated to a glassy foam.
Example 29
Conjugates Prepared Using Natural Insulins from Other Species Such
as Bovine and Porcine
[0489] Insulins from other species which contain at least one
reactive amine functionality (e.g., bovine and porcine insulin) may
be coupled using any of the methods used to conjugate recombinant
human insulin. Those skilled in the art will appreciate that the
molecular weights of the resulting conjugates made from bovine or
porcine insulins will differ from those made from recombinant human
insulin by the amounts listed in the following table.
TABLE-US-00009 Molecular Weight Difference in MW Type of Insulin
(g/mol) human insulin (g/mol) Human insulin 5808 -- Porcine insulin
5778 -30 Bovine insulin 5733 -75
[0490] Those skilled in the art will also appreciate that the
resulting conjugates made from bovine or porcine insulin may have
chromatographic peak retention times that differ slightly from
those conjugates made from human insulin, due to the small
differences in structures between the insulins.
Example 30
Conjugates Prepared with Insulin Analogs Such as Lispro, Aspart,
Glulysine, Glargine, and Detemir
[0491] All known insulin analogs which contain at least one
reactive amine functionality (e.g., Lispro, Aspart, Glulisine,
Glargine, and Detemir) may be coupled using any of the methods used
to conjugate recombinant human insulin. Those skilled in the art
will appreciate that the molecular weights of the resulting
conjugates made from insulin analogs will differ from those made
from recombinant human insulin by the amounts listed in the
following table.
TABLE-US-00010 Molecular Weight Difference in MW Type of Insulin
(g/mol) human insulin (g/mol) Human insulin 5808 -- Insulin lispro
5808 -- Insulin aspart 5832 +24 Insulin glulisine 5823 +15 Insulin
glargine 6063 +255 Insulin detemir 5913 +105
[0492] Those skilled in the art will also appreciate that the
resulting conjugates made from insulin analogs may have
chromatographic peak retention times that differ slightly from
those conjugates made from human insulin, due to the small
differences in structures between the insulins.
[0493] The use of insulin glulisine (which does not contain a B29
lysine, but rather a B3 lysine) will give predominantly B3
conjugates when using unprotected insulin glulisine. However, if
B1-insulin glulisine conjugates are desired, then
BOC-(A1,B3)-insulin glulisine is first synthesized using the same
protocol as BOC-(A1,B29)-human insulin as described in Example
8.
Example 31
Conjugates Prepared with Peptidic Insulin Secretagogue
Conjugates
[0494] Peptidic insulin secretagogues (e.g., without limitation
GLP-1 or the GLP-1 analog exanitide) which contain an N-terminal
amine functionality may be coupled using any of the methods used to
conjugate insulin.
II. In Vitro Assays of Exemplary Conjugates
[0495] This second set of examples describes various experiments
investigating the in vitro properties of some exemplary
conjugates.
Example 32
Synthesis of Insulin-Glycogen Conjugates
[0496] This comparative example describes the synthesis of an
insulin-glycogen conjugate according to U.S. Patent Application
Publication No. 20070099820. Briefly, 1 gm of commercially
available, unpurified oyster glycogen (Type II, Sigma-Aldrich, St.
Louis, Mo.) is dissolved in deionized water at a concentration of
10 mg/ml. Solid CNBr is added to the resulting solution at a CNBr
to glycogen mass ratio of 0.68 and the pH maintained constant at
10.7+/-0.2 using 3N sodium hydroxide (NaOH) solution. After
stirring for 15 minutes, another equal mass of solid CNBr equal is
added and the pH maintained constant at 10.7+/-0.2 while stirring
for 45 minutes. Insulin is then added to the solution at an insulin
to glycogen mass ratio of 0.60 and the pH adjusted to 9.15 using
solid sodium bicarbonate. The solution is stirred overnight,
ultrafiltered exhaustively against deionized water using a 50 kDa
MWCO polyethersulfone disc membrane filter (Millipore, Bedford,
Mass.), and lyophilized. The resulting powder is then purified from
unconjugated insulin by gel filtration HPLC (Waters, Milford,
Mass.) using a 1 M acetic acid mobile phase over a Superdex.TM. 30
HiLoad 16/60 (Amersham Biosciences, Piscataway, N.J.) packed
column. The insulin glycogen fraction is then lyophilized to obtain
the conjugate as a pure white powder. The resulting purified
material contained 1.0 wt % of insulin per insulin-glycogen
conjugate as measured using amino acid analysis (UCLA Biopolymers
Laboratory, Los Angeles, Calif.).
Example 33
Liquid Chromatography Analysis
[0497] This example describes the differences between the RP-HPLC
profiles of insulin-glycogen synthesized according to Example 32
and an exemplary conjugate synthesized according to the present
invention. 100 ul of a 5 mg/ml solution of insulin-glycogen
synthesized according to Example 32 and 100 ul of a 1 mg/ml
solution of exemplary conjugate were injected separately onto a
Waters Symmetry C8 5 um column (4.6 mm.times.250 mm), equilibrated
with a 80% Water/20% Acetonitrile (CH3CN) mobile phase (each
containing 0.1% TFA). The exemplary conjugate used in this study
was synthesized using TSAT-C6 as the framework, AEM as the affinity
ligand, and NH.sub.2--B1-BOC2(A1,B29)-insulin as the drug.
[0498] The samples were eluted at 1.0 ml/minutes using the
following gradient method: 0-5 minutes--constant 80% Water/20%
CH3CN, 5-35 minutes--linear gradient to 50% Water/50% CH3CN. The
elution profiles in FIG. 1 show a single spike for the exemplary
conjugate indicating a single chemically distinct species as
compared to a broad and heterogenous elution profile for the
insulin-glycogen conjugate, indicating a broad distribution of
different chemical and/or molecular weight entitites.
Example 34
Molecular Weight Distribution Analysis
[0499] This example describes the difference in MW and MW
distribution between the insulin-glycogen synthesized according to
Example 32 and the same exemplary conjugate. The MW and MW
distribution of the insulin-glycogen conjugate was determined by
injecting 1 ml of a 25 mg/ml solution in pH 7 HEPES buffered saline
onto an Ultrahydrogel Size Exclusion Column (Waters Corporation,
Millford, Mass.) equilibrated with HEPES buffered saline. The
column was eluted over the course of 30 minutes at 0.5 ml per min,
and the elution profile was measured as an absorbance at 280 nm. In
separate experiments using the same protocol, dextran MW standards
of 1000, 5000, 12000, 25000, 50000, 80000, 150000, 270000, and
410000 g/mol (Sigma-Aldrich, St. Louis, Mo.) were injected to
establish a calibration curve of MW versus retention time. Based on
the calibration curve and the elution profile of the
insulin-glycogen conjugate, the average MW was determined to be
500,000 g/mol with 67% of the distribution eluting over the broad
range of 250,000 to 1,000,000 g/mol (data not shown). In contrast,
the exemplary conjugate was determined to have just a single MW of
exactly 6,730 g/mol as determined by LC/MS (HT Laboratories, San
Diego, Calif.) (data not shown).
Example 35
Chemical and Physical Stability of Conjugates
[0500] This example compares the stability of an exemplary
conjugate with that of unconjugated insulin under accelerated
conditions according to the method described in Hinds et al.
(Bioconj. Chem. 11:195-201, 2000) at 37 C and a mechanical
agitation rate of 150 strokes/min.
[0501] Pharmaceutical grade recombinant human insulin (RHI) was
selected as the control for the accelerated stability study.
Holcombe et al. (Diabetes Care 27:1241-1242, 2004) describes that
under non-accelerated conditions RHI stability is maintained for at
least 30 days at room temperature (RT) and considerably longer when
refrigerated. FIG. 2 shows the results from the aggregation
stability assay for RHI and two exemplary conjugates in pH 7.4
phosphate buffered saline (PBS) at 50 U/ml. In all cases, the %
remaining in solution was determined by centrifuging (4500.times.g,
5 min) the solution at a given time point, measuring the A280 of
the supernatant, and dividing the supernatant A280 by that of the
original starting solution. Conjugate 1 was synthesized using
TSAT-C6 as the framework, AEM as the affinity ligand, and
NH.sub.2--B1-BOC2(A1,B29)-insulin as the drug. Conjugate 2 was
synthesized using TSPE as the framework, AEM as the affinity
ligand, and NH.sub.2--B1-BOC2(A1,B29)-insulin as the drug.
[0502] After 48 hours of continuous agitation at 37 C, less than 6%
of the RHI remained stable in solution, while the majority of the
RHI precipitated out as insoluble aggregates. After the same amount
of time, the both conjugates remained substantially more stable, as
96%-99% of the IPC's remained intact and soluble in the PBS
solution. The data conclusively show that the conjugates are
significantly more stable than RHI under these conditions.
[0503] RP-HPLC was used to assess the chemical stability of the
conjugates (see FIG. 3a). After 48 hours of accelerated stability
the conjugate solutions were analyzed using a C8-reverse phase
column using a water-acetonitrile elution gradient. The retention
times of the pre- and post-stability conjugate samples are shown
along with the percentage of unconjugated (free) insulin and
desamido insulin found in the resulting LC traces. No detectable
amounts of free insulin or desamido were observed, indicating that
(i) the covalent linkage between the sugars and the insulin
molecule is stable, and (ii) no significant chemical degradation of
the conjugate occurs during the accelerated stability test (AST).
Prior to and in parallel with the AST, the conjugate was also
subjected to a 90-day non-accelerated stability test that included
daily thermal cycling between 4.degree. C. and RT. At the
conclusion of the parallel study, RP-HPLC demonstrated that the
conjugate was still chemically and physically stable (data not
shown).
[0504] Further confirmation of the conjugate chemical stability in
HEPES buffer is provided from the LC-MS data obtained before and
after subjecting the conjugate to the AST. Interestingly, the 48
hour AST conjugate samples in PBS showed that substantial
degradation had occurred, while the 48 hour AST conjugate samples
in HEPES buffer were completely intact and stable (see FIG. 3b).
Conjugate HS-1-60-1 stored in HEPES has a MW of 6730 Da before and
after the AST, demonstrating that both mannose residues, the
multimeric scaffold, and insulin are all chemically unchanged and
quite stable. To ensure conjugate stability, all buffers used for
storage, in vitro testing, and in vivo testing contain HEPES as the
buffering agent.
[0505] The LC-MS data greatly enhances FDA manufacturing regulatory
compliance, as the LC-MS test can readily act as the chemical
identity assay of the conjugate. Since the drug (e.g., insulin),
multimeric scaffold, and conjugate all have discrete molecular
weights, the resulting affinity ligand ratio can be readily
calculated by subtracting the scaffold MW from the conjugate MW to
give the remaining mass due to the sugar groups. In the case of
conjugate HS-1-60-1, the mannose:insulin molar ratio is calculated
as exactly 2.0.
Example
Functional Stability of Conjugates
[0506] After demonstrating that the conjugate was chemically and
physically stable, a 72 hour AST conjugate was assessed for its
subcutaneous bioactivity in vivo vs. fresh conjugate using
Sprague-Dawley rats at 5 U/kg (see FIG. 4).
[0507] Analysis of the 72 hour HEPES AST conjugate data showed that
the time to reach the glucose nadir (T.sub.nadir) was 60 minutes,
and the time to return to 70% of the fasting blood glucose values
(T.sub.70%BG) was less than 128.+-.15 min. A comparison of fresh
conjugate vs. 72 hour AST conjugate bioactivity curves at each
timepoint using the student t-test (n=4 for each group) showed no
significant differences (all p-values >0.21). These results were
within specified targets for the formulation, indicating that
preserved conjugate chemical stability translates into preserved in
vivo functional performance.
III. In Vivo Assays of Exemplary Conjugates
[0508] This third set of examples describes various experiments
investigating the in vivo properties of some exemplary
conjugates.
Example 37
Conjugate Bioactivity Versus RHI and Dextran or Glycogen
Conjugates
[0509] a. Insulin-Dextran Bioactivity
[0510] This comparative example evaluates the in vivo
pharmacodynamic profile of subcutaneously administered
insulin-dextran (Sigma-Aldrich, MW .about.70K). As shown below, the
insulin-dextran conjugates synthesized according to U.S. Patent
Publication No. 20040202719 act relatively slowly after
subcutaneous injection, because the high MW of the conjugate
polymer significantly hinders the absorption rate into systemic
circulation. Insulin-dextran was synthesized using a modified
cyanogen bromide (CNBr) coupling reaction. Briefly, 500 mg of
dextran (MW=70K, Sigma-Aldrich) was dissolved in 50 ml of deionized
water. 56 mg of solid CNBr was added to the resulting solution and
the pH was maintained at 10.7.+-.0.2 using 5 N NaOH solution. After
stirring for 15 min, another 56 mg of solid CNBr was added and the
pH was maintained at 10.7.+-.0.2 while stirring for 45 minutes. 300
mg of recombinant human insulin (RHI) was then added to the
solution, and the pH was adjusted to 9.15 using solid sodium
bicarbonate. The solution was stirred overnight, ultrafiltered
exhaustively against DI water using a 10K MWCO polyethersulfone
disc membrane filter (Millipore, Bedford, Mass.), and lyophilized.
The resulting powder was then purified from unconjugated insulin by
high performance liquid chromatography (Waters, Milford, Mass.)
using a 1 M acetic acid mobile phase over a Superdex.TM. 75 packed
column (Amersham Biosciences, Piscataway, N.J.). The
insulin-dextran fraction was then lyophilized to obtain the
conjugate as a pure powder. The degree of insulin conjugation was
10% (w/w) as determined by amino acid analysis (UCLA Biopolymers
Laboratory, Los Angeles, Calif.).
[0511] Subcutaneous injections of the insulin-dextran were
administered using 0.25 ml of a sterilized 1.times.PBS solution (20
U of equivalent insulin/ml) behind the neck of fasted normal
non-diabetic rats (Male Sprague-Dawley, 200-250 g, n=4). Blood
samples were collected via tail vein bleeding at -15 and 0 minutes,
and at 15, 30, 45, 60, 90, 120, 180, 240, 300 and 360 minutes after
injection. Blood glucose values were measured using commercially
available test strips (Precision Xtra, Abbott Laboratories, Abbott
Park, Ill.). As shown in FIG. 5, the times to reach the glucose
nadir (T.sub.nadir) concentration was found to be about 3 hours
after injection, and the serum glucose levels remain depressed for
at least five hours post injection.
[0512] b. Insulin-Glycogen Bioactivity
[0513] This example evaluates the in vivo pharmacodynamic profile
of subcutaneously administered insulin-glycogen. The
insulin-glycogen conjugate was synthesized according to Example 32.
The bioactivity of the insulin-glycogen conjugate was evaluated by
injecting a 2.5 equivalent U of insulin/kg dose behind the neck of
fasted normal non-diabetic rats (Male Sprague-Dawley, 200-250 g,
n=4). Blood samples were collected via tail vein bleeding at -15
and 0 minutes, and at 15, 30, 45, 60, 90, 120, 180, 240, 300 and
360 minutes after injection. Blood glucose values were measured
using commercially available test strips (Precision Xtra, Abbott
Laboratories, Abbott Park, Ill.). As compared to the
insulin-dextran conjugates above, the high MW insulin-glycogen
conjugates lower glucose levels much more rapidly and to a greater
extent (see FIG. 6). This rapid action and elimination profile is
due to the rapid enzymatic digestion of the high MW glycogen
polymer chain following subcutaneous injection.
[0514] c. A Comparison of Conjugate and RHI Bioactivity
[0515] This example evaluates and compares the in vivo
pharmacodynamic profile of a subcutaneously administered exemplary
conjugate and recombinant human insulin (RHI). The exemplary
conjugate was synthesized using TSAT-C6 as the scaffold, AEM as the
indicator analog, and NH.sub.2--B1-BOC2(A1,B29)-insulin as the
drug. In each case, the conjugate or RHI was injected at 3.5 U/kg
behind the neck of fasted normal non-diabetic rats (Male
Sprague-Dawley, 400-500 g, n=6). Blood samples were collected via
tail vein bleeding at 0 minutes and at 30, 60, 90, 120, 150, 180,
210, 240, and 300 minutes after injection. Blood glucose values
were measured using commercially available test strips (Precision
Xtra, Abbott Laboratories, Abbott Park, Ill.). As shown in FIG. 7,
the glucose depression profiles for RHI and the exemplary conjugate
are nearly identical despite the inability for the exemplary
conjugate to be enzymatically digested in vivo. The rapid action
and elimination profiles of the conjugate are most likely due to
the fact that the conjugate is only 14% larger than RHI making any
effect of increased MW almost negligible in terms of
pharmacodynamic properties.
Example 38
PK Comparison with RHI
[0516] This example describes and compares the serum insulin
profiles obtained for a subcutaneously administered exemplary
conjugate and recombinant human insulin (RHI). The exemplary
conjugate was synthesized using TSAT-C6 as the framework, AEM as
the affinity ligand, and NH.sub.2--B1-BOC2(A1,B29)-insulin as the
drug. In each case, the conjugate or RHI was injected at 3.5 U/kg
behind the neck of fasted normal non-diabetic rats (Male
Sprague-Dawley, 400-500 g, n=6). Blood samples were collected via
tail vein bleeding at 0 minutes and at 30, 60, 90, 120, 150, 180,
210, 240, and 300 minutes after injection. Blood from each
timepoint was centrifuged at 4 C to collect the serum. Serum
insulin concentrations were subsequently measured with a
commercially available ELISA kit (Human Insulin ELISA, Mercodia,
Uppsala, Sweden). As can be seen in FIG. 8, the pharmacokinetic
profile for the conjugate is statistically indistinguishable from
that of RHI, demonstrating that this conjugate is rapidly absorbed
into and eliminated from serum following a subcutaneous
injection.
Example 39
PK and Bioactivity of a B29-Substituted Version of the
AEM-2-TSAT-C6-Insulin Conjugate
[0517] This example describes the serum insulin and blood glucose
depression profiles obtained for a subcutaneously administered
exemplary conjugate. The exemplary conjugate was synthesized using
TSAT-C6 as the framework, AEM as the affinity ligand, and
recombinant human insulin as the drug (to produce a B29-substituted
conjugate instead of a B1-substituted conjugate as in Examples 37
and 38). In this case, the conjugate was injected at 5 U/kg behind
the neck of fasted normal non-diabetic rats (Male Sprague-Dawley,
400-500 g, n=3). Blood samples were collected via tail vein
bleeding at 0 minutes and at 30, 60, 90, 120, 150, 180, 210, 240,
and 300 minutes after injection. Blood glucose values were measured
using commercially available test strips (Precision Xtra, Abbott
Laboratories, Abbott Park, Ill.). In addition, blood from each
timepoint was centrifuged at 4 C to collect the serum. Serum
insulin concentrations were subsequently measured with a
commercially available ELISA kit (Human Insulin ELISA, Mercodia,
Uppsala, Sweden). As can be seen in FIG. 9, the pharmacokinetic
profile for the B29-substituted conjugate is statistically
indistinguishable from that of RHI as well as the B1-substituted
conjugate from Example 38, demonstrating that this conjugate is
also rapidly absorbed into and eliminated from serum following a
subcutaneous injection.
Example 40
PK and Bioactivity Comparison with Lispro
[0518] This example compares the serum insulin and blood glucose
profiles obtained for a subcutaneously administered exemplary
conjugate and insulin lispro. Insulin lispro (HUMALOG.RTM.) is a
rapid acting insulin analog in which the penultimate lysine and
proline residues on the C-terminal end of the B-chain have been
reversed. This modification blocks the formation of insulin
multimers. Data from soluble recombinant human insulin (RHI) is
also provided for comparison (see Example 38 and FIG. 8).
[0519] The exemplary conjugate was synthesized using TSAT-C6 as the
framework, AEM as the affinity ligand, and
NH.sub.2--B1-BOC2(A1,B29)-insulin as the drug. In each case, the
conjugate or insulin lispro was injected at 3.5 U/kg behind the
neck of fasted normal non-diabetic rats (Male Sprague-Dawley,
400-500 gm, n=6). Blood samples were collected via tail vein
bleeding at 0 minutes and at 30, 60, 90, 120, 150, 180, 210, 240,
and 300 minutes after injection. Blood glucose values were measured
using commercially available test strips (Precision Xtra, Abbott
Laboratories, Abbott Park, Ill.). In addition, blood from each
timepoint was centrifuged at 4 C to collect the serum. Serum
insulin concentrations were subsequently measured with a
commercially available ELISA kit (Human Insulin ELISA, Mercodia,
Uppsala, Sweden). As can be seen in FIG. 12, the pharmacokinetic
profile for the conjugate is statistically indistinguishable from
that of insulin lispro.
Example 41
Effect of Affinity Ligand on Bioactivity
[0520] This example compares the blood glucose profiles obtained
for a series of subcutaneously administered exemplary conjugates.
The exemplary conjugates were synthesized using TSAT-C6 as the
framework, and NH.sub.2--B1-BOC2(A1,B29)-insulin as the drug. The
affinity ligand composition was varied across the conjugates to
cover a range of affinities: AEM-2, AEBM-2, AETM-1 AEBM-1 and
AETM-2 (from lowest to highest affinity). In each case, the
conjugates were injected at 5 U/kg (3.5 U/kg for AEM-2) behind the
neck of fasted normal non-diabetic rats (Male Sprague-Dawley,
400-500 gm, n=6). Blood samples were collected via tail vein
bleeding at 0 minutes and at 30, 60, 90, 120, 150, 180, 210, 240,
and 300 minutes after injection. Blood glucose values were measured
using commercially available test strips (Precision Xtra, Abbott
Laboratories, Abbott Park, Ill.). In addition, blood from each
timepoint was centrifuged at 4 C to collect the serum. Serum
insulin concentrations were subsequently measured with a
commercially available ELISA kit (Human Insulin ELISA, Mercodia,
Uppsala, Sweden).
[0521] As can be seen in FIG. 13, the glucose lowering response
decreased as the affinity of the ligand increased. This data
provided the first indication that the nature of the affinity
ligand may affect the bioactivity of the conjugate. FIGS. 14-16,
show the blood glucose levels alongside the serum insulin levels
for each of the four conjugates tested. These results show quite
clearly that the reduced glucose response for conjugates with
higher affinity ligands result from the reduced PK profile of the
conjugate (compare FIG. 14 for AEM-2 with FIG. 16 for AETM-2). As
described in U.S. Provisional Application No. 61/147,878 filed Jan.
28, 2009, U.S. Provisional Application No. 61/159,643 filed Mar.
12, 2009, U.S. Provisional Application No. 61/162,107 filed Mar.
20, 2009, U.S. Provisional Application No. 61/163,084 filed Mar.
25, 2009, U.S. Provisional Application No. 61/219,897 filed Jun.
24, 2009, U.S. Provisional Application No. 61/223,572 filed Jul. 7,
2009, U.S. Provisional Application No. 61/252,857 filed Oct. 19,
2009, and corresponding PCT application filed on Jan. 27, 2010, we
have demonstrated that this reduced PK profile (and associated
bioactivity) can be reversed by an increase in the physiological
glucose concentration (i.e., the level of conjugate in circulation
rises with increasing glucose concentration). It will be
appreciated that, in certain embodiments, this glucose dependence
can be used to further tune the in vivo properties of a
conjugate.
IV. Binding-Site Modified Lectins
[0522] This fourth set of examples describes the preparation and
testing of a variety of binding-site modified lectins.
Example 42
Synthesis of Azidophenyl-Sugar Modified Con A
[0523] All steps were performed at room temperature unless
otherwise specified. First, 5.0 g of native Con A (Sigma-Aldrich,
St. Louis, Mo.) was dissolved in 200 ml of a 10 mM pH 5.0 acetate
buffer solution containing 150 mM sodium chloride, 2 mM calcium
chloride, 2 mM manganese chloride, and 0.1% w/v sodium azide (S28
buffer) and any insoluble material was separated by centrifugation
and/or filtration. We have found that different commercial
preparations of native Con A contain appreciable concentrations of
inhibitory sugars that are, in certain embodiments, removed prior
to photoaffinity modification. To that end, the solution was
purified through a Biogel-P6 size exclusion column with an S28
mobile phase two times. Finally, the resulting solution was diluted
with S28 to a final volume of 1 L. Under gentle stirring
conditions, 0.4 g of hydroquinone (Sigma-Aldrich, St. Louis, Mo.)
was added followed by 165 mg of either azidophenylglucose (APG,
PolyOrg Inc., Leominster, Mass.) or azidophenylmannose (APM,
PolyOrg. Inc., Leominster, Mass.). The solution was stirred in the
dark at 4 C for one hour at the lowest possible stir speed. After
one hour of stirring, any additional insoluble material was removed
via centrifugation and/or filtration. 200 ml of the solution was
poured into a 9''.times.13'' aluminum pan and reacted at 4 C inside
a CL-1000 UV crosslinking oven (UVP, Upland, Calif.) for 15 min at
360 nm (the UV reaction may also take place using 302 nm light).
Following the reaction, any additional insoluble material was
removed via centrifugation and/or filtration. The clarified
solution was then purified 1.times. through Biogel-P6 size
exclusion columns (Econopak, Bio-Rad Labs, Hercules, Calif.) with
an S28 mobile phase. The UV crosslinking reaction and P6
purification process was then repeated until the entire solution
was reacted. Finally, the combined P6-purified solutions were
concentrated down to .about.180 ml using a Pall tangential flow
filtration cartridge apparatus (Millipore, Billerica, Mass.)
equipped with Omega 30K membranes. The resulting solution was
clarified via centrifugation and/or filtration and passed through
0.22 um filters prior to affinity column purification.
Example 43
Generalized Synthesis of Diazirine Photoreactive Ligands
[0524] 0.9 mmol of aminoethyl (AE) functionalized sugar ligand
(e.g., AEG, AEM, AEBM, AETM) were dissolved in 4 ml of anhydrous
DMSO after which 1.6 ml of anhydrous triethylamine (TEA) were added
to form a cloudy emulsion. In a separate container, 200 mg (0.9
mmol) of NHS-diazirine (Thermo Fisher Scientific Inc., Rockford,
Ill.) powder was dissolved in 4 ml of anhydrous DMSO under dark
conditions. Once dissolved, the NHS-diazirine solution was added
dropwise to the AE-sugar solution and then allowed to react
overnight at room temperature in the dark. TLC analysis (50%
ethanol:50% ethyl acetate) of the overnight solution confirmed
complete reaction as evidenced by the co-elution of the UV signal
of the diazirine moiety (254 nm) and the sugar signal (sulfuric
acid-ethanol stain) and concomitant disappearance of the
AE-functionalized sugar ligand from the origin of the TLC (sulfuric
acid-ethanol stain). The solution was then diluted into 80 ml of a
pH 5.0, 25 mM HEPES solution containing 0.15 M sodium chloride, pH
adjusted to pH 5 if necessary, and then frozen until required for
photoaffinity reaction with Con A.
Example 44
Synthesis and Characterization of Sugar-Functionalized Diazirine
Con A
[0525] All steps were performed at room temperature unless
otherwise specified. First, 5.0 g of native Con A (Sigma-Aldrich,
St. Louis, Mo.) was dissolved in 200 ml of a 10 mM pH 5.0 acetate
buffer solution containing 150 mM sodium chloride, 2 mM calcium
chloride, 2 mM manganese chloride, and 0.1% w/v sodium azide (S28
buffer) and any insoluble material were separated by centrifugation
and/or filtration. We have found that different commercial
preparations of native Con A contain appreciable concentrations of
inhibitory sugars that are, in certain embodiments, removed prior
to photoaffinity modification. To that end, the solution was
purified through a Biogel-P6 size exclusion column with an S28
mobile phase two times. Finally, the resulting solution was diluted
with S28 to a final volume of 1 L. Next, the solution volume was
brought up to 1 L-1/3 ligand volume, using 1.times. S28 and poured
into a 1 L media bottle with stir bar. Under gentle stirring
conditions in the dark, 0.4 g of hydroquinone (Sigma-Aldrich, St.
Louis, Mo.) was dissolved. Next, 33 ml of the diazirine-sugar
conjugate obtained in Example 43 was added in 7 aliquots under
gentle stirring conditions in the dark. Once dissolved, the entire
solution was incubated under gentle stirring for an additional 10
min at 4 C in the dark. After 10 min of stirring, any additional
insoluble material was removed via centrifugation and/or
filtration. 250 ml of the solution was poured into a 9''.times.13''
aluminum pan and reacted at 4 C inside a CL-1000 UV crosslinking
oven (UVP, Upland, Calif.) for 15 min at 360 nm. Following the
reaction, any additional insoluble material was removed via
centrifugation and/or filtration. The clarified solution was then
purified 1.times. through Biogel-P6 size exclusion columns
(Econopak, Bio-Rad Labs, Hercules, Calif.) with an S28 mobile
phase. The UV crosslinking reaction and P6 purification process was
then repeated until the entire solution was reacted. Finally, the
combined P6-purified solutions were concentrated down to .about.180
ml using a Pall tangential flow filtration cartridge apparatus
(Millipore, Billerica, Mass.) equipped with Omega 30K membranes.
The resulting solution was clarified via centrifugation and/or
filtration and passed through 0.22 um filters prior to affinity
column purification.
Example 45
Affinity Column Purification of Modified Con A Samples
[0526] Photoaffinity modified lectins synthesized according to
Examples 42 and 44 were purified via affinity column chromatography
to separate fully reacted material from unreacted and/or partially
reacted material. 100-200 ml of solution was injected onto a
XK50/100 column (50 mm diameter.times.100 cm length) packed with
glucose-containing Superdex 30 beads (GE Healthcare Life Sciences,
UK) equilibrated with S28 buffer. The column was then eluted for 4
hours at 5 ml/min with S28. The desired fraction, having been fully
reacted, eluted first from the column followed by partially reacted
material which still had a partial affinity for the
glucose-containing stationary phase. Typically, material eluting
from 70-120 min was collected and the rest discarded. The column
was then washed at 5 ml/min with S28 buffer containing 80 mM
alpha-methyl-mannose solution for six hours to remove any unreacted
lectin followed by regeneration in S28 at 5 ml/min for another six
hours. The collected fraction was concentrated using Amicon Ultra
30K ultrafiltration membranes (Millipore, Billerica, Mass.) to
approximately 100 ml and passed through 0.22 um filters prior to
any further affinity column purification steps. The column
purification process was repeated a second, third, and fourth time
to obtain sufficiently pure material for subsequent studies. After
the fourth purification step, the material was concentrated using
Amicon Ultra 30K ultrafiltration membranes (Millipore, Billerica,
Mass.) to approximately 18 mg/ml as determined by the solution
absorbance at 280 nm (A280). This solution was passed through a
0.22 um filter and stored at 4 C until required for future
studies.
Example 46
Chemical Characterization of Modified Con A Samples
[0527] a. SDS-PAGE
[0528] Denaturing polyacrylamide gel electrophoresis (PAGE) using
sodium dodecyl sulfate (SDS) was performed on the materials to
ensure that no adverse proteolytic cleavage occurred as a result of
exposure to UV light. Briefly, a 10-15% Tris-HCl pre-made gel
(Criterion, Bio-Rad, Hercules, Calif.) and 1.times.
Tris-glycine-SDS buffer (Bio-Rad, Hercules, Calif.) were used to
perform the PAGE experiment. A broad-range molecular weight
standard (Bio-Rad, Hercules, Calif.) and a 2 mg/ml sample of native
concanavlin A lectin (Con A, Type VI, Sigma-Aldrich, St. Louis,
Mo.) were also run as controls. 25 uL of each modified lectin or
control sample was dissolved in 50 uL of 1.times. Laemmli Buffer
(Bio-Rad, Hercules, Calif.) containing 5 uL of -mercaptoethanol
(Fisher Scientific), and the samples were heated in a boiling water
bath for approximately 5 minutes. After the samples had cooled to
room temperature, 20 uL of each sample was loaded into the wells of
the pre-made PAGE gels. The samples were then run at 200 volts for
60 minutes. After the electrophoresis, the gels were fixed in a
solution of deionized water:methanol:glacial acetic acid in a
volume ratio of 60:30:10 for 30 minutes, followed by two washes in
deionized water. Finally, the gels were stained with 1.times.
Bio-Safe Coomassie Blue stain (Bio-Rad, Hercules, Calif.) for 60
minutes. The final gels were imaged with a light table and digital
camera to record the stained gel. The stained protein bands were
assayed for their molecular weights by comparing against the
molecular weight and native Con A control samples. Proteolytic
cleavage of the modified lectin samples during exposure to UV light
would result in molecular weight bands that appear to be lower MW
and distinctly different than those present in the native Con A
control.
[0529] b. Matrix-Assisted Laser Desorption Ionization (MALDI) Mass
Spectroscopy
[0530] Those skilled in the art will recognize that MALDI is a well
known technique to characterize protein molecular weights. MALDI
can be used to characterize the modified lectin subunit MW after
conjugation to affinity ligand and subsequent affinity column
purification to calculate the extent to which the modified lectin
has been covalently linked with affinity ligand.
[0531] Modified lectin samples at 2 mg/ml were added to BioSpin 30
columns (Bio-Rad, Hercules, Calif.) that had been previously
equilibrated with deionized water. The BioSpin columns were
centrifuged for 4 minutes at 1000.times.g, and the resulting eluent
contained modified lectin samples that had been substantially
desalted. The samples were frozen on dry ice and shipped for MALDI
analysis using a sinnapic acid matrix.
[0532] c. Analytical Ultracentrifugation (AUC)
[0533] AUC is a technique used to determine the native molecular
weight of protein samples as they exist in solution. Since some
lectins include quaternary structures (e.g., Con A) it is
recommended to uncover the molecular mass of the modified lectins
under non denaturing conditions (SDS-PAGE, MALDI).
[0534] Modified lectin samples and control native Con A (Type VI,
Sigma-Aldrich, St. Louis, Mo.) samples were dissolved at
concentrations of 1.0, 0.5, and 0.25 mg/ml in S28 buffer containing
12.5 mM .alpha.-D-mannose, and these were placed into the AUC cells
of a Beckman XL-I analytical ultracentrifuge (Biophysical
Instrumentation Facility, MIT, Cambridge, Mass.) and successively
spun at speeds of 10 k, 20 k, 30 k, or 40 k rpm and allowed to
equilibrate for multiple hours at each speed. Each cell was scanned
at a wavelength of 280 nm, and Winmatch software (Cambridge, Mass.)
was used to determine the equilibration times of the AUC cells. The
obtained AUC data for each sample was fit using a non-linear least
squares analysis using WinNonLin v1.06 (UConn, Rockville, Conn.) to
obtain the molecular weight of the sample.
[0535] d. Isothermal Calorimetry
[0536] Titration calorimetry was performed at 25 C in a Micro-Cal
VP-ITC microcalorimeter (Biophysical Instrumentation Facility, MIT,
Cambridge, Mass.), using a 1.4 ml (nominal) titration cell. Typical
modified lectin concentrations were in the range of 4-6 mg/ml in
PBS buffer (10 mM NaPO.sub.4 pH 7.2, 150 mM NaCl, 0.2 mM
CaCl.sub.2). Samples were titrated with 10 mM
methyl-.alpha.-D-mannopyranoside in the same buffer, using one 2
.mu.l increment initially to clear the syringe, followed by 9
injections of 4 .mu.l, increasing to 8 .mu.l for the 11th to 30th
addition, at intervals of 240 sec. Normally, the latter additions
showed only background heat of dilution (i.e., total saturation).
Data (eliminating the first data point, and any others that were
obviously bad) were fit to the single site model using Origins
software supplied with the instrument.
[0537] e. MAC Essay
[0538] Various photoaffinity-labeled lectins such as those
synthesized in Examples 42 and 44 and purified according to Example
45 were compared based on their ability to agglutinate cells
possessing affinity ligands to which the unmodified lectin is
capable of binding. The minimum agglutinating concentrations (MAC)
of each composition was determined in V-well microtitre plates
using a 2% v/v suspension of formaldehyde-stabilized rabbit
erythrocytes according to the procedure of Crowley et al., Methods.
Enzymol. 83:368-373, 1982. Formaldehyde-treated rabbit
erythrocytes, prepared by published procedures (Nowak et al.,
Biochim. Biophys. Acta 393:115-123, 1975), from rabbit blood
obtained from University of Michigan Unit for Laboratory Animal
Medicine, were available from previous studies. The MAC was defined
as the lectin protein concentration (exclusive of attached chemical
compounds) in the highest dilution showing visible
agglutination.
[0539] Briefly, an aqueous solution of a lectin composition was
added to the wells of a 96-well plate using dilutions so that the
lectin concentration spanned from about 0.1 to 1000 ug/ml. An
aliquot of the formaldehyde-treated Rabbit erythrocytes was then
pipetted into each well. At low lectin concentrations, there was
insufficient lectin to form a network of crosslinked cells and the
cells dropped to the bottom of the V-well forming what looks like a
dark pin-point circle at the bottom of the plate when viewed from
above. However, once the lectin concentration reached the minimum
agglutination concentration (MAC), the lectin molecules began
crosslinking the saccharide receptors on the erythrocyte surfaces,
resulting in a network that cannot settle to the bottom of the
V-well forming what looks like a large, opaque, diffuse circle when
viewed from above. The lowest concentration that produces the large
diffuse circle is the MAC value for a particular formulation.
[0540] The following table summarizes the MAC values for Con
A-based formulations synthesized according to the examples
described above (see also FIG. 17):
TABLE-US-00011 Modified lectin Affinity ligand type Synthesis
method MAC (ug/ml) Umodified -- -- <1 APG-Con A APG Example 42
128 APM-Con A APM Example 42 128 DEM-Con A AEM-diazirine Examples
43-44 >1,000
Example 47
Mitogenicity Assay
[0541] This example describes an assay that may be used to
characterize and thereby compare the T-cell mitogenicity of
different modified lectin compositions. Modifications and
alternatives to this typical assay will be apparent to those
skilled in the art. Peripheral blood mononuclear cells (PBMCs),
rather than highly purified T-cells, are used for this assay since
T-cell activation by lectins generally requires the presence of
non-T-cell populations collectively termed accessory cells (e.g.,
monocytes, dendritic cells). In a typical assay, PBMCs are isolated
from the whole blood of three healthy human donors and plated out
separately at about 100,000 cells per well in a 96 well plate.
Triplicate serial dilutions of different lectin compositions (e.g.,
native and treated) starting at 1000 (or 100) ug/ml concentration
are then added to the wells. The plates are incubated for three
days at 37 C, at which time 0.8 uCi of .sup.3H-thymidine is added
to each well for an additional 18 hours. The degree of mitogenicity
is then measured by .sup.3H-thymidine uptake by the proliferating
PBMCs. In some cases, the mitogenicity of a novel lectin
composition (e.g., a treated composition) is expressed as the %
maximal native mitogenicity. The % maximal native mitogenicity is
obtained by dividing the maximal CPM (counts per minute) value for
the modified lectin composition over all measured concentrations by
the maximal CPM value of the native lectin composition over all
measured compositions.
[0542] In previous studies we have found a strong correlation
between the MAC value and % Con A maximal mitogenicity, i.e., a
significant increase in MAC value leads to a significant decrease
in mitogenic effect. Therefore, MAC value is used in the present
disclosure as a surrogate for determining potential reductions in
mitogenicity for a given chemical modification.
V. Cross-Linked Materials for Controllably Releasing a
Conjugate
[0543] This fifth set of examples describes the preparation of
exemplary cross-linked materials for controllable releasing
conjugates. The examples also describe some of their in vitro and
in vivo properties.
Example 48
Cross-Linked Materials Prepared from Modified Con A
[0544] 0.50 ml of a 18 mg/ml DEM-Con A solution in S28 was added to
a centrifuge tube and subsequently mixed with 0.111 ml of a 1.18
mg/ml zinc acetate dihydrate deionized water solution. 0.50 ml of a
2.3 mg/ml solution of C6-amine-AEBM-2-insulin in pH 8.2, 25 mM
HEPES buffer containing 0.150 M sodium chloride (S14 buffer) was
then added followed by rapid mixing to form a dispersion of
insoluble particles. The dispersion was allowed to sit at room
temperature for 20 min and then separated from the supernatant by
centrifugation. The resulting cake was washed 2.times. with 1.0 ml
of pH 7.4, 25 mM HEPES buffer containing 0.150 M sodium chloride
(S24 buffer). During this process, the initial supernatant as well
as the 2.times. wash solutions were collected in one large
centrifuge tube. To the combined supernatant and wash solutions,
0.333 ml of a 1.18 mg/ml zinc acetate dihydrate deionized water
solution were added. The solution was allowed to stand for 20 min
after which any additional precipitated particles were isolated via
centrifugation and combined with the particles remaining from the
first two washing steps. This combined insoluble fraction was
washed an additional 3.times. with 0.333 ml of S24 buffer. The
remaining insoluble material was dispersed in 0.333 ml of S24
buffer and incubated overnight under mild agitation at 37 C. The
next day, the remaining particles were again isolated by
centrifugation and washed one additional time in 0.333 ml of S24.
The resulting insoluble material was dispersed in a total volume of
0.30 ml using S24 and set aside for future studies. This process
may be scaled up directly to produce any amount of desired product.
C6-amine-AEBM-2-insulin may be substituted in the above synthesis
with C6-amine-AETM-2-insulin (or any other conjugate) to produce a
formulation with different stimuli-responsive performance
characteristics.
Example 49
IPGTT Experiments in Non-Diabetic Rats
[0545] 0.300 ml of a given cross-linked material is injected
subcutaneously into each of three normal male Sprague Dawley (SD)
rats (Charles River Laboratories, location) weighing between 400
and 500 g. Prior to formulation injection, blood glucose values are
measured via tail vein bleeding using a Precision Xtra glucometer
(Abbott Laboratories, Alameda, Calif.) and approximately 100 ul of
serum is obtained via tail vein bleeding to assay for background
insulin levels. Food is removed from the rat cages during the
duration of the study. Serum and blood glucose values are obtained
at 30 min, 60 min, 90 min, and 120 min post-injection. At 120 min
after the injection, an intraperitoneal injection of a 38% w/v
glucose solution is injected to provide a 4 g/kg dose after which
serum and blood glucose values are obtained at 135 min, 150 min,
180 min, 210 min, 240 min, and 300 min. Serum insulin
concentrations are subsequently measured with a commercially
available ELISA kit (Human Insulin ELISA, Mercodia, Uppsala,
Sweden) using a standard curve generated from the pure insulin
conjugate solution.
[0546] FIGS. 18 and 19 show the results obtained with cross-linked
materials that were constructed from DEM-Con A and
C6-amine-AEBM-2-insulin or C6-amine-AETM-2-insulin, respectively
according to the procedures described in Example 48. The DEM-Con
A/C6-amine-AEBM-2 formulation shows .about.2.times. increase in
serum insulin concentration from baseline following the
intraperitoneal glucose tolerance test (IPGTT) indicating
glucose-responsive delivery in vivo. The DEM-Con A/C6-amine-AETM-2
formulation on the other hand shows 3-4.times. increase in serum
insulin concentration from baseline in response to glucose
following the IPGTT with significantly less material leaking out of
the system at physiologically normal glucose concentrations.
Furthermore, the injection sites in all animals receiving DEM-Con A
formulations showed absolutely no signs of inflammation or necrosis
due to the presence of the lectin further confirming the improved
safety profile of the photoaffinity-modified materials.
Example 50
Effect of Different Animal Sera on Glucose-Responsive Dissolution
of Insulin-Glycogen Cross-Linked Materials and Correlation to
Amylase Activity
[0547] This example describes the in vitro dissolution in various
animal sera as a function of glucose concentration for
glucose-responsive formulations synthesized using an
insulin-glycogen based conjugate. The insulin-glycogen conjugate
was synthesized according to the following procedure. First, 62.5
ml of a 10 mg/ml recombinant human insulin solution (RHI) in pH
8.2, 25 mM HEPES buffer (Sigma-Aldrich, St. Louis, Mass.) was
adjusted to pH 9.0 and cooled on ice to produce the RHI stock
solution. Separately, 0.312 ml of triethylamine (TEA,
Sigma-Aldrich, St. Louis, Mass.) was dissolved in 3 ml of DI water
to produce the TEA stock solution. Separately, 0.300 g of
cyanodimethylamino pyridinium tetrafluoroborate (CDAP,
Sigma-Aldrich, St. Louis, Mo.) was dissolved in 1.2 ml of DMSO to
produce the CDAP Stock solution. Separately, 100 mg of
mannosamine-HCl (Sigma-Aldrich, St. Louis, Mo.) was dissolved in
1.5 ml of a 100 mM pH 9 HEPES saline buffered saline solution and
pH adjusted to 9.0 to produce the mannosamine stock solution.
Separately, 2.0 g of oyster Type IX glycogen (Sigma-Aldrich, St.
Louis, Mo.) was dissolved in 40 ml of a 100 mM pH 9 HEPES saline
buffered saline solution after which the solution was clarified by
filtration and cooled on an ice bath. Next, 1 ml of the CDAP stock
solution was added to the glycogen solution and mixed for one
minute after which 1 ml of the TEA solution was added and the pH of
the resulting solution adjusted to 9.0. After an additional 1
minute of stirring, 62 ml of the RHI solution were added and the
resulting solution stirred for five minutes followed by addition of
1.065 ml of the mannosamine solution. The solution was stirred
overnight at room temperature, ultrafiltered exhaustively against
deionized water using a 50 kDa MWCO polyethersulfone disc membrane
filter (Millipore, Bedford, Mass.), and lyophilized. The resulting
powder was then purified 3.times. from unconjugated insulin by gel
filtration HPLC (Waters, Milford, Mass.) using a 1 M acetic acid
mobile phase over a Superdex.TM. 30 HiLoad 16/60 (Amersham
Biosciences, Piscataway, N.J.) packed column. The insulin glycogen
fraction was then lyophilized to obtain the conjugate as a pure
white powder.
[0548] Twenty-four glucose-responsive formulations were prepared
using acetylated Con A (ACA) as the multivalent crosslinking agent
in the following manner. 200 ul of a 25 mg/ml insulin-glycogen
conjugate solution in pH 7.0 HEPES buffered saline was mixed with
200 ul of a 25 mg/ml chemically-modified, acetylated Con A (ACA)
solution in pH 7.0 HEPES buffered saline and allowed to stand for
20 minutes. Next, each formulation was centrifuged and washed
5.times. at room temperature with 400 ul of pH 7.0 HEPES buffered
saline. After the last wash and centrifugation, the supernatant was
discarded and the remaining insoluble material dispersed in 50 ul
of 1.times.PBS.
[0549] The 24.times.50 ul dispersions were added to a 96-well plate
along with 50 ul of serum from a particular animal species
containing a specific amount of glucose according to the following
format:
TABLE-US-00012 Insulin-glycogen/ACA cross-linked material Species
sera Glucose Concentration (mg/dl) pH 7, 1x PBS Rat Pig Human 0 1 7
13 19 50 2 8 14 20 100 3 9 15 21 200 4 10 16 22 400 5 11 17 23 800
6 12 18 24
[0550] At the start of the experiment each well appeared white and
opaque (as measured by a decrease in light transmission or increase
in absorbance at 450 nm, A450). The 96-well plate was then
incubated for 6 hours at 37 C after which the A450 value for each
well was measured again. The % of the formulation remaining was
calculated by dividing the A450 (final) by the A450 (initial) and
multiplying by 100. If all the material had dissolved, the A450
value was close to zero indicating almost 0% remaining.
Alternatively, if no material had dissolved, the A450 was close to
the initial value indicating almost 100% remaining.
[0551] The results in FIG. 20 show that the cross-linked materials
constructed from insulin-glycogen conjugates dissolve in an ideal
glucose responsive manner over the six hour study when incubated in
buffered saline. However, the materials dissolve completely
regardless of the glucose concentration when incubated in pig
serum. Rat serum maintains some glucose responsiveness but
dissolves significantly over six hours even in the absence of
glucose. Over 20% of the material incubated in human serum still
dissolves in the absence of glucose.
[0552] These differences were correlated to each species' intrinsic
amylase and glucosidase digestion activity by first developing a
microplate assay that takes advantage of the production of a
colorimetric signal from oligosaccharides connected through linear
.alpha.-1,4 glycosidic bonds like glycogen. To investigate amylase
activity, 4-Nitrophenyl
.alpha.-D-penta-(1.fwdarw.4)-glucopyranoside (Sigma Aldrich, St.
Louis, Mo.) was used, and 4-Nitrophenyl .alpha.-D-glucopyranoside
(Sigma Aldrich, St. Louis, Mo.) was used to investigate glucosidase
activity. For each assay, serum from a particular species was
diluted by increasing amounts with 1.times.PBS and a known
concentration of colorimetric reporter was spiked into the solution
after which the absorbance signal at 405 nm (A405) was measured as
a function of time. FIGS. 21a and 21b illustrate the A405
production due to enzyme activity in each of the different species
of serum tested for amylase and glucosidase activity, respectively.
Here we see that at a 1:8 dilution of serum in PBS, porcine serum
exhibits approximately 17.times. the digestion activity of rat
serum. Furthermore, there appears to be almost no activity
whatsoever in the human serum tested under these conditions.
Therefore, the differences in the material dissolution profiles in
each species' serum are directly correlated with the ability for
that species' serum to digest the underlying glycogen conjugate.
Taken together, these results provided the impetus for designing a
subcutaneous bioactive conjugate such as the ones described in this
disclosure to circumvent the glycogen-digestion limitation but
still form glucose-responsive materials.
Example 51
Glucose-Responsive Material Using ACA and an AEM-2 Conjugate
[0553] This example describes the formation of glucose-responsive
insoluble materials using a conjugate synthesized with TSAT-C6 as
the framework, AEM as the affinity ligand, and
NH.sub.2--B1-BOC2(A1,B29)-insulin as the drug. 50 ul of a 2 mg/ml
conjugate solution in pH 8.2 HEPES buffered saline was mixed with
50 ul of a 25 mg/ml chemically-modified, acetylated Con A (ACA)
solution in pH 7.0 HEPES buffered saline in each well of a 96-well
microplate. Each well contained 5.5 ul of a concentrated glucose
solution of increasing concentrations to produce final
concentrations equal to 0, 50, 100, 200, 400, 800, and 1600 mg/dl.
The final well contained 5.5 ul of the highly potent alpha-methyl
mannose sugar inhibitor such that the final concentration was 100
mM. The ability of the ACA/conjugate mixture to precipitate in the
presence of increasing glucose concentrations was then evaluated.
When the combination forms an insoluble network, the well appears
white and opaque (as measured by a decrease in light transmission
or increase in absorbance at 450 nm, A450) as shown in FIG. 22.
When the glucose concentration is high enough, the contents of the
entire well become soluble and clear (as measured by an increase in
light transmission or decrease in absorbance at 450 nm, A450). The
results clearly show that this particular formulation is most
responsive to concentrations between 100 and 400 mg/dl, an ideal
candidate for in vivo testing. Furthermore, as described below,
this particular conjugate exhibits almost the same subcutaneous
bioactivity as unconjugated insulin without requiring enzymatic
digestion to exert its biological effects.
Example 52
Similar Performance Across all Animal Sera
[0554] This example describes the in vitro dissolution in various
animal sera as a function of glucose concentration for the
glucose-responsive formulation of Example 51. 24.times.50 ul
dispersions were added to a 96-well plate along with 50 ul of serum
from a particular animal species containing a specific amount of
glucose according to the following format:
TABLE-US-00013 Insulin-glycogen/ACA cross-linked material Species
sera Glucose Concentration (mg/dl) pH 7, 1x PBS Rat Pig Human 0 1 7
13 19 50 2 8 14 20 100 3 9 15 21 200 4 10 16 22 400 5 11 17 23 800
6 12 18 24
[0555] At the start of the experiment each well appeared white and
opaque (as measured by a decrease in light transmission or increase
in absorbance at 450 nm, A450). The 96-well plate was then
incubated for 6 hours at 37 C after which the A450 value for each
well was measured again. The % of the formulation remaining was
calculated by dividing the A450 (final) by the A450 (initial) and
multiplying by 100. If all the material had dissolved, the A450
value was close to zero indicating almost 0% remaining.
Alternatively, if no material had dissolved, the A450 was close to
the initial value indicating almost 100% remaining. The results are
shown in FIG. 22.
[0556] When compared to the insulin-glycogen formulation tested
under the same conditions (see FIG. 20), this new formulation was
not only glucose-responsive and resistant to dissolution at low
glucose concentrations, but its glucose-responsive properties were
nearly identical in all the species tested (see FIG. 23).
Example 53
Glucose-Responsive Material Using ACA and an AEM-2 Conjugate
[0557] This example describes an alternative method for forming
glucose-responsive insoluble materials using a conjugate
synthesized with TSAT-C6 as the framework, AEM as the affinity
ligand, and NH.sub.2--B1-BOC2(A1,B29)-insulin as the drug. 0.50 ml
of a 2.3 mg/ml solution of conjugate in pH 8.2, 25 mM HEPES buffer
containing 0.150 M sodium chloride (S14 buffer) was added to a
centrifuge tube and subsequently mixed rapidly with 0.500 ml of a
25 mg/ml ACA solution in pH 7.4, 25 mM HEPES buffer containing
0.150 M sodium chloride (S24 buffer) to form a dispersion of
insoluble particles. The dispersion was allowed to sit at room
temperature for 20 min and then separated from the supernatant by
centrifugation. The resulting cake was washed 5.times. with 1.0 ml
of pH 7.4, 25 mM HEPES buffer containing 0.150 M sodium chloride
(S24 buffer). After the last wash, the remaining insoluble material
was incubated overnight at 37 C. The next day, the remaining
particles were again isolated by centrifugation and washed one
additional time in 1.0 ml of S24. The resulting insoluble material
was dispersed in a total volume of 0.30 ml using S24 and set aside
for future studies. This process may be scaled up directly to
produce any amount of desired product.
Example 54
IPGTT Experiments in Non-Diabetic Rats
[0558] 0.300 ml of the material prepared in Example 53 was injected
subcutaneously into each of three normal male Sprague Dawley (SD)
rats (Charles River Laboratories, Wilmington, Mass.) weighing
between 400 and 500 g. Prior to formulation injection, blood
glucose values were measured via tail vein bleeding using a
Precision Xtra glucometer (Abbott Laboratories, Alameda, Calif.)
and approximately 100 ul of serum was obtained via tail vein
bleeding to assay for background insulin levels. Food was removed
from the rat cages during the duration of the study. Serum and
blood glucose values were obtained at 30 min, 60 min, 90 min, and
120 min post-injection. At 120 min after the injection, an
intraperitoneal injection of a 38% w/v glucose solution was
injected to provide a 4 g/kg dose after which serum and blood
glucose values were obtained at 135 min, 150 min, 180 min, 210 min,
240 min, and 300 min. Serum insulin concentrations were
subsequently measured with a commercially available ELISA kit
(Human Insulin ELISA, Mercodia, Uppsala, Sweden) using a standard
curve generated from the pure insulin conjugate solution.
Endogenous rat insulin does not cross-react on this assay;
therefore, any results obtained were due solely to the exogenously
administered insulin conjugate and not from endogeneous insulin
from the animal (See Human Insulin ELISA kit instructions,
Mercodia, Uppsala, Sweden).
[0559] In a separate experiment, 0.300 ml of saline was injected
subcutaneously into each of three normal male Sprague Dawley (SD)
rats (Charles River Laboratories, Wilmington, Mass.) weighing
between 400 and 500 g. Prior to saline injection, blood glucose
values were measured via tail vein bleeding using a Precision Xtra
glucometer (Abbott Laboratories, Alameda, Calif.) and approximately
100 ul of serum was obtained via tail vein bleeding to assay for
background insulin levels. Food was removed from the rat cages
during the duration of the study. Serum and blood glucose values
were obtained at 30 min, 60 min, 90 min, and 120 min
post-injection. At 120 min after the injection, an intraperitoneal
injection of a 38% w/v glucose solution was injected to provide a 4
g/kg dose after which serum and blood glucose values were obtained
at 135 min, 150 min, 180 min, 210 min, 240 min, and 300 min. Serum
insulin concentrations were subsequently measured with a
commercially available ELISA kit specific for Rat Insulin (Rat
Insulin ELISA, Mercodia, Uppsala, Sweden). The results from this
experiment established the glucose-responsive endogenous insulin
secretion produced by the pancreas in a normal, non-diabetic
rat.
[0560] In a separate experiment, 5 U/kg of recombinant human
insulin (RHI, Sigma-Aldrich, St. Louis, Mo.) was injected
subcutaneously into each of three normal male Sprague Dawley (SD)
rats (Charles River Laboratories, Wilmington, Mass.) weighing
between 400 and 500 g. Prior to the RHI injection, blood glucose
values were measured via tail vein bleeding using a Precision Xtra
glucometer (Abbott Laboratories, Alameda, Calif.) and approximately
100 ul of serum was obtained via tail vein bleeding to assay for
background insulin levels. Food was removed from the rat cages
during the duration of the study. Serum and blood glucose values
were obtained at 30 min, 60 min, 90 min, and 120 min
post-injection. At 120 min after the injection, an intraperitoneal
injection of a 38% w/v glucose solution was injected to provide a 4
g/kg dose after which serum and blood glucose values were obtained
at 135 min, 150 min, 180 min, 210 min, 240 min, and 300 min. Serum
insulin concentrations were subsequently measured with a
commercially available ELISA kit (Human Insulin ELISA, Mercodia,
Uppsala, Sweden) using a standard curve generated from the pure
insulin conjugate solution. Endogenous rat insulin does not
cross-react on this assay; therefore, any results obtained were due
solely to the exogenously administered insulin conjugate and not
from endogeneous insulin from the animal (See Human Insulin ELISA
kit instructions, Mercodia, Uppsala, Sweden).
[0561] FIG. 24a shows .about.2.times. increase in serum insulin
concentration from baseline following the intraperitoneal glucose
tolerance test (IPGTT) indicating glucose-responsive delivery in
vivo. Furthermore, the peak-baseline release profile compares
favorably to the glucose-responsive endogenous insulin production
in a normal, non-diabetic rat (see FIG. 24b). Finally, FIG. 25
shows that RHI injected and analyzed under the same exact
conditions is absorbed and eliminated rapidly causing severe
hypoglycemia during the first 120 minutes and fails to exhibit any
measurable glucose-responsive profile after IPGTT
administration.
Example 55
Normo-/Hyper-Glycemic Clamp Experiments in Non-Diabetic Rats
[0562] This example describes the use of glucose clamps to maintain
glucose levels in rats at a constant value to obtain the steady
state serum insulin concentration as a function of glucose
concentration. 0.300 ml (.about.0.6 ml/kg of body weight) of the
material prepared in Example 53 was injected subcutaneously into
each of four normal, double jugular vein catheterized, male Sprague
Dawley (SD) rats (Charles River Laboratories, Wilmington, Mass.)
weighing between 300 and 400 g. One catheter from each rat was
connected to a variable rate syringe pump containing a concentrated
glucose solution. Blood glucose values were measured via tail vein
bleeding every five minutes using a Precision Xtra glucometer
(Abbott Laboratories, Alameda, Calif.) and the syringe pump
intravenous infusion rate was adjusted periodically for the first
two hours post-injection to maintain the rats at 100 mg/dl. After
the first two hours, the glucose infusion rate was increased to and
maintained at 400 mg/dl for an additional two hours. Serum was
collected at regular intervals for insulin concentration (Human
Insulin ELISA, Mercodia, Uppsala, Sweden) and blood glucose values.
As shown in FIG. 26 this material exhibits a steady state increase
in glucose concentration of .about.4.times. from 100 to 400 mg/dl
(p<0.05) and a near 1:1 matching between glucose and insulin
levels (p<0.0001).
Example 56
Normo-/Hyper-Glycemic Clamp Experiments in Non-Diabetic Pigs and
Correspondence to Results Obtained in Rats
[0563] Because the particular material of Example 53 did not show
significant differences in dissolution rates between rat and pig
serum, the following experiment was performed to determine if
similar glucose-responsive profiles could be obtained in pigs.
0.300 ml (.about.0.012 ml/kg of body weight) of the material
prepared in Example 53 was injected subcutaneously into each of
four normal, jugular vein catheterized, male Yucatan Miniature pigs
(Sinclair Research, Columbia, Mo.) weighing 20-25 kg. The catheter
from each pig was connected to a variable rate syringe pump
containing a concentrated glucose solution. Blood glucose values
were measured via intravenous catheter blood withdrawals every five
minutes using a Precision Xtra glucometer (Abbott Laboratories,
Alameda, Calif.) and the syringe pump intravenous infusion rate was
adjusted periodically for the first two hours post-injection to
maintain the pigs at 65 mg/dl. After the first two hours, the
glucose infusion rate was increased to and maintained at 400 mg/dl
for an additional two hours. Serum was collected at regular
intervals for insulin concentration and blood glucose values.
Because the insulin conjugate cross-reacts with endogenous porcine
insulin, a new assay methodology was developed and implemented to
detect the insulin in pigs. First, a radioimmunoassay (RIA) kit
(Millipore, Billerica, Mass.) was developed to detect both porcine
and the exemplary insulin conjugate with roughly the same signal to
noise. The signal on this kit due to endogenous porcine insulin was
determined by running a particular blank pig serum sample on a
c-Peptide RIA kit (Millipore, Billerica, Mass.) and on the insulin
RIA kit. Once the resulting correlation was determined, any serum
sample RIA insulin signal could be converted into a contribution
from endogenous insulin and conjugated insulin.
[0564] Using this method, FIG. 27 was constructed to display the
net conjugate serum insulin levels (endogenous porcine insulin
already subtracted), which shows that this formulation exhibits a
steady state increase in glucose concentration of .about.6.times.
from 65 to 400 mg/dl (p<0.05) and a near 1:1 matching between
glucose and insulin levels (p<0.0001). Therefore, the
formulation performs in nearly the same glucose-responsive manner
in both rats and pigs.
Example 57
Conjugates of Formula (Iv)
[0565] This example describes some exemplary conjugates of formula
(IV):
##STR00045##
[0566] Yet other embodiments of these conjugates as well as
intermediates and methods of making these conjugates can be found
in U.S. Provisional Application No. 61/162,105 filed Mar. 20, 2009
and corresponding PCT application filed Jan. 27, 2010. The entire
contents of these related applications are incorporated herein by
reference.
[0567] In certain embodiments, a conjugate of formula (IV) may
include one or more of the following exemplary groups:
R.sup.x
[0568] In certain embodiments, R.sup.x is hydrogen. In certain
embodiments, R.sup.x is optionally substituted C.sub.1-6 alkyl. In
certain embodiments, R.sup.x is optionally substituted C.sub.1-3
alkyl. In certain embodiments, R.sup.x is optionally substituted
methyl. In certain embodiments, R.sup.x is --CH.sub.3.
Z.sup.1
[0569] In certain embodiments, Z.sup.1 is an optionally substituted
bivalent C.sub.1-10, C.sub.1-8, C.sub.1-6, C.sub.1-4, or C.sub.1-2
hydrocarbon chain. In certain embodiments, Z.sup.1 is
--(CH.sub.2)--, --(CH.sub.2CH.sub.2)--,
--(CH.sub.2CH.sub.2CH.sub.2)--,
--(CH.sub.2CH.sub.2CH.sub.2CH.sub.2)--,
--(CH.sub.2CH.sub.2CH.sub.2CH.sub.2CH.sub.2)--, or
--(CH.sub.2CH.sub.2CH.sub.2CH.sub.2CH.sub.2CH.sub.2)--. In certain
embodiments, Z.sup.1 is --(CH.sub.2)--, or --(CH.sub.2CH.sub.2)--.
In certain embodiments, Z.sup.1 is --(CH.sub.2)--. In certain
embodiments, Z.sup.1 is --(CH.sub.2CH.sub.2)--. In certain
embodiments, Z.sup.1 is --(CH.sub.2CH.sub.2CH.sub.2)--. In certain
embodiments, Z.sup.1 is --(CH.sub.2CH.sub.2CH.sub.2CH.sub.2)--.
[0570] In certain embodiments, Z.sup.1 is an optionally substituted
bivalent C.sub.1-10 hydrocarbon chain, wherein 1, 2 or 3 methylene
units of Z.sup.1 are optionally and independently replaced with one
or more groups selected from --S--, --O--, --NR.sup.a--,
--(C.dbd.NR.sup.a)--, --(C.dbd.O)--, --(S.dbd.O)--,
--S(.dbd.O).sub.2--, --(CR.sup.b.dbd.CR.sup.b)--, --(N.dbd.N)--, an
optionally substituted arylene moiety or an optionally substituted
heteroarylene moiety. In certain embodiments, Z.sup.1 is an
optionally substituted bivalent C.sub.1-10 hydrocarbon chain,
wherein 1, 2 or 3 methylene units of Z.sup.1 are optionally and
independently replaced with one or more groups selected from --S--,
--O--, --NR.sup.a--, --(C.dbd.NR.sup.a)--, or --(C.dbd.O)--. In
certain embodiments, Z.sup.1 is
--CH.sub.2CH.sub.2NH(C.dbd.O)C(CH.sub.3).sub.2--,
--CH.sub.2CH.sub.2N(C.dbd.NH)(CH.sub.2).sub.3S--,
--CH(R.sup.f).sub.2, --CH.sub.2CH(R.sup.f).sub.2,
--CH.sub.2CH.sub.2CH(R.sup.f).sub.2--, --CH.sub.2S--, or
--CH.sub.2CH.sub.2S--, wherein R.sup.f is optionally substituted
aliphatic, optionally substituted heteroaliphatic, optionally
substituted aryl, optionally substituted heteroaryl (e.g., in
certain embodiments, R.sup.f is optionally substituted aryl; in
certain embodiments, R.sup.f is phenyl). In certain embodiments,
Z.sup.1 is --CH.sub.2CH.sub.2NH(C.dbd.O)C(CH.sub.3).sub.2-- or
--CH.sub.2CH.sub.2N(C.dbd.NH)(CH.sub.2).sub.3S--. In certain
embodiments, Z.sup.1 is
--CH.sub.2CH.sub.2NH(C.dbd.O)C(CH.sub.3).sub.2--. In certain
embodiments, Z.sup.1 is
--CH.sub.2CH.sub.2N(C.dbd.NH)(CH.sub.2).sub.3S--.
Y.sup.1
[0571] In certain embodiments, Y.sup.1 is a fragment of a free
radical initiator. Such a fragment is encompassed by the definition
of Y', as initiator fragments may include halogen, --OR.sup.e,
--SR.sup.e, optionally substituted aliphatic, optionally
substituted heteroaliphatic, optionally substituted aryl, and
optionally substituted heteroaryl moieties.
[0572] In certain embodiments, Y.sup.1 is hydrogen, halogen, or an
initiator fragment. In certain embodiments, Y.sup.1 is hydrogen or
halogen. In certain embodiments, Y.sup.1 is hydrogen or
bromine.
X.sup.1
[0573] certain embodiments, X.sup.1 is --OR.sup.c. In certain
embodiments, X.sup.1 is a mixture of --OR.sup.c and
--N(R.sup.d).sub.2. In certain embodiments, X.sup.1 is
--N(R.sup.d).sub.2.
W.sup.1 and
[0574] In certain embodiments, is a single covalent bond.
[0575] In certain embodiments, W.sup.1 is covalently bound to the
polymer via an amino group. In certain embodiments, W.sup.1 is
covalently bound to the polymer via a primary amino group.
[0576] For example, in certain embodiments, the group
##STR00046##
corresponds to the group
##STR00047##
wherein the group [Drug-NH--] or [Drug-N.dbd.] is the drug directly
covalently conjugated via a primary amino group. In other
embodiments, the drug may include a spacer group (e.g., an alkylene
group, arylene group, heteroarylene group, ester linkage, amide
linkage, and the like) which terminates with a pendant amino group.
The latter embodiments enable greater separation between the active
portion of the drug and the polymer. r
[0577] In certain embodiments, r is an integer between 10-25,
inclusive. In certain embodiments, r is an integer between 15-25,
inclusive. In certain embodiments, r is an integer between 20-25,
inclusive. In certain embodiments, r is an integer between 5-20,
inclusive. In certain embodiments, r is an integer between 10-20,
inclusive. In certain embodiments, r is an integer between 15-20,
inclusive. In certain embodiments, r is 5, 6, 7, 8, 9, 10, 11, 12,
13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25. In certain
embodiments r is 5. In certain embodiments r is 10. In certain
embodiments r is 15. In certain embodiments r is 20. In certain
embodiments r is 25.
[0578] In certain embodiments, the group:
##STR00048##
[0579] corresponds to a mixture of the groups:
##STR00049##
[0580] wherein the sum of (g+t) is equal to r. In certain
embodiments, each instance of g and t is, independently, an integer
between 1 and 24, inclusive, with the proviso that the sum of (g+t)
is greater than or equal to 5 and less than or equal to 25. In
certain embodiments, g and t are present in a ratio of about 1:10,
1:9, 1:8, 1:7, 1:6, 1:5, 1:4, 1:3, 1:2, or 1:1 (g to t). In certain
embodiments, t and g are present in a ratio of about 1:10, 1:9,
1:8, 1:7, 1:6, 1:5, 1:4, 1:3, or 1:2 (t to g).
Exemplary Conjugates
[0581] In certain embodiments, a conjugate of formula (IV-a1) may
be used:
##STR00050##
[0582] In certain embodiments, a conjugate of formula (IV-a2) may
be used:
##STR00051##
[0583] In certain embodiments, a conjugate of formula (IV-b1) may
be used:
##STR00052##
[0584] In certain embodiments, a conjugate of formula (IV-b2) may
be used:
##STR00053##
[0585] In certain embodiments, a conjugate of formula (IV-c1) may
be used:
##STR00054##
[0586] In certain embodiments, a conjugate of formula (IV-c2) may
be used:
##STR00055##
[0587] In any of these exemplary conjugates, the group:
##STR00056##
[0588] may correspond to a mixture of the groups:
##STR00057##
[0589] wherein the sum of (g+t) is equal to r, respectively. In
certain embodiments, r is 10. In certain embodiments, r is 20.
Characterization of Conjugates
[0590] The conjugates can be characterized by any analytical method
including nuclear magnetic resonance (e.g., .sup.1H NMR); gel
permeation chromatography (GPC) for molecular weight and
polydispersity; and Fourier transform infrared spectroscopy (FTIR)
or acid titration for determination of the number of acid groups
per chain.
[0591] In certain embodiments the conjugate framework (i.e.,
without including the affinity ligands, drug or detectable label)
has a molecular weight of less than 10,000 Da, e.g., in the range
of about 100 to about 10,000 Da. In certain embodiments, the
conjugate framework has a molecular weight in the range of about
300 to about 5,000 Da. In certain embodiments, the conjugate
framework has a molecular weight in the range of about 500 to about
2,500 Da. In certain embodiments, the conjugate framework has a
molecular weight in the range of about 1,000 to 2,000 Da. In
certain embodiments, the conjugate framework has a molecular weight
in the range of about 200 to 1,000 Da. In certain embodiments, the
conjugate framework has a molecular weight in the range of about
300 to 800 Da.
[0592] In certain embodiments, a mixture of conjugates is
generated. The conjugates in this mixture may have the same or
different molecular weights. In one embodiment, the polydispersity
of the mixture is less than 1.5. In one embodiment, the
polydispersity of the mixture is less than 1.25.
Example 58
Conjugates of Formula (V)
[0593] This example describes some exemplary conjugates of formula
(V):
##STR00058##
[0594] Yet other embodiments of these conjugates as well as
intermediates and methods of making these conjugates can be found
in U.S. Provisional Application No. 61/147,878 filed Jan. 28, 2009,
U.S. Provisional Application No. 61/159,643 filed Mar. 12, 2009,
U.S. Provisional Application No. 61/162,107 filed Mar. 20, 2009,
U.S. Provisional Application No. 61/163,084 filed Mar. 25, 2009,
U.S. Provisional Application No. 61/219,897 filed Jun. 24, 2009,
U.S. Provisional Application No. 61/223,572 filed Jul. 7, 2009,
U.S. Provisional Application No. 61/252,857 filed Oct. 19, 2009,
and corresponding PCT application filed on Jan. 27, 2010. The
entire contents of these related applications are incorporated
herein by reference.
[0595] In some embodiments, the present disclosure provides
conjugates of general formula (IX-a):
##STR00059##
[0596] For example, in some embodiments, the present disclosure
provides conjugates of formula:
##STR00060##
[0597] In some embodiments, the present disclosure provides
conjugates of general formula (IX-a):
##STR00061##
[0598] For example, in some embodiments, the present disclosure
provides conjugates of formula:
##STR00062##
[0599] In some embodiments, the present disclosure provides
conjugates of general formula (IX-a):
##STR00063##
[0600] For example, in some embodiments, the present disclosure
provides conjugates of formula:
##STR00064##
Characterization of Conjugates
[0601] The conjugates can be characterized by any analytical method
including nuclear magnetic resonance (e.g., .sup.1H NMR); gel
permeation chromatography (GPC) for molecular weight and
polydispersity; Fourier transform infrared spectroscopy (FTIR),
etc.
[0602] In certain embodiments the conjugate framework (i.e.,
without including the affinity ligands, drug or detectable label)
has a molecular weight of less than 10,000 Da, e.g., in the range
of about 100 to about 10,000 Da. In certain embodiments, the
conjugate framework has a molecular weight in the range of about
300 to about 5,000 Da. In certain embodiments, the conjugate
framework has a molecular weight in the range of about 500 to about
2,500 Da. In certain embodiments, the conjugate framework has a
molecular weight in the range of about 1,000 to 2,000 Da. In
certain embodiments, the conjugate framework has a molecular weight
in the range of about 200 to 1,000 Da. In certain embodiments, the
conjugate framework has a molecular weight in the range of about
300 to 800 Da.
Example 59
Preparation of Fluorescently-Labeled Polysaccharides
[0603] This example describes a method for making fluorescent
polysaccharides, specifically tetramethylrhodamine isothiocyanate
(TRITC, Sigma Aldrich, St. Louis, Mo.) derived mannan which is
sometimes used in FRET-based glucose sensors. The TRITC-mannan
compound is the one used in the application of Example 60.
[0604] Briefly, in a Schlenk tube under nitrogen, 1 g of mannan
(Sigma Aldrich, St. Louis, Mo.) is dissolved in 20 ml of
dimethylsulfoxide (DMSO, Sigma Aldrich, St. Louis, Mo.) at 95 C
until the solution is clear. Next two drops of pyridine (anhydrous,
Sigma Aldrich, St. Louis, Mo.) are added to the mixture. 20 mg of
TRITC powder is added directly to the heated solution, and then 10
ul of a dibutyltin dilaurate (Sigma Aldrich, St. Louis, Mo.) is
added and the mixture is allowed to react for 2 hours, after which
time the flask is removed from the temperature bath and allowed to
cool. The TRITC-mannan is purified by several precipitation cycles
using 50:50 ethanol:diethyl ether mixtures, where the precipitate
is centrifuged at 2000.times.g for 10 min (Allegra 21R, Beckman
Coulter, Fullerton, Calif.) and redissolved in the minimum amount
of deionized water to redissolve the centrifuged particle cake
between each precipitation step. This is repeated until no visible
red or orange color was visibly seen in the supernatant after
centrifuging the solution under the above conditions. The
precipitate is redissolved in deionized water a final time and
lyophilized to give the purified TRITC-mannan product.
Example 60
Use of modified lectin compositions in FRET applications
[0605] This method describes an application of the inventive
modified Con A compositions as a glucose sensor based on
fluorescence resonance energy transfer (FRET). FRET is based on the
fact that when two different fluorophores are brought closely
together this allow for energy transfer between the two
fluorophores, resulting in a decrease in the fluorescence of one or
both of the fluorophores, which is called fluorescence quenching
(Ballerstadt et al., Anal. Chim. Acta 345:203-212, 1997).
[0606] In the absence of a saccharide inhibitor, a mixture of a
fluorescent modified Con A and a fluorescent polysaccharide will
form a compact gel and the neighboring fluorophores will undergo
FRET. In the presence of a saccharide inhibitor such as glucose,
the average distance between the fluorescent modified Con A and the
fluorescent polysaccharide will increase causing the level of FRET
to decrease and thereby leading to an increase in the individual
fluorescence signals.
[0607] Because of their improved safety profile the inventive
modified Con A compositions may provide for a safe in vivo glucose
sensor than those that use unmodified Con A.
[0608] The following in vitro tests are performed using a modified
Con A of the present disclosure. A FITC-labeled modified Con A can
be made using fluorescein isothiocyanate (FITC, Sigma Aldrich, St.
Louis, Mo.). The purified FITC-modified Con A is then mixed with
TRITC-mannan synthesized according to Example 59.
[0609] Three stock solutions are made as follows:
[0610] (i) FITC-modified Con A--60 mg of FITC-modified Con A is
dissolved in 2 ml of 100 mM BES, pH 7, 1.0 M NaCl, 1 mM MnCl.sub.2
and 1 mM CaCl.sub.2.
[0611] (ii) TRITC-mannan Stock--60 mg of TRITC-mannan is dissolved
in 2 ml of 100 mM BES, pH 7, 1.0 M NaCl, 1 mM MnCl.sub.2 and 1 mM
CaCl.sub.2.
[0612] (iii) Glucose Stock--a 1200 mg/dl glucose solution is made
by dissolving 1200 mg glucose in 100 ml of 100 mM BES, pH 7, 1.0 M
NaCl, 1 mM MnCl.sub.2 and 1 mM CaCl.sub.2. [0613] 1:2 serial
dilutions of the FITC-modified Con A and TRITC-mannan stock
solutions are then performed in 100 mM BES, pH 7, 1.0 M NaCl, 1 mM
MnCl.sub.2 and 1 mM CaCl.sub.2 separately so that the final
concentrations of FITC-modified Con A and TRITC-Mannan are 30, 3,
0.3, 0.03, 0.003, 0.0003, 0.00003, and 0.000003 mg/ml. The stock
solutions are mixed together, e.g., on a 96-well microtiter plate
(VWR Scientific, Bridgeport, N.J.). The plate is designed so that
the final concentrations of all components are decreased by a
factor of 3.times. after mixing all solutions together.
[0614] After mixing the solutions together, the fluorescence of the
plate is assayed by a fluorescence plate reader (fmax, Molecular
Devices, Sunnyvale, Calif.) using the 485/525 nm filter pair for
FITC and 544/590 nm filter pair for measuring TRITC
fluorescence.
[0615] After measuring with both sets of filter pairs using the
1200 mg/dl glucose buffer at room temperature, the plate is heated
to 37 C using the plate reader incubator function. After 30 minutes
of equilibration, the plate is read for both FITC and TRITC
fluorescence a second time. After which the plate is allowed to
recool to room temperature.
[0616] Rows 2, 4, 6, and 8 all receive another 50 ul of a 9600
mg/dl glucose solution, while Rows 1, 3, 5, and 7 all receive
another 50 ul of buffer. The plate is read a third time at room
temperature, and the process is repeated a final time using 0.1 M
Methyl-.alpha.-mannopyrannoside.
[0617] Further optimization of the glucose sensor can be made by
adjusting the affinity of the polymer, optimizing the fluorescence
loading of the modified Con A and TRITC-mannan, and rerunning the
experiment on a fluorescence spectrophotometer to allow for the
maximum FRET or FRET quenching compared to the plate reader/filter
pair setup.
Example 61
Viscosimetric Glucose Sensor
[0618] This example demonstrates how a modified Con A composition
can be used in a system that is capable of detecting glucose based
on the changes in viscosity of a glucose-responsive solution. A
modified Con A composition is dissolved in a 20 mM BES buffer at pH
7 containing 1 mM MnCl.sub.2 and CaCl.sub.2 at a concentration of
100 mg Con A equivalents/ml. Separately, yeast mannan
(Sigma-Aldrich, St. Louis, Mo.) is dissolved in five solutions of
200 mM BES buffer at pH 7 at a concentration of 50 mg/ml with each
solution containing 0, 100, 800, 1600, and 3200 mg/dl of glucose,
respectively. 0.700 ml of the modified Con A stock solution is
mixed with each of the five mannan stock solutions containing the
varying concentrations of glucose such that the five resulting
solutions contain 0, 50, 400, 800, and 1600 mg/dl of glucose.
[0619] The viscosity of each solution is measured as a function of
shear rate using a microviscometer set up in a cone-and-plate
geometry. The cone measures 4 cm in diameter and has a 2 degree
angle, requiring a sample volume of 0.58 ml. A solvent trap is used
to reduce sample evaporation. Steady state flow viscosity is
measured for a range of shear rates for each sample at both 22 C
and 37 C.
[0620] When this liquid is contacted by a body fluid, the measured
viscosity will directly correlate to the fluid's glucose
concentration.
Other Embodiments
[0621] Other embodiments of the invention will be apparent to those
skilled in the art from a consideration of the specification or
practice of the invention disclosed herein. It is intended that the
specification and examples be considered as exemplary only, with
the true scope and spirit of the invention being indicated by the
following claims.
Sequence CWU 1
1
2121PRTHomo sapiens 1Gly Ile Val Glu Gln Cys Cys Thr Ser Ile Cys
Ser Leu Tyr Gln Leu1 5 10 15Glu Asn Tyr Cys Asn 20230PRTHomo
sapiens 2Phe Val Asn Gln His Leu Cys Gly Ser His Leu Val Glu Ala
Leu Tyr1 5 10 15Leu Val Cys Gly Glu Arg Gly Phe Phe Tyr Thr Pro Lys
Thr 20 25 30
* * * * *