Recombinant Nell Protein Production

Abstract

The present invention provides a method and system for producing a NELL protein. The method and system comprise a CELL encoding a NELL protein or peptide and a non-insect secretory signal peptide.

Description

CROSS-REFERENCE

[0001] This application claims the benefit of U.S. Provisional Application No. 61/103,534 filed on Oct. 7, 2008, the teaching of which is incorporated by reference in its entirety.

FIELD OF THE INVENTION

[0002] The present invention is directed to a system and method of producing NELL peptides.

BACKGROUND OF THE INVENTION

[0003] Growth factors are substances, such as peptides, which affect the growth and differentiation of defined populations of cells in vivo or in vitro.

[0004] Bone formation occurs during development of long bones (endochondral bone formation) and flat bones (intramembranous bone formation). Further, bone formation occurs during bone remodeling which occurs continuously in adult life in order to preserve the integrity of the skeleton. Finally, bone formation occurs during bone repair, such as when bone wounds occur in a fracture or surgical situation, for example. While separate bone formation mechanisms are thought to be involved in the embryological development of long and flat bones and repair is thought to involve intramembranous bone formation.

[0005] Bone formation by either mechanism involves the activity of osteoblasts, which are regulated by growth factors. Osteoblasts are derived from a pool of marrow stromal cells (also known as mesenchymal stem cells; MSC). These cells are present in a variety of tissues and are prevalent in bone marrow stroma. MSC are pluripotent and can differentiate into a variety of cell types including osteoblasts, chondrocytes, fibroblasts, myocytes, and adipocytes. Growth factors are thought to impact osteogenic cell proliferation, differentiation and osteoblast mineralization, each of which impacts bone formation.

[0006] Autogenous bone has been used, such to repair bone in patients with craniosynostosis and cleft grafting, for example. Craniosynostosis (CS), the premature closure of cranial sutures, affects 1 in 3,000 infants and therefore is one of the most common human congenital craniofacial deformities. Premature suture closure results in cranial dimorphism, which can need surgical correction. Premature suture closure in human CS can occur by two possibly distinct processes: calvarial overgrowth and bony fusion. Recently, fibroblast growth factor 2 (FGF2) and fibroblast growth factor receptor 1(FGFR1) have been implicated in premature cranial suture fusion via CBFA1-mediated pathways (8). Missense mutation of CBFA1 is linked to cleidocranial dysplasia, manifested as delayed suture closure.

[0007] Autologous bone grafting procedures have been performed utilizing autogenous bone, such as from the iliac crest or calvaria. These donor sites are not without associated morbidity including pain, gait disturbance, thigh paresthesia for iliac crest donor sites, and infection, neurologic deficits, and hematomas for calvarial grafts. Further, donor sites can have limited volume and can contribute to increased surgical time and hospital stay.

[0008] Alloplastic grafting materials have also been utilized, and growth factors have been tested in animal models. For example, bFGF has shown potential for use in bone regeneration and repair. Another family of osteogenic growth factors have been described as bone morphogenic protein (BMP). Specifically, BMP-2 recombinant protein has been demonstrated to regenerate mandibular continuity defects and cleft palate defects with results equal to or better than autogenous particulate bone and marrow. BMPs and other osteogenic factors have been studied for use in clinical applications. However, the cost of using minimally effective dosages of BMP has been a limiting factor in clinical use.

[0009] Spinal fusion is a surgical technique in which one more of the vertebrae of the spine are united together so that motion no longer occurs between them. Indications include: treatment of a fractured (broken) vertebra, correction of deformity, elimination of pain from motion, treatment of instability, and treatment of some cervical disc herniations. The surgery can involve placement of a bone graft between the vertebrae to obtain a solid union between the vertebrae. The procedure also can involve supplemental treatments including the placement of plates, screws, cages, and recently bone morphogenic protein 2 and 7 to assist in stabilizing and healing the bone graft. Autogenous bone grafting has been the clinically preferred method, and yet has about a 30-50% failure rate. Autogenous bone grafting is a separate surgery and also carries significant morbidity.

[0010] Cartilage is a type of dense connective tissue. It is composed of chondrocytes which are dispersed in a firm gel-like matrix. Cartilage is avascular (contains no blood vessels) and nutrients are diffused through the matrix. Cartilage is found in the joints, the rib cage, the ear, the nose, in the throat and between intervertebral disks. There are three main types of cartilage: hyaline (e.g., costal cartilages, the cartilages of the nose, trachea, and bronchi, and the articular cartilages of joints), elastic (e.g., external ear, external auditory meatus, part of the Eustachian tube, epiglottis, and in some of the laryngeal cartilages) and fibrocartilage [e.g. meniscus (e.g., wrist triangular fibrocartilage complex, knee meniscus), intervertebral discs, temporomandibular joint disc, the pubic symphysis, and in some tendons and ligaments at their attachment to bones. One of the main purposes of cartilage is to provide a framework upon which bone deposition could begin (i.e., during endochondral ossification). Another important purpose of cartilage is to provide smooth surfaces for the movement of articulating bones. For example, articular cartilage, most notably that which is found in the knee joint, is generally characterized by very low friction, high wear resistance, and poor regenerative qualities. It is responsible for much of the compressive resistance and load bearing qualities of the knee joint and, without it, walking is painful to impossible. Yet another important purpose of cartilage is to provide, firm, yet flexible support (e.g., nasal cartilage, spinal discs, tracheal cartilage, knee meniscus, bronchial cartilage). For instance, cartilage such as the meniscus plays a crucial role in joint stability, lubrication, and force transmission. Under a weight bearing load, the meniscus maintains the balanced position of the femur on the tibia and distributes the compressive forces by increasing the surface contact area, thereby decreasing the average stress two to three times. Additionally, the menisci interact with the joint fluid to produce a coefficient of friction that is five times as slick as ice on ice. In another example, the intervertebral disc has several important functions, including functioning as a spacer, as a shock absorber, and as a motion unit. The gelatinous central portion of the disc is called the nucleus pulposus. It is composed of 80-90% water. The solid portion of the nucleus is Type II collagen and non-aggregated proteoglycans. The outer ligamentous ring around the nucleus pulposus is called the annulus fibrosus, which hydraulically seals the nucleus, and allows intradiscal pressures to rise as the disc is loaded. The annulus has overlapping radial bands, not unlike the plies of a radial tire, and this allows torsional stresses to be distributed through the annulus under normal loading without rupture. The disc functions as a hydraulic cylinder. The annulus interacts with the nucleus. As the nucleus is pressurized, the annular fibers serve a containment function to prevent the nucleus from bulging or herniating.

[0011] Cartilage can be damaged by wear, injury or diseases. As we age, the water and protein content of the body's cartilage changes. This change results in weaker, more fragile and thin cartilage. Osteoarthritis is a common condition of cartilage failure that can lead to limited range of motion, bone damage and invariably, pain. Due to a combination of acute stress and chronic fatigue, osteoarthritis directly manifests itself in a wearing away of the articulating surface and, in extreme cases, bone can be exposed in the joint. In another example, loss of the protective stabilizing meniscus leads to increased joint laxity or abnormal motions that lead to joint instability. The excessive motion and narrowed contact area promotes early arthritic changes. At the cellular level, there is initially a loss of cells from the superficial layer of the articular cartilage followed by cartilage splitting, subsequent thinning and erosion occurs, and finally protrusion of the underlying raw bone. The earliest arthritic changes have been noted three weeks after loss of the entire meniscus. In yet another example, because both the discs and the joints that stack the vertebrae (facet joints) are partly composed of cartilage, these areas are subject to wear and tear over time (degenerative changes). As the inner nucleus dehydrates, the disc space narrows, and redundant annular ligaments bulge. With progressive nuclear dehydration, the annular fibers can crack and tear. Loss of normal soft tissue tension may allow the spinal segment to sublux (e.g. partial dislocation of the joint), leading to osteophyte formation (bone spurs), foraminal narrowing, mechanical instability, and pain. If the annular fibers stretch or rupture, allowing the pressurized nuclear material to bulge or herniate and compress neural tissues, pain and weakness may result. This is the condition called a pinched nerve, slipped disc, or herniated disc. Radiculopathy refers to nerve irritation caused by damage to the disc between the vertebrae. Mechanical dysfunction may also cause disc degeneration and pain (e.g. degenerative disc disease). For example, the disc may be damaged as the result of some trauma that overloads the capacity of the disc to withstand increased forces passing through it, and inner or outer portions of the annular fibers may tear. These torn fibers may be the focus for inflammatory response when they are subjected to increased stress, and may cause pain directly, or through the compensatory protective spasm of the deep paraspinal muscles.

[0012] NELL peptide has been documented to stimulate bone formation and cartilage formation. Existing methods and systems of producing NELL peptides have limited success with problems. A common problem of existing NELL peptide expression systems (e.g., a mammalian cell such as a CHO cell expression system) is low productivity. Low productivity is generally found to be caused by, for example, an inappropriate construct of the nucleic acid sequence expressing a NELL peptide and/or other additional sequences, e.g., a secretory signal peptide sequence, in a particular expression system, e.g., a CHO cell.

[0013] Therefore there is a continuous need for a method and system for producing NELL peptides.

SUMMARY OF THE INVENTION

[0014] The present invention relates to a system and method for producing a NELL peptide. The method comprises:

[0015] providing a nucleic acid construct including at least a nucleic acid encoding at least a NELL peptide in frame with a nucleic acid encoding a non-insect secretory signal peptide;

[0016] transfecting a mammalian cell with the nucleic acid construct; and

[0017] culturing the mammalian cell under conditions that permit expression of the NELL peptide.

[0018] The mammalian cell can be, e.g., a Chinese hamster ovary cell. The nucleic acid encodes NELL1 or NELL2 or both.

[0019] In some embodiments, the method further comprises: collecting NELL peptide secreted from the cell line; and substantially purifying the NELL peptide.

[0020] In some embodiments, the method of the above various embodiments can further comprise testing the activity of the NELL peptide to induce bone formation.

[0021] The act of purifying can be any step of purifying a protein or peptide. In some embodiments, the act of purifying includes chromatography purification.

[0022] In some embodiments, the present invention provides a nucleic acid construct for expressing a NELL peptide in a mammalian cell. The nucleic acid construct comprises at least a nucleic acid encoding at least a NELL peptide in frame with a nucleic acid encoding a secretory signal peptide that is a non-insect secretory signal peptide. The nucleic acid encodes NELL1 or NELL2. In some embodiments, the mammalian cell can be a CHO cell.

[0023] In some embodiments, the present invention provides a mammalian cell line for expressing a NELL peptide. The cell line comprises a nucleic acid construct comprising at least a nucleic acid encoding at least a NELL peptide in frame with a nucleic acid encoding a secretory signal peptide that is a non-insect secretory signal peptide. The nucleic acid encodes NELL1 or NELL2. In some embodiments, the mammalian cell can be a CHO cell.

[0024] In some embodiments, the present invention provides a polypeptide comprising a NELL peptide and a non-insect secretory signal peptide.

[0025] In some embodiments, the mammalian cell can be human embryo kidney cell, such as HEK-293.

[0026] The present invention provides a method of purifying a NELL peptide, comprising providing a crude solution containing a NELL peptide, and subjecting the crude solution to membrane chromotography to obtain a purified NELL peptide.

[0027] In some embodiments, the membrane chromatography is anion-exchange membrane chromatography or cation-exchange membrane chromatography.

[0028] The present invention provides a method of purifying a NELLpeptide, comprising providing a crude solution containing a NELL peptide, and subjecting the crude solution to chromotography process to obtain a purified NELL peptide, wherein the chromatography process comprises a medium comprising a metal ion bearing two or more charges. In some embodiments, the metal ion is calcium ion.

[0029] The NELL peptide can be NELL-1 peptide or NELL-2 peptide.

BRIEF DESCRIPTION OF THE DRAWINGS

[0030] FIGS. 1A-1D illustrate a signal peptide-NELL1-FLAG nucleic acid construct. The underlined amino acid sequence is from melittin signal peptide. The NELL1 peptide is from rat NELL1 peptide.

[0031] FIG. 2A is an illustration of a CBB-stained SDS-PAGE gel of UnoQ-eluate containing purified NELL1 peptide.

[0032] FIG. 2B shows a Western blot using anti-FLAG antibody depicting NELL1-FLAG expression in reference to a protein ladder.

[0033] FIG. 2C is an illustration of a CBB-stained SDS-PAGE gel of UnoQ-eluate containing NELL1-FLAG.

[0034] FIG. 2D shows a Western blot using anti-FLAG antibody depicting NELL1-FLAG expression.

[0035] FIG. 3A depicts the nucleic acid sequence of the cDNA construct and amino acid sequences of three different signal peptides that were used for the constructs.

[0036] FIG. 3B is a Western blot with anti-c-myc antibody detecting secreting NELL1 from transfections with different constructs after immunoprecipitation using anti-c-myc agarose.

[0037] FIG. 3C is a Western blot with anti-c-myc or mouse anti-human NELL1 antibodies detecting secreting NELL1 after immunoprecipitation using rabbit anti-human Nell-1 antibody-NHS activated sepharose.

[0038] FIGS. 4A-D show NELL1 (homo sapiens) nucleotide sequence and corresponding amino acid sequence (SEQ ID NOs: 1 and 2).

[0039] FIGS. 5A-D show NELL1 (rattus norvegicus) nucleotide sequence and corresponding amino acid sequence (SEQ ID NOs: 3 and 4).

[0040] FIGS. 6A-F show NELL1 (Mus musculs) nucleotide sequence and corresponding amino acid sequence (SEQ ID NOs: 5 and 6).

[0041] FIGS. 7A-D show NELL2 (homo sapiens) nucleotide sequence and corresponding amino acid sequence (SEQ ID NOs: 7 and 8).

[0042] FIGS. 8A-D show NELL2 (rattus norvegicus) nucleotide sequence and corresponding amino acid sequence (SEQ ID NOs: 9 and 10).

[0043] FIGS. 9A-D show NELL2 (Mus musculs) nucleotide sequence and corresponding amino acid sequence (SEQ ID NOs: 11 and 12).

[0044] FIGS. 10A-D show NELL2 (Gallus gallus) nucleotide sequence and corresponding amino acid sequence (SEQ ID NOs: 13 and 14).

DETAILED DESCRIPTION

Definitions

[0045] As used herein, the terms "polypeptide", "peptide" and "protein" can be used interchangeably to refer to a polymer of amino acid residues. The terms can apply to amino acid polymers in which one or more amino acid residues is an artificial chemical analogue of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers.

[0046] The term "antibody" can include various forms of modified or altered antibodies, such as an intact immunoglobulin, an Fv fragment containing only the light and heavy chain variable regions, an Fv fragment linked by a disulfide bond, a Fab or F(ab').sup.2 fragment containing the variable regions and parts of the constant regions, a single-chain antibody and the like. An antibody can include intact molecules as well as fragments thereof, such as, Fab and F(ab').sup.2, and/or single-chain antibodies (e.g. scFv) which can bind an epitopic determinant. An antibody can be of animal, e.g., mouse or rat, or of human origin, or can be chimeric or humanized. Antibodies can be polyclonal or monoclonal antibodies (mAbs), such as monoclonal antibodies with specificity for a polypeptide encoded by a NELL1 or NELL 2 protein.

[0047] The term "capture agent" refers to molecules that specifically bind other molecules to form a binding complex such as, but not limited to, an antibody-antigen complex, a lectin-carbohydrate complex, a nucleic acid-nucleic acid complex or a biotin-avidin complex.

[0048] The term "specifically binds" refers to the binding property of a biomolecule (e.g., protein, nucleic acid, antibody, etc.), which is determinative of the presence of such a biomolecule in a heterogeneous population of molecules (e.g., proteins and other biologics). Thus, under designated conditions (e.g., immunoassay conditions in the case of an antibody or stringent hybridization conditions in the case of a nucleic acid), the specified ligand or antibody specifically binds to its particular "target" molecule and will not bind in a significant amount to other molecules present in the sample.

[0049] The terms "nucleic acid" or "oligonucleotide" refer to at least two nucleotides covalently linked together. A nucleic acid of the present invention can be single-stranded or double stranded and can contain phosphodiester bonds, although in some cases, nucleic acid analogs can be included that can have alternate backbones, comprising, for example, phosphoramide, phosphorothioate, phosphorodithioate, omethylphophoroamidite linkages, and/or peptide nucleic acid backbones and linkages. Analog nucleic acids can have positive backbones and/or non-ribose backbones. Nucleic acids can also include one or more carbocyclic sugars. Modifications of the ribose-phosphate backbone can be done to facilitate the addition of additional moieties such as labels, or to increase the stability and half-life of such molecules in physiological environments, for example.

[0050] The term "specific hybridization" refers to the preferential binding, duplexing, or hybridizing of a nucleic acid molecule to a particular nucleotide sequence under stringent conditions, including conditions under which a probe can hybridize preferentially to its target subsequence, and can hybridize to a lesser extent to other sequences.

[0051] The terms "NELL1 cDNA" refer to SEQ ID NO:1, 3 and 5, and "NELL2 cDNA" can refer to SEQ ID NO:7, 9, 11 and 13.

NELL Peptides

[0052] NELL1 is a 810 aa (amino acid) peptide, distributed primarily in bone. In adults, NELL1 is expressed at high levels in craniofacial bone, and lower levels in long bone. NELL1 has known roles in osteoblast differentiation, bone formation and bone regeneration. NELL1 has known rules in forming cartilage tissues without forming bone.

[0053] NELL 2 is a 816 aa peptide, distributed in neural cells and brain.

[0054] The human NELL1 gene includes at least 3 Cbfa1 response elements in the promoter region. Cbfa1 specifically binds to these response elements. NELL1 expression can be under the control of these transcription factors expressed endogenously at least in preosteoblasts, osteoblasts and hypertrophic chondrocytes in development and in adulthood. Cleidocranial disostosis is a developmental cranial defect thought to be caused at least in part by Cbfa disruption.

[0055] A NELL1 peptide can be encoded by the NELL1 gene or cDNA and includes SEQ ID NO: 2, 4, and 6. The NELL1 peptide can include a NELL1 peptide fragment that retains the ability to induce osteogenic cell differentiation, osteoblast differentiation or bone formation. In some embodiments, the NELL1 peptide can include a NELL 1 peptide fragment that retains the ability to induce cartilage formation without forming bone. A NELL2 peptide can be encoded by the NELL2 gene or cDNA and includes SEQ ID NO: 8, 10, 12 and 14. The NELL2 peptide can include NELL2 peptide fragments that retain similar activity to the full NELL2 peptide sequence.

[0056] In some embodiments, the amino acid sequence of the NELL peptide can be selected from the group including, but not limited to human NELL1 (SEQ ID NO:2), rat NELL1 (SEQ ID NO:4), mouse NELL1 (SEQ ID NO:6), or human NELL2 (SEQ ID NO:8), rat NELL2 (SEQ ID NO:10), mouse NELL2 (SEQ ID NO:12), chicken NELL2 (SEQ ID NO:14). The amino acid sequence can also include sequences such as those with substantial similarity, such as sequences having at least about 75% sequence similarity with any portion of the sequences listed above, or contain similar active binding domains as NELL1 peptides.

[0057] The term "derivative" as used herein, refers to any chemical or biological compound or material derived from a NELL peptide, structural equivalents thereof or conformational equivalents thereof. For example, such a derivative can include any pro-drug form, PEGylated form, or any other form of a NELL peptide that renders the NELL peptide more stable or more osteophilic or lipophilic. In some embodiments, the derivative can be a NELL peptide attached to poly(ethylene glycol), a poly(amino acid), a hydrocarbyl short chain having C1-C20 carbons, or a biocompatible polymer. In some embodiments, the term "derivative" can include NELL peptide mimetics. As used herein, the term "mimetic" refers to a peptide having at least one non-peptide bond in its backbone. A peptide bond is a chemical bond formed between the carboxylic acid group of an amino acid molecule and the amino group of another amino acid molecule. A NELL peptide mimetic can be any compound that exhibits at least one or more bone forming, bone repairing, cartilage forming, and/or cartilage repairing function of a NELL peptide.

[0058] Synthetic methods for making peptide mimetics are well known in the art. The following describes an example of the basic procedure for the synthesis of a peptide, including a peptide mimetics:

[0059] Before the peptide synthesis starts, the amine terminus of the amino acid (starting material) can protected with FMOC (9-fluoromethyl carbamate) or other protective groups, and a solid support such as a Merrifield resin (free amines) is used as an initiator. Then, step (1) through step (3) reactions are performed and repeated until the desired peptide is obtained: (1) a free-amine is reacted with carboxyl terminus using carbodiimide chemistry, (2) the amino acid sequence is purified, and (3) the protecting group, e.g., the FMOC protecting group, is removed under mildly acidic conditions to yield a free amine. The peptide can then be cleaved from the resin to yield a free standing peptide or peptide mimetics.

Systems Expressing NELL Peptides

[0060] Generally, the method of invention includes providing a nucleic acid sequence encoding a NELL peptide, such as NELL1 or NELL2 peptide, in frame with a nucleic acid sequence encoding a non-insect signal peptide.

[0061] In one embodiment, the method can include transfecting an insect cell line with a nucleic acid construct encoding a NELL peptide; and culturing the insect cell line under conditions that permit expression and/or secretion of the NELL peptide. For example, the cell line can be transfected transiently or stably with the nucleic acid construct encoding a NELL peptide.

[0062] In one embodiment, the method can include providing a nucleic acid sequence encoding a NELL peptide, such as NELL1 or NELL2 peptide. The nucleic acid sequence can be a cDNA or genomic DNA, encoding at least a functional portion of a NELL peptide. For example, the nucleic acid sequence can be selected from the group including, but not limited to human NELL1 (SEQ ID NO:1), rat NELL1 (SEQ ID NO:3), mouse NELL1 (SEQ ID NO:5), or human NELL2 (SEQ ID NO:7), rat NELL2 (SEQ ID NO:9), mouse NELL2 (SEQ ID NO:11), chicken NELL2 (SEQ ID NO:13). In some embodiments, the nucleic acid sequence can also include sequences such as those with substantial sequence similarity, such as sequences having at least about 75% sequence similarity with any portion of the sequences listed above.

[0063] Further the nucleic acid can include an expression vector for expressing the nucleic acid sequence encoding a NELL peptide, such as NELL1 or NELL2 peptide. For example, the expression vector can be pIZTA/5-His (Invitrogen), and selective markers can also include blastcidin and neomycin.

[0064] Such expression systems can include a carrier such as a viral carrier or viral vector, peptide carrier or a short polymer molecule.

[0065] Nucleic acid constructs can comprise expression and cloning vectors should contain a selection gene, also termed a selectable marker, such as a gene that encodes a protein necessary for the survival or growth of a host cell transformed with the vector. The presence of this gene ensures that any host cell which deletes the vector will not obtain an advantage in growth or reproduction over transformed hosts. Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, neomycin, methotrexate or tetracycline, (b) complement auxotrophic deficiencies.

[0066] Further, the nucleic acid sequence can also include additional nucleic acids which encode reporter products to monitor levels of gene expression, or encode peptide tags which can be visualized using known methods in the art to monitor levels of peptide expression. Additional sequences can be selected so as to not interfere with the expression of the nucleic acid, or the functionality of the expressed peptide product.

[0067] A promoter is recognized by the host organism and is operatively linked to the NELL encoding nucleic acid. Promoters are untranslated sequences located upstream from the start codon of a structural gene (generally within about 100 to 1000 bp) that control the transcription and translation of nucleic acid under their control, including inducible and constitutive promoters. Inducible promoters are promoters that initiate increased levels of transcription from DNA under their control in response to some change in culture conditions, e.g. the presence or absence of a nutrient or a change in temperature. At this time a large number of promoters recognized by a variety of potential host cells are well known.

[0068] A nucleic acid can be operably linked when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA for a presequence or secretory leader is operatively linked to DNA for a polypeptide if it is expressed as a preprotein which participates in the secretion of the polypeptide; a promoter or enhancer is operatively linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operatively linked to a coding sequence if it is positioned so as to facilitate translation.

[0069] A NELL peptide can be expressed in any biological system. For example, a NELL peptide can be expressed in a bacterial system, a yeast system, a plant system or animal system.

[0070] In some embodiments, a NELL peptide can be expressed in a cell free expression system well known to those in the art. For example, E coli cell-free protein translation systems or wheat germ cell-free protein translation systems.

[0071] In some embodiments, a NELL peptide can be expressed in transgenic plant cell systems derived from tobacco, corn, rice or soybean.

[0072] In some embodiments, a NELL peptide can be expressed in insect cells. The NELL1 and NELL2 peptides expressed in an insect system are functional forms of the protein.

[0073] COS7 cells can be used to produce NELL1 and NELL2 proteins at low levels, such as about 10 micrograms per litter medium, but require serum-containing medium for the expression. As for the signal peptides, NELL1 and NELL2 endogenous signal peptides permit expression in COS7 cells.

[0074] In one embodiment, the invention includes a method of expressing a functional NELL peptide, such as NELL1 or NELL2 peptide, using an insect cell line. In one embodiment, the insect cell can be a high five cell, Sf9 and other Sf cells.

[0075] In one embodiment, the invention can include a nucleic acid construct for expressing a NELL peptide, such as NELL1 and/or NELL2 peptide in an insect cell. The nucleic acid sequence can be a cDNA or genomic DNA, encoding at least a functional portion of a NELL peptide. For example, the nucleic acid sequence can be selected from the group including, but not limited to human NELL1 (SEQ ID NO:1), rat NELL1 (SEQ ID NO:3), mouse NELL1 (SEQ ID NO:5), or human NELL2 (SEQ ID NO:7), rat NELL2 (SEQ ID NO:9), mouse NELL2 (SEQ ID NO:11), chicken NELL2 (SEQ ID NO:13). The nucleic acid sequence can also include sequences such as those with substantial sequence similarity, such as sequences having at least about 75% sequence similarity with any portion of the sequences listed above.

[0076] In one embodiment, the invention can include a nucleic acid construct for expressing a NELL peptide, such as NELL1 and/or NELL2 peptide in a mammalian cell such as a Chinese hamster ovary cell (CHO cell). The nucleic acid sequence can be a cDNA or genomic DNA, encoding at least a functional portion of a NELL peptide. For example, the nucleic acid sequence can be selected from the group including, but not limited to human NELL1 (SEQ ID NO:1), rat NELL1 (SEQ ID NO:3), mouse NELL1 (SEQ ID NO:5), or human NELL2 (SEQ ID NO:7), rat NELL2 (SEQ ID NO:9), mouse NELL2 (SEQ ID NO:11), chicken NELL2 (SEQ ID NO:13). In some embodiments, the nucleic acid sequence can also include sequences such as those with substantial sequence similarity, such as sequences having at least about 75% sequence similarity with any portion of the sequences listed above.

[0077] In one embodiment, the invention can include cells that express functional NELL peptides. For example, the cell can be a CHO cell. In one embodiment, the cell can be transfected with a nucleic acid construct encoding a NELL peptide. For example, the cell line can be transfected transiently or stably with the nucleic acid construct encoding a NELL peptide. In one embodiment, NELL expressing nucleic acids (e.g., cDNA(s) can be cloned into gene expression vector or viral particles that are competent to transfect cells (such as insect cells or Chinese hamster ovary cells (CHO cells)).

[0078] The nucleic acid construct can also include a nucleic acid sequence encoding a NELL peptide, such as NELL1 or NELL2 peptide, in frame with a nucleic acid sequence encoding a non-insect signal peptide that is a non-insect secretory signal peptide.

[0079] In one embodiment, the invention can include cells that express functional NELL peptides, and can secrete functional proteins.

[0080] In one embodiment, the invention can include a polypeptide (amino acid sequence) comprising a NELL peptide, such as NELL1 or NELL2 peptide, and can include a non-insect secretory signal peptide.

Non-Insect Secretory Signal Peptide

[0081] Useful non-insect secretory signal peptide for use in a NELL peptide expression system (e.g., a mammalian cell such as a CHO cell) can be any secretory signal peptide. Such non-insect secretory signal peptide can be, for example, plant secretory signal peptide, or animal secretory signal peptide, e.g., mammalian secretory signal peptide such as human secretory signal peptide. Various secretory signal peptide can be found at various publicly accessible sources, e.g., http://proline.bic.nus.edu.sq/spdb/download.html.

[0082] Human secretory signal peptides are well documented. Examples of human secretory signal peptides include, but are not limited to, [0083] 1A02_human secretory signal peptide, 1A11_human secretory signal peptide, [0084] 1A25_human secretory signal peptide, 1A26_human secretory signal peptide, [0085] 1A30_human secretory signal peptide, 1A31_human secretory signal peptide, [0086] 1A33_human secretory signal peptide, 1A68_human secretory signal peptide, [0087] 1A80_human secretory signal peptide, 1 B07_human secretory signal peptide, [0088] 1B15_human secretory signal peptide, 1 B37_human secretory signal peptide, [0089] 1B40_human secretory signal peptide, 1 B47_human secretory signal peptide, [0090] 1B48_human secretory signal peptide, 1 B57_human secretory signal peptide, [0091] 1B59_human secretory signal peptide, 1 B78_human secretory signal peptide, [0092] 1C03_human secretory signal peptide, 1C04_human secretory signal peptide, [0093] 1C05_human secretory signal peptide, 1C07_human secretory signal peptide, [0094] 1C14_human secretory signal peptide, 1C15_human secretory signal peptide, [0095] 1C16_human secretory signal peptide, 1C17_human secretory signal peptide, [0096] 1C18_human secretory signal peptide, 2B11_human secretory signal peptide, [0097] 2B14_human secretory signal peptide, 2B17_human secretory signal peptide, [0098] 2B1A_human secretory signal peptide, 2B1B_human secretory signal peptide, [0099] 2B32_human secretory signal peptide, 2DOB_human secretory signal peptide, [0100] 7B2_human secretory signal peptide, A1AT_human secretory signal peptide, [0101] A2GL_human secretory signal peptide, A2MG_human secretory signal peptide, [0102] ABP1_human secretory signal peptide, ACET_human secretory signal peptide, [0103] ACHB_human secretory signal peptide, ACHE_human secretory signal peptide, [0104] ACRO_human secretory signal peptide, ADA32_human secretory signal peptide, [0105] ADIPO_human secretory signal peptide, ADML_human secretory signal peptide, [0106] AGAL_human secretory signal peptide, AGR2_human secretory signal peptide, [0107] AGR3_human secretory signal peptide, AMBP_human secretory signal peptide, [0108] AMTN_human secretory signal peptide, ANF_human secretory signal peptide, [0109] ANGI_human secretory signal peptide, ANGL3_human secretory signal peptide, [0110] ANGL7_human secretory signal peptide, ANGT_human secretory signal peptide, [0111] ANPRA_human secretory signal peptide, APOA2_human secretory signal peptide, [0112] APOA4_human secretory signal peptide, APOA_human secretory signal peptide, [0113] APOC1_human secretory signal peptide, APOC2_human secretory signal peptide, [0114] APOC3_human secretory signal peptide, APOD_human secretory signal peptide, [0115] APOE_human secretory signal peptide, APOH_human secretory signal peptide, [0116] APR3_human secretory signal peptide, ASM_human secretory signal peptide, [0117] ASPG_human secretory signal peptide, BAMBI_human secretory signal peptide, [0118] BASI_human secretory signal peptide, BGAL_human secretory signal peptide, [0119] BGLR_human secretory signal peptide, BOC_human secretory signal peptide, [0120] BPIL1_human secretory signal peptide, BPI_human secretory signal peptide, [0121] BT3A3_human secretory signal peptide, BTNL8_human secretory signal peptide, [0122] C16L2_human secretory signal peptide, C1QT5_human secretory signal peptide, [0123] C1QT6_human secretory signal peptide, C1R_human secretory signal peptide, [0124] C1S_human secretory signal peptide, C4BPA_human secretory signal peptide, [0125] CA187_human secretory signal peptide, CADM3_human secretory signal peptide, [0126] CAH9_human secretory signal peptide, CALCR_human secretory signal peptide, [0127] CALRL_human secretory signal peptide, CALR_human secretory signal peptide, [0128] CAP7_human secretory signal peptide, CART_human secretory signal peptide, [0129] CASA1_human secretory signal peptide, CASB_human secretory signal peptide, [0130] CASK human secretory signal peptide, CATC_human secretory signal peptide, [0131] CATE_human secretory signal peptide, CATG_human secretory signal peptide, [0132] CATW_human secretory signal peptide, CBG_human secretory signal peptide, [0133] CBLN3_human secretory signal peptide, CBLN4_human secretory signal peptide, [0134] CBPA1_human secretory signal peptide, CBPA3_human secretory signal peptide, [0135] CBPB1_human secretory signal peptide, CBPN_human secretory signal peptide, [0136] CCL11_human secretory signal peptide, CCL15_human secretory signal peptide, [0137] CCL19_human secretory signal peptide, CCL1_human secretory signal peptide, [0138] CCL22_human secretory signal peptide, CCL24_human secretory signal peptide, [0139] CCL2_human secretory signal peptide, CCL4_human secretory signal peptide, [0140] CCL5_human secretory signal peptide, CCL7_human secretory signal peptide, [0141] CD180_human secretory signal peptide, CD1A_human secretory signal peptide, [0142] CD244_human secretory signal peptide, CD276_human secretory signal peptide, [0143] CD27_human secretory signal peptide, CD28_human secretory signal peptide, [0144] CD2_human secretory signal peptide, CD320_human secretory signal peptide, [0145] CD34_human secretory signal peptide, CD3E_human secretory signal peptide, [0146] CD3G_human secretory signal peptide, CD3Z_human secretory signal peptide, [0147] CD45_human secretory signal peptide, CD5L_human secretory signal peptide, [0148] CD5_human secretory signal peptide, CD83_human secretory signal peptide, [0149] CD8B_human secretory signal peptide, CD99_human secretory signal peptide, [0150] CEAM1_human secretory signal peptide, CER1_human secretory signal peptide, [0151] CERU_human secretory signal peptide, CETP_human secretory signal peptide, [0152] CF126_human secretory signal peptide, CFAB_human secretory signal peptide, [0153] CFAH_human secretory signal peptide, CFAI_human secretory signal peptide, [0154] CH3L1_human secretory signal peptide, CH3L2_human secretory signal peptide, [0155] CHIT1_human secretory signal peptide, CL3L1_human secretory signal peptide, [0156] CLC11_human secretory signal peptide, CLC14_human secretory signal peptide, [0157] CLM1_human secretory signal peptide, CLM9_human secretory signal peptide, [0158] CLUS_human secretory signal peptide, CMA1_human secretory signal peptide, [0159] CMGA_human secretory signal peptide, CO1A1_human secretory signal peptide, [0160] CO2_human secretory signal peptide, CO3_human secretory signal peptide, [0161] CO4A2_human secretory signal peptide, CO5A2_human secretory signal peptide, [0162] CO6A1_human secretory signal peptide, CO6_human secretory signal peptide, [0163] CO7_human secretory signal peptide, CO9A1_human secretory signal peptide, [0164] CO9_human secretory signal peptide, COGA1_human secretory signal peptide, [0165] COLI_human secretory signal peptide, COL_human secretory signal peptide, [0166] CR2_human secretory signal peptide, CRDL2_human secretory signal peptide, [0167] CREG1_human secretory signal peptide, CRHBP_human secretory signal peptide, [0168] CRIM1_human secretory signal peptide, CRIS1_human secretory signal peptide, [0169] CRLF1_human secretory signal peptide, CRP_human secretory signal peptide, [0170] CSF2R_human secretory signal peptide, CSF2_human secretory signal peptide, [0171] CSF3R_human secretory signal peptide, CSPG2_human secretory signal peptide, [0172] CST9L_human secretory signal peptide, CST9_human secretory signal peptide, [0173] CTHR1_human secretory signal peptide, CTRB1_human secretory signal peptide, [0174] CXCL7_human secretory signal peptide, CXL10_human secretory signal peptide, [0175] CYTC_human secretory signal peptide, CYTL1_human secretory signal peptide, [0176] CYTN_human secretory signal peptide, CYTS_human secretory signal peptide, [0177] CYTT_human secretory signal peptide, D103A_human secretory signal peptide, [0178] DB127_human secretory signal peptide, DCD_human secretory signal peptide, [0179] DEF1_human secretory signal peptide, DKK1_human secretory signal peptide, [0180] DKK3_human secretory signal peptide, DKK4_human secretory signal peptide, [0181] DLK_human secretory signal peptide, DLL4_human secretory signal peptide, [0182] DNAS1_human secretory signal peptide, ECP_human secretory signal peptide, [0183] EDAR_human secretory signal peptide, EFNB1_human secretory signal peptide, [0184] EFNB3_human secretory signal peptide, EGFL8_human secretory signal peptide, [0185] EGFR_human secretory signal peptide, EGLN_human secretory signal peptide, [0186] ELA2A_human secretory signal peptide, ELA2B_human secretory signal peptide, [0187] ELAF_human secretory signal peptide, ENPL_human secretory signal peptide, [0188] ENPP7_human secretory signal peptide, EPGN_human secretory signal peptide, [0189] EPHB1_human secretory signal peptide, EPHB6_human secretory signal peptide, [0190] EPOR_human secretory signal peptide, EPO_human secretory signal peptide, [0191] ESAM_human secretory signal peptide, EST1_human secretory signal peptide, [0192] F13B_human secretory signal peptide, FA11_human secretory signal peptide, [0193] FA5_human secretory signal peptide, FA8_human secretory signal peptide, [0194] FCGR1_human secretory signal peptide, FCGRN_human secretory signal peptide, [0195] FCN1_human secretory signal peptide, FCN3_human secretory signal peptide, [0196] FCRL2_human secretory signal peptide, FCRLA_human secretory signal peptide, [0197] FETUA_human secretory signal peptide, FGF19_human secretory signal peptide, [0198] FGF21_human secretory signal peptide, FGF23_human secretory signal peptide, [0199] FGFR3_human secretory signal peptide, FGFR4_human secretory signal peptide, [0200] FGRL1_human secretory signal peptide, FIBA_human secretory signal peptide, [0201] FIBG_human secretory signal peptide, FKB14_human secretory signal peptide, [0202] FKBP2_human secretory signal peptide, FLRT2_human secretory signal peptide, [0203] FSHB_human secretory signal peptide, FSTL1_human secretory signal peptide, [0204] FSTL3_human secretory signal peptide, FST_human secretory signal peptide, [0205] FZD3_human secretory signal peptide, G6B_human secretory signal peptide, [0206] GALC_human secretory signal peptide, GDN_human secretory signal peptide, [0207] GELS_human secretory signal peptide, G124_human secretory signal peptide, [0208] GLHA_human secretory signal peptide, GLPA_human secretory signal peptide, [0209] GLPB_human secretory signal peptide, GLPE_human secretory signal peptide, [0210] GLUC_human secretory signal peptide, GNS_human secretory signal peptide, [0211] GP1 BA_human secretory signal peptide, GPI8_human secretory signal peptide, [0212] GPIX_human secretory signal peptide, GPR56_human secretory signal peptide, [0213] GPR97_human secretory signal peptide, GRAB_human secretory signal peptide, [0214] GREM1_human secretory signal peptide, GROA_human secretory signal peptide, [0215] GRP78_human secretory signal peptide, GRP_human secretory signal peptide, [0216] HA22_human secretory signal peptide, HA23_human secretory signal peptide, [0217] HA25_human secretory signal peptide, HA27_human secretory signal peptide, [0218] HB21_human secretory signal peptide, HB23_human secretory signal peptide, [0219] HB24_human secretory signal peptide, HB25_human secretory signal peptide, [0220] HB2B_human secretory signal peptide, HB2C_human secretory signal peptide, [0221] HB2K_human secretory signal peptide, HEP2_human secretory signal peptide, [0222] HGFA_human secretory signal peptide, HIS1_human secretory signal peptide, [0223] HIS3_human secretory signal peptide, HLAE_human secretory signal peptide, [0224] HPSE_human secretory signal peptide, HPT_human secretory signal peptide, [0225] HV103_human secretory signal peptide, HV303_human secretory signal peptide, [0226] I10R1_human secretory signal peptide, I10R2_human secretory signal peptide, [0227] I17RA_human secretory signal peptide, I17RB_human secretory signal peptide, [0228] I17RC_human secretory signal, I18BP_human secretory signal peptide, [0229] I20RA_human secretory signal peptide, 120RB_human secretory signal peptide, [0230] I22RA_human secretory signal peptide, IBP1_human secretory signal peptide,

[0231] IBP2_human secretory signal peptide, IBP3_human secretory signal peptide, [0232] IBP7_human secretory signal peptide, IFN16_human secretory signal peptide, [0233] IFNA2_human secretory signal peptide, IFNA4_human secretory signal peptide, [0234] IFNA5_human secretory signal peptide, IFNA6_human secretory signal peptide, [0235] IFNA7_human secretory signal peptide, IFNK_human secretory signal peptide, [0236] IFNW1_human secretory signal peptide, IGF2_human secretory signal peptide, [0237] IGFL1_human secretory signal peptide, IGFL3_human secretory signal peptide, [0238] IL10_human secretory signal peptide, IL12A_human secretory signal peptide, [0239] IL12B_human secretory signal peptide, IL17F_human secretory signal peptide, [0240] IL17_human secretory signal peptide, IL19_human secretory signal peptide, [0241] IL1R1_human secretory signal peptide, IL1RA_human secretory signal peptide, [0242] IL20_human secretory signal peptide, IL21 R_human secretory signal peptide, [0243] IL22_human secretory signal peptide, IL24_human secretory signal peptide, [0244] IL25_human secretory signal peptide, IL2RA_human secretory signal peptide, [0245] IL2RB_human secretory signal peptide, IL2RG_human secretory signal peptide, [0246] IL2_human secretory signal peptide, IL3_human secretory signal peptide, [0247] IL4_human secretory signal peptide, IL5RA_human secretory signal peptide, [0248] IL6RA_human secretory signal peptide , IL7RA_human secretory signal peptide, [0249] IL7_human secretory signal peptide, IL9_human secretory signal peptide, [0250] ILRL1_human secretory signal peptide, INAR2_human secretory signal peptide, [0251] INHA_human secretory signal peptide, INSL3_human secretory signal peptide, [0252] INSL4_human secretory signal peptide, INSL5_human secretory signal peptide, [0253] INS_human secretory signal peptide, IPSP_human secretory signal peptide, [0254] IRBP_human secretory signal peptide, ISK6_human secretory signal peptide, [0255] ITA2B_human secretory signal peptide, ITA2_human secretory signal peptide, [0256] ITA3_human secretory signal peptide, ITA4_human secretory signal peptide, [0257] ITA6_human secretory signal peptide, ITA7_human secretory signal peptide, [0258] ITAE_human secretory signal peptide, ITAL_human secretory signal peptide, [0259] ITAV_human secretory signal peptide, ITAX_human secretory signal peptide, [0260] ITB2_human secretory signal peptide, ITB4_human secretory signal peptide, [0261] ITIH4_human secretory signal peptide, JAM1_human secretory signal peptide, [0262] JAM2_human secretory signal peptide, JAM3_human secretory signal peptide, [0263] JAML1_human secretory signal peptide, KAZD1_human secretory signal peptide, [0264] KI2L1_human secretory signal peptide, KIRR2_human secretory signal peptide, [0265] KLK3_human secretory signal peptide, KLKB1_human secretory signal peptide, [0266] KNG1_human secretory signal peptide, KTEL1_human secretory signal peptide, KV403_human secretory signal peptide, KV404_human secretory signal peptide, [0267] L1CAM_human secretory signal peptide, LALBA_human secretory signal peptide, [0268] LAMB1_human secretory signal peptide, LAMC1_human secretory signal peptide, [0269] LAMP1_human secretory signal peptide, LAMP2_human secretory signal peptide, [0270] LBP_human secretory signal peptide, LCAT_human secretory signal peptide, [0271] LCN1_human secretory signal peptide, LCTL_human secretory signal peptide, [0272] LEUK_human secretory signal peptide, LG3BP_human secretory signal peptide, [0273] LIF_human secretory signal peptide, LIPG_human secretory signal peptide, [0274] LIPP_human secretory signal peptide, LIRA3_human secretory signal peptide, [0275] LMAN1_human secretory signal peptide, LPH_human secretory signal peptide, [0276] LRC55_human secretory signal peptide, LRRN1_human secretory signal peptide, [0277] LSHB_human secretory signal peptide, LUM_human secretory signal peptide, [0278] LU_human secretory signal peptide, LV605_human secretory signal peptide, [0279] LY86_human secretory signal peptide, LYAM2_human secretory signal peptide, [0280] LYPA3_human secretory signal peptide, LYPD6_human secretory signal peptide, [0281] LYSC_human secretory signal peptide, MBL2_human secretory signal peptide, [0282] MCP_human secretory signal peptide, MFAP4_human secretory signal peptide, [0283] MGP_human secretory signal peptide, MIA human secretory signal peptide, [0284] MIME_human secretory signal peptide, MIP2A_human secretory signal peptide, [0285] MIP2B_human secretory signal peptide, MK human secretory signal peptide, [0286] MMP1_human secretory signal peptide, MOTI_human secretory signal peptide, [0287] MOX2R_human secretory signal peptide, MPRD_human secretory signal peptide, [0288] MPRI_human secretory signal peptide, MPZL3_human secretory signal peptide, [0289] MSMB_human secretory signal peptide, MYP0_human secretory signal peptide, [0290] NAGAB_human secretory signal peptide, NELL1_human secretory signal peptide, [0291] NELL2_human secretory signal peptide, NETO2_human secretory signal peptide, [0292] NEU1_human secretory signal peptide, NEU2_human secretory signal peptide, [0293] NGAL_human secretory signal peptide, NID1_human secretory signal peptide, [0294] NID2_human secretory signal peptide, NLGNX_human secretory signal peptide, [0295] NMB_human secretory signal peptide, NOV human secretory signal peptide, [0296] NPTN_human secretory signal peptide, NPY_human secretory signal peptide, [0297] NRP1_human secretory signal peptide, NTRK2_human secretory signal peptide, [0298] NXPH3_human secretory signal peptide, OLFL1_human secretory signal peptide, [0299] OTOR_human secretory signal peptide, OXLA_human secretory signal peptide, [0300] P3IP1_human secretory signal peptide, PAHO_human secretory signal peptide, [0301] PARM1_human secretory signal peptide, PCDBA_human secretory signal peptide, [0302] PCOC2_human secretory signal peptide, PCYXL_human secretory signal peptide, [0303] PDGFA_human secretory signal peptide, PDIA1_human secretory signal peptide, [0304] PDIA3_human secretory signal peptide, PDYN_human secretory signal peptide, [0305] PEBP4_human secretory signal peptide, PECA1_human secretory signal peptide, [0306] PG12B_human secretory signal peptide, PGFRA_human secretory signal peptide, [0307] PGFRB_human secretory signal peptide, PGH1_human secretory signal peptide, [0308] PGRP2_human secretory signal peptide, PIGT_human secretory signal peptide, [0309] PIP_human secretory signal peptide, PLBL2_human secretory signal peptide, [0310] PLF4_human secretory signal peptide, PLOD1_human secretory signal peptide, [0311] PORIM_human secretory signal peptide, PPA6_human secretory signal peptide, [0312] PPAP_human secretory signal peptide, PPGB_human secretory signal peptide, [0313] PPIB_human secretory signal peptide, PRB4_human secretory signal peptide, [0314] PRLR_human secretory signal peptide, PRL_human secretory signal peptide, [0315] PROK1_human secretory signal peptide, PROK2_human secretory signal peptide, [0316] PROP_human secretory signal peptide, PROZ_human secretory signal peptide, [0317] PRP1_human secretory signal peptide, PRPC_human secretory signal peptide, [0318] PRRT3_human secretory signal peptide, PTGDS_human secretory signal peptide, [0319] PTHY_human secretory signal peptide, PTPRG_human secretory signal peptide, [0320] PYY_human secretory signal peptide, PZP_human secretory signal peptide, [0321] REGIA human secretory signal peptide, REG3G_human secretory signal peptide, [0322] RIB1_human secretory signal peptide, RIB2_human secretory signal peptide, [0323] RISC_human secretory signal peptide, RNAS1_human secretory signal peptide, [0324] RNAS4_human secretory signal peptide, S39A6_human secretory signal peptide, [0325] SAA4_human secretory signal peptide, SAA human secretory signal peptide, [0326] SAMP_human secretory signal peptide, SCG1_human secretory signal peptide, [0327] SCRG1_human secretory signal peptide, SEM4B_human secretory signal peptide, [0328] SEM6B_human secretory signal peptide, SEMG1_human secretory signal peptide, [0329] SEMG2_human secretory signal peptide, SEPP1_human secretory signal peptide, [0330] SFRP2_human secretory signal peptide, SFRP3_human secretory signal peptide, [0331] SFTPG_human secretory signal peptide, SG1 D4_human secretory signal peptide, [0332] SG3A1_human secretory signal peptide, SHBG_human secretory signal peptide, [0333] SIAL_human secretory signal peptide, SIDT2_human secretory signal peptide, [0334] SLAF6_human secretory signal peptide, SLAF7_human secretory signal peptide, [0335] SLAF8_human secretory signal peptide, SLPI_human secretory signal peptide, [0336] SMR3B_human secretory signal peptide, SMS_human secretory signal peptide, [0337] SODE_human secretory signal peptide, SOSD1_human secretory signal peptide, [0338] SOST_human secretory signal peptide, SPIT1_human secretory signal peptide, [0339] SPIT2_human secretory signal peptide, SRCH_human secretory signal peptide, [0340] SRGN_human secretory signal peptide, STAT_human secretory signal peptide, [0341] STC1_human secretory signal peptide, TCO1_human secretory signal peptide, [0342] TCO2_human secretory signal peptide, TENA_human secretory signal peptide, [0343] TETN_human secretory signal peptide, TFF1_human secretory signal peptide, [0344] TFF3_human secretory signal peptide, TFPI1_human secretory signal peptide, [0345] TGFR2_human secretory signal peptide, THBG_human secretory signal peptide, [0346] THYG_human secretory signal peptide, TICN2_human secretory signal peptide, [0347] TIE1_human secretory signal peptide, TIE2_human secretory signal peptide, [0348] TIMP1_human secretory signal peptide, TIMP2_human secretory signal peptide, [0349] TIMP3_human secretory signal peptide, TINAL_human secretory signal peptide, [0350] TLR1_human secretory signal peptide, TLR3_human secretory signal peptide, [0351] TLR4_human secretory signal peptide, TLR5_human secretory signal peptide, [0352] TM2D1_human secretory signal peptide, TMIG2_human secretory signal peptide, [0353] TMM25_human secretory signal peptide, TMM46_human secretory signal peptide, [0354] TMM66_human secretory signal peptide, TMM9B_human secretory signal peptide, [0355] TNFB_human secretory signal peptide, TNR14_human secretory signal peptide, [0356] TNR16_human secretory signal peptide, TNR18_human secretory signal peptide, [0357] TNR19_human secretory signal peptide, TNR1 B_human secretory signal peptide, [0358] TNR5_human secretory signal peptide, TNR6B_human secretory signal peptide, [0359] TNR8_human secretory signal peptide, TNR9_human secretory signal peptide, [0360] TPO_human secretory signal peptide, TPSNR_human secretory signal peptide, [0361] TPSN_human secretory signal peptide, TR10D_human secretory signal peptide, [0362] TR11B_human secretory signal peptide, TR19L_human secretory signal peptide, [0363] TRBM_human secretory signal peptide, TRFE_human secretory signal peptide, [0364] TRFL_human secretory signal peptide, TRY1_human secretory signal peptide, [0365] TRY2_human secretory signal peptide, TSHB_human secretory signal peptide, [0366] TSP1_human secretory signal peptide, TVA2_human secretory signal peptide, [0367] TVB2_human secretory signal peptide, TXD12_human secretory signal peptide, [0368] TXND4_human secretory signal peptide, TYRP1_human secretory signal peptide, [0369] UROK_human secretory signal peptide, UTER_human secretory signal peptide, [0370] UTS2_human secretory signal peptide, VCAM1_human secretory signal peptide, [0371] VEGFA_human secretory signal peptide, VEGFC_human secretory signal peptide, [0372] VGFR3_human secretory signal peptide, VMO1_human secretory signal peptide, [0373] VSIG2_human secretory signal peptide, VSIG4_human secretory signal peptide, [0374] VSTM1_human secretory signal peptide, VTNC_human secretory signal peptide, [0375] VWF_human secretory signal peptide, WISP2_human secretory signal peptide, [0376] X3CL1_human secretory signal peptide, XCL2_human secretory signal peptide, [0377] YK001_human secretory signal peptide, YQ001_human secretory signal peptide, [0378] ZA2G_human secretory signal peptide, ZG16_human secretory signal peptide, [0379] ZP2_human secretory signal peptide.

[0380] The sequences of these secretory signal peptides are as following: [0381] 1A02_HUMAN SPdb195 Homo sapiens (Human) (SEQ ID NO:15) MAVMAPRTLVLLLSGALALTQTWA [0382] 1A11_HUMAN SPdb208 Homo sapiens (Human) (SEQ ID NO:16) MAVMAPRTLLLLLSGALALTQTWA [0383] 1A25_HUMAN SPdb276 Homo sapiens (Human) (SEQ ID NO:17) MAVMAPRTLVLLLSGALALTQTWA [0384] 1A26_HUMAN SPdb277 Homo sapiens (Human) (SEQ ID NO:18) MAVMAPRTLVLLLSGALALTQTWA [0385] 1A30_HUMAN SPdb279 Homo sapiens (Human) (SEQ ID NO:19) MAVMAPRTLLLLLSGALALTHTWA [0386] 1A31_HUMAN SPdb280 Homo sapiens (Human) (SEQ ID NO:20) MAVMAPRTLLLLLLGALALTQTWA [0387] 1A33_HUMAN SPdb282 Homo sapiens (Human) (SEQ ID NO:21) MAVMAPRTLLLLLLGALALTQTWA [0388] 1A68_HUMAN SPdb287 Homo sapiens (Human) (SEQ ID NO:22) MAVMAPRTLVLLLSGALALTQTWA [0389] 1A80_HUMAN SPdb290 Homo sapiens (Human) (SEQ ID NO:23) MAVM PPRTLLLLLSGALALTQTWA [0390] 1B07_HUMAN SPdb298 Homo sapiens (Human) (SEQ ID NO:24) M LVMAPRTVLLLLSAALALTETWA [0391] 1B15_HUMAN SPdb302 Homo sapiens (Human) (SEQ ID NO:25) MRVTAPRTVLLLLSGALALTETWA [0392] 1B37_HUMAN SPdb306 Homo sapiens (Human) (SEQ ID NO:26) MRVTAPRTLLLLLWGAVALTETWA [0393] 1B40_HUMAN SPdb309 Homo sapiens (Human) (SEQ ID NO:27) MRVTAPRTLLLLLWGAVALTETWA [0394] 1B47_HUMAN SPdb315 Homo sapiens (Human) (SEQ ID NO:28) MRVTAPRTLLLLLWGAVALTETWA [0395] 1B48_HUMAN SPdb316 Homo sapiens (Human) (SEQ ID NO:29) MLVMAPRTVLLLLSAALALTETWA [0396] 1B57_HUMAN SPdb325 Homo sapiens (Human) (SEQ ID NO:30) MRVTAPRTVLLLLWGAVALTETWA [0397] 1B59_HUMAN SPdb327 Homo sapiens (Human) (SEQ ID NO:31) MRVTAPRTLLLLLWGALALTETWA [0398] 1B78_HUMAN SPdb330 Homo sapiens (Human) (SEQ ID NO:32) MRVTAPRTVLLLLWGAVALTETWA [0399] 1C03_HUMAN SPdb340 Homo sapiens (Human) (SEQ ID NO:33) MRVMAPRTLILLLSGALALTETWA [0400] 1C04_HUMAN SPdb342 Homo sapiens (Human) (SEQ ID NO:34) MRVMAPRTLILLLSGALALTETWA [0401] 1C05_HUMAN SPdb343 Homo sapiens (Human) (SEQ ID NO:35) MRVMAPRTLILLLSGALALTETWA [0402] 1C07_HUMAN SPdb345 Homo sapiens (Human) (SEQ ID NO:36) MRVMAPRALLLLLSGG LALTETWA [0403] 1C14_HUMAN SPdb348 Homo sapiens (Human) (SEQ ID NO:37) MRVMAPRTLILLLSGALALTETWA [0404] 1C15_HUMAN SPdb349 Homo sapiens (Human) (SEQ ID NO:38) MRVMAPRTLLLLLSGALALTETWA [0405] 1C16_HUMAN SPdb350 Homo sapiens (Human) (SEQ ID NO:39) MRVMAPRTLILLLSGALALTETWA [0406] 1C17_HUMAN SPdb351 Homo sapiens (Human) (SEQ ID NO:40) MRVMAPQALLLLLSGALALIETWA [0407] 1C18_HUMAN SPdb352 Homo sapiens (Human) (SEQ ID NO:41) MRVMAPRALLLLLSGG LALTETWA [0408] 2B11_HUMAN SPdb440 Homo sapiens (Human) (SEQ ID NO:42) MVCLKLPGGSCMTALTVTLMVLSSPLALA [0409] 2B14_HUMAN SPdb441 Homo sapiens (Human) (SEQ ID NO:43) MVCLKFPGGSCMAALTVTLMVLSSPLALA [0410] 2B17_HUMAN SPdb442 Homo sapiens (Human) (SEQ ID NO:44) MVCLKLPGGSCMAALTVTLMVLSSPLALA [0411] 2B1A_HUMAN SPdb445 Homo sapiens (Human) (SEQ ID NO:45) MVCLRLPGGSCMAVLTVTLMVLSSPLALA [0412] 2B1B_HUMAN SPdb446 Homo sapiens (Human) (SEQ ID NO:46) MVCLRLPGGSCMAVLTVTLMVLSSPLALA [0413] 2B32_HUMAN SPdb449 Homo sapiens (Human) (SEQ ID NO:47) MVCLKLPGGSSLAALTVTLMVLSSRLAFA [0414] 2DOB_HUMAN SPdb458 Homo sapiens (Human) (SEQ ID NO:48) MGSGWVPWWALLVNLTRLDSSMTQG [0415] 7B2_HUMAN SPdb1113 Homo sapiens (Human) (SEQ ID NO:49) MVSRMVSTMLSGLLFWLASGWTPAFA [0416] A1AT_HUMAN SPdb1182 Homo sapiens (Human) (SEQ ID NO:50) MPSSVSWGILLLAGLCCLVPVSLA [0417] A2GL_HUMAN SPdb1223 Homo sapiens (Human) (SEQ ID NO:51) MSSWSRQRPKSPGGIQPHVSRTLFLLLLLAASAWG [0418] A2MG_HUMAN SPdb1225 Homo sapiens (Human) (SEQ ID NO:52) MGKNKLLHPSLVLLLLVLLPTDA [0419] ABP1_HUMAN SPdb2047 Homo sapiens (Human) (SEQ ID NO:53) MPALGWAVAAILMLQTAMA [0420] ACET_HUMAN SPdb2859 Homo sapiens (Human) (SEQ ID NO:54) MGQGWATAGLPSLLFLLLCYGHPLLVPSQEA [0421] ACHB_HUMAN SPdb2984 Homo sapiens (Human) (SEQ ID NO:55) MTPGALLMLLGALGAPLAPGVRG [0422] ACHE_HUMAN SPdb2999 Homo sapiens (Human) (SEQ ID NO:56) MARAPLGVLLLLGLLGRGVG [0423] ACRO_HUMAN SPdb4311 Homo sapiens (Human) (SEQ ID NO:57) MVEMLPTAILLVLAVSVVA [0424] ADA32_HUMAN SPdb5197 Homo sapiens (Human) (SEQ ID NO:58) MFRLWLLLAGLCGLLA [0425] ADIPO_HUMAN SPdb5938 Homo sapiens (Human) (SEQ ID NO:59) MLLLGAVLLLLALPGHDQ [0426] ADML_HUMAN SPdb5966 Homo sapiens (Human) (SEQ ID NO:60) MKLVSVALMYLGSLAFLGADT [0427] AGAL_HUMAN SPdb6382 Homo sapiens (Human) (SEQ ID NO:61) MQLRNPELHLGCALALRFLALVSWDIPGARA [0428] AGR2_HUMAN SPdb6560 Homo sapiens (Human) (SEQ ID NO:62) MEKIPVSAFLLLVALSYTLA [0429] AGR3_HUMAN SPdb6563 Homo sapiens (Human) (SEQ ID NO:63) MMLHSALGLCLLLVTVSSNLA [0430] AMBP_HUMAN SPdb8414 Homo sapiens (Human) (SEQ ID NO:64) MRSLGALLLLLSACLAVSA [0431] AMTN_HUMAN SPdb9141 Homo sapiens (Human) (SEQ ID NO:65) MRSTILLFCLLGSTRS [0432] ANF_HUMAN SPdb9494 Homo sapiens (Human) (SEQ ID NO:66) MSSFSTTTVSFLLLLAFQLLGQTRA [0433] ANGI_HUMAN SPdb9521 Homo sapiens (Human) (SEQ ID NO:67) MVMGLGVLLLVFVLGLGLTPPTLA [0434] ANGL3_HUMAN SPdb9540 Homo sapiens (Human) (SEQ ID NO:68) MFTIKLLLFIVPLVIS [0435] ANGL7_HUMAN SPdb9551 Homo sapiens (Human) (SEQ ID NO:69) MLKKPLSAVTWLCIFIVAFVSHPAWL [0436] ANGT_HUMAN SPdb9580 Homo sapiens (Human) (SEQ ID NO:70) MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAG [0437] ANPRA_HUMAN SPdb9903 Homo sapiens (Human) (SEQ ID NO:71) MPGPRRPAGSRLRLLLLLLLPPLLLLLRGSHA [0438] APOA2_HUMAN SPdb10884 Homo sapiens (Human) (SEQ ID NO:72) MKLLAATVLLLTICSLEG [0439] APOA4_HUMAN SPdb10891 Homo sapiens (Human) (SEQ ID NO:73) MFLKAWLTLALVAVAGARA [0440] APOA_HUMAN SPdb10900 Homo sapiens (Human) (SEQ ID NO:74) MEHKEVVLLLLLFLKSAAP [0441] APOC1_HUMAN SPdb10907 Homo sapiens (Human) (SEQ ID NO:75) MRLFLSLPVLVVVLSIVLEGPAPAQG [0442] APOC2_HUMAN SPdb10917 Homo sapiens (Human) (SEQ ID NO:76) MGTRLLPALFLVLLVLGFEVQG [0443] APOC3_HUMAN SPdb10924 Homo sapiens (Human) (SEQ ID NO:77) MQPRVLLVVALLALLASARA [0444] APOD_HUMAN SPdb10936 Homo sapiens (Human) (SEQ ID NO:78) MVMLLLLLSALAGLFGAAEG [0445] APOE_HUMAN SPdb10946 Homo sapiens (Human) (SEQ ID NO:79) MKVLWAALLVTFLAGCQA [0446] APOH_HUMAN SPdb10966 Homo sapiens (Human) (SEQ ID NO:80) MISPVLILFSSFLCHVAIA [0447] APR3_HUMAN SPdb11011 Homo sapiens (Human) (SEQ ID NO:81) MAPHGPGSLTTLVPWAAALLLALGVERALA [0448] ASM_HUMAN SPdb16794 Homo sapiens (Human) (SEQ ID NO:82) M PRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALA [0449] ASPG_HUMAN SPdb17050 Homo sapiens (Human) (SEQ ID NO:83) MARKSNLPVLLVPFLLCQALVRC [0450] BAMBI_HUMAN SPdb23773 Homo sapiens (Human) (SEQ ID NO:84) MDRHSSYIFIWLQLELCAMA [0451] BASI_HUMAN SPdb23850 Homo sapiens (Human) (SEQ ID NO:85) MAAALFVLLGFALLGTHGASG [0452] BGAL_HUMAN SPdb24876 Homo sapiens (Human) (SEQ ID NO:86) MPGFLVRILLLLLVLLLLGPTRG [0453] BGLR_HUMAN SPdb24971 Homo sapiens (Human) (SEQ ID NO:87) MARGSAVAWAALGPLLWGCALG [0454] BOC_HUMAN SPdb25928 Homo sapiens (Human) (SEQ ID NO:88) MLRGTMTAWRGMRPEVTLACLLLATAGCFA [0455] BPIL1_HUMAN SPdb26090 Homo sapiens (Human) (SEQ ID NO:89) MAWASRLGLLLALLLPVVGA [0456] BPI_HUMAN SPdb26097 Homo sapiens (Human) (SEQ ID NO:90) MRENMARGPCNAPRWVSLMVLVAIGTAVTAA [0457] BT3A3_HUMAN SPdb26592 Homo sapiens (Human) (SEQ ID NO:91) MKMASSLAFLLLNFHVSLFLVQLLTPCSA [0458] BTNL8_HUMAN SPdb26692 Homo sapiens (Human) (SEQ ID NO:92) MALMLSLVLSLLKLGSG [0459] C16L2_HUMAN SPdb27156 Homo sapiens (Human) (SEQ ID NO:93) MEAPGPRALRTALCGGCCCLLLCAQLAVA [0460] C1QT5_HUMAN SPdb27240 Homo sapiens (Human) (SEQ ID NO:94) MRPLLVLLLLGLAAG [0461] C1QT6_HUMAN SPdb27243 Homo sapiens (Human) (SEQ ID NO:95) MVTAALGPVWAALLLFLLMCEIPMVEL [0462] C1R_HUMAN SPdb27257 Homo sapiens (Human) (SEQ ID NO:96) MWLLYLLVPALFCRAGG [0463] C1S_HUMAN SPdb27262 Homo sapiens (Human) (SEQ ID NO:97) MWCIVLFSLLAWVYA [0464] C4BPA_HUMAN SPdb27346 Homo sapiens (Human) (SEQ ID NO:98) MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLG [0465] CA187_HUMAN SPdb27946 Homo sapiens (Human) (SEQ ID NO:99) MAGPAIHTAPMLFLVLLLPLELSLA [0466] CADM3_HUMAN SPdb28390 Homo sapiens (Human) (SEQ ID NO:100) MGAPAASLLLLLLLFACCWAPGGA [0467] CAH9_HUMAN SPdb28555 Homo sapiens (Human) (SEQ ID NO:101) MAPLCPSPWLPLLIPAPAPGLTVQLLLSLLLLVPVHP [0468] CALCR_HUMAN SPdb28726 Homo sapiens (Human) (SEQ ID NO:102) MRFTFTSRCLALFLLLNHPTPILP [0469] CALRL_HUMAN SPdb28899 Homo sapiens (Human) (SEQ ID NO:103) MEKKCTLYFLVLLPFFMILVTA [0470] CALR_HUMAN SPdb28916 Homo sapiens (Human) (SEQ ID NO:104) MLLSVPLLLGLLGLAVA [0471] CAP7_HUMAN SPdb29157 Homo sapiens (Human) (SEQ ID NO:105) MTRLTVLALLAGLLASSRAGSSPLLD [0472] CART_HUMAN SPdb29961 Homo sapiens (Human) (SEQ ID NO:106) MESSRVRLLPLLGAALLLMLPLLGTRA [0473] CASA1_HUMAN SPdb29986 Homo sapiens (Human) (SEQ ID NO:107) MRLLILTCLVAVALA [0474] CASB_HUMAN SPdb30005 Homo sapiens (Human) (SEQ ID NO:108) MKVLILACLVALALA [0475] CASK_HUMAN SPdb30048 Homo sapiens (Human) (SEQ ID NO:109) MKSFLLVVNALALTLPFLAV [0476] CATC_HUMAN SPdb30354 Homo sapiens (Human) (SEQ ID NO:110) MGAGPSLLLAALLLLLSGDGAVRC [0477] CATE_HUMAN SPdb30381 Homo sapiens (Human) (SEQ ID NO:111) MKTLLLLLLVLLELGEA [0478] CATG_HUMAN SPdb30393 Homo sapiens (Human) (SEQ ID NO:112) MQPLLLLLAFLLPTGAEA [0479] CATW_HUMAN SPdb30490 Homo sapiens (Human) (SEQ ID NO:113) MALTAHPSCLLALLVAGLAQG [0480] CBG_HUMAN SPdb30913 Homo sapiens (Human) (SEQ ID NO:114) MPLLLYTCLLWLPTSGLWTVQA [0481] CBLN3_HUMAN SPdb31375 Homo sapiens (Human) (SEQ ID NO:115) MLGAKPHWLPGPLHSPGLPLVLVLLALGAGWA [0482] CBLN4_HUMAN SPdb31377 Homo sapiens (Human) (SEQ ID NO:116) MGSGRRALSAVPAVLLVLTLPGLPVWA [0483] CBPA1_HUMAN SPdb31413 Homo sapiens (Human) (SEQ ID NO:117) MRGLLVLSVLLGAVFG [0484] CBPA3_HUMAN SPdb31420 Homo sapiens (Human) (SEQ ID NO:118) MRLILPVGLIATTLA [0485] CBPB1_HUMAN SPdb31459 Homo sapiens (Human) (SEQ ID NO:119) MLALLVLVTVALASA [0486] CBPN_HUMAN SPdb31531 Homo sapiens (Human) (SEQ ID NO:120) MSDLLSVFLHLLLLFKLVAP [0487] CCL11_HUMAN SPdb32635 Homo sapiens (Human) (SEQ ID NO:121) MKVSAALLWLLLIAAAFSPQGLA [0488] CCL15_HUMAN SPdb32644 Homo sapiens (Human) (SEQ ID NO:122) MKVSVAALSCLMLVAVLGSQA [0489] CCL19_HUMAN SPdb32652 Homo sapiens (Human) (SEQ ID NO:123) MALLLALSLLVLWTSPAPTLS [0490] CCL1_HUMAN SPdb32654 Homo sapiens (Human) (SEQ ID NO:124) MQIITTALVCLLLAGMWPEDVDS [0491] CCL22_HUMAN SPdb32663 Homo sapiens (Human) (SEQ ID NO:125) MARLQTALLVVLVLLAVALQATEA [0492] CCL24_HUMAN SPdb32668 Homo sapiens (Human) (SEQ ID NO:126) MAGLMTIVTSLLFLGVCAHHIIPTGS [0493] CCL2_HUMAN SPdb32684 Homo sapiens (Human) (SEQ ID NO:127) MKVSAALLCLLLIAATFIPQGLA [0494] CCL4_HUMAN SPdb32700 Homo sapiens (Human) (SEQ ID NO:128) MKLCVTVLSLLMLVAAFCSPALS [0495] CCL5_HUMAN SPdb32709 Homo sapiens (Human) (SEQ ID NO:129) MKVSAAALAVILIATALCAPASA [0496] CCL7_HUMAN SPdb32717 Homo sapiens (Human) (SEQ ID NO:130) MKASAALLCLLLTAAAFSPQGLA [0497] CD180_HUMAN SPdb33618 Homo sapiens (Human) (SEQ ID NO:131) MAFDVSCFFWWLFSAGCKVITS [0498] CD1A_HUMAN SPdb33624 Homo sapiens (Human) (SEQ ID NO:132) MLFLLLPLLAVLPGDG [0499] CD244_HUMAN SPdb33672 Homo sapiens (Human) (SEQ ID NO:133) MLGQWTLILLLLLKVYQGKG [0500] CD276_HUMAN SPdb33680 Homo sapiens (Human) (SEQ ID NO:134) MLRRRGSPGMGVHVGAALGALWFCLTGA [0501] CD27_HUMAN SPdb33684 Homo sapiens (Human) (SEQ ID NO:135) MARPHPWWLCVLGTLVGLS [0502] CD28_HUMAN SPdb33689 Homo sapiens (Human) (SEQ ID NO:136) MLRLLLALNLFPSIQVTG [0503] CD2_HUMAN SPdb33718 Homo sapiens (Human) (SEQ ID NO:137) MSFPCKFVASFLLIFNVSSKGAVS [0504] CD320_HUMAN SPdb33725 Homo sapiens (Human) (SEQ ID NO:138) MSGGWMAQVGAWRTGALGLALLLLLGLGLGLEAAA [0505] CD34_HUMAN SPdb33729 Homo sapiens (Human) (SEQ ID NO:139) MLVRRGARAGPRMPRGWTALCLLSLLPSGFM [0506] CD3E_HUMAN SPdb33763 Homo sapiens (Human) (SEQ ID NO:140) MQSGTHWRVLGLCLLSVGVWGQ [0507] CD3G_HUMAN SPdb33770 Homo sapiens (Human) (SEQ ID NO:141) MEQGKGLAVLILAIILLQGTLA [0508] CD3Z_HUMAN SPdb33777 Homo sapiens (Human)(SEQ ID NO:142) MKWKALFTAAILQAQLPITEA [0509] CD45_HUMAN SPdb33804 Homo sapiens (Human) (SEQ ID NO:143) MYLWLKLLAFGFAFLDTEVFVTG [0510] CD5L_HUMAN SPdb33861 Homo sapiens (Human) (SEQ ID NO:144) MALLFSLILAICTRPGFLA [0511] CD5_HUMAN SPdb33872 Homo sapiens (Human) (SEQ ID NO:145) MPMGSLQPLATLYLLGMLVASCLG [0512] CD83_HUMAN SPdb33912 Homo sapiens (Human) (SEQ ID NO:146) MSRGLQLLLLSCAYSLAPA [0513] CD8B_HUMAN SPdb33924 Homo sapiens (Human) (SEQ ID NO:147) MRPRLWLLLAAQLTVLHGNSV [0514] CD99_HUMAN SPdb33932 Homo sapiens (Human) (SEQ ID NO:148) MARGAALALLLFGLLGVLVAAP [0515] CEAM1_HUMAN SPdb34729 Homo sapiens (Human) (SEQ ID NO:149) MGHLSAPLHRVRVPWQGLLLTASLLTFWNPPTTA [0516] CER1_HUMAN SPdb35232 Homo sapiens (Human) (SEQ ID NO:150) MHLLLFQLLVLLPLGKT [0517] CERU_HUMAN SPdb35241 Homo sapiens (Human) (SEQ ID NO:151) MKILILGIFLFLCSTPAWA [0518] CETP_HUMAN SPdb35298 Homo sapiens (Human) (SEQ ID NO:152) MLAATVLTLALLGNAHA [0519] CF126_HUMAN SPdb35387 Homo sapiens (Human) (SEQ ID NO:153) MAAALALVAGVLSGAVLPLWS [0520] CFAB_HUMAN SPdb35492 Homo sapiens (Human) (SEQ ID NO:154) MGSNLSPQLCLMPFILGLLSGGVTT [0521] CFAH_HUMAN SPdb35506 Homo sapiens (Human) (SEQ ID NO:155) MRLLAKIICLMLWAICVA [0522] CFAI_HUMAN SPdb35508 Homo sapiens (Human) (SEQ ID NO:156) MKLLHVFLLFLCFHLRFC [0523] CH3L1_HUMAN SPdb36470 Homo sapiens (Human) (SEQ ID NO:157) MGVKASQTGFWLVLLQCCSA [0524] CH3L2_HUMAN SPdb36476 Homo sapiens (Human) (SEQ ID NO:158) MGATTMDQKSLWAGVWLLLLQGGSA [0525] CHIT1_HUMAN SPdb37892 Homo sapiens (Human) (SEQ ID NO:159) MVRSVAWAGFMVLLMIPWGSA [0526] CL3L1_HUMAN SPdb39759 Homo sapiens (Human) (SEQ ID NO:160) MQVSTAALAVLLCTMALCNQVLS [0527] CLC11_HUMAN SPdb39795 Homo sapiens (Human) (SEQ ID NO:161) MQAAWLLGALWPQLLGFGHG [0528] CLC14_HUMAN SPdb39798 Homo sapiens (Human) (SEQ ID NO:162) MRPAFALCLLWQALWPGPGGG [0529] CLM1_HUMAN SPdb40173 Homo sapiens (Human) (SEQ ID NO:163) MPLLTLYLLLFWLSGYSIA [0530] CLM9_HUMAN SPdb40190 Homo sapiens (Human) (SEQ ID NO:164) MRLLVLLWGCLLLPGYEA [0531] CLUS_HUMAN SPdb41741 Homo sapiens (Human) (SEQ ID NO:165) MMKTLLLFVGLLLTWESGQVLG [0532] CMA1_HUMAN SPdb41778 Homo sapiens (Human) (SEQ ID NO:166) MLLLPLPLLLFLLCSRAEA [0533] CMGA_HUMAN SPdb41825 Homo sapiens (Human) (SEQ ID NO:167) M RSAAVLALLLCAGQVTA [0534] CO1A1_HUMAN SPdb42643 Homo sapiens (Human) (SEQ ID NO:168) MFSFVDLRLLLLLAATALLTHG [0535] CO2_HUMAN SPdb42671 Homo sapiens (Human) (SEQ ID NO:169) MGPLMVLFCLLFLYPGLADS [0536] CO3_HUMAN SPdb42683 Homo sapiens (Human) (SEQ ID NO:170) MGPTSGPSLLLLLLTHLPLALG [0537] CO4A2_HUMAN SPdb42702 Homo sapiens (Human) (SEQ ID NO:171) MGRDQRAVAGPALRRWLLLGTVTVG [0538] CO5A2_HUMAN SPdb42724 Homo sapiens (Human) (SEQ ID NO:172) MMANWAEARPLLILIVLLGQFVSIKA [0539] CO6A1_HUMAN SPdb42733 Homo sapiens (Human) (SEQ ID NO:173) MRAARALLPLLLQACWTAA [0540] CO6_HUMAN SPdb42741 Homo sapiens (Human) (SEQ ID NO:174) MARRSVLYFILLNALINKGQA [0541] CO7_HUMAN SPdb42748 Homo sapiens (Human) (SEQ ID NO:175) MKVISLFILVGFIGEFQSFSSA [0542] CO9A1_HUMAN SPdb42770 Homo sapiens (Human) (SEQ ID NO:176) MKTCWKIPVFFFVCSFLEPWASA [0543] CO9_HUMAN SPdb42781 Homo sapiens (Human) (SEQ ID NO:177) MSACRSFAVAICILEISILTA [0544] COGA1_HUMAN SPdb44971 Homo sapiens (Human) (SEQ ID NO:178) MWVSWAPGLWLLGLWATFGHG [0545] COLI_HUMAN SPdb45068 Homo sapiens (Human) (SEQ ID NO:179) MPRSCCSRSGALLLALLLQASMEVRG [0546] COL_HUMAN SPdb45103 Homo sapiens (Human) (SEQ ID NO:180) MEKILILLLVALSVAYA [0547] CR2_HUMAN SPdb47985 Homo sapiens (Human) (SEQ ID NO:181) MGAAGLLGVFLALVAPGVLG [0548] CRDL2_HUMAN SPdb48539 Homo sapiens (Human) (SEQ ID NO:182) MVPEVRVLSSLLGLALLWFPLDSHA [0549] CREG1_HUMAN SPdb48576 Homo sapiens (Human) (SEQ ID NO:183) MAG LSRGSARALLAALLASTLLALLVSPARG [0550] CRHBP_HUMAN SPdb48678

Homo sapiens (Human) (SEQ ID NO:184) MSPNFKLQCHFILIFLTALRGESR [0551] CRIM1_HUMAN SPdb48688 Homo sapiens (Human) (SEQ ID NO:185) MYLVAGDRGLAGCGHLLVSLLGLLLLLARSGTRA [0552] CRIS1_HUMAN SPdb48712 Homo sapiens (Human) (SEQ ID NO:186) MEIKHLLFLVAAACLLPMLSM [0553] CRLF1_HUMAN SPdb48785 Homo sapiens (Human) (SEQ ID NO:187) MPAGRRGPAAQSARRPPPLLPLLLLLCVLGAPRAGSG [0554] CRP_HUMAN SPdb48875 Homo sapiens (Human) (SEQ ID NO:188) MEKLLCFLVLTSLSHAFG [0555] CSF2R_HUMAN SPdb49487 Homo sapiens (Human) (SEQ ID NO:189) MLLLVTSLLLCELPHPAFLLIP [0556] CSF2_HUMAN SPdb49495 Homo sapiens (Human) (SEQ ID NO:190) MWLQSLLLLGTVACSIS [0557] CSF3R_HUMAN SPdb49500 Homo sapiens (Human) (SEQ ID NO:191) MARLGNCSLTWAALIILLLPGSLE [0558] CSPG2_HUMAN SPdb50031 Homo sapiens (Human) (SEQ ID NO:192) MFINIKSILWMCSTLIVTHA [0559] CST9L_HUMAN SPdb50299 Homo sapiens (Human) (SEQ ID NO:193) MLGLPWKGGLSWALLLLLLGSQILLIYA [0560] CST9_HUMAN SPdb50302 Homo sapiens (Human) (SEQ ID NO:194) MSSPQRRKAMPWALSLLLMGFQLLVTYA [0561] CTHR1_HUMAN SPdb50661 Homo sapiens (Human) (SEQ ID NO:195) MRPQGPAASPQRLRGLLLLLLLQLPAPSSA [0562] CTRB1_HUMAN SPdb50822 Homo sapiens (Human) (SEQ ID NO:196) MAFLWLLSCWALLGTTFG [0563] CXCL7_HUMAN SPdb52153 Homo sapiens (Human) (SEQ ID NO:197) MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALA [0564] CXL10_HUMAN SPdb52338 Homo sapiens (Human) (SEQ ID NO:198) MNQTAILICCLIFLTLSGIQG [0565] CYTC_HUMAN SPdb56121 Homo sapiens (Human) (SEQ ID NO:199) MAGPLRAPLLLLAILAVALAVSPAAG [0566] CYTL1_HUMAN SPdb56131 Homo sapiens (Human) (SEQ ID NO:200) MRTPGPLPVLLLLLAGAPAARP [0567] CYTN_HUMAN SPdb56136 Homo sapiens (Human) (SEQ ID NO:201) MAQHLSTLLLLLATLAVALA [0568] CYTS_HUMAN SPdb56151 Homo sapiens (Human) (SEQ ID NO:202) MARPLCTLLLLMATLAGALA [0569] CYTT_HUMAN SPdb56153 Homo sapiens (Human) (SEQ ID NO:203) MAWPLCTLLLLLATQAVALA [0570] D103A_HUMAN SPdb56224 Homo sapiens (Human) (SEQ ID NO:204) MRIHYLLFALLFLFLVPVPGHG [0571] DB127_HUMAN SPdb57844 Homo sapiens (Human) (SEQ ID NO:205) MGLFMIIAILLFQKPTVTEQ [0572] DCD_HUMAN SPdb58564 Homo sapiens (Human) (SEQ ID NO:206) MRFMTLLFLTALAGALVCA [0573] DEF1_HUMAN SPdb60113 Homo sapiens (Human) (SEQ ID NO:207) MRTLAILAAILLVALQAQA [0574] DKK1_HUMAN SPdb62795 Homo sapiens (Human) (SEQ ID NO:208) MMALGAAGATRVFVAMVAAALGGHPLLGVSA [0575] DKK3_HUMAN SPdb62800 Homo sapiens (Human) (SEQ ID NO:209) MQRLGATLLCLLLAAAVPTAP [0576] DKK4_HUMAN SPdb62802 Homo sapiens (Human) (SEQ ID NO:210) MVAAVLLGLSWLCSPLGA [0577] DLK_HUMAN SPdb62960 Homo sapiens (Human) (SEQ ID NO:211) MTATEALLRVLLLLLAFGHSTYG [0578] DLL4_HUMAN SPdb62971 Homo sapiens (Human) (SEQ ID NO:212) MAAASRSASGWALLLLVALWQQRAAG [0579] DNAS1_HUMAN SPdb64678 Homo sapiens (Human) (SEQ ID NO:213) MRGMKLLGALLALAALLQGAVS [0580] ECP_HUMAN SPdb69940 Homo sapiens (Human) (SEQ ID NO:214) MVPKLFTSQICLLLLLGLMGVEGSLHA [0581] EDAR_HUMAN SPdb70101 Homo sapiens (Human) (SEQ ID NO:215) MAHVGDCTQTPWLPVLVVSLMCSARA [0582] EFNB1_HUMAN SPdb71207 Homo sapiens (Human) (SEQ ID NO:216) MARPGQRWLGKWLVAMWWALCRLATP [0583] EFNB3_HUMAN SPdb71214 Homo sapiens (Human) (SEQ ID NO:217) MGPPHSGPGGVRVGALLLLGVLGLVSG [0584] EGFL8_HUMAN SPdb72652 Homo sapiens (Human) (SEQ ID NO:218) MGSRAELCTLLGGFSFLLLLIPGEG [0585] EGFR_HUMAN SPdb72662 Homo sapiens (Human) (SEQ ID NO:219) MRPSGTAGAALLALLAALCPASRA [0586] EGLN_HUMAN SPdb72697 Homo sapiens (Human) (SEQ ID NO:220) MDRGTLPLAVALLLASCSLSPTSLA [0587] ELA2A_HUMAN SPdb73024 Homo sapiens (Human) (SEQ ID NO:221) MIRTLLLSTLVAGALS [0588] ELA2B_HUMAN SPdb73028 Homo sapiens (Human) (SEQ ID NO:222) MIRTLLLSTLVAGALS [0589] ELAF_HUMAN SPdb73040 Homo sapiens (Human) (SEQ ID NO:223) MRASSFLIVWFLIAGTLVLEA [0590] ENPL_HUMAN SPdb75253 Homo sapiens (Human) (SEQ ID NO:224) MRALWVLGLCCVLLTFGSVRA [0591] ENPP7_HUMAN SPdb75282 Homo sapiens (Human) (SEQ ID NO:225) MRGLAVLLTVALATLLAPGAG [0592] EPGN_HUMAN SPdb75639 Homo sapiens (Human) (SEQ ID NO:226) MALGVPISVYLLFNAMTALTEE [0593] EPHB1_HUMAN SPdb75671 Homo sapiens (Human) (SEQ ID NO:227) MALDYLLLLLLASAVAA [0594] EPHB6_HUMAN SPdb75686 Homo sapiens (Human) (SEQ ID NO:228) MVCSLWVLLLVSSVLA [0595] EPOR_HUMAN SPdb75734 Homo sapiens (Human) (SEQ ID NO:229) MDHLGASLWPQVGSLCLLLAGAAW [0596] EPO_HUMAN SPdb75747 Homo sapiens (Human) (SEQ ID NO:230) MGVHECPAWLWLLLSLLSLPLGLPVLG [0597] ESAM_HUMAN SPdb76640 Homo sapiens (Human) (SEQ ID NO:231) MISLPGPLVTNLLRFLFLGLSALAPPSRA [0598] EST1_HUMAN SPdb76818 Homo sapiens (Human) (SEQ ID NO:232) MWLRAFILATLSASAAWG [0599] F13B_HUMAN SPdb78523 Homo sapiens (Human) (SEQ ID NO:233) MRLKNLTFIIILIISGELYA [0600] FA11_HUMAN SPdb78712 Homo sapiens (Human) (SEQ ID NO:234) MIFLYQVVHFILFTSVSG [0601] FA5_HUMAN SPdb78865 Homo sapiens (Human)(SEQ ID NO:235) MFPGCPRLWVLVVLGTSWVGWGSQGTEA [0602] FA8_HUMAN SPdb78981 Homo sapiens (Human) (SEQ ID NO:236) MQIELSTCFFLCLLRFCFS [0603] FCGR1_HUMAN SPdb81611 Homo sapiens (Human) (SEQ ID NO:237) MWFLTTLLLWVPVDG [0604] FCGRN_HUMAN SPdb81622 Homo sapiens (Human) (SEQ ID NO:238) MGVPRPQPWALGLLLFLLPGSLG [0605] FCN1_HUMAN SPdb81643 Homo sapiens (Human) (SEQ ID NO:239) MELSGATMARGLAVLLVLFLHIKNLPAQA [0606] FCN3_HUMAN SPdb81652 Homo sapiens (Human) (SEQ ID NO:240) MDLLWILPSLWLLLLGGPACLKT [0607] FCRL2_HUMAN SPdb81673 Homo sapiens (Human) (SEQ ID NO:241) MLLWSLLVIFDAVTEQADS [0608] FCRLA_HUMAN SPdb81677 Homo sapiens (Human) (SEQ ID NO:242) MKLGCVLMAWALYLSLGVLWVAQMLLA [0609] FETUA_HUMAN SPdb82655 Homo sapiens (Human) (SEQ ID NO:243) MKSLVLLLCLAQLWGCHS [0610] FGF19_HUMAN SPdb82742 Homo sapiens (Human) (SEQ ID NO:244) MRSGCVVVHVWILAGLWLAVAGRP [0611] FGF21_HUMAN SPdb82761 Homo sapiens (Human) (SEQ ID NO:245) MDSDETGFEHSGLWVSVLAGLLLGACQA [0612] FGF23_HUMAN SPdb82765 Homo sapiens (Human) (SEQ ID NO:246) MLGARLRLWVCALCSVCSMSVLRA [0613] FGFR3_HUMAN SPdb82845 Homo sapiens (Human) (SEQ ID NO:247) MGAPACALALCVAVAIVAGASS [0614] FGFR4_HUMAN SPdb82851 Homo sapiens (Human) (SEQ ID NO:248) MRLLLALLGVLLSVPGPPVLS [0615] FGRL1_HUMAN SPdb82874 Homo sapiens (Human) (SEQ ID NO:249) MTPSPLLLLLLPPLLLGAFPPAAA [0616] FIBA_HUMAN SPdb83006 Homo sapiens (Human) (SEQ ID NO:250) MFSMRIVCLVLSVVGTAWT [0617] FIBG_HUMAN SPdb83075 Homo sapiens (Human) (SEQ ID NO:251) MSWSLHPRNLILYFYALLFLSSTCVA [0618] FKB14_HUMAN SPdb83515 Homo sapiens (Human) (SEQ ID NO:252) MRLFLWNAVLTLFVTSLIG [0619] FKBP2_HUMAN SPdb83570 Homo sapiens (Human) (SEQ ID NO:253) MRLSWFRVLTVLSICLSAVAT [0620] FLRT2_HUMAN SPdb84949 Homo sapiens (Human) (SEQ ID NO:254) MGLQTTKWPSHGAFFLKSWLIISLGLYSQVSKLLA [0621] FSHB_HUMAN SPdb87356 Homo sapiens (Human) (SEQ ID NO:255) MKTLQFFFLFCCWKAICC [0622] FSTL1_HUMAN SPdb87403 Homo sapiens (Human) (SEQ ID NO:256) MWKRWLALALALVAVAWVRA [0623] FSTL3_HUMAN SPdb87408 Homo sapiens (Human) (SEQ ID NO:257) MRPGAPGPLWPLPWGALAWAVGFVSS [0624] FST_HUMAN SPdb87422 Homo sapiens (Human) (SEQ ID NO:258) MVRARHQPGGLCLLLLLLCQFMEDRSAQA [0625] FZD3_HUMAN SPdb88844 Homo sapiens (Human) (SEQ ID NO:259) MAMTWIVFSLWPLTVFMGHIGG [0626] G6B_HUMAN SPdb89267 Homo sapiens (Human) (SEQ ID NO:260) MAVFLQLLPLLLSRAQG [0627] GALC_HUMAN SPdb90251 Homo sapiens (Human) (SEQ ID NO:261) MTAAAGSAGRAAVPLLLCALLAPGGA [0628] GDN_HUMAN SPdb94028 Homo sapiens (Human) (SEQ ID NO:262) MNWHLPLFLLASVTLPSIC [0629] GELS_HUMAN SPdb94075 Homo sapiens (Human) (SEQ ID NO:263) MAPHRPAPALLCALSLALCALSLPVRA [0630] GI24_HUMAN SPdb94473 Homo sapiens (Human) (SEQ ID NO:264) MGVPTALEAGSWRWGSLLFALFLAASLGPVAA [0631] GLHA_HUMAN SPdb96435 Homo sapiens (Human) (SEQ ID NO:265) MDYYRKYAAIFLVTLSVFLHVLHS [0632] GLPA_HUMAN SPdb98215 Homo sapiens (Human) (SEQ ID NO:266) MYGKIIFVLLLSAIVSISA [0633] GLPB_HUMAN SPdb98238 Homo sapiens (Human) (SEQ ID NO:267) MYGKIIFVLLLSEIVSISA [0634] GLPE_HUMAN SPdb98310 Homo sapiens (Human) (SEQ ID NO:268) MYGKIIFVLLLSGIVSISA [0635] GLUC_HUMAN SPdb99110 Homo sapiens (Human) (SEQ ID NO:269) MKSIYFVAGLFVMLVQGSWQ [0636] GNS_HUMAN SPdb100194 Homo sapiens (Human) (SEQ ID NO:270) MRLLPLAPGRLRRGSPRHLPSCSPALLLLVLGGCLG [0637] GP1BA_HUMAN SPdb100593 Homo sapiens (Human) (SEQ ID NO:271) MPLLLLLLLLPSPLHP [0638] GPI8_HUMAN SPdb101405 Homo sapiens (Human) (SEQ ID NO:272) MAVTDSLSRAATVLATVLLLSFGSVAA [0639] GPIX_HUMAN SPdb101411 Homo sapiens (Human) (SEQ ID NO:273) MPAWGALFLLWATAEA [0640] GPR56_HUMAN SPdb102058 Homo sapiens (Human) (SEQ ID NO:274) MTPQSLLQTTLFLLSLLFLVQGAHG [0641] GPR97_HUMAN SPdb102106 Homo sapiens (Human) (SEQ ID NO:275) MATPRGLGALLLLLLLPTSG [0642] GRAB_HUMAN SPdb102370 Homo sapiens (Human) (SEQ ID NO:276) MQPILLLLAFLLLPRADA [0643] GREM1_HUMAN SPdb102718 Homo sapiens (Human) (SEQ ID NO:277) MSRTAYTVGALLLLLGTLLPAAEG [0644] GROA_HUMAN SPdb102897 Homo sapiens (Human) (SEQ ID NO:278) MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAG [0645] GRP78_HUMAN SPdb102967 Homo sapiens (Human) (SEQ ID NO:279) MKLSLVAAMLLLLSAARA [0646] GRP_HUMAN SPdb103369 Homo sapiens (Human) (SEQ ID NO:280) MRGSELPLVLLALVLCLAPRGRA [0647] HA22_HUMAN SPdb106653 Homo sapiens (Human) (SEQ ID NO:281) MILNKALMLGALALTTVMSPCGG [0648] HA23_HUMAN SPdb106655 Homo sapiens (Human) (SEQ ID NO:282) MILNKALMLGALALTTVMSPCGG [0649] HA25_HUMAN SPdb106658 Homo sapiens (Human) (SEQ ID NO:283) MILNKALLLGALALTTVMSPCGG [0650] HA27_HUMAN SPdb106660 Homo sapiens (Human) (SEQ ID NO:284) MILNKALMLGSLALTTVMSPCGG [0651] HB21_HUMAN SPdb106943 Homo sapiens (Human) (SEQ ID NO:285) MSWKKALRIPGGLRAATVTLMLSMLSTPVAEG [0652] HB23_HUMAN SPdb106948 Homo sapiens (Human) (SEQ ID NO:286) MSWKKALRIPGGLRVATVTLMLAMLSTSVAEG [0653] HB24_HUMAN SPdb106950 Homo sapiens (Human) (SEQ ID NO:287) MSWKKALRIPGGLRVATVTLMLAMLSTPVAEG [0654] HB25_HUMAN SPdb106952 Homo sapiens (Human) (SEQ ID NO:288) MSWKKALRIPGDLRVATVTLMLAMLSSLLAEG [0655] HB2B_HUMAN SPdb106955 Homo sapiens (Human) (SEQ ID NO:289) MVCLRLPGGSCMAVLTVTLMVLSSPLALA [0656] HB2C_HUMAN SPdb106957 Homo sapiens (Human) (SEQ ID NO:290) MVCLRLPGGSCMAVLTVTLMVLSSPLALA [0657] HB2K_HUMAN SPdb106966 Homo sapiens (Human) (SEQ ID NO:291) MVCLKLPGGSCMAALTVTLTVLSSPLALA [0658] HEP2_HUMAN SPdb110024 Homo sapiens (Human) (SEQ ID NO:292) MKHSLNALLIFLIITSAWG [0659] HGFA_HUMAN SPdb110611 Homo sapiens (Human)(SEQ ID NO:293) MGRWAWVPSPWPPPGLGPFLLLLLLLLLLPRGFQP [0660] HIS1_HUMAN SPdb111008 Homo sapiens (Human) (SEQ ID NO:294) MKFFVFALVLALMISMISA [0661] HIS3_HUMAN SPdb111571 Homo sapiens (Human) (SEQ ID NO:295) MKFFVFALILALMLSMTGA [0662] HLAE_HUMAN SPdb113899 Homo sapiens (Human) (SEQ ID NO:296) MVDGTLLLLLSEALALTQTWA [0663] HPSE_HUMAN SPdb115516 Homo sapiens (Human) (SEQ ID NO:297) MLLRSKPALPPPLMLLLLGPLGPLSPGALPRPAQA [0664] HPT_HUMAN SPdb115541 Homo sapiens (Human) (SEQ ID NO:298) MSALGAVIALLLWGQLFA [0665] HV103_HUMAN SPdb118845 Homo sapiens (Human) (SEQ ID NO:299) MDWTWRILFLVAAATGAHS [0666] HV303_HUMAN SPdb118866 Homo sapiens (Human) (SEQ ID NO:300) MEFGLSWLFLVAILKGVQC [0667] 110R1_HUMAN SPdb119663 Homo sapiens (Human) (SEQ ID NO:301) MLPCLVVLLAALLSLRLGSDA [0668] 110R2_HUMAN SPdb119665 Homo sapiens (Human) (SEQ ID NO:302) MAWSLGSWLGGCLLVSALG [0669] I17RA_HUMAN SPdb119686 Homo sapiens (Human) (SEQ ID NO:303) MGAARSPPSAVPGPLLGLLLLLLGVLAPGGAS [0670] I17RB_HUMAN SPdb119688 Homo sapiens (Human) (SEQ ID NO:304) MSLVLLSLAALCRSAVP [0671] I17RC_HUMAN SPdb119690 Homo sapiens (Human) (SEQ ID NO:305) MPVPWFLLSLALGRSPVVLS [0672] I18BP_HUMAN SPdb119699 Homo sapiens (Human) (SEQ ID NO:306) MRHNWTPDLSPLVVVLLLCAHVVTLLVRA [0673] 120RA_HUMAN SPdb119707 Homo sapiens (Human) (SEQ ID NO:307) MRAPGRPALRPLPLPPLLLLLLAAPWGRA [0674] 120RB_HUMAN SPdb119709 Homo sapiens (Human) (SEQ ID NO:308) MQTFTMVLEEIWTSLFMWFFYALIPCLLT [0675] I22RA_HUMAN SPdb119711 Homo sapiens (Human) (SEQ ID NO:309) MMPKHCFLGFLISFFLTGVAG [0676] IBP1_HUMAN SPdb119979 Homo sapiens (Human) (SEQ ID NO:310) MSEVPVARVWLVLLLLTVQVGVTAG [0677] IBP2_HUMAN SPdb119988 Homo sapiens (Human) (SEQ ID NO:311) MLPRVGCPALPLPPPPLLPLLPLLLLLLGASGGGGGARA [0678] IBP3_HUMAN SPdb119995 Homo sapiens (Human) (SEQ ID NO:312) MQRARPTLWAAALTLLVLLRGPPVARA [0679] IBP7_HUMAN SPdb120015 Homo sapiens (Human) (SEQ ID NO:313) MERPSLRALLLGAAGLLLLLLPLSSS [0680] IFN16_HUMAN SPdb122381 Homo sapiens (Human) (SEQ ID NO:314) MALSFSLLMAVLVLSYKSICSLG [0681] IFNA2_HUMAN SPdb122393 Homo sapiens (Human) (SEQ ID NO:315) MALTFALLVALLVLSCKSSCSVG [0682] IFNA4_HUMAN SPdb122399 Homo sapiens (Human) (SEQ ID NO:316) MALSFSLLMAVLVLSYKSICSLG [0683] IFNA5_HUMAN SPdb122401 Homo sapiens (Human) (SEQ ID NO:317) MALPFVLLMALWLNCKSICS [0684] IFNA6_HUMAN SPdb122403 Homo sapiens (Human) (SEQ ID NO:318) MALPFALLMALVVLSCKSSC [0685] IFNA7_HUMAN SPdb122405 Homo sapiens (Human) (SEQ ID NO:319) MARSFSLLMVVLVLSYKSICSLG [0686] IFNK_HUMAN SPdb122481 Homo sapiens (Human) (SEQ ID NO:320) MSTKPDMIQKCLWLEILMGIFIAGTLS [0687] IFNW1_HUMAN SPdb122503 Homo sapiens (Human) (SEQ ID NO:321) MALLFPLLAALVMTSYSPVGS [0688] IGF2_HUMAN SPdb122603 Homo sapiens (Human) (SEQ ID NO:322) MGIPMGKSMLVLLTFLAFASCCIA [0689] IGFL1_HUMAN SPdb122611 Homo sapiens (Human) (SEQ ID NO:323) MAPRGCIVAVFAIFCISRLLCSHG [0690] IGFL3_HUMAN SPdb122613 Homo sapiens (Human) (SEQ ID NO:324) MRPRCCILALVCWITVFLLQCSKG [0691] IL10_HUMAN SPdb123103 Homo sapiens (Human) (SEQ ID NO:325) MHSSALLCCLVLLTGVRA [0692] IL12A_HUMAN SPdb123133 Homo sapiens (Human) (SEQ ID NO:326) MCPARSLLLVATLVLLDHLSLA [0693] IL12B_HUMAN SPdb123153 Homo sapiens (Human) (SEQ ID NO:327) MCHQQLVISWFSLVFLASPLVA [0694] IL17F_HUMAN SPdb123200 Homo sapiens (Human) (SEQ ID NO:328) MVKYLLLSILGLAFLSEAAA [0695] IL17_HUMAN SPdb123202 Homo sapiens (Human) (SEQ ID NO:329) MTPGKTSLVSLLLLLSLEAIVKA [0696] IL19_HUMAN SPdb123221 Homo sapiens (Human) (SEQ ID NO:330) MKLQCVSLWLLGTILILCSVDNHG [0697] IL1R1_HUMAN SPdb123285 Homo sapiens (Human) (SEQ ID NO:331) MKVLLRLICFIALLISS [0698] IL1RA_HUMAN SPdb123295 Homo sapiens (Human) (SEQ ID NO:332) MEICRGLRSHLITLLLFLFHSETIC [0699] IL20_HUMAN SPdb123302 Homo sapiens (Human) (SEQ ID NO:333) MKASSLAFSLLSAAFYLLWTPSTG [0700] IL21R_HUMAN SPdb123304 Homo sapiens (Human) (SEQ ID NO:334) MPRGWAAPLLLLLLQGGWG [0701] IL22_HUMAN SPdb123314 Homo sapiens (Human) (SEQ ID NO:335) MAALQKSVSSFLMGTLATSCLLLLALLVQGGAA [0702] IL24_HUMAN SPdb123324 Homo sapiens (Human) (SEQ ID NO:336) MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSG [0703] AQG [0704] IL25_HUMAN SPdb123327 Homo sapiens (Human) (SEQ ID NO:337) MRERPRLGEDSSLISLFLQWAFLAMVMGTHT [0705] IL2RA_HUMAN SPdb123341 Homo sapiens (Human) (SEQ ID NO:338) MDSYLLMWGLLTFIMVPGCQA [0706] IL2RB_HUMAN SPdb123348 Homo sapiens (Human) (SEQ ID NO:339) MAAPALSWRLPLLILLLPLATSWASA [0707] IL2RG_HUMAN SPdb123355 Homo sapiens (Human) (SEQ ID NO:340) MLKPSLPFTSLLFLQLPLLGVG [0708] IL2_HUMAN SPdb123376 Homo sapiens (Human) (SEQ ID NO:341) MYRMQLLSCIALSLALVTNS [0709] IL3_HUMAN SPdb123414 Homo sapiens (Human) (SEQ ID NO:342) MSRLPVLLLLQLLVRPGLQ [0710] IL4_HUMAN SPdb123438 Homo sapiens (Human) (SEQ ID NO:343) MGLTSQLLPPLFFLLACAGNFVHG [0711] IL5RA_HUMAN SPdb123452 Homo sapiens (Human) (SEQ ID NO:344) MIIVAHVLLILLGATEILQA [0712] IL6RA_HUMAN SPdb123469 Homo sapiens (Human) (SEQ ID NO:345) MLAVGCALLAALLAAPGAA [0713] IL7RA_HUMAN SPdb123503 Homo sapiens (Human) (SEQ ID NO:346) MTILGTTFGMVFSLLQWSG [0714] IL7_HUMAN SPdb123506 Homo sapiens (Human) (SEQ ID NO:347) MFHVSFRYIFGLPPLILVLLPVASS [0715] IL9_HUMAN SPdb123527 Homo sapiens (Human) (SEQ ID NO:348) MLLAMVLTSALLLCSVAG [0716] ILRL1_HUMAN SPdb123591 Homo sapiens (Human) (SEQ ID NO:349) MGFWILAILTILMYSTAA [0717] INAR2_HUMAN SPdb124806

Homo sapiens (Human) (SEQ ID NO:350) MLLSQNAFIFRSLNLVLMVYISLVFG [0718] INHA_HUMAN SPdb124863 Homo sapiens (Human) (SEQ ID NO:351) MVLHLLLFLLLTPQGGHS [0719] INSL3_HUMAN SPdb125047 Homo sapiens (Human) (SEQ ID NO:352) MDPRLPAWALVLLGPALVFA [0720] INSL4_HUMAN SPdb125053 Homo sapiens (Human) (SEQ ID NO:353) MASLFRSYLPAIWLLLSQLLRESLA [0721] INSL5_HUMAN SPdb125056 Homo sapiens (Human) (SEQ ID NO:354) MKGSIFTLFLFSVLFAISEVRS [0722] INS_HUMANSPdb125119 Homo sapiens (Human) (SEQ ID NO:355) MALWMRLLPLLALLALWGPDPAAA [0723] IPSP_HUMAN SPdb125761 Homo sapiens (Human) (SEQ ID NO:356) MQLFLLLCLVLLSPQGASL [0724] IRBP_HUMAN SPdb126007 Homo sapiens (Human) (SEQ ID NO:357) MMREVVVLLMSVLLCGLA [0725] ISK6_HUMAN SPdb126513 Homo sapiens (Human) (SEQ ID NO:358) MKLSGMFLLLSLALFCFLTGVFS [0726] ITA2B_HUMAN SPdb128319 Homo sapiens (Human) (SEQ ID NO:359) MARALCPLQALWLLEWVLLLLGPCAAPPAWA [0727] ITA2_HUMAN SPdb128324 Homo sapiens (Human) (SEQ ID NO:360) MGPERTGAAPLPLLLVLALSQGILNCCLA [0728] ITA3_HUMAN SPdb128328 Homo sapiens (Human) (SEQ ID NO:361) MGPGPSRAPRAPRLMLCALALMVAAGGCWSA [0729] ITA4_HUMAN SPdb128331 Homo sapiens (Human) (SEQ ID NO:362) MFPTESAWLGKRGANPGPEAAVRETVMLLLCLGVPTGRP [0730] ITA6_HUMAN SPdb128340 Homo sapiens (Human) (SEQ ID NO:363) MAAAGQLCLLYLSAGLLSRLGAA [0731] ITA7_HUMAN SPdb128342 Homo sapiens (Human) (SEQ ID NO:364) MAGARSRDPWGASGICYLFGSLLVELLFSRAVA [0732] ITAE_HUMAN SPdb128352 Homo sapiens (Human) (SEQ ID NO:365) MWLFHTLLCIASLALLAA [0733] ITAL_HUMAN SPdb128355 Homo sapiens (Human) (SEQ ID NO:366) MKDSCITVMAMALLSGFFFFAPASS [0734] ITAV_HUMAN SPdb128362 Homo sapiens (Human) (SEQ ID NO:367) MAFPPRRRLRLGPRGLPLLLSGLLLPLCRA [0735] ITAX_HUMAN SPdb128364 Homo sapiens (Human) (SEQ ID NO:368) MTRTRAALLLFTALATSLG [0736] ITB2_HUMAN SPdb128379 Homo sapiens (Human) (SEQ ID NO:369) MLGLRPPLLALVGLLSLGCVLS [0737] ITB4_HUMAN SPdb128387 Homo sapiens (Human) (SEQ ID NO:370) MAGPRPSPWARLLLAALISVSLSGTLA [0738] ITIH4_HUMAN SPdb128480 Homo sapiens (Human) (SEQ ID NO:371) MKPPRPVRTCSKVLVLLSLLAIHQTTTA [0739] JAM1_HUMAN SPdb128758 Homo sapiens (Human) (SEQ ID NO:372) MGTKAQVERKLLCLFILAILLCSLALG [0740] JAM2_HUMAN SPdb128761 Homo sapiens (Human) (SEQ ID NO:373) MARRSRHRLLLLLLRYLWALGYHKAYG [0741] JAM3_HUMAN SPdb128763 Homo sapiens (Human) (SEQ ID NO:374) MALRRPPRLRLCARLPDFFLLLLFRGCLIGA [0742] JAML1_HUMAN SPdb128766 Homo sapiens (Human) (SEQ ID NO:375) MFCPLKLILLPVLLDYSLG [0743] KAZD1_HUMAN SPdb130734 Homo sapiens (Human) (SEQ ID NO:376) MLPPPRPAAALALPVLLLLLVVLTPPPTGA [0744] KI2L1_HUMAN SPdb132984 Homo sapiens (Human) (SEQ ID NO:377) MSLLWSMACVGFFLLQGAWP [0745] KIRR2_HUMAN SPdb133175 Homo sapiens (Human) (SEQ ID NO:378) MLRMRVPALLVLLFCFRGRA [0746] KLK3_HUMAN SPdb133637 Homo sapiens (Human) (SEQ ID NO:379) MWVPVVFLTLSVTWIGA [0747] KLKB1_HUMAN SPdb133654 Homo sapiens (Human) (SEQ ID NO:380) MILFKQATYFISLFATVSC [0748] KNG1_HUMAN SPdb133744 Homo sapiens (Human) (SEQ ID NO:381) MKLITILFLCSRLLLSLT [0749] KTEL1_HUMAN SPdb135048 Homo sapiens (Human) (SEQ ID NO:382) MEWWASSPLRLWLLLFLLPSAQG [0750] KV403_HUMAN SPdb135854 Homo sapiens (Human) (SEQ ID NO:383) MVLQTQVFISLLLWISGAYG [0751] KV404_HUMAN SPdb135855 Homo sapiens (Human) (SEQ ID NO:384) MVLQTQVFISLLLWISGAYG [0752] L1CAM_HUMAN SPdb135937 Homo sapiens (Human) (SEQ ID NO:385) MVVALRYVWPLLLCSPCLL [0753] LALBA_HUMAN SPdb136381 Homo sapiens (Human) (SEQ ID NO:386) MRFFVPLFLVGILFPAILA [0754] LAMB1_HUMAN SPdb136411 Homo sapiens (Human) (SEQ ID NO:387) MG LLQLLAFSFLALCRARVRA [0755] LAMC1_HUMAN SPdb136476 Homo sapiens (Human) (SEQ ID NO:388) MRGSHRAAPALRPRGRLWPVLAVLAAAAAAGCA [0756] LAMP1_HUMAN SPdb136491 Homo sapiens (Human) (SEQ ID NO:389) MAPRSARRPLLLLLPVAAARPHALSSA [0757] LAMP2_HUMAN SPdb136496 Homo sapiens (Human) (SEQ ID NO:390) MVCFRLFPVPGSGLVLVCLVLGAVRSYA [0758] LBP_HUMAN SPdb136757 Homo sapiens (Human) (SEQ ID NO:391) MGALARALPSILLALLLTSTPEALG [0759] LCAT_HUMAN SPdb136799 Homo sapiens (Human) (SEQ ID NO:392) MGPPGSPWQWVTLLLGLLLPPAAP [0760] LCN1_HUMAN SPdb136934 Homo sapiens (Human) (SEQ ID NO:393) MKPLLLAVSLGLIAALQA [0761] LCTL_HUMAN SPdb137082 Homo sapiens (Human) (SEQ ID NO:394) MKPVWVATLLWMLLLVPRLGA [0762] LEUK_HUMAN SPdb139543 Homo sapiens (Human) (SEQ ID NO:395) MATLLLLLGVLVVSPDALG [0763] LG3BP_HUMAN SPdb140022 Homo sapiens (Human) (SEQ ID NO:396) MTPPRLFWVWLLVAGTQG [0764] LIF_HUMAN SPdb140701 Homo sapiens (Human) (SEQ ID NO:397) MKVLAAGWPLLLVLHWKHGAG [0765] LIPG_HUMAN SPdb141547 Homo sapiens (Human) (SEQ ID NO:398) MWLLLTMASLISVLGTTHG [0766] LIPP_HUMAN SPdb141584 Homo sapiens (Human) (SEQ ID NO:399) MLPLWTLSLLLGAVAG [0767] LIRA3_HUMAN SPdb141630 Homo sapiens (Human) (SEQ ID NO:400) MTPILTVLICLGLSLDPRTHVQA [0768] LMAN1_HUMAN SPdb141882 Homo sapiens (Human) (SEQ ID NO:401) MAGSRQRGLRARVRPLFCALLLSLGRFVRG [0769] LPH_HUMAN SPdb142734 Homo sapiens (Human) (SEQ ID NO:402) MELSWHWFIALLSFSCWG [0770] LRC55_HUMAN SPdb144275 Homo sapiens (Human) (SEQ ID NO:403) MGSLQHCCCLLPKMGDTWAQLPWPGPPHPAMLLISLLLAAGLMHSDA [0771] LRRN1_HUMAN SPdb144478 Homo sapiens (Human) (SEQ ID NO:404) MARMSFVIAACQLVLGLLMTSLTES [0772] LSHB_HUMAN SPdb144551 Homo sapiens (Human) (SEQ ID NO:405) MEMLQGLLLLLLLSMGGAWA [0773] LUM_HUMAN SPdb145084 Homo sapiens (Human) (SEQ ID NO:406) MSLSAFTLFLALIGGTSG [0774] LU_HUMAN SPdb145367 Homo sapiens (Human) (SEQ ID NO:407) MEPPDAPAQARGAPRLLLLAVLLAAHPDAQA [0775] LV605_HUMAN SPdb145410 Homo sapiens (Human) (SEQ ID NO:408) MAWAPLLLTLLAHCTDCWA [0776] LY86_HUMAN SPdb145461 Homo sapiens (Human) (SEQ ID NO:409) MKGFTATLFLWTLIFPSCSG [0777] LYAM2_HUMAN SPdb145485 Homo sapiens (Human) (SEQ ID NO:410) MIASQFLSALTLVLLIKESGA [0778] LYPA3_HUMAN SPdb145568 Homo sapiens (Human) (SEQ ID NO:411) MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALP [0779] LYPD6_HUMAN SPdb145583 Homo sapiens (Human) (SEQ ID NO:412) MEPGPALAWLLLLSLLADCLKA [0780] LYSC_HUMAN SPdb145736 Homo sapiens (Human) (SEQ ID NO:413) MKALIVLGLVLLSVTVQG [0781] MBL2_HUMAN SPdb148469 Homo sapiens (Human) (SEQ ID NO:414) MSLFPSLPLLLLSMVAASYS [0782] MCP_HUMAN SPdb149004 Homo sapiens (Human) (SEQ ID NO:415) MEPPGRRECPFPSWRFPGLLLAAMVLLLYSFSDA [0783] MFAP4_HUMAN SPdb152514 Homo sapiens (Human) (SEQ ID NO:416) MKALLALPLLLLLSTPPCAPQ [0784] MGP_HUMAN SPdb152777 Homo sapiens (Human) (SEQ ID NO:417) MKSLILLAILAALAVVTLC [0785] MIA_HUMAN SPdb153344 Homo sapiens (Human) (SEQ ID NO:418) MARSLVCLGVIILLSAFSGPGVRG [0786] MIME_HUMAN SPdb153448 Homo sapiens (Human) (SEQ ID NO:419) MKTLQSTLLLLLLVPLIKPA [0787] MIP2A_HUMAN SPdb153896 Homo sapiens (Human) (SEQ ID NO:420) MARATLSAAPSNPRLLRVALLLLLLVAASRRAAG [0788] MIP2B_HUMAN SPdb153898 Homo sapiens (Human) (SEQ ID NO:421) MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAG [0789] MK_HUMAN SPdb154137 Homo sapiens (Human) (SEQ ID NO:422) MQHRGFLLLTLLALLALTSA [0790] MMP1_HUMAN SPdb154439 Homo sapiens (Human) (SEQ ID NO:423) MHSFPPLLLLLFWGWSHS [0791] MOTI_HUMAN SPdb155899 Homo sapiens (Human) (SEQ ID NO:424) MVSRKAVAALLVVHVAAMLASQTEA [0792] MOX2R_HUMAN SPdb155983 Homo sapiens (Human) (SEQ ID NO:425) MLCPWRTANLGLLLILTIFLVAASSSLC [0793] MPRD_HUMAN SPdb156360 Homo sapiens (Human) (SEQ ID NO:426) MFPFYSCWRTGLLLLLLAVAVRESWQ [0794] MPRI_HUMAN SPdb156380 Homo sapiens (Human) (SEQ ID NO:427) MGAAAGRSPHLGPAPARRPQRSLLLLQLLLLVAAPGSTQA [0795] MPZL3_HUMAN SPdb156425 Homo sapiens (Human) (SEQ ID NO:428) MQQRGAAGSRGCALFPLLGVLFFQGVYIVFS [0796] MSMB_HUMAN SPdb158422 Homo sapiens (Human) (SEQ ID NO:429) MNVLLGSWIFATFVTLCNA [0797] MYP0_HUMAN SPdb164385 Homo sapiens (Human) (SEQ ID NO:430) MAPGAPSSSPSPILAVLLFSSLVLSPAQA [0798] NAGAB_HUMAN SPdb165267 Homo sapiens (Human) (SEQ ID NO:431) MLLKTVLLLGHVAQVLM [0799] NELL2_HUMAN SPdb168581 Homo sapiens (Human) (SEQ ID NO:432) MESRVLLRTFCLIFGLGAVWG [0800] NETO2_HUMAN SPdb168760 Homo sapiens (Human) (SEQ ID NO:433) MALERLCSVLKVLLITVLWEG [0801] NEU1_HUMAN SPdb168777 Homo sapiens (Human) (SEQ ID NO:434) MAGPSLACCLLGLLALTSA [0802] NEU2_HUMAN SPdb168794 Homo sapiens (Human) (SEQ ID NO:435) MPDTMLPACFLGLLAFSSA [0803] NGAL_HUMAN SPdb169201 Homo sapiens (Human) (SEQ ID NO:436) MPLGLLWLGLALLGALHAQA [0804] NID1_HUMAN SPdb169544 Homo sapiens (Human) (SEQ ID NO:437) MLASSSRIRAAWTRALLLPLLLAGPVGC [0805] NID2_HUMAN SPdb169547 Homo sapiens (Human) (SEQ ID NO:438) MEGDRVAGRPVLSSLPVLLLLQLLMLRAAA [0806] NLGNX_HUMAN SPdb170305 Homo sapiens (Human) (SEQ ID NO:439) MSRPQGLLWLPLLFTPVCVMLNSNVLLWLTALAIKFTLIDS [0807] NMB_HUMAN SPdb170485 Homo sapiens (Human) (SEQ ID NO:440) MARRAGGARMFGSLLLFALLAAGV [0808] NOV_HUMAN SPdb171434 Homo sapiens (Human) (SEQ ID NO:441) MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAA [0809] NPTN_HUMAN SPdb171815 Homo sapiens (Human) (SEQ ID NO:442) MSGSSLPSALALSLLLVSGSLLPGPGAA [0810] NPY_HUMAN SPdb171875 Homo sapiens (Human) (SEQ ID NO:443) MLGNKRLGLSGLTLALSLLVCLGALAEA [0811] NRP1_HUMAN SPdb172978 Homo sapiens (Human) (SEQ ID NO:444) MERGLPLLCAVLALVLAPAGA [0812] NTRK2_HUMAN SPdb173863 Homo sapiens (Human) (SEQ ID NO:445) MSSWIRWHGPAMARLWGFCWLWGFWRAAFA [0813] NXPH3_HUMAN SPdb177361 Homo sapiens (Human) (SEQ ID NO:446) MQLTRCCFVFLVQGSLYLVICG [0814] OLFL1_HUMAN SPdb178511 Homo sapiens (Human) (SEQ ID NO:447) MMVALRGASALLVLFLAAFLPPPQCTQD [0815] OTOR_HUMAN SPdb180733 Homo sapiens (Human) (SEQ ID NO:448) MARILLLFLPGLVAVCA [0816] OXLA_HUMAN SPdb181241 Homo sapiens (Human) (SEQ ID NO:449) MAPLALHLLVLVPILLSLVAS [0817] P3IP1_HUMAN SPdb181543 Homo sapiens (Human) (SEQ ID NO:450) MLLAWVQAFLVSNMLLAEAYG [0818] PAHO_HUMAN SPdb182446 Homo sapiens (Human) (SEQ ID NO:451) MAAARLCLSLLLLSTCVALLLQPLLGAQG [0819] PARM1_HUMAN SPdb184104 Homo sapiens (Human) (SEQ ID NO:452) MVYKTLFALCILTAGWRVQS [0820] PCDBA_HUMAN SPdb184878 Homo sapiens (Human) (SEQ ID NO:453) MAVRELCFPRQRQVLFLFLFWGVSLA [0821] PCOC2_HUMAN SPdb185137 Homo sapiens (Human) (SEQ ID NO:454) MRGANAWAPLCLLLAAATQLSRQ [0822] PCYXL_HUMAN SPdb185474 Homo sapiens (Human) (SEQ ID NO:455) MARAPPLLAALTALLAAAAAGG [0823] PDGFA_HUMAN SPdb185687 Homo sapiens (Human) (SEQ ID NO:456) MRTLACLLLLGCGYLAHVLA [0824] PDIA1_HUMAN SPdb185732 Homo sapiens (Human) (SEQ ID NO:457) MLRRALLCLAVAALVRA [0825] PDIA3_HUMAN SPdb185743 Homo sapiens (Human) (SEQ ID NO:458) MRLRRLALFPGVALLLAAARLAAA [0826] PDYN_HUMAN SPdb186941 Homo sapiens (Human) (SEQ ID NO:459) MAWQGLVLAACLLMFPSTTA [0827] PEBP4_HUMAN SPdb187068 Homo sapiens (Human) (SEQ ID NO:460) MGWTMRLVTAALLLGLMMWTG [0828] PECA1_HUMAN SPdb187074 Homo sapiens (Human) (SEQ ID NO:461) MQPRWAQGATMWLGVLLTLLLCSSLEG [0829] PG12B_HUMAN SPdb188887 Homo sapiens (Human) (SEQ ID NO:462) MKLASGFLVLWLSLGGGLA [0830] PGFRA_HUMAN SPdb189004 Homo sapiens (Human) (SEQ ID NO:463) MGTSHPAFLVLGCLLTGLSLILC [0831] PGFRB_HUMAN SPdb189010 Homo sapiens (Human) (SEQ ID NO:464) MRLPGAMPALALKGELLLLSLLLLLEPQISQG [0832] PGH1_HUMAN SPdb189021 Homo sapiens (Human) (SEQ ID NO:465) MSRSLLLRFLLFLLLLPPLPVLL [0833] PGRP2_HUMAN SPdb189713 Homo sapiens (Human) (SEQ ID NO:466) MAQGVLWILLGLLLWSDPGTA [0834] PIGT_HUMAN SPdb191467 Homo sapiens (Human) (SEQ ID NO:467) MAAAMPLALLVLLLLGPGGWC [0835] PIP_HUMAN SPdb191771 Homo sapiens (Human) (SEQ ID NO:468) MRLLQLLFRASPATLLLVLCLQLGANKA [0836] PLBL2_HUMAN SPdb192296 Homo sapiens (Human) (SEQ ID NO:469) MVGQMYCYPGSHLARALTRALALALVLALLVGPFLSGLAGA [0837] PLF4_HUMAN SPdb192496 Homo sapiens (Human) (SEQ ID NO:470) MSSAAGFCASRPGLLFLGLLLLPLVVAFASA [0838] PLOD1_HUMAN SPdb192587 Homo sapiens (Human) (SEQ ID NO:471) MRPLLLLALLGWLLLAEA [0839] PORIM_HUMAN SPdb194575 Homo sapiens (Human) (SEQ ID NO:472) MGLGARGAWAALLLGTLQVLALLGAA [0840] PPA6_HUMAN SPdb195079 Homo sapiens (Human) (SEQ ID NO:473) MITGVFSMRLWTPVGVLTSLAYCLHQRRVALA [0841] PPAP_HUMAN SPdb195174 Homo sapiens (Human) (SEQ ID NO:474) MRAAPLLLARAASLSLGFLFLLFFWLDRSVLA [0842] PPGB_HUMAN SPdb195573 Homo sapiens (Human) (SEQ ID NO:475) MIRAAPPPLFLLLLLLLLLVSWASRGEA [0843] PPIB_HUMAN SPdb195662 Homo sapiens (Human) (SEQ ID NO:476) MKVLLAAALIAGSVFFLLLPGPSAA [0844] PRB4_HUMAN SPdb196833 Homo sapiens (Human) (SEQ ID NO:477) MLLILLSVALLALSSA [0845] PRLR_HUMAN SPdb197321 Homo sapiens (Human) (SEQ ID NO:478) MKENVASATVFTLLLFLNTCLLNG [0846] PRL_HUMAN SPdb197346 Homo sapiens (Human) (SEQ ID NO:479) MN IKGSPWKGSLLLLLVSNLLLCQSVAP [0847] PROK1_HUMAN SPdb198420 Homo sapiens (Human) (SEQ ID NO:480) MRGATRVSIMLLLVTVSDC [0848] PROK2_HUMAN SPdb198424 Homo sapiens (Human) (SEQ ID NO:481) MRSLCCAPLLLLLLLPPLLLTPRAGDA [0849] PROP_HUMAN SPdb198449 Homo sapiens (Human) (SEQ ID NO:482) MITEGAQAPRLLLPPLLLLLTLPATGS [0850] PROZ_HUMAN SPdb198539 Homo sapiens (Human) (SEQ ID NO:483) MAGCVPLLQGLVLVLALHRVEPS [0851] PRP1_HUMAN SPdb198570 Homo sapiens (Human) (SEQ ID NO:484) MLLILLSVALLALSSA [0852] PRPC_HUMAN SPdb198723 Homo sapiens (Human) (SEQ ID NO:485) MLLILLSVALLAFSSA [0853] PRRT3_HUMAN SPdb198854 Homo sapiens (Human) (SEQ ID NO:486) MASSPWGCVCGLLLLLLPLLGTGPALG [0854] PTGDS_HUMAN SPdb203865 Homo sapiens (Human) (SEQ ID NO:487) MATH HTLWMGLALLGVLGDLQA [0855] PTHY_HUMAN SPdb203993 Homo sapiens (Human) (SEQ ID NO:488) MIPAKDMAKVMIVMLAICFLTKSDG [0856] PTPRG_HUMAN SPdb204842 Homo sapiens (Human) (SEQ ID NO:489) MRRLLEPCWWILFLKITSS [0857] PYY_HUMAN SPdb210515 Homo sapiens (Human) (SEQ ID NO:490) MVFVRRPWPALTTVLLALLVCLGALVDA [0858] PZP_HUMAN SPdb210532 Homo sapiens (Human) (SEQ ID NO:491) MRKDRLLHLCLVLLLILLSASDSNS [0859] REGIA_HUMAN SPdb217426 Homo sapiens (Human) (SEQ ID NO:492) MAQTSSYFMLISCLMFLSQSQG [0860] REG3G_HUMAN SPdb217443 Homo sapiens (Human) (SEQ ID NO:493) MLPPMALPSVSWMLLSCLILLCQVQG [0861] RIB1_HUMAN SPdb220194 Homo sapiens (Human) (SEQ ID NO:494) MEAPAAGLFLLLLLGTWAPAPGS [0862] RIB2_HUMAN SPdb220201 Homo sapiens (Human) (SEQ ID NO:495) MAPPGSSTVFLLALTIIASTWA [0863] RISC_HUMAN SPdb221907 Homo sapiens (Human) (SEQ ID NO:496) MELALRRSPVPRWLLLLPLLLGLNAG [0864] RNAS1_HUMAN SPdb241351 Homo sapiens (Human) (SEQ ID NO:497) MALEKSLVRLLLLVLILLVLGVVVQPSLG [0865] RNAS4_HUMAN SPdb241408 Homo sapiens (Human) (SEQ ID NO:498) MALQRTHSLLLLLLLTLLGLGLVQPSYG [0866] S39A6_HUMAN SPdb264754 Homo sapiens (Human) (SEQ ID NO:499) MARKLSVILILTFALSVTNPLHELKAAA [0867] SAA4_HUMAN SPdb264973 Homo sapiens (Human) (SEQ ID NO:500) MRLFTGIVFCSLVMGVTS [0868] SAA_HUMAN SPdb264986 Homo sapiens (Human) (SEQ ID NO:501) MKLLTGLVFCSLVLGVSS [0869] SAMP_HUMAN SPdb265378 Homo sapiens (Human) (SEQ ID NO:502) MNKPLLWISVLTSLLEAFA [0870] SCG1_HUMAN SPdb266260 Homo sapiens (Human) (SEQ ID NO:503) MQPTLLLSLLGAVGLAAVNS [0871] SCRG1_HUMAN SPdb266759 Homo sapiens (Human) (SEQ ID NO:504) MKLMVLVFTIGLTLLLGVQA [0872] SEM4B_HUMAN SPdb269059 Homo sapiens (Human) (SEQ ID NO:505) MGLRSWLAAPWGALPPRPPLLLLLLLLLLLQPPPPTWA [0873] SEM6B_HUMAN SPdb269079 Homo sapiens (Human) (SEQ ID NO:506) MQTPRASPPRPALLLLLLLLGGAHG [0874] SEMG1_HUMAN SPdb269090 Homo sapiens (Human) (SEQ ID NO:507) MKPNIIFVLSLLLILEKQAAVMG [0875] SEMG2_HUMAN SPdb269095 Homo sapiens (Human) (SEQ ID NO:508) MKSIILFVLSLLLILEKQAAVMG [0876] SEPP1_HUMAN SPdb269196 Homo sapiens (Human) (SEQ ID NO:509) MWRSLGLALALCLLPSGGT [0877] SFRP2_HUMAN SPdb269743 Homo sapiens (Human) (SEQ ID NO:510) MLQGPGSLLLLFLASHCCLGSARG [0878] SFRP3_HUMAN SPdb269747 Homo sapiens (Human) (SEQ ID NO:511) MVCGSPGGMLLLRAGLLALAALCLLRVPGARA [0879] SFTPG_HUMAN SPdb269980 Homo sapiens (Human) (SEQ ID NO:512) MGSGLPLVLLLTLLGSSHG [0880] SG1D4_HUMAN SPdb270016 Homo sapiens (Human) (SEQ ID NO:513) MRLSVCLLMVSLALCCYQAHA [0881] SG3A1_HUMAN SPdb270025

Homo sapiens (Human) (SEQ ID NO:514) MKLAALLGLCVALSCSSAAA [0882] SHBG_HUMAN SPdb270301 Homo sapiens (Human) (SEQ ID NO:515) MESRGPLATSRLLLLLLLLLLRHTRQGWA [0883] SIAL_HUMAN SPdb270534 Homo sapiens (Human) (SEQ ID NO:516) MKTALILLSILGMACA [0884] SIDT2_HUMAN SPdb270589 Homo sapiens (Human) (SEQ ID NO:517) MFALGLPFLVLLVASVES [0885] SLAF6_HUMAN SPdb271065 Homo sapiens (Human) (SEQ ID NO:518) MLWLFQSLLFVFCFGPGNWS [0886] SLAF7_HUMAN SPdb271067 Homo sapiens (Human) (SEQ ID NO:519) MAGSPTCLTLIYILWQLTGSAA [0887] SLAF8_HUMAN SPdb271069 Homo sapiens (Human)(SEQ ID NO:520) MVMRPLWSLLLWEALLPITVTG [0888] SLPI_HUMAN SPdb271309 Homo sapiens (Human) (SEQ ID NO:521) MKSSGLFPFLVLLALGTLAPWAVEG [0889] SMR3B_HUMAN SPdb271976 Homo sapiens (Human) (SEQ ID NO:522) MKSLTWILGLWALAACFTPGES [0890] SMS_HUMAN SPdb272029 Homo sapiens (Human) (SEQ ID NO:523) MLSCRLQCALAALSIVLALGCVTG [0891] SODE_HUMAN SPdb272720 Homo sapiens (Human) (SEQ ID NO:524) MLALLCSCLLLAAGASDA [0892] SOSD1_HUMAN SPdb273214 Homo sapiens (Human) (SEQ ID NO:525) MLPPAIHFYLLPLACILMKSCLA [0893] SOST_HUMAN SPdb273220 Homo sapiens (Human) (SEQ ID NO:526) MQLPLALCLVCLLVHTAFRWEG [0894] SPIT1_HUMAN SPdb274564 Homo sapiens (Human) (SEQ ID NO:527) MAPARTMARARLAPAGIPAVALWLLCTLGLQGTQA [0895] SPIT2_HUMAN SPdb274566 Homo sapiens (Human) (SEQ ID NO:528) MAQLCGLRRSRAFLALLGSLLLSGVLA [0896] SRCH_HUMAN SPdb275436 Homo sapiens (Human) (SEQ ID NO:529) MGHHRPWLHASVLWAGVASLLLPPAMTQ [0897] SRGN_HUMAN SPdb275551 Homo sapiens (Human) (SEQ ID NO:530) MMQKLLKCSRLVLALALILVLESSVQG [0898] STAT_HUMAN SPdb277447 Homo sapiens (Human) (SEQ ID NO:531) MKFLVFAFILALMVSMIGA [0899] STC1_HUMAN SPdb277483 Homo sapiens (Human) (SEQ ID NO:532) MLQNSAVLLVLVISASA [0900] TCO1_HUMAN SPdb290388 Homo sapiens (Human) (SEQ ID NO:533) MRQSHQLPLVGLLLFSFIPSQLC [0901] TCO2_HUMAN SPdb290391 Homo sapiens (Human) (SEQ ID NO:534) MRHLGAFLFLLGVLGALT [0902] TENA_HUMAN SPdb291090 Homo sapiens (Human) (SEQ ID NO:535) MGAMTQLLAGVFLAFLALATEG [0903] TETN_HUMAN SPdb291269 Homo sapiens (Human) (SEQ ID NO:536) MELWGAYLLLCLFSLLTQVTT [0904] TFF1_HUMAN SPdb291574 Homo sapiens (Human) (SEQ ID NO:537) MATMENKVICALVLVSMLALGTLA [0905] TFF3_HUMAN SPdb291583 Homo sapiens (Human) (SEQ ID NO:538) MAARALCMLGLVLALLSSSSA [0906] TFPI1_HUMAN SPdb291601 Homo sapiens (Human) (SEQ ID NO:539) MIYTMKKVHALWASVCLLLNLAPAPLNA [0907] TGFR2_HUMAN SPdb291788 Homo sapiens (Human) (SEQ ID NO:540) MGRGLLRGLWPLHIVLWTRIAS [0908] THBG_HUMAN SPdb292195 Homo sapiens (Human) (SEQ ID NO:541) MSPFLYLVLLVLGLHATIHC [0909] THYG_HUMAN SPdb293853 Homo sapiens (Human) (SEQ ID NO:542) MALVLEIFTLLASICVVVSA [0910] TICN2_HUMAN SPdb293959 Homo sapiens (Human) (SEQ ID NO:543) MRAPGCGRLVLPLLLLAAAALA [0911] TIE1_HUMAN SPdb293968 Homo sapiens (Human) (SEQ ID NO:544) MVWRVPPFLLPILFLASHVGA [0912] TIE2_HUMAN SPdb293972 Homo sapiens (Human) (SEQ ID NO:545) MDSLASLVLCGVSLLLSGTVEG [0913] TIMP1_HUMAN SPdb294965 Homo sapiens (Human) (SEQ ID NO:546) MAPFEPLASGILLLLWLIAPSRA [0914] TIMP2_HUMAN SPdb294980 Homo sapiens (Human) (SEQ ID NO:547) MGAAARTLRLALGLLLLATLLRPADA [0915] TIMP3_HUMAN SPdb294987 Homo sapiens (Human) (SEQ ID NO:548) MTPWLGLIVLLGSWSLGDWGAEA [0916] TINAL_HUMAN SPdb295015 Homo sapiens (Human) (SEQ ID NO:549) MWRCPLGLLLLLPLAGHLALG [0917] TLR1_HUMAN SPdb295471 Homo sapiens (Human) (SEQ ID NO:550) MTSIFHFAIIFMLILQIRIQLSEE [0918] TLR3_HUMAN SPdb295485 Homo sapiens (Human) (SEQ ID NO:551) MRQTLPCIYFWGGLLPFGMLCAS [0919] TLR4_HUMAN SPdb295493 Homo sapiens (Human) (SEQ ID NO:552) MMSASRLAGTLIPAMAFLSCVRP [0920] TLR5_HUMAN SPdb295500 Homo sapiens (Human) (SEQ ID NO:553) MGDHLDLLLGWLMAGPVFG [0921] TM2D1_HUMAN SPdb295869 Homo sapiens (Human) (SEQ ID NO:554) MAAAWPSGPSAPEAVTARLVGVLWFVSVTTGPWGAVA [0922] TMIG2_HUMAN SPdb296142 Homo sapiens (Human) (SEQ ID NO:555) MGSPGMVLGLLVQIWALQEASS [0923] TMM25_HUMAN SPdb296188 Homo sapiens (Human) (SEQ ID NO:556) MALPPGPAALRHTLLLLPALLSSGWG [0924] TMM46_HUMAN SPdb296232 Homo sapiens (Human) (SEQ ID NO:557) MWGARRSSVSSSWNAASLLQLLLAALLAAGARA [0925] TMM66_HUMAN SPdb296282 Homo sapiens (Human) (SEQ ID NO:558) MAAACGPGAAGYCLLLGLHLFLLTAGPALG [0926] TMM9B_HUMAN SPdb296355 Homo sapiens (Human) (SEQ ID NO:559) MATLWGGLLRLGSLLSLSCLALSVLLLAQLSDA [0927] TNFB_HUMAN SPdb296533 Homo sapiens (Human) (SEQ ID NO:560) MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQG [0928] TNR14_HUMAN SPdb296702 Homo sapiens (Human) (SEQ ID NO:561) MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPA [0929] TNR16_HUMAN SPdb296704 Homo sapiens (Human) (SEQ ID NO:562) MGAGATGRAMDGPRLLLLLLLGVSLGGA [0930] TNR18_HUMAN SPdb296709 Homo sapiens (Human) (SEQ ID NO:563) MAQHGAMGAFRALCGLALLCALSLG [0931] TNR19_HUMAN SPdb296711 Homo sapiens (Human) (SEQ ID NO:564) MALKVLLEQEKTFFTLLVLLGYLSCKVTC [0932] TNR1 B_HUMAN SPdb296718 Homo sapiens (Human) (SEQ ID NO:565) MAPVAVWAALAVGLELWAAAHA [0933] TNR5_HUMAN SPdb296744 Homo sapiens (Human) (SEQ ID NO:566) MVRLPLQCVLWGCLLTAVHP [0934] TNR6B_HUMAN SPdb296751 Homo sapiens (Human) (SEQ ID NO:567) MRALEGPGLSLLCLVLALPALLPVPAVRG [0935] TNR8_HUMAN SPdb296768 Homo sapiens (Human) (SEQ ID NO:568) MRVLLAALGLLFLGALRA [0936] TNR9_HUMAN SPdb296771 Homo sapiens (Human) (SEQ ID NO:569) MGNSCYNIVATLLLVLNFERTRS [0937] TPO_HUMAN SPdb298326 Homo sapiens (Human) (SEQ ID NO:570) MELTELLLWMLLLTARLTLS [0938] TPSNR_HUMAN SPdb298428 Homo sapiens (Human) (SEQ ID NO:571) MGTQEGWCLLLCLALSGA [0939] TPSN_HUMAN SPdb298434 Homo sapiens (Human) (SEQ ID NO:572) MKSLSLLLAVALGLATAVSA [0940] TR1OD_HUMAN SPdb298538 Homo sapiens (Human) (SEQ ID NO:573) MGLWGQSVPTASSARAGRYPGARTASGTRPWLLDPKILKFVVFIVAVLLP [0941] VRVDS [0942] TR11B_HUMAN SPdb298559 Homo sapiens (Human) (SEQ ID NO:574) MNKLLCCALVFLDISIKWTTQ [0943] TR19L_HUMAN SPdb298594 Homo sapiens (Human) (SEQ ID NO:575) MKPSLLCRPLSCFLMLLPWPLATLT [0944] TRBM_HUMAN SPdb298866 Homo sapiens (Human) (SEQ ID NO:576) MLGVLVLGALALAGLGFP [0945] TRFE_HUMAN SPdb299004 Homo sapiens (Human) (SEQ ID NO:577) MRLAVGALLVCAVLGLCLA [0946] TRFL_HUMAN SPdb299019 Homo sapiens (Human) (SEQ ID NO:578) MKLVFLVLLFLGALGLCLA [0947] TRY1_HUMAN SPdb303488 Homo sapiens (Human) (SEQ ID NO:579) MNPLLILTFVAAALA [0948] TRY2_HUMAN SPdb303496 Homo sapiens (Human) (SEQ ID NO:580) MNLLLILTFVAAAVA [0949] TSHB_HUMAN SPdb303727 Homo sapiens (Human) (SEQ ID NO:581) MTALFLMSMLFGLACGQAMS [0950] TSP1_HUMAN SPdb303853 Homo sapiens (Human) (SEQ ID NO:582) MGLAWGLGVLFLMHVCGT [0951] TVA2_HUMAN SPdb304532 Homo sapiens (Human) (SEQ ID NO:583) MAMLLGASVLILWLQPDVVVNSQQKNDD [0952] TVB2_HUMAN SPdb304538 Homo sapiens (Human) (SEQ ID NO:584) MGTSLLCWMALCLLGADHADT [0953] TXD12_HUMAN SPdb304820 Homo sapiens (Human) (SEQ ID NO:585) METRPRLGATCLLGFSFLLLVISSDG [0954] TXND4_HUMAN SPdb304996 Homo sapiens (Human) (SEQ ID NO:586) MHPAVFLSLPDLRCSLLLLVTWVFTPVTT [0955] TYRP1_HUMAN SPdb305383 Homo sapiens (Human) (SEQ ID NO:587) MSAPKLLSLGCIFFPLLLFQQARA [0956] UROK_HUMAN SPdb311443 Homo sapiens (Human)(SEQ ID NO:588) MRALLARLLLCVLVVSDSKG [0957] UTER_HUMAN SPdb311731 Homo sapiens (Human) (SEQ ID NO:589) M KLAVTLTLVTLALCCSSASA [0958] UTS2_HUMAN SPdb311840 Homo sapiens (Human) (SEQ ID NO:590) MYKLASCCLLFIGFLNPLLS [0959] VCAM1_HUMAN SPdb314239 Homo sapiens (Human) (SEQ ID NO:591) MPGKMVVILGASNILWIMFAASQA [0960] VEGFA_HUMAN SPdb314841 Homo sapiens (Human) (SEQ ID NO:592) MNFLLSVVVHWSLALLLYLHHAKWSQA [0961] VEGFC_HUMAN SPdb314852 Homo sapiens (Human) (SEQ ID NO:593) MHLLGFFSVACSLLAAALLPGPREAPAAAAA [0962] VGFR3_HUMAN SPdb315610 Homo sapiens (Human) (SEQ ID NO:594) MQRGAALCLRLWLCLGLLDGLVSG [0963] VMO1_HUMAN SPdb317004 Homo sapiens (Human) (SEQ ID NO:595) MERGAGAKLLPLLLLLRATGFTCA [0964] VSIG2_HUMAN SPdb318531 Homo sapiens (Human) (SEQ ID NO:596) MAELPGPFLCGALLGFLCLSGLA [0965] VSIG4_HUMAN SPdb318533 Homo sapiens (Human) (SEQ ID NO:597) MGILLGLLLLGHLTVDTYG [0966] VSTM1_HUMAN SPdb318698 Homo sapiens (Human) (SEQ ID NO:598) MTAEFLSLLCLGLCLG [0967] VTNC_HUMAN SPdb318799 Homo sapiens (Human) (SEQ ID NO:599) MAPLRPLLILALLAVVVALA [0968] VWF_HUMAN SPdb318878 Homo sapiens (Human) (SEQ ID NO:600) MIPARFAGVLLALALILPGTLC [0969] WISP2_HUMAN SPdb319573 Homo sapiens (Human) (SEQ ID NO:601) MRGTPKTHLLAFSLLCLLSKVRT [0970] X3CL1_HUMAN SPdb320112 Homo sapiens (Human) (SEQ ID NO:602) MAPISLSWLLRLATFCHLTVLLAG [0971] XCL2_HUMAN SPdb320139 Homo sapiens (Human) (SEQ ID NO:603) MRLLILALLGICSLTAYIVEG [0972] YK001_HUMAN SPdb348747 Homo sapiens (Human) (SEQ ID NO:604) M DSLRKMLISVAMLGAGAGVGYA [0973] YQ001_HUMAN SPdb352137 Homo sapiens (Human) (SEQ ID NO:605) MGLPGLFCLAVLAASSFSKA [0974] ZA2G_HUMAN SPdb354335 Homo sapiens (Human) (SEQ ID NO:606) MVPVLLSLLLLLGPAVP [0975] ZG16_HUMAN SPdb354803 Homo sapiens (Human) (SEQ ID NO:607) MLTVALLALLCASASG [0976] ZP2_HUMAN SPdb355981 Homo sapiens (Human) (SEQ ID NO:608) MACRQRGGSWSPSGWFNAGWSTYRSISLFFALVTSGNS

[0977] A preferred expression system using each specific human secretory signal peptide listed above is a CHO cell expression system.

[0978] In some embodiments, the human secretory signal peptide can include any combination of the aforelisted secretory signal peptide. In some embodiments, the human secretory signal peptide can specifically exclude any one or more of the aforelisted secretory signal peptide. For the sake of providing a concise description of the invention, listing of the above human secretory signal peptides is not repeated. Nonetheless this invention encompasses specific exclusion of any one of the human secretory signal peptide or nucleic acid sequences encoding each one of the secretory signal peptide listed above.

[0979] For the sake of providing a concise description of the invention, listing of nucleic acid sequences encoding each one of the secretory signal peptide listed above is omitted. Nonetheless, such nucleic acid sequences are publicly available and can be readily ascertained by a person of ordinary skill in the art. One public source of such nucleic acid sequence information is, e.g., http://proline.bic.nus.edu.sq/spdb/download.html.

[0980] In some embodiments, for mammalian expression systems, a protrypsin leading sequence can also be used.

[0981] In some embodiments, for production of NELL1 and/or NELL2 peptides in mammalian cells (e.g., CHO cells), the expression system for NELL1 and/or NELL2 can include the nucleic acid or cDNA that expresses an endogenous NELL signal peptide. In some embodiments, the method and system described herein specifically excludes an endogenous NELL signal peptide.

Peptide Purification

[0982] In some embodiments, the invention includes a method purifying NELL1 and/or NELL2 peptides secreted into culture media, according to standard peptide purification protocols, including, but not limited to those described below.

[0983] The method can also include collecting secreted NELL peptides and/or purifying NELL peptides for use. Peptide products can be tested for activity in a variety of functional or expression assays. For example in any assay, if a NELL peptide has a significant effect over a control substance on a given parameter, the NELL peptides can be functional to effect the measured parameter in a functional or expression assay.

[0984] In one embodiment, whether a selected cell expresses a selected nucleic acid sequence to express and/or secrete a NELL peptide can be examined. In one embodiment, the presence, amount or and/or activity of NELL peptides can be examined.

[0985] In one embodiment, NELL peptides detected and quantified by any of a number of methods well known to those of skill in the art. These can include analytic biochemical methods such as electrophoresis, capillary electrophoresis, high performance liquid chromatography (HPLC), thin layer chromatography (TLC), hyperdiffusion chromatography, and the like, or various immunological methods such as fluid or gel precipitin reactions, immunodiffusion (single or double), immunoelectrophoresis, radioimmunoassay (RIA), enzyme-linked immunosorbent assays (ELISAs), immunofluorescent assays, western blotting, and the like.

[0986] In one embodiment, Western blot (immunoblot) analysis can be used to detect and quantify the presence of NELL peptide(s) in a selected sample. Western blot analysis is well known in the art.

[0987] The assays of this invention can be scored (as positive or negative or quantity of target polypeptide) according to standard methods well known to those of skill in the art. The particular method of scoring can depend on the assay format and choice of label. For example, a Western Blot assay can be scored by visualizing the colored product produced by an enzymatic label. A clearly visible colored band or spot at the correct molecular weight can be scored as a positive result, while the absence of a clearly visible spot or band can be scored as a negative. The intensity of the band or spot can provide a quantitative measure of target polypeptide concentration.

[0988] NELL peptides, when in non-monomeric forms can be a large molecule and many of the techniques that work for purification of smaller proteins may not work as well for NELL peptides. The unusually large size of NELL oligomeric protein molecules causes it to be incompatible with the industry standard techniques used to purify smaller proteins, such as monoclonal antibodies and blood clotting factors. Specifically, the industry standard media is made by cross-linking agarose (e.g., agarose columns) into round beads with dead-end channels. The channels are lined with a functional group and interaction of this functional group with a protein forms the basis for purification. Because the channels are dead-ends, a protein molecule enters the channels by the forces of diffusion. As the protein of interest increases in size, diffusion into the channel slows and purification efficiently drops.

[0989] Instead of traditional porous media (e.g., agarose columns), other media not traditionally used for proteins may be used to purify NELL peptides in a more efficient fashion both in terms of speed and amount of NELL peptides purified/recovered. The present invention provides a method for purifying NELL peptides with a higher productivity. A low productivity in purification of protein is generally considered a production rate limiting factor in protein production. Therefore achieving a higher productivity is important in protein production.

[0990] In some embodiments, the method includes subjecting crude NELL peptides to membrane chromatography to obtain purified NELL peptides. In some embodiments, the method includes using commercially available purification media in membrane format. In some embodiments, the NELL peptide is NELL-1 peptide. In some embodiments, the NELL peptide is NELL-2 peptide. By employing membrane purification media, an efficient purification process for the NELL peptide was developed whereas analogous efforts with porous media was much less efficient.

[0991] The ion-exchange membrane can be anion-exchange membrane or cation-exchange membrane. It is not at all obvious that membrane chromatography can be used to purify NELL peptides.

[0992] Further, it is particularly surprising that cation-exchange chromatography is effective for NELL peptide purification. For example, analysis of the NELL-1 primary protein sequence indicates that its theoretical pl is 5.8. Under the pH ranges of 7-8.5 typically used to purify proteins, NELL-1 would be predicted to carry a net negative charge and therefore bind to anion exchange functional groups such as quaternary or secondary amines and not necessarily cation exchanges. Unexpectedly, however, NELL-1 is found to bind to both cation and anion exchange functional groups.

[0993] In some embodiments, purification of Nell-1 peptide/protein can be effected through a chromatography process using a medium including a metal cation bearing two, three or more charges, e.g., an earth metal cation, a rare earth metal cation. Examples of such metal ions are, e.g., Mg(++), Ca(++), Al(+++), and any rare earth ions Ln(+++). Such metal ions can be included in a buffer solution or eluting solution.

[0994] In some embodiments, purification can sequentially employ a cation exchange chromotography, an anion exchange chromotography and an hydroxyapatite medium. In other embodiments, it can also sequentially employ an anion exchange chromotography, a cation exchange chromotography and an hydroxyapatite medium. Alternatively, other combinations or steps can be introduced in between the aforementioned sequences.

[0995] The following examples are offered to illustrate, but not to limit the claimed invention.

EXAMPLES

[0996] In general, expression hosts can be bacteria, yeast and fungi, mammalian cells, plants, transgenic animals or it can also be cell-free expression systems such as those based on wheat germ or E. coli extracts. In general, expression elements can be Prokaryotic, Yeast, Mammalian and Plant promoters or viral promoters. Protein expression strategies can be: intra- or extracellular, fusion proteins and display strategies. Downstream processing of recombinant proteins can include: harvest, lysis, filtration, ultrafiltration, precipitation, and/or other protein processing/purification strategies that encompass protein capture, purification, polishing, and optimization.

Example 1

Expression of NELL Peptides

[0997] A cDNA fragment was ligated into the expression vector PiZT/V5-His (3.4 kb) (EcoRV site, Invitrogen) and included a melittin signal peptide, BamHI-EcoRI cDNA fragment of the mature rat NELL1 and a FLAG tag sequence. FIGS. 1A-1B are a depiction of the nucleic acid sequence of the cDNA construct used in this example, and corresponding predicted peptide sequence.

[0998] The High five cells (BTI-TN-5B1-4) were adapted to serum-free medium, and cells were transfected with the NELL1 peptide expression vector. Cells were treated with zeocin so as to select only cell populations expressing the NELL1 FLAG constructs. Surviving cell populations were confirmed to be stable transformants. Extracellular media was collected and tested for the presence of NELL1 peptide. NELL1 peptide was purified and used in functional assays described below.

[0999] FIG. 2A is an illustration of a CBB-stained SDS-PAGE gel of UnoQ-eluate containing purified NELL1 peptide. The medium was applied onto UnoQ column (Bio-Rad) as described herein. FIG. 2B shows a Western blot using anti-FLAG antibody depicting NELL1-FLAG expression in reference to a protein ladder. Peptide: 140 kDa (intracellular precursor), 130 kDa (mature form; 90 kDa peptide), 400 kDa (secreted form, homotrimer). In the example above, the productivity of the expression system was about 3 mg NELL1 peptide/L medium.

[1000] Relative to other expression systems which did not express or secrete peptide at all (such as bacterial expression, including yeast) or whose peptide production was extremely low (e.g., E. coli fused peptide system, CHO-dhfr cells, >10 mcg/L) production with the systems described (mammalian and insect cells) was surprisingly and substantially more effective at producing large amounts of functional protein.

[1001] Expression and Purification of Recombinant Rat NELL1 Protein. For production of the C-terminally FLAG-tagged NELL1 peptide by insect cells, a pIZT-NELL1-FLC plasmid was constructed by inserting the rat NELL1 cDNA fused to a FLAG epitope sequence derived from the pTB701-NELL1-FLC plasmid (Kuroda, BBRC, 265, 752-757, 1999) into insect expression vector pIZT/V5-His (Invitrogen). Furthermore, NELL1 original secretory signal sequence was replaced to honeybee mellitin signal sequence using PCR methods. High Five cells were purchased from Invitrogen, and were cultured in High Five Serum-Free Medium (Invitrogen). High Five cells were transfected with the pIZT-NELL1-FLC plasmid using FuGene6 (Roche). Forty-eight hours after transfection, cells were selected with 400 mg/ml of Zeocin (Invitrogen). Replace selective medium every 3 to 4 days until the stable expression cell line was established. NELL1 secretion was confirmed using immunoprecipitation and Western blot analyses. High five cells were found to express NELL1 peptides (140-kDa) in the culture medium.

[1002] The recombinant rat NELL1-FLC peptide was purified from the culture medium of Zeocin-resistant High Five cells by anion exchange chromatography using a UNO Q-1 column (Bio-Rad). NELL1 peptide was eluted at 500 mM NaCl.

[1003] For production of the C-terminally FLAG-tagged NELL1 peptide by COS7 cells, a pcDNA3.1-NELL1-FLC plasmid was constructed by inserting the rat NELL1 cDNA linked to a FLAG epitope sequence derived from the pTB701-NELL1-FLC plasmid into mammalian expression vector pcDNA3.1 (Invitrogen). COS7 cells were cultured in DMEM supplemented with 10% FBS. COS7 cells were transfected with the pcDNA3.1-NELL1-FLC using the endogenous NELL signal peptide plasmid and using electroporation method. Forty-eight hours after transfection, culture medium was subjected to immunoprecipitation and Western blot analyses for NELL1 peptide.

[1004] FIG. 2C is an illustration of a CBB-stained SDS-PAGE gel of UnoQ-eluate including NELL1-FLAG. These expression studies showed that COS cells did not express functional NELL peptide, without modifying the N terminal of the NELL to increase secretion efficiency such as including a signal sequence. FIG. 2D is an illustration of a Western blot using anti-FLAG antibody depicting NELL1-FLAG expression.

[1005] Expression and Purification of Recombinant Rat NELL2 Protein. For production of the C-terminally FLAG-tagged NELL2 peptide by insect cells, a pIZT-NELL2-FLC plasmid was constructed by inserting the rat NELL2 cDNA fused to a FLAG epitope sequence derived from the pTB701-NELL2-FLC plasmid into insect expression vector pIZT/V5-His (Invitrogen). High Five cells were purchased from Invitrogen, and were cultured in High Five Serum-Free Medium (Invitrogen). High Five cells were transfected with the pIZT-NELL2-FLC plasmid using FuGene6 (Roche). Forty-eight hours after transfection, cells were selected with 400 mg/ml of Zeocin (Invitrogen). Selective media was replaced every 3 to 4 days, until the stable expression cell line was established. NELL2 expression was confirmed in culture medium was confirmed using immunoprecipitation and Western blot analyses. High five cells were found to express NELL2 peptides (140-kDa) in the culture medium.

[1006] The recombinant rat NELL2-FLC peptide was purified from the culture medium of Zeocin-resistant High Five cells by anion exchange chromatography using a UNO Q-1 column (Bio-Rad). NELL2-FLC peptide was eluted at 500 mM NaCl.

Example 2

Expression of NELL1 in Mammalian Systems

[1007] The mammalian expression system used for production of rhNELL1 by non-viral DNA delivery in this invention may include, but not limit to these commonly used stable suspension systems listed in Table 1. The relatively detailed protocols including vector design, host cell line culture, transfection and selection of stable cell line as well as purification of rhNell-1 in HEK 293 and CHO system are described below, but are well known to those in the art.

TABLE-US-00001 TABLE 1 Mammalian Expression System for production of rhNell-1 Gene System Parental vector Leader sequence amplification CHO p3Xflag-CMV preprotrypsin No/optinal DXB11 mp19-Lp human tPA DHFR/MTX HEK293 pSecTag immunoglobulin No/optinal NS/0 or Sp2/0 pdCs-Fc-X light chain of Ig DHFR/MTX and Fc fragment pEE12 N/A GS/MSX DHFR: dihydrofolate reductase; MTX: methotrexate; GS: glutamine synthetase; MSX: methionine sulphoximine.

[1008] A. CHO System #1

Vector design: A cDNA fragment was ligated into the expression vector p3XFlag-CMV (Sigma). The resulting expression construct, pCMV-rhNELL3Xflag, includes a preprotrypsin leading sequence, cDNA fragment of the mature human NELL1 coding region and a 3Xflag sequences at c-terminal.

[1009] Host Cell line: The CHO-K1 were adherent cell line and can be adapted to suspension culture in serum-free medium. The construct of pCMV-rhNell-1-3Xflag was transfected by either lipofectamin (Invitrogen) or calcium phosphates treatment. The stable cell lines were selected by adding G418 (400-600 ug/ml) into the cell culture medium for about two weeks. The stable transformants were further screened for single clones with high productivity of rhNELL1 by limiting dilution. The selected stable cell lines can be expended in laboratory or industrial scale bioreactors for rhNell-1 production.

[1010] Purification procedure: rhNELL1 peptide containing media or cell lysate were purified through anti-flag antibody M2 (Sigma) affinity column at its native condition and eluted with 3Xflag peptide.

[1011] B. CHO System #2

[1012] Vector design: FIG. 3A depicts the nucleic acid sequence of the cDNA construct and amino acid sequences of three different signal peptides that were used for the constructs.

[1013] Host Cell line: The CHO-K1 were adherent cell line and can be adapted to suspension culture in serum-free medium. The construct of pcDNA3.1-hNELL1-c-myc/His, pIL2-hNELL1-c-myc/His, or pN2-hNELL1-c-myc/His were transfected by either lipofectamin (Invitrogen) or calcium phosphates treatment. The stable cell lines were selected by adding G418 (400-600 ug/ml) into the cell culture medium for about two weeks. The stable transformants were further screened for single clones with high productivity of rhNELL1 by limiting dilution. The selected stable cell lines can be expended in laboratory or industrial scale bioreactors for rhNELL1 production.

[1014] Purification procedure: rhNELL1 peptide containing media or cell lysate were purified through immunoprecipitation through anti- c-myc agarose. FIG. 3B is a Western blot with anti-c-myc antibody detecting secreting NELL1 from transfections with different constructs after immunoprecipitation using anti-c-myc agarose. FIG. 3C is a Western blot with anti-c-myc or mouse anti-human NELL1 antibodies detecting secreting NELL1 after immunoprecipitation using rabbit anti-human Nell-1 antibody-NHS activated sepharose.

[1015] C. CHO System # 3

[1016] Vector design: Proprietary cDNA constructs expressing a NELL1 peptide was constructed according to the general procedures described above.

[1017] Host Cell line: The proprietary CHO cell lines were adherent cell line and can be adapted to suspension culture in serum-free medium. The proprietary constructs were transfected. The stable cell lines were selected by adding appropriate factors into the cell culture medium for about two weeks. The stable transformants were further screened for single clones with high productivity of rhNELL1 by limiting dilution. The selected stable cell lines can be expended in laboratory or industrial scale bioreactors for rhNELL1 production.

[1018] Purification procedure: rhNELL1 peptide containing media or cell lysate were purified through analytical and preparative protein purifications methods well known to those in the art (e.g., size, exclusion chromatography, ion exchange chromatography, affinity chromatography, immunoaffinity chromatography, high performance liquid chromatography,

[1019] Concentration procedure: rhNELL1 was concentrated using lyophilization or ultrafiltration.

[1020] D: HEK293 System

[1021] Vector design: A cDNA fragment was ligated into the expression vector pSecTagA (Invitrogen). The resulting expression construct, pSec-hNell-1-Tag, includes a murine immunoglobulin K-chain leader sequence, cDNA fragment of the mature human NELL1 coding region and dual tag of Myc and His sequences at c-terminal.

[1022] Host Cell line: The human embryo kidney cell line, HEK-293 which was adapted to serum-free medium and grown in suspension format, was transfected with the NELL1 peptide expression vector, pSec-hNell-1-Tag. Cells were either cultured for a couple of days as transient transfection before collecting conditioned medium for purification of rhNell-1 or treated with Zeocin (250 ug/ml) for selection of stable expression cell line. The stable transformants were further screened for single clones with high productivity of rhNell-1 by limiting dilution. The selected stable cell lines can be expended in laboratory or industrial scale bioreactors for rhNell-1 production.

[1023] Purification procedure: rhNell-1 peptide containing media were purified through Ni.sup.2+ affinity column at its native condition and eluted with 1M imidazole. The rhNell-1 was tested for its integrity, purity and bioactivity after extensively dialysis against at least 1000 volumes of PBS (pH 7.4) at 4.degree. C. for 20 hrs.

[1024] In addition, the modifications of parental vectors for replacing existing leader sequence with a new one such as rat serum albumin, CD33, tPA and human interlukin-2 leader sequence or adding gene amplification target such as DHFR or GS into the backbone sequence will result in new expression vectors and systems. In this invention, the native signal peptide of human Nell-1 is not effective enough to guide the protein secretion and sometimes even the external leading sequence didn't work well, either. Thus, the construction of expression vector with in frame fusion of a small natural secretory protein such as human granulocyte-macrophage colony stimulating factor (GM-CSF) by a spacer containing intraprotein His tag and proteolytic cleavage site as "MPHHHHHHGGGDDDDKDPM" might be needed. The epitope tags used for purification of NELL1 can be one of the following: 6XHistidines, 3XFIag, Myc, GST (glutathione S-transferase), EGFP or CTHS (C-terminal half of SUMO which stands for small ubiquitin modifying protein) etc, but also could be dual of His plus Myc as listed plasmid pSecTag in Table 1 (supra).

[1025] Furthermore, the dicistronic or multicistronic vectors using IRES might be constructed for regulatory or inducible expression of rhNell-1 under certain circumstances. The genetic modifications of host cell lines for gaining longer lasting proliferation and delayed apoptosis or compatible with special requests such as Tet (tetracycline) inducible system and Flp-In specific site integration system will be considered for improvement of rhNell-1 production.

[1026] Besides the stable expression of system for production of rhNell-1 mentioned above, we would not exclude the possibility to establish a large-scale transient transfection (LST) approach using multi-milligram purified plasmid vector (pREP4) to transfect HEK 293 or BHK suspension cells with cationic polymer PEI as backup alternative or complimentary to stable system.

Example 3

Purification of NELL2 Protein from Culture Medium

[1027] High Five cells carrying pIZT-FLC-NELL2 were cultured for about three days in serum free culture medium (1 L). The culture medium was centrifuged at. 3000.times.g for 5 minutes and the supernatant was collected. PMSF was added to a final concentration of 1 mM. Saturated ammonium sulfate solution (80% saturation (v/v) was added and the solution kept at 4 degrees for 1 hour. The solution was centrifuged at 15000.times.g for 30 min. and precipitate collected. Precipitate was dissolved in 50 ml of 20 mM Tris-HCl (pH 8.0), 1 mm EDTA at 4 degree and applied onto an anion-exchange chromatography UnoQ column (6 ml, Bio-Rad) equilibrated in 20 mM Tris-HCl (pH 8.0), 1 mM EDTA at 4 degree (1 ml/min speed by FPLC (Amersham-Pharmacia). The column was thoroughly washed with the same buffer.

[1028] The binding protein was then eluted by the gradation from 0 M to 1.5 M NaCl in the same buffer. The NELL2-FLAG fractions were identified by Western blotting using anti-Flag M2 (Sigma) Ab. The positive fractions were collected into one tube. Final product was dialyzed in the seamless cellulose tube (Wako, cutoff MW 12000) against 1 L PBS for overnight at 4 degree. The product was stored at -70 degree.

Example 4

Cell Line Development and Expression of NELL-1

[1029] A series of Chinese Hamster Ovary (CHO) cell lines expressing recombinant human Nell-1 protein were developed according to procedures described above or procedures known in the art. The cell lines were screened according to known methods (please see references 1-8, below). The top 12 clones were cultured in a medium to amplify expression. The cell pools exhibiting the highest expression of human Nell-1 by ELISA were subcloned. They were then subjected to amplification, after which the cell pools were rescreened by ELISA. From this procedure, the ten highest expressing MTX-amplified subclones from transfection were expanded.

[1030] The six highest expressing subclones were adapted to grow in protein-free medium. All serum-free adapted clones were evaluated for Nell-1 expression by ELISA and by SDS gel. The clones that were observed to express the best at 1,000 nM MTX were identified as N2-1.9E10.1F9.4C2, N2-1.9E10.1F9.5H6, N2-1.9E10.1F9.5H2. All expressed Nell-1 protein at levels .gtoreq.40 ug/ml by ELISA. [1031] (1) Urlaub, G. & Chasin, L. (1980) Isolation of Chinese Hamster Cell Mutants Deficient in Dihydrofolate Reductase Activity. Proc Natl. Acad. Sci. 77: 4216-4220 [1032] (2) Kao, F.-T. and Puck, T. T. (1967) Genetics of somatic mammalian cells. IV. Properties of Chinese hamster cells with respect to the requirement for proline. Genetics 55: 513-524 [1033] (3) Wigler, M., Perucho, M., Kurtz, D., Dana, S., Pellicer, A, Axel, R., and Silverstein, S. (1980) Transformation of mammalian genes with an amplifiable dominant-acting gene. Proc. Natl. Acad. Sci. USA Vol 77: 3567-3570. [1034] (4) Bourouis, M. and Jarry, B. (1983) Vectors containing a prokaryotic dihydrofolate reductase gene transform Drosophila cells to methotrexate resistance. EMBO J. 2: 1099-1104. [1035] (5) Ringold, G., Dieckmann, B., and Lee, F. (1982) Co-expression and amplification of dihydrofolate reductase cDNA and the Escherichia coli XGPRT gene in Chinese hamster ovary cells. Journal of Molecular and Applied Genetics, Vol. 1:3: 165-175. [1036] (6) Gasser C. S., Simonsen C. C., Schilling J. W., Schimke R. T. (1982) Expression of abbreviated mouse dihydrofolate reductase genes in cultured hamster cells. Proc. Natl. Acad. Sci. V 79: 6522-6526. [1037] (7) Kaufman, R. J., Wasley, L. C., Spiliotes, A. J., Gossels, S. D., Latt, S. A., Larsen, G. R. and Kay, R. M. (1985) Co-amplification and co-expression of human tissue type plasminogen activator and murine dihydrofolate reductase sequences in Chinese hamster ovary cells. Mol. Cell. Biol. Vol 5: 1750-1759. [1038] (8) Simonsen, C. C. and Levinson, A. D. (1983) Isolation and expression of an altered mouse dihydrofolate reductase cDNA. Proc. Natl. Acad. Sci. U.S.A. 80: 2495-2499.

[1039] While particular embodiments of the present invention have been shown and described, it will be obvious to those skilled in the art that changes and modifications can be made without departing from this invention in its broader aspects. Therefore, the claims are to encompass within their scope all such changes and modifications as fall within the true sprit and scope of this invention.

Sequence CWU 1

1

61412433DNAHomo sapiensCDS(1)..(2433) 1atg ccg atg gat ttg att tta gtt gtg tgg ttc tgt gtg tgc act gcc 48Met Pro Met Asp Leu Ile Leu Val Val Trp Phe Cys Val Cys Thr Ala1 5 10 15agg aca gtg gtg ggc ttt ggg atg gac cct gac ctt cag atg gat atc 96Arg Thr Val Val Gly Phe Gly Met Asp Pro Asp Leu Gln Met Asp Ile 20 25 30gtc acc gag ctt gac ctt gtg aac acc acc ctt gga gtt gct cag gtg 144Val Thr Glu Leu Asp Leu Val Asn Thr Thr Leu Gly Val Ala Gln Val 35 40 45tct gga atg cac aat gcc agc aaa gca ttt tta ttt caa gac ata gaa 192Ser Gly Met His Asn Ala Ser Lys Ala Phe Leu Phe Gln Asp Ile Glu 50 55 60aga gag atc cat gca gct cct cat gtg agt gag aaa tta att cag ctg 240Arg Glu Ile His Ala Ala Pro His Val Ser Glu Lys Leu Ile Gln Leu65 70 75 80ttc cag aac aag agt gaa ttc acc att ttg gcc act gta cag cag aag 288Phe Gln Asn Lys Ser Glu Phe Thr Ile Leu Ala Thr Val Gln Gln Lys 85 90 95cca tcc act tca gga gtg ata ctg tcc att cga gaa ctg gag cac agc 336Pro Ser Thr Ser Gly Val Ile Leu Ser Ile Arg Glu Leu Glu His Ser 100 105 110tat ttt gaa ctg gag agc agt ggc ctg agg gat gag att cgg tat cac 384Tyr Phe Glu Leu Glu Ser Ser Gly Leu Arg Asp Glu Ile Arg Tyr His 115 120 125tac ata cac aat ggg aag cca agg aca gag gca ctt cct tac cgc atg 432Tyr Ile His Asn Gly Lys Pro Arg Thr Glu Ala Leu Pro Tyr Arg Met 130 135 140gca gat gga caa tgg cac aag gtt gca ctg tca gtt agc gcc tct cat 480Ala Asp Gly Gln Trp His Lys Val Ala Leu Ser Val Ser Ala Ser His145 150 155 160ctc ctg ctc cat gtc gac tgt aac agg att tat gag cgt gtg ata gac 528Leu Leu Leu His Val Asp Cys Asn Arg Ile Tyr Glu Arg Val Ile Asp 165 170 175cct cca gat acc aac ctt ccc cca gga atc aat tta tgg ctt ggc cag 576Pro Pro Asp Thr Asn Leu Pro Pro Gly Ile Asn Leu Trp Leu Gly Gln 180 185 190cgc aac caa aag cat ggc tta ttc aaa ggg atc atc caa gat ggg aag 624Arg Asn Gln Lys His Gly Leu Phe Lys Gly Ile Ile Gln Asp Gly Lys 195 200 205atc atc ttt atg ccg aat gga tat ata aca cag tgt cca aat cta aat 672Ile Ile Phe Met Pro Asn Gly Tyr Ile Thr Gln Cys Pro Asn Leu Asn 210 215 220cac act tgc cca acc tgc agt gat ttc tta agc ctg gtg caa gga ata 720His Thr Cys Pro Thr Cys Ser Asp Phe Leu Ser Leu Val Gln Gly Ile225 230 235 240atg gat tta caa gag ctt ttg gcc aag atg act gca aaa cta aat tat 768Met Asp Leu Gln Glu Leu Leu Ala Lys Met Thr Ala Lys Leu Asn Tyr 245 250 255gca gag aca aga ctt agt caa ttg gaa aac tgt cat tgt gag aag act 816Ala Glu Thr Arg Leu Ser Gln Leu Glu Asn Cys His Cys Glu Lys Thr 260 265 270tgt caa gtg agt gga ctg ctc tat cga gat caa gac tct tgg gta gat 864Cys Gln Val Ser Gly Leu Leu Tyr Arg Asp Gln Asp Ser Trp Val Asp 275 280 285ggt gac cat tgc agg aac tgc act tgc aaa agt ggt gcc gtg gaa tgc 912Gly Asp His Cys Arg Asn Cys Thr Cys Lys Ser Gly Ala Val Glu Cys 290 295 300cga agg atg tcc tgt ccc cct ctc aat tgc tcc cca gac tcc ctc cca 960Arg Arg Met Ser Cys Pro Pro Leu Asn Cys Ser Pro Asp Ser Leu Pro305 310 315 320gta cac att gct ggc cag tgc tgt aag gtc tgc cga cca aaa tgt atc 1008Val His Ile Ala Gly Gln Cys Cys Lys Val Cys Arg Pro Lys Cys Ile 325 330 335tat gga gga aaa gtt ctt gca gaa ggc cag cgg att tta acc aag agc 1056Tyr Gly Gly Lys Val Leu Ala Glu Gly Gln Arg Ile Leu Thr Lys Ser 340 345 350tgt cgg gaa tgc cga ggt gga gtt tta gta aaa att aca gaa atg tgt 1104Cys Arg Glu Cys Arg Gly Gly Val Leu Val Lys Ile Thr Glu Met Cys 355 360 365cct cct ttg aac tgc tca gaa aag gat cac att ctt cct gag aat cag 1152Pro Pro Leu Asn Cys Ser Glu Lys Asp His Ile Leu Pro Glu Asn Gln 370 375 380tgc tgc cgt gtc tgt aga ggt cat aac ttt tgt gca gaa gga cct aaa 1200Cys Cys Arg Val Cys Arg Gly His Asn Phe Cys Ala Glu Gly Pro Lys385 390 395 400tgt ggt gaa aac tca gag tgc aaa aac tgg aat aca aaa gct act tgt 1248Cys Gly Glu Asn Ser Glu Cys Lys Asn Trp Asn Thr Lys Ala Thr Cys 405 410 415gag tgc aag agt ggt tac atc tct gtc cag gga gac tct gcc tac tgt 1296Glu Cys Lys Ser Gly Tyr Ile Ser Val Gln Gly Asp Ser Ala Tyr Cys 420 425 430gaa gat att gat gag tgt gca gct aag atg cat tac tgt cat gcc aat 1344Glu Asp Ile Asp Glu Cys Ala Ala Lys Met His Tyr Cys His Ala Asn 435 440 445act gtg tgt gtc aac ctt cct ggg tta tat cgc tgt gac tgt gtc cca 1392Thr Val Cys Val Asn Leu Pro Gly Leu Tyr Arg Cys Asp Cys Val Pro 450 455 460gga tac att cgt gtg gat gac ttc tct tgt aca gaa cac gat gaa tgt 1440Gly Tyr Ile Arg Val Asp Asp Phe Ser Cys Thr Glu His Asp Glu Cys465 470 475 480ggc agc ggc cag cac aac tgt gat gag aat gcc atc tgc acc aac act 1488Gly Ser Gly Gln His Asn Cys Asp Glu Asn Ala Ile Cys Thr Asn Thr 485 490 495gtc cag gga cac agc tgc acc tgc aaa ccg ggc tac gtg ggg aac ggg 1536Val Gln Gly His Ser Cys Thr Cys Lys Pro Gly Tyr Val Gly Asn Gly 500 505 510acc atc tgc aga gct ttc tgt gaa gag ggc tgc aga tac ggt gga acg 1584Thr Ile Cys Arg Ala Phe Cys Glu Glu Gly Cys Arg Tyr Gly Gly Thr 515 520 525tgt gtg gct ccc aac aaa tgt gtc tgt cca tct gga ttc aca gga agc 1632Cys Val Ala Pro Asn Lys Cys Val Cys Pro Ser Gly Phe Thr Gly Ser 530 535 540cac tgc gag aaa gat att gat gaa tgt tca gag gga atc att gag tgc 1680His Cys Glu Lys Asp Ile Asp Glu Cys Ser Glu Gly Ile Ile Glu Cys545 550 555 560cac aac cat tcc cgc tgc gtt aac ctg cca ggg tgg tac cac tgt gag 1728His Asn His Ser Arg Cys Val Asn Leu Pro Gly Trp Tyr His Cys Glu 565 570 575tgc aga agc ggt ttc cat gac gat ggg acc tat tca ctg tcc ggg gag 1776Cys Arg Ser Gly Phe His Asp Asp Gly Thr Tyr Ser Leu Ser Gly Glu 580 585 590tcc tgt att gac att gat gaa tgt gcc tta aga act cac acc tgt tgg 1824Ser Cys Ile Asp Ile Asp Glu Cys Ala Leu Arg Thr His Thr Cys Trp 595 600 605aac gat tct gcc tgc atc aac ctg gca ggg ggt ttt gac tgt ctc tgc 1872Asn Asp Ser Ala Cys Ile Asn Leu Ala Gly Gly Phe Asp Cys Leu Cys 610 615 620ccc tct ggg ccc tcc tgc tct ggt gac tgt cct cat gaa ggg ggg ctg 1920Pro Ser Gly Pro Ser Cys Ser Gly Asp Cys Pro His Glu Gly Gly Leu625 630 635 640aag cac aat ggc cag gtg tgg acc ttg aaa gaa gac agg tgt tct gtc 1968Lys His Asn Gly Gln Val Trp Thr Leu Lys Glu Asp Arg Cys Ser Val 645 650 655tgc tcc tgc aag gat ggc aag ata ttc tgc cga cgg aca gct tgt gat 2016Cys Ser Cys Lys Asp Gly Lys Ile Phe Cys Arg Arg Thr Ala Cys Asp 660 665 670tgc cag aat cca agt gct gac cta ttc tgt tgc cca gaa tgt gac acc 2064Cys Gln Asn Pro Ser Ala Asp Leu Phe Cys Cys Pro Glu Cys Asp Thr 675 680 685aga gtc aca agt caa tgt tta gac caa aat ggt cac aag ctg tat cga 2112Arg Val Thr Ser Gln Cys Leu Asp Gln Asn Gly His Lys Leu Tyr Arg 690 695 700agt gga gac aat tgg acc cat agc tgt cag cag tgt cgg tgt ctg gaa 2160Ser Gly Asp Asn Trp Thr His Ser Cys Gln Gln Cys Arg Cys Leu Glu705 710 715 720gga gag gta gat tgc tgg cca ctc act tgc ccc aac ttg agc tgt gag 2208Gly Glu Val Asp Cys Trp Pro Leu Thr Cys Pro Asn Leu Ser Cys Glu 725 730 735tat aca gct atc tta gaa ggg gaa tgt tgt ccc cgc tgt gtc agt gac 2256Tyr Thr Ala Ile Leu Glu Gly Glu Cys Cys Pro Arg Cys Val Ser Asp 740 745 750ccc tgc cta gct gat aac atc acc tat gac atc aga aaa act tgc ctg 2304Pro Cys Leu Ala Asp Asn Ile Thr Tyr Asp Ile Arg Lys Thr Cys Leu 755 760 765gac agc tat ggt gtt tca cgg ctt agt ggc tca gtg tgg acg atg gct 2352Asp Ser Tyr Gly Val Ser Arg Leu Ser Gly Ser Val Trp Thr Met Ala 770 775 780gga tct ccc tgc aca acc tgt aaa tgc aag aat gga aga gtc tgt tgt 2400Gly Ser Pro Cys Thr Thr Cys Lys Cys Lys Asn Gly Arg Val Cys Cys785 790 795 800tct gtg gat ttt gag tgt ctt caa aat aat tga 2433Ser Val Asp Phe Glu Cys Leu Gln Asn Asn 805 8102810PRTHomo sapiens 2Met Pro Met Asp Leu Ile Leu Val Val Trp Phe Cys Val Cys Thr Ala1 5 10 15Arg Thr Val Val Gly Phe Gly Met Asp Pro Asp Leu Gln Met Asp Ile 20 25 30Val Thr Glu Leu Asp Leu Val Asn Thr Thr Leu Gly Val Ala Gln Val 35 40 45Ser Gly Met His Asn Ala Ser Lys Ala Phe Leu Phe Gln Asp Ile Glu 50 55 60Arg Glu Ile His Ala Ala Pro His Val Ser Glu Lys Leu Ile Gln Leu65 70 75 80Phe Gln Asn Lys Ser Glu Phe Thr Ile Leu Ala Thr Val Gln Gln Lys 85 90 95Pro Ser Thr Ser Gly Val Ile Leu Ser Ile Arg Glu Leu Glu His Ser 100 105 110Tyr Phe Glu Leu Glu Ser Ser Gly Leu Arg Asp Glu Ile Arg Tyr His 115 120 125Tyr Ile His Asn Gly Lys Pro Arg Thr Glu Ala Leu Pro Tyr Arg Met 130 135 140Ala Asp Gly Gln Trp His Lys Val Ala Leu Ser Val Ser Ala Ser His145 150 155 160Leu Leu Leu His Val Asp Cys Asn Arg Ile Tyr Glu Arg Val Ile Asp 165 170 175Pro Pro Asp Thr Asn Leu Pro Pro Gly Ile Asn Leu Trp Leu Gly Gln 180 185 190Arg Asn Gln Lys His Gly Leu Phe Lys Gly Ile Ile Gln Asp Gly Lys 195 200 205Ile Ile Phe Met Pro Asn Gly Tyr Ile Thr Gln Cys Pro Asn Leu Asn 210 215 220His Thr Cys Pro Thr Cys Ser Asp Phe Leu Ser Leu Val Gln Gly Ile225 230 235 240Met Asp Leu Gln Glu Leu Leu Ala Lys Met Thr Ala Lys Leu Asn Tyr 245 250 255Ala Glu Thr Arg Leu Ser Gln Leu Glu Asn Cys His Cys Glu Lys Thr 260 265 270Cys Gln Val Ser Gly Leu Leu Tyr Arg Asp Gln Asp Ser Trp Val Asp 275 280 285Gly Asp His Cys Arg Asn Cys Thr Cys Lys Ser Gly Ala Val Glu Cys 290 295 300Arg Arg Met Ser Cys Pro Pro Leu Asn Cys Ser Pro Asp Ser Leu Pro305 310 315 320Val His Ile Ala Gly Gln Cys Cys Lys Val Cys Arg Pro Lys Cys Ile 325 330 335Tyr Gly Gly Lys Val Leu Ala Glu Gly Gln Arg Ile Leu Thr Lys Ser 340 345 350Cys Arg Glu Cys Arg Gly Gly Val Leu Val Lys Ile Thr Glu Met Cys 355 360 365Pro Pro Leu Asn Cys Ser Glu Lys Asp His Ile Leu Pro Glu Asn Gln 370 375 380Cys Cys Arg Val Cys Arg Gly His Asn Phe Cys Ala Glu Gly Pro Lys385 390 395 400Cys Gly Glu Asn Ser Glu Cys Lys Asn Trp Asn Thr Lys Ala Thr Cys 405 410 415Glu Cys Lys Ser Gly Tyr Ile Ser Val Gln Gly Asp Ser Ala Tyr Cys 420 425 430Glu Asp Ile Asp Glu Cys Ala Ala Lys Met His Tyr Cys His Ala Asn 435 440 445Thr Val Cys Val Asn Leu Pro Gly Leu Tyr Arg Cys Asp Cys Val Pro 450 455 460Gly Tyr Ile Arg Val Asp Asp Phe Ser Cys Thr Glu His Asp Glu Cys465 470 475 480Gly Ser Gly Gln His Asn Cys Asp Glu Asn Ala Ile Cys Thr Asn Thr 485 490 495Val Gln Gly His Ser Cys Thr Cys Lys Pro Gly Tyr Val Gly Asn Gly 500 505 510Thr Ile Cys Arg Ala Phe Cys Glu Glu Gly Cys Arg Tyr Gly Gly Thr 515 520 525Cys Val Ala Pro Asn Lys Cys Val Cys Pro Ser Gly Phe Thr Gly Ser 530 535 540His Cys Glu Lys Asp Ile Asp Glu Cys Ser Glu Gly Ile Ile Glu Cys545 550 555 560His Asn His Ser Arg Cys Val Asn Leu Pro Gly Trp Tyr His Cys Glu 565 570 575Cys Arg Ser Gly Phe His Asp Asp Gly Thr Tyr Ser Leu Ser Gly Glu 580 585 590Ser Cys Ile Asp Ile Asp Glu Cys Ala Leu Arg Thr His Thr Cys Trp 595 600 605Asn Asp Ser Ala Cys Ile Asn Leu Ala Gly Gly Phe Asp Cys Leu Cys 610 615 620Pro Ser Gly Pro Ser Cys Ser Gly Asp Cys Pro His Glu Gly Gly Leu625 630 635 640Lys His Asn Gly Gln Val Trp Thr Leu Lys Glu Asp Arg Cys Ser Val 645 650 655Cys Ser Cys Lys Asp Gly Lys Ile Phe Cys Arg Arg Thr Ala Cys Asp 660 665 670Cys Gln Asn Pro Ser Ala Asp Leu Phe Cys Cys Pro Glu Cys Asp Thr 675 680 685Arg Val Thr Ser Gln Cys Leu Asp Gln Asn Gly His Lys Leu Tyr Arg 690 695 700Ser Gly Asp Asn Trp Thr His Ser Cys Gln Gln Cys Arg Cys Leu Glu705 710 715 720Gly Glu Val Asp Cys Trp Pro Leu Thr Cys Pro Asn Leu Ser Cys Glu 725 730 735Tyr Thr Ala Ile Leu Glu Gly Glu Cys Cys Pro Arg Cys Val Ser Asp 740 745 750Pro Cys Leu Ala Asp Asn Ile Thr Tyr Asp Ile Arg Lys Thr Cys Leu 755 760 765Asp Ser Tyr Gly Val Ser Arg Leu Ser Gly Ser Val Trp Thr Met Ala 770 775 780Gly Ser Pro Cys Thr Thr Cys Lys Cys Lys Asn Gly Arg Val Cys Cys785 790 795 800Ser Val Asp Phe Glu Cys Leu Gln Asn Asn 805 81032433DNARattus norvegicusCDS(1)..(2433) 3atg ccg atg gat gtg att tta gtt ttg tgg ttc tgt gta tgc acc gcc 48Met Pro Met Asp Val Ile Leu Val Leu Trp Phe Cys Val Cys Thr Ala1 5 10 15agg aca gtg ttg ggc ttt ggg atg gac cct gac ctt cag ctg gac atc 96Arg Thr Val Leu Gly Phe Gly Met Asp Pro Asp Leu Gln Leu Asp Ile 20 25 30atc tca gag ctc gac ctg gtg aac acc acc ctg gga gtc acg cag gtg 144Ile Ser Glu Leu Asp Leu Val Asn Thr Thr Leu Gly Val Thr Gln Val 35 40 45gct gga ctg cac aac gcc agt aaa gca ttt cta ttt caa gat gta cag 192Ala Gly Leu His Asn Ala Ser Lys Ala Phe Leu Phe Gln Asp Val Gln 50 55 60aga gag atc cat tcg gcc cct cac gtg agt gag aag ctg atc cag cta 240Arg Glu Ile His Ser Ala Pro His Val Ser Glu Lys Leu Ile Gln Leu65 70 75 80ttc cgg aat aag agc gag ttc acc ttt ttg gct aca gtg cag cag aaa 288Phe Arg Asn Lys Ser Glu Phe Thr Phe Leu Ala Thr Val Gln Gln Lys 85 90 95cca tcc acc tca ggg gtg ata ctg tcc atc cgg gag ctg gag cac agc 336Pro Ser Thr Ser Gly Val Ile Leu Ser Ile Arg Glu Leu Glu His Ser 100 105 110tat ttt gaa ctg gag agc agt ggc cca aga gaa gag ata cgc tac cat 384Tyr Phe Glu Leu Glu Ser Ser Gly Pro Arg Glu Glu Ile Arg Tyr His 115 120 125tac ata cat ggt gga aag ccc agg act gag gcc ctt ccc tac cgc atg 432Tyr Ile His Gly Gly Lys Pro Arg Thr Glu Ala Leu Pro Tyr Arg Met 130 135 140gca gac gga caa tgg cac aag gtc gcg ctg tca gtg agc gcc tct cac 480Ala Asp Gly Gln Trp His Lys Val Ala Leu Ser Val Ser Ala Ser His145 150 155 160ctc ctg ctc cac atc gac tgc aat agg att tac gag cgt gtg ata gac 528Leu Leu Leu His Ile Asp Cys Asn Arg Ile Tyr Glu Arg Val Ile Asp 165 170 175cct ccg gag acc aac ctt cct cca gga agc aat ctg tgg ctt ggg caa 576Pro Pro Glu Thr Asn Leu Pro Pro Gly Ser Asn Leu Trp Leu Gly Gln 180 185 190cgt aac caa aag cat ggc ttt ttc aaa gga atc atc caa gat ggt aag 624Arg Asn Gln Lys His Gly Phe Phe Lys Gly Ile Ile Gln Asp Gly Lys 195 200 205atc atc ttc atg ccg aat ggt ttc atc aca cag tgt ccc aac ctc aat 672Ile Ile

Phe Met Pro Asn Gly Phe Ile Thr Gln Cys Pro Asn Leu Asn 210 215 220cgc act tgc cca aca tgc agt gac ttc ctg agc ctg gtt caa gga ata 720Arg Thr Cys Pro Thr Cys Ser Asp Phe Leu Ser Leu Val Gln Gly Ile225 230 235 240atg gat ttg caa gag ctt ttg gcc aag atg act gca aaa ctg aat tat 768Met Asp Leu Gln Glu Leu Leu Ala Lys Met Thr Ala Lys Leu Asn Tyr 245 250 255gca gag acg aga ctt ggt caa ctg gaa aat tgc cac tgt gag aag acc 816Ala Glu Thr Arg Leu Gly Gln Leu Glu Asn Cys His Cys Glu Lys Thr 260 265 270tgc caa gtg agt ggg ctg ctc tac agg gac caa gac tcc tgg gtg gat 864Cys Gln Val Ser Gly Leu Leu Tyr Arg Asp Gln Asp Ser Trp Val Asp 275 280 285ggt gac aac tgt ggg aac tgc acg tgc aaa agt ggt gcc gtg gag tgc 912Gly Asp Asn Cys Gly Asn Cys Thr Cys Lys Ser Gly Ala Val Glu Cys 290 295 300cgc agg atg tcc tgt ccc ccg ctc aac tgt tcc ccg gac tca ctt cct 960Arg Arg Met Ser Cys Pro Pro Leu Asn Cys Ser Pro Asp Ser Leu Pro305 310 315 320gtg cac att tcc ggc cag tgt tgt aaa gtt tgc aga cca aaa tgt atc 1008Val His Ile Ser Gly Gln Cys Cys Lys Val Cys Arg Pro Lys Cys Ile 325 330 335tat gga gga aaa gtt ctt gct gag ggc cag cgg att tta acc aag acc 1056Tyr Gly Gly Lys Val Leu Ala Glu Gly Gln Arg Ile Leu Thr Lys Thr 340 345 350tgc cgg gaa tgt cga ggt gga gtc ttg gta aaa atc aca gaa gct tgc 1104Cys Arg Glu Cys Arg Gly Gly Val Leu Val Lys Ile Thr Glu Ala Cys 355 360 365cct cct ttg aac tgc tca gca aag gat cat att ctt cca gag aat cag 1152Pro Pro Leu Asn Cys Ser Ala Lys Asp His Ile Leu Pro Glu Asn Gln 370 375 380tgc tgc agg gtc tgc cca ggt cat aac ttc tgt gca gaa gca cct aag 1200Cys Cys Arg Val Cys Pro Gly His Asn Phe Cys Ala Glu Ala Pro Lys385 390 395 400tgc gga gaa aac tcg gaa tgc aaa aat tgg aat aca aaa gca acc tgt 1248Cys Gly Glu Asn Ser Glu Cys Lys Asn Trp Asn Thr Lys Ala Thr Cys 405 410 415gag tgc aag aat gga tac atc tct gtc cag ggc aac tct gca tac tgt 1296Glu Cys Lys Asn Gly Tyr Ile Ser Val Gln Gly Asn Ser Ala Tyr Cys 420 425 430gaa gat att gat gag tgt gca gct aaa atg cac tat tgt cat gcc aac 1344Glu Asp Ile Asp Glu Cys Ala Ala Lys Met His Tyr Cys His Ala Asn 435 440 445acc gtg tgt gtc aac ttg ccg ggg ttg tat cgc tgt gac tgc gtc cca 1392Thr Val Cys Val Asn Leu Pro Gly Leu Tyr Arg Cys Asp Cys Val Pro 450 455 460ggg tac atc cgt gtg gat gac ttc tct tgt acg gag cat gat gat tgt 1440Gly Tyr Ile Arg Val Asp Asp Phe Ser Cys Thr Glu His Asp Asp Cys465 470 475 480ggc agc gga caa cac aac tgc gac aaa aat gcc atc tgt acc aac aca 1488Gly Ser Gly Gln His Asn Cys Asp Lys Asn Ala Ile Cys Thr Asn Thr 485 490 495gtc cag gga cac agc tgc acc tgc cag ccg ggt tac gtg gga aat ggc 1536Val Gln Gly His Ser Cys Thr Cys Gln Pro Gly Tyr Val Gly Asn Gly 500 505 510acc atc tgc aaa gca ttc tgt gaa gag ggt tgc aga tac gga ggt acc 1584Thr Ile Cys Lys Ala Phe Cys Glu Glu Gly Cys Arg Tyr Gly Gly Thr 515 520 525tgt gtg gct cct aac aag tgt gtc tgt cct tct gga ttc acg gga agc 1632Cys Val Ala Pro Asn Lys Cys Val Cys Pro Ser Gly Phe Thr Gly Ser 530 535 540cac tgt gag aaa gat att gat gaa tgc gca gag gga ttc gtt gaa tgc 1680His Cys Glu Lys Asp Ile Asp Glu Cys Ala Glu Gly Phe Val Glu Cys545 550 555 560cac aac tac tcc cgc tgt gtt aac ctg cca ggg tgg tac cac tgt gag 1728His Asn Tyr Ser Arg Cys Val Asn Leu Pro Gly Trp Tyr His Cys Glu 565 570 575tgc aga agc ggt ttc cat gac gat ggg acc tac tca ctg tcc ggg gag 1776Cys Arg Ser Gly Phe His Asp Asp Gly Thr Tyr Ser Leu Ser Gly Glu 580 585 590tcc tgc att gat atc gat gaa tgt gcc tta aga act cac act tgt tgg 1824Ser Cys Ile Asp Ile Asp Glu Cys Ala Leu Arg Thr His Thr Cys Trp 595 600 605aat gac tct gcc tgc atc aac tta gca gga gga ttt gac tgc ctg tgt 1872Asn Asp Ser Ala Cys Ile Asn Leu Ala Gly Gly Phe Asp Cys Leu Cys 610 615 620ccc tct ggg ccc tcc tgc tct ggt gac tgt ccc cac gaa gga ggg ctg 1920Pro Ser Gly Pro Ser Cys Ser Gly Asp Cys Pro His Glu Gly Gly Leu625 630 635 640aag cat aat ggg cag gtg tgg att ctg aga gaa gac agg tgt tca gtc 1968Lys His Asn Gly Gln Val Trp Ile Leu Arg Glu Asp Arg Cys Ser Val 645 650 655tgt tcc tgc aag gat ggg aag ata ttc tgc cgg cgg aca gct tgt gat 2016Cys Ser Cys Lys Asp Gly Lys Ile Phe Cys Arg Arg Thr Ala Cys Asp 660 665 670tgc cag aat cca aat gtt gac ctt ttt tgc tgc cca gag tgc gat acc 2064Cys Gln Asn Pro Asn Val Asp Leu Phe Cys Cys Pro Glu Cys Asp Thr 675 680 685agg gtc acc agc caa tgt tta gat caa agt gga cag aag ctc tat cga 2112Arg Val Thr Ser Gln Cys Leu Asp Gln Ser Gly Gln Lys Leu Tyr Arg 690 695 700agt gga gac aac tgg acc cac agc tgc cag cag tgc cga tgt ctg gaa 2160Ser Gly Asp Asn Trp Thr His Ser Cys Gln Gln Cys Arg Cys Leu Glu705 710 715 720gga gag gca gac tgc tgg cct ctg gct tgc cct agt ttg ggc tgt gaa 2208Gly Glu Ala Asp Cys Trp Pro Leu Ala Cys Pro Ser Leu Gly Cys Glu 725 730 735tac aca gcc atg ttt gaa ggg gag tgt tgt ccc cga tgt gtc agt gac 2256Tyr Thr Ala Met Phe Glu Gly Glu Cys Cys Pro Arg Cys Val Ser Asp 740 745 750ccc tgc ctg gct ggt aat att gcc tat gac atc aga aaa act tgc ctg 2304Pro Cys Leu Ala Gly Asn Ile Ala Tyr Asp Ile Arg Lys Thr Cys Leu 755 760 765gac agc ttt ggt gtt tcg agg ctg agc gga gcc gtg tgg aca atg gct 2352Asp Ser Phe Gly Val Ser Arg Leu Ser Gly Ala Val Trp Thr Met Ala 770 775 780gga tct cct tgt aca acc tgc aaa tgc aag aat ggg aga gtc tgc tgc 2400Gly Ser Pro Cys Thr Thr Cys Lys Cys Lys Asn Gly Arg Val Cys Cys785 790 795 800tct gtg gat ctg gag tgt att gag aat aac tga 2433Ser Val Asp Leu Glu Cys Ile Glu Asn Asn 805 8104810PRTRattus norvegicus 4Met Pro Met Asp Val Ile Leu Val Leu Trp Phe Cys Val Cys Thr Ala1 5 10 15Arg Thr Val Leu Gly Phe Gly Met Asp Pro Asp Leu Gln Leu Asp Ile 20 25 30Ile Ser Glu Leu Asp Leu Val Asn Thr Thr Leu Gly Val Thr Gln Val 35 40 45Ala Gly Leu His Asn Ala Ser Lys Ala Phe Leu Phe Gln Asp Val Gln 50 55 60Arg Glu Ile His Ser Ala Pro His Val Ser Glu Lys Leu Ile Gln Leu65 70 75 80Phe Arg Asn Lys Ser Glu Phe Thr Phe Leu Ala Thr Val Gln Gln Lys 85 90 95Pro Ser Thr Ser Gly Val Ile Leu Ser Ile Arg Glu Leu Glu His Ser 100 105 110Tyr Phe Glu Leu Glu Ser Ser Gly Pro Arg Glu Glu Ile Arg Tyr His 115 120 125Tyr Ile His Gly Gly Lys Pro Arg Thr Glu Ala Leu Pro Tyr Arg Met 130 135 140Ala Asp Gly Gln Trp His Lys Val Ala Leu Ser Val Ser Ala Ser His145 150 155 160Leu Leu Leu His Ile Asp Cys Asn Arg Ile Tyr Glu Arg Val Ile Asp 165 170 175Pro Pro Glu Thr Asn Leu Pro Pro Gly Ser Asn Leu Trp Leu Gly Gln 180 185 190Arg Asn Gln Lys His Gly Phe Phe Lys Gly Ile Ile Gln Asp Gly Lys 195 200 205Ile Ile Phe Met Pro Asn Gly Phe Ile Thr Gln Cys Pro Asn Leu Asn 210 215 220Arg Thr Cys Pro Thr Cys Ser Asp Phe Leu Ser Leu Val Gln Gly Ile225 230 235 240Met Asp Leu Gln Glu Leu Leu Ala Lys Met Thr Ala Lys Leu Asn Tyr 245 250 255Ala Glu Thr Arg Leu Gly Gln Leu Glu Asn Cys His Cys Glu Lys Thr 260 265 270Cys Gln Val Ser Gly Leu Leu Tyr Arg Asp Gln Asp Ser Trp Val Asp 275 280 285Gly Asp Asn Cys Gly Asn Cys Thr Cys Lys Ser Gly Ala Val Glu Cys 290 295 300Arg Arg Met Ser Cys Pro Pro Leu Asn Cys Ser Pro Asp Ser Leu Pro305 310 315 320Val His Ile Ser Gly Gln Cys Cys Lys Val Cys Arg Pro Lys Cys Ile 325 330 335Tyr Gly Gly Lys Val Leu Ala Glu Gly Gln Arg Ile Leu Thr Lys Thr 340 345 350Cys Arg Glu Cys Arg Gly Gly Val Leu Val Lys Ile Thr Glu Ala Cys 355 360 365Pro Pro Leu Asn Cys Ser Ala Lys Asp His Ile Leu Pro Glu Asn Gln 370 375 380Cys Cys Arg Val Cys Pro Gly His Asn Phe Cys Ala Glu Ala Pro Lys385 390 395 400Cys Gly Glu Asn Ser Glu Cys Lys Asn Trp Asn Thr Lys Ala Thr Cys 405 410 415Glu Cys Lys Asn Gly Tyr Ile Ser Val Gln Gly Asn Ser Ala Tyr Cys 420 425 430Glu Asp Ile Asp Glu Cys Ala Ala Lys Met His Tyr Cys His Ala Asn 435 440 445Thr Val Cys Val Asn Leu Pro Gly Leu Tyr Arg Cys Asp Cys Val Pro 450 455 460Gly Tyr Ile Arg Val Asp Asp Phe Ser Cys Thr Glu His Asp Asp Cys465 470 475 480Gly Ser Gly Gln His Asn Cys Asp Lys Asn Ala Ile Cys Thr Asn Thr 485 490 495Val Gln Gly His Ser Cys Thr Cys Gln Pro Gly Tyr Val Gly Asn Gly 500 505 510Thr Ile Cys Lys Ala Phe Cys Glu Glu Gly Cys Arg Tyr Gly Gly Thr 515 520 525Cys Val Ala Pro Asn Lys Cys Val Cys Pro Ser Gly Phe Thr Gly Ser 530 535 540His Cys Glu Lys Asp Ile Asp Glu Cys Ala Glu Gly Phe Val Glu Cys545 550 555 560His Asn Tyr Ser Arg Cys Val Asn Leu Pro Gly Trp Tyr His Cys Glu 565 570 575Cys Arg Ser Gly Phe His Asp Asp Gly Thr Tyr Ser Leu Ser Gly Glu 580 585 590Ser Cys Ile Asp Ile Asp Glu Cys Ala Leu Arg Thr His Thr Cys Trp 595 600 605Asn Asp Ser Ala Cys Ile Asn Leu Ala Gly Gly Phe Asp Cys Leu Cys 610 615 620Pro Ser Gly Pro Ser Cys Ser Gly Asp Cys Pro His Glu Gly Gly Leu625 630 635 640Lys His Asn Gly Gln Val Trp Ile Leu Arg Glu Asp Arg Cys Ser Val 645 650 655Cys Ser Cys Lys Asp Gly Lys Ile Phe Cys Arg Arg Thr Ala Cys Asp 660 665 670Cys Gln Asn Pro Asn Val Asp Leu Phe Cys Cys Pro Glu Cys Asp Thr 675 680 685Arg Val Thr Ser Gln Cys Leu Asp Gln Ser Gly Gln Lys Leu Tyr Arg 690 695 700Ser Gly Asp Asn Trp Thr His Ser Cys Gln Gln Cys Arg Cys Leu Glu705 710 715 720Gly Glu Ala Asp Cys Trp Pro Leu Ala Cys Pro Ser Leu Gly Cys Glu 725 730 735Tyr Thr Ala Met Phe Glu Gly Glu Cys Cys Pro Arg Cys Val Ser Asp 740 745 750Pro Cys Leu Ala Gly Asn Ile Ala Tyr Asp Ile Arg Lys Thr Cys Leu 755 760 765Asp Ser Phe Gly Val Ser Arg Leu Ser Gly Ala Val Trp Thr Met Ala 770 775 780Gly Ser Pro Cys Thr Thr Cys Lys Cys Lys Asn Gly Arg Val Cys Cys785 790 795 800Ser Val Asp Leu Glu Cys Ile Glu Asn Asn 805 81052433DNAMus musculus 5atgccgatgg atgtgatttt agttttgtgg ttctgtgtgt gcaccgccag gacagtgctg 60ggctttggga tggaccctga ccttcagatg gacatcatca ctgaacttga ccttgtgaac 120accaccctgg gcgtcactca ggtggctgga ctacacaatg ccagtaaggc atttctgttt 180caagatgtac agagagagat ccactcagcc cctcatgtga gtgagaagct gatccagcta 240ttccggaata agagtgagtt tacctttttg gctacagtgc agcagaagcc gtccacctca 300ggggtgatac tgtcgatccg ggagctggaa cacagctatt ttgaactgga gagcagtggc 360ccaagagaag agatacgcta tcattacatc catggcggca agcccaggac tgaggccctt 420ccctaccgca tggccgatgg acagtggcac aaggtcgcgc tgtctgtgag cgcctctcac 480ctcctactcc atgtcgactg caataggatt tatgagcgtg tgatagatcc tccggagacc 540aaccttcctc caggaagcaa tctatggctt gggcaacgta atcaaaagca tggctttttc 600aaaggaatca tccaagatgg caagatcatc ttcatgccga acggcttcat cacacagtgc 660cccaacctaa atcgcacttg cccaacatgc agtgatttcc tgagcctggt tcaaggaata 720atggatttgc aagagctttt ggccaagatg actgcaaaac tgaattatgc agagacgaga 780cttggtcaac tggaaaattg ccactgtgag aagacctgcc aagtgagtgg gctgctctac 840agggaccaag actcctgggt agatggtgac aactgcagga actgcacatg caaaagtggt 900gctgtggagt gccgaaggat gtcctgtccc ccactcaact gttccccaga ctcacttcct 960gtgcatattt ctggccaatg ttgtaaagtt tgcagaccaa aatgtatcta tggaggaaaa 1020gttcttgctg agggccagcg gattttaacc aagacctgcc gggaatgtcg aggtggagtc 1080ttggtaaaaa tcacagaagc ttgccctcct ttgaactgct cagagaagga tcatattctt 1140ccggagaacc agtgctgcag ggtctgccga ggtcataact tctgtgcaga agcacctaag 1200tgtggagaaa actcggaatg caaaaattgg aatacaaaag cgacttgtga gtgcaagaat 1260ggatacatct ctgtccaggg caactctgca tactgtgaag atatcgatga gtgtgcagca 1320aagatgcact actgtcatgc caacacggtg tgtgtcaact tgccggggtt atatcgctgt 1380gactgcatcc caggatacat ccgtgtggat gacttctctt gtacggagca tgatgattgt 1440ggcagcggac aacacaactg tgacaaaaat gccatctgta ccaacacagt ccagggacac 1500agctgtacct gccagccagg ctacgtggga aatggtactg tctgcaaagc attctgtgaa 1560gagggttgca gatacggagg tacctgtgtg gcccctaaca aatgtgtctg tccttctgga 1620ttcacaggaa gccactgtga gaaagatatt gatgaatgtg cagagggatt cgttgagtgc 1680cacaaccact cccgctgcgt taaccttcca gggtggtacc actgtgagtg cagaagcggt 1740ttccatgacg atgggaccta ttcactgtcc ggggagtcct gcattgatat tgatgaatgt 1800gccttaagaa ctcacacttg ttggaatgac tctgcctgca tcaacttagc aggaggattt 1860gactgcctgt gtccctctgg gccctcctgc tctggtgact gtccccacga aggggggctg 1920aagcataatg ggcaggtgtg gattctgaga gaagacaggt gttcagtctg ttcctgtaag 1980gatgggaaga tattctgccg gcggacagct tgtgattgcc agaatccaaa tgttgacctt 2040ttctgctgcc cagagtgtga caccagggtc actagccaat gtttagatca aagcggacag 2100aagctctatc gaagtggaga caactggacc cacagctgcc agcagtgccg atgtctggaa 2160ggagaggcag actgctggcc tctagcttgc cctagtttga gctgtgaata cacagccatc 2220tttgaaggag agtgttgtcc ccgctgtgtc agtgacccct gcctggctga taatattgcc 2280tatgacatca gaaaaacttg cctggacagc tctggtattt cgaggctgag cggcgcagtg 2340tggacaatgg ctggatctcc ctgtacaacc tgtcaatgca agaatgggag agtctgctgc 2400tctgtggatc tggtgtgtct tgagaataac tga 24336810PRTMus musculus 6Met Pro Met Asp Val Ile Leu Val Leu Trp Phe Cys Val Cys Thr Ala1 5 10 15Arg Thr Val Leu Gly Phe Gly Met Asp Pro Asp Leu Gln Met Asp Ile 20 25 30Ile Thr Glu Leu Asp Leu Val Asn Thr Thr Leu Gly Val Thr Gln Val 35 40 45Ala Gly Leu His Asn Ala Ser Lys Ala Phe Leu Phe Gln Asp Val Gln 50 55 60Arg Glu Ile His Ser Ala Pro His Val Ser Glu Lys Leu Ile Gln Leu65 70 75 80Phe Arg Asn Lys Ser Glu Phe Thr Phe Leu Ala Thr Val Gln Gln Lys 85 90 95Pro Ser Thr Ser Gly Val Ile Leu Ser Ile Arg Glu Leu Glu His Ser 100 105 110Tyr Phe Glu Leu Glu Ser Ser Gly Pro Arg Glu Glu Ile Arg Tyr His 115 120 125Tyr Ile His Gly Gly Lys Pro Arg Thr Glu Ala Leu Pro Tyr Arg Met 130 135 140Ala Asp Gly Gln Trp His Lys Val Ala Leu Ser Val Ser Ala Ser His145 150 155 160Leu Leu Leu His Val Asp Cys Asn Arg Ile Tyr Glu Arg Val Ile Asp 165 170 175Pro Pro Glu Thr Asn Leu Pro Pro Gly Ser Asn Leu Trp Leu Gly Gln 180 185 190Arg Asn Gln Lys His Gly Phe Phe Lys Gly Ile Ile Gln Asp Gly Lys 195 200 205Ile Ile Phe Met Pro Asn Gly Phe Ile Thr Gln Cys Pro Asn Leu Asn 210 215 220Arg Thr Cys Pro Thr Cys Ser Asp Phe Leu Ser Leu Val Gln Gly Ile225 230 235 240Met Asp Leu Gln Glu Leu Leu Ala Lys Met Thr Ala Lys Leu Asn Tyr 245 250 255Ala Glu Thr Arg Leu Gly Gln Leu Glu Asn Cys His Cys Glu Lys Thr 260 265 270Cys Gln Val Ser Gly Leu Leu Tyr Arg Asp Gln Asp Ser Trp Val Asp 275 280 285Gly Asp Asn Cys Arg Asn Cys Thr Cys

Lys Ser Gly Ala Val Glu Cys 290 295 300Arg Arg Met Ser Cys Pro Pro Leu Asn Cys Ser Pro Asp Ser Leu Pro305 310 315 320Val His Ile Ser Gly Gln Cys Cys Lys Val Cys Arg Pro Lys Cys Ile 325 330 335Tyr Gly Gly Lys Val Leu Ala Glu Gly Gln Arg Ile Leu Thr Lys Thr 340 345 350Cys Arg Glu Cys Arg Gly Gly Val Leu Val Lys Ile Thr Glu Ala Cys 355 360 365Pro Pro Leu Asn Cys Ser Glu Lys Asp His Ile Leu Pro Glu Asn Gln 370 375 380Cys Cys Arg Val Cys Arg Gly His Asn Phe Cys Ala Glu Ala Pro Lys385 390 395 400Cys Gly Glu Asn Ser Glu Cys Lys Asn Trp Asn Thr Lys Ala Thr Cys 405 410 415Glu Cys Lys Asn Gly Tyr Ile Ser Val Gln Gly Asn Ser Ala Tyr Cys 420 425 430Glu Asp Ile Asp Glu Cys Ala Ala Lys Met His Tyr Cys His Ala Asn 435 440 445Thr Val Cys Val Asn Leu Pro Gly Leu Tyr Arg Cys Asp Cys Ile Pro 450 455 460Gly Tyr Ile Arg Val Asp Asp Phe Ser Cys Thr Glu His Asp Asp Cys465 470 475 480Gly Ser Gly Gln His Asn Cys Asp Lys Asn Ala Ile Cys Thr Asn Thr 485 490 495Val Gln Gly His Ser Cys Thr Cys Gln Pro Gly Tyr Val Gly Asn Gly 500 505 510Thr Val Cys Lys Ala Phe Cys Glu Glu Gly Cys Arg Tyr Gly Gly Thr 515 520 525Cys Val Ala Pro Asn Lys Cys Val Cys Pro Ser Gly Phe Thr Gly Ser 530 535 540His Cys Glu Lys Asp Ile Asp Glu Cys Ala Glu Gly Phe Val Glu Cys545 550 555 560His Asn His Ser Arg Cys Val Asn Leu Pro Gly Trp Tyr His Cys Glu 565 570 575Cys Arg Ser Gly Phe His Asp Asp Gly Thr Tyr Ser Leu Ser Gly Glu 580 585 590Ser Cys Ile Asp Ile Asp Glu Cys Ala Leu Arg Thr His Thr Cys Trp 595 600 605Asn Asp Ser Ala Cys Ile Asn Leu Ala Gly Gly Phe Asp Cys Leu Cys 610 615 620Pro Ser Gly Pro Ser Cys Ser Gly Asp Cys Pro His Glu Gly Gly Leu625 630 635 640Lys His Asn Gly Gln Val Trp Ile Leu Arg Glu Asp Arg Cys Ser Val 645 650 655Cys Ser Cys Lys Asp Gly Lys Ile Phe Cys Arg Arg Thr Ala Cys Asp 660 665 670Cys Gln Asn Pro Asn Val Asp Leu Phe Cys Cys Pro Glu Cys Asp Thr 675 680 685Arg Val Thr Ser Gln Cys Leu Asp Gln Ser Gly Gln Lys Leu Tyr Arg 690 695 700Ser Gly Asp Asn Trp Thr His Ser Cys Gln Gln Cys Arg Cys Leu Glu705 710 715 720Gly Glu Ala Asp Cys Trp Pro Leu Ala Cys Pro Ser Leu Ser Cys Glu 725 730 735Tyr Thr Ala Ile Phe Glu Gly Glu Cys Cys Pro Arg Cys Val Ser Asp 740 745 750Pro Cys Leu Ala Asp Asn Ile Ala Tyr Asp Ile Arg Lys Thr Cys Leu 755 760 765Asp Ser Ser Gly Ile Ser Arg Leu Ser Gly Ala Val Trp Thr Met Ala 770 775 780Gly Ser Pro Cys Thr Thr Cys Gln Cys Lys Asn Gly Arg Val Cys Cys785 790 795 800Ser Val Asp Leu Val Cys Leu Glu Asn Asn 805 81072451DNAHomo sapiensCDS(1)..(2448) 7atg gag tct cgg gtc tta ctg aga aca ttc tgt ttg atc ttc ggt ctc 48Met Glu Ser Arg Val Leu Leu Arg Thr Phe Cys Leu Ile Phe Gly Leu1 5 10 15gga gca gtt tgg ggg ctt ggt gtg gac cct tcc cta cag att gac gtc 96Gly Ala Val Trp Gly Leu Gly Val Asp Pro Ser Leu Gln Ile Asp Val 20 25 30tta aca gag tta gaa ctt ggg gag tcc acg acc gga gtg cgt cag gtc 144Leu Thr Glu Leu Glu Leu Gly Glu Ser Thr Thr Gly Val Arg Gln Val 35 40 45ccg ggg ctg cat aat ggg acg aaa gcc ttt ctc ttt caa gat act ccc 192Pro Gly Leu His Asn Gly Thr Lys Ala Phe Leu Phe Gln Asp Thr Pro 50 55 60aga agc ata aaa gca tcc act gct aca gct gaa cag ttt ttt cag aag 240Arg Ser Ile Lys Ala Ser Thr Ala Thr Ala Glu Gln Phe Phe Gln Lys65 70 75 80ctg aga aat aaa cat gaa ttt act att ttg gtg acc cta aaa cag acc 288Leu Arg Asn Lys His Glu Phe Thr Ile Leu Val Thr Leu Lys Gln Thr 85 90 95cac tta aat tca gga gtt att ctc tca att cac cac ttg gat cac agg 336His Leu Asn Ser Gly Val Ile Leu Ser Ile His His Leu Asp His Arg 100 105 110tac ctg gaa ctg gaa agt agt ggc cat cgg aat gaa gtc aga ctg cat 384Tyr Leu Glu Leu Glu Ser Ser Gly His Arg Asn Glu Val Arg Leu His 115 120 125tac cgc tca ggc agt cac cgc cct cac aca gaa gtg ttt cct tac att 432Tyr Arg Ser Gly Ser His Arg Pro His Thr Glu Val Phe Pro Tyr Ile 130 135 140ttg gct gat gac aag tgg cac aag ctc tcc tta gcc atc agt gct tcc 480Leu Ala Asp Asp Lys Trp His Lys Leu Ser Leu Ala Ile Ser Ala Ser145 150 155 160cat ttg att tta cac att gac tgc aat aaa att tat gaa agg gta gta 528His Leu Ile Leu His Ile Asp Cys Asn Lys Ile Tyr Glu Arg Val Val 165 170 175gaa aag ccc tcc aca gac ttg cct cta ggc aca aca ttt tgg cta gga 576Glu Lys Pro Ser Thr Asp Leu Pro Leu Gly Thr Thr Phe Trp Leu Gly 180 185 190cag aga aat aat gcg cat gga tat ttt aag ggt ata atg caa gat gtc 624Gln Arg Asn Asn Ala His Gly Tyr Phe Lys Gly Ile Met Gln Asp Val 195 200 205caa tta ctt gtc atg ccc cag gga ttt att gct cag tgc cca gat ctt 672Gln Leu Leu Val Met Pro Gln Gly Phe Ile Ala Gln Cys Pro Asp Leu 210 215 220aat cgc acc tgt cca act tgc aat gac ttc cat gga ctt gtg cag aaa 720Asn Arg Thr Cys Pro Thr Cys Asn Asp Phe His Gly Leu Val Gln Lys225 230 235 240atc atg gag cta cag gat att tta gcc aaa aca tca gcc aag ctg tct 768Ile Met Glu Leu Gln Asp Ile Leu Ala Lys Thr Ser Ala Lys Leu Ser 245 250 255cga gct gaa cag cga atg aat aga ttg gat cag tgc tat tgt gaa agg 816Arg Ala Glu Gln Arg Met Asn Arg Leu Asp Gln Cys Tyr Cys Glu Arg 260 265 270act tgc acc atg aag gga acc acc tac cga gaa ttt gag tcc tgg ata 864Thr Cys Thr Met Lys Gly Thr Thr Tyr Arg Glu Phe Glu Ser Trp Ile 275 280 285gac ggc tgt aag aac tgc aca tgc ctg aat gga acc atc cag tgt gaa 912Asp Gly Cys Lys Asn Cys Thr Cys Leu Asn Gly Thr Ile Gln Cys Glu 290 295 300act cta atc tgc cca aat cct gac tgc cca ctt aag tcg gct ctt gcg 960Thr Leu Ile Cys Pro Asn Pro Asp Cys Pro Leu Lys Ser Ala Leu Ala305 310 315 320tat gtg gat ggc aaa tgc tgt aag gaa tgc aaa tcg ata tgc caa ttt 1008Tyr Val Asp Gly Lys Cys Cys Lys Glu Cys Lys Ser Ile Cys Gln Phe 325 330 335caa gga cga acc tac ttt gaa gga gaa aga aat aca gtc tat tcc tct 1056Gln Gly Arg Thr Tyr Phe Glu Gly Glu Arg Asn Thr Val Tyr Ser Ser 340 345 350tct gga gta tgt gtt ctc tat gag tgc aag gac cag acc atg aaa ctt 1104Ser Gly Val Cys Val Leu Tyr Glu Cys Lys Asp Gln Thr Met Lys Leu 355 360 365gtt gag agt tca ggc tgt cca gct ttg gat tgt cca gag tct cat cag 1152Val Glu Ser Ser Gly Cys Pro Ala Leu Asp Cys Pro Glu Ser His Gln 370 375 380ata acc ttg tct cac agc tgt tgc aaa gtt tgt aaa ggt tat gac ttt 1200Ile Thr Leu Ser His Ser Cys Cys Lys Val Cys Lys Gly Tyr Asp Phe385 390 395 400tgt tct gaa agg cat aac tgc atg gag aat tcc atc tgc aga aat ctg 1248Cys Ser Glu Arg His Asn Cys Met Glu Asn Ser Ile Cys Arg Asn Leu 405 410 415aat gac agg gct gtt tgt agc tgt cga gat ggt ttt agg gct ctt cga 1296Asn Asp Arg Ala Val Cys Ser Cys Arg Asp Gly Phe Arg Ala Leu Arg 420 425 430gag gat aat gcc tac tgt gaa gac atc gat gag tgt gct gaa ggg cgc 1344Glu Asp Asn Ala Tyr Cys Glu Asp Ile Asp Glu Cys Ala Glu Gly Arg 435 440 445cat tac tgt cgt gaa aat aca atg tgt gtc aac acc ccg ggt tct ttt 1392His Tyr Cys Arg Glu Asn Thr Met Cys Val Asn Thr Pro Gly Ser Phe 450 455 460atg tgc atc tgc aaa act gga tac atc aga att gat gat tat tca tgt 1440Met Cys Ile Cys Lys Thr Gly Tyr Ile Arg Ile Asp Asp Tyr Ser Cys465 470 475 480aca gaa cat gat gag tgt atc aca aat cag cac aac tgt gat gaa aat 1488Thr Glu His Asp Glu Cys Ile Thr Asn Gln His Asn Cys Asp Glu Asn 485 490 495gct tta tgc ttc aac act gtt gga gga cac aac tgt gtt tgc aag ccg 1536Ala Leu Cys Phe Asn Thr Val Gly Gly His Asn Cys Val Cys Lys Pro 500 505 510ggc tat aca ggg aat gga acg aca tgc aaa gca ttt tgc aaa gat ggc 1584Gly Tyr Thr Gly Asn Gly Thr Thr Cys Lys Ala Phe Cys Lys Asp Gly 515 520 525tgt agg aat gga gga gcc tgt att gcc gct aat gtg tgt gcc tgc cca 1632Cys Arg Asn Gly Gly Ala Cys Ile Ala Ala Asn Val Cys Ala Cys Pro 530 535 540caa ggc ttc act gga ccc agc tgt gaa acg gac att gat gaa tgc tct 1680Gln Gly Phe Thr Gly Pro Ser Cys Glu Thr Asp Ile Asp Glu Cys Ser545 550 555 560gat ggt ttt gtt caa tgt gac agt cgt gct aat tgc att aac ctg cct 1728Asp Gly Phe Val Gln Cys Asp Ser Arg Ala Asn Cys Ile Asn Leu Pro 565 570 575gga tgg tac cac tgt gag tgc aga gat ggc tac cat gac aat ggg atg 1776Gly Trp Tyr His Cys Glu Cys Arg Asp Gly Tyr His Asp Asn Gly Met 580 585 590ttt tca cca agt gga gaa tcg tgt gaa gat att gat gag tgt ggg acc 1824Phe Ser Pro Ser Gly Glu Ser Cys Glu Asp Ile Asp Glu Cys Gly Thr 595 600 605ggg agg cac agc tgt gcc aat gat acc att tgc ttc aat ttg gat ggc 1872Gly Arg His Ser Cys Ala Asn Asp Thr Ile Cys Phe Asn Leu Asp Gly 610 615 620gga tat gat tgt cga tgt cct cat gga aag aat tgc aca ggg gac tgc 1920Gly Tyr Asp Cys Arg Cys Pro His Gly Lys Asn Cys Thr Gly Asp Cys625 630 635 640atc cat gat gga aaa gtt aag cac aat ggt cag att tgg gtg ttg gaa 1968Ile His Asp Gly Lys Val Lys His Asn Gly Gln Ile Trp Val Leu Glu 645 650 655aat gac agg tgc tct gtg tgc tca tgt cag aat gga ttc gtt atg tgt 2016Asn Asp Arg Cys Ser Val Cys Ser Cys Gln Asn Gly Phe Val Met Cys 660 665 670cga cgg atg gtc tgt gac tgt gag aat ccc aca gtt gat ctt ttt tgc 2064Arg Arg Met Val Cys Asp Cys Glu Asn Pro Thr Val Asp Leu Phe Cys 675 680 685tgc cct gaa tgt gac cca agg ctt agt agt cag tgc ctc cat caa aat 2112Cys Pro Glu Cys Asp Pro Arg Leu Ser Ser Gln Cys Leu His Gln Asn 690 695 700ggg gaa act ttg tat aac agt ggt gac acc tgg gtc cag aat tgt caa 2160Gly Glu Thr Leu Tyr Asn Ser Gly Asp Thr Trp Val Gln Asn Cys Gln705 710 715 720cag tgc cgc tgc ttg caa ggg gaa gtt gat tgt tgg ccc ctg cct tgc 2208Gln Cys Arg Cys Leu Gln Gly Glu Val Asp Cys Trp Pro Leu Pro Cys 725 730 735cca gat gtg gag tgt gaa ttc agc att ctc cca gag aat gag tgc tgc 2256Pro Asp Val Glu Cys Glu Phe Ser Ile Leu Pro Glu Asn Glu Cys Cys 740 745 750ccg cgc tgt gtc aca gac cct tgc cag gct gac acc atc cgc aat gac 2304Pro Arg Cys Val Thr Asp Pro Cys Gln Ala Asp Thr Ile Arg Asn Asp 755 760 765atc acc aag act tgc ctg gac gaa atg aat gtg gtt cgc ttc acc ggg 2352Ile Thr Lys Thr Cys Leu Asp Glu Met Asn Val Val Arg Phe Thr Gly 770 775 780tcc tct tgg atc aaa cat ggc act gag tgt act ctc tgc cag tgc aag 2400Ser Ser Trp Ile Lys His Gly Thr Glu Cys Thr Leu Cys Gln Cys Lys785 790 795 800aat ggc cac atc tgt tgc tca gtg gat cca cag tgc ctt cag gaa ctg 2448Asn Gly His Ile Cys Cys Ser Val Asp Pro Gln Cys Leu Gln Glu Leu 805 810 815tga 24518816PRTHomo sapiens 8Met Glu Ser Arg Val Leu Leu Arg Thr Phe Cys Leu Ile Phe Gly Leu1 5 10 15Gly Ala Val Trp Gly Leu Gly Val Asp Pro Ser Leu Gln Ile Asp Val 20 25 30Leu Thr Glu Leu Glu Leu Gly Glu Ser Thr Thr Gly Val Arg Gln Val 35 40 45Pro Gly Leu His Asn Gly Thr Lys Ala Phe Leu Phe Gln Asp Thr Pro 50 55 60Arg Ser Ile Lys Ala Ser Thr Ala Thr Ala Glu Gln Phe Phe Gln Lys65 70 75 80Leu Arg Asn Lys His Glu Phe Thr Ile Leu Val Thr Leu Lys Gln Thr 85 90 95His Leu Asn Ser Gly Val Ile Leu Ser Ile His His Leu Asp His Arg 100 105 110Tyr Leu Glu Leu Glu Ser Ser Gly His Arg Asn Glu Val Arg Leu His 115 120 125Tyr Arg Ser Gly Ser His Arg Pro His Thr Glu Val Phe Pro Tyr Ile 130 135 140Leu Ala Asp Asp Lys Trp His Lys Leu Ser Leu Ala Ile Ser Ala Ser145 150 155 160His Leu Ile Leu His Ile Asp Cys Asn Lys Ile Tyr Glu Arg Val Val 165 170 175Glu Lys Pro Ser Thr Asp Leu Pro Leu Gly Thr Thr Phe Trp Leu Gly 180 185 190Gln Arg Asn Asn Ala His Gly Tyr Phe Lys Gly Ile Met Gln Asp Val 195 200 205Gln Leu Leu Val Met Pro Gln Gly Phe Ile Ala Gln Cys Pro Asp Leu 210 215 220Asn Arg Thr Cys Pro Thr Cys Asn Asp Phe His Gly Leu Val Gln Lys225 230 235 240Ile Met Glu Leu Gln Asp Ile Leu Ala Lys Thr Ser Ala Lys Leu Ser 245 250 255Arg Ala Glu Gln Arg Met Asn Arg Leu Asp Gln Cys Tyr Cys Glu Arg 260 265 270Thr Cys Thr Met Lys Gly Thr Thr Tyr Arg Glu Phe Glu Ser Trp Ile 275 280 285Asp Gly Cys Lys Asn Cys Thr Cys Leu Asn Gly Thr Ile Gln Cys Glu 290 295 300Thr Leu Ile Cys Pro Asn Pro Asp Cys Pro Leu Lys Ser Ala Leu Ala305 310 315 320Tyr Val Asp Gly Lys Cys Cys Lys Glu Cys Lys Ser Ile Cys Gln Phe 325 330 335Gln Gly Arg Thr Tyr Phe Glu Gly Glu Arg Asn Thr Val Tyr Ser Ser 340 345 350Ser Gly Val Cys Val Leu Tyr Glu Cys Lys Asp Gln Thr Met Lys Leu 355 360 365Val Glu Ser Ser Gly Cys Pro Ala Leu Asp Cys Pro Glu Ser His Gln 370 375 380Ile Thr Leu Ser His Ser Cys Cys Lys Val Cys Lys Gly Tyr Asp Phe385 390 395 400Cys Ser Glu Arg His Asn Cys Met Glu Asn Ser Ile Cys Arg Asn Leu 405 410 415Asn Asp Arg Ala Val Cys Ser Cys Arg Asp Gly Phe Arg Ala Leu Arg 420 425 430Glu Asp Asn Ala Tyr Cys Glu Asp Ile Asp Glu Cys Ala Glu Gly Arg 435 440 445His Tyr Cys Arg Glu Asn Thr Met Cys Val Asn Thr Pro Gly Ser Phe 450 455 460Met Cys Ile Cys Lys Thr Gly Tyr Ile Arg Ile Asp Asp Tyr Ser Cys465 470 475 480Thr Glu His Asp Glu Cys Ile Thr Asn Gln His Asn Cys Asp Glu Asn 485 490 495Ala Leu Cys Phe Asn Thr Val Gly Gly His Asn Cys Val Cys Lys Pro 500 505 510Gly Tyr Thr Gly Asn Gly Thr Thr Cys Lys Ala Phe Cys Lys Asp Gly 515 520 525Cys Arg Asn Gly Gly Ala Cys Ile Ala Ala Asn Val Cys Ala Cys Pro 530 535 540Gln Gly Phe Thr Gly Pro Ser Cys Glu Thr Asp Ile Asp Glu Cys Ser545 550 555 560Asp Gly Phe Val Gln Cys Asp Ser Arg Ala Asn Cys Ile Asn Leu Pro 565 570 575Gly Trp Tyr His Cys Glu Cys Arg Asp Gly Tyr His Asp Asn Gly Met 580 585 590Phe Ser Pro Ser Gly Glu Ser Cys Glu Asp Ile Asp Glu Cys Gly Thr 595 600 605Gly Arg His Ser Cys Ala Asn Asp Thr Ile Cys Phe Asn Leu Asp Gly 610 615 620Gly Tyr Asp Cys Arg Cys Pro His Gly Lys Asn Cys Thr Gly Asp

Cys625 630 635 640Ile His Asp Gly Lys Val Lys His Asn Gly Gln Ile Trp Val Leu Glu 645 650 655Asn Asp Arg Cys Ser Val Cys Ser Cys Gln Asn Gly Phe Val Met Cys 660 665 670Arg Arg Met Val Cys Asp Cys Glu Asn Pro Thr Val Asp Leu Phe Cys 675 680 685Cys Pro Glu Cys Asp Pro Arg Leu Ser Ser Gln Cys Leu His Gln Asn 690 695 700Gly Glu Thr Leu Tyr Asn Ser Gly Asp Thr Trp Val Gln Asn Cys Gln705 710 715 720Gln Cys Arg Cys Leu Gln Gly Glu Val Asp Cys Trp Pro Leu Pro Cys 725 730 735Pro Asp Val Glu Cys Glu Phe Ser Ile Leu Pro Glu Asn Glu Cys Cys 740 745 750Pro Arg Cys Val Thr Asp Pro Cys Gln Ala Asp Thr Ile Arg Asn Asp 755 760 765Ile Thr Lys Thr Cys Leu Asp Glu Met Asn Val Val Arg Phe Thr Gly 770 775 780Ser Ser Trp Ile Lys His Gly Thr Glu Cys Thr Leu Cys Gln Cys Lys785 790 795 800Asn Gly His Ile Cys Cys Ser Val Asp Pro Gln Cys Leu Gln Glu Leu 805 810 81592451DNARattus norvegicusCDS(1)..(2448) 9atg gaa tcc cgg gta tta ctg aga acg ttc tgc gtg atc ctc ggg ctc 48Met Glu Ser Arg Val Leu Leu Arg Thr Phe Cys Val Ile Leu Gly Leu1 5 10 15gaa gcg gtt tgg gga ctt ggt gtg gac ccc tcc cta cag att gac gtc 96Glu Ala Val Trp Gly Leu Gly Val Asp Pro Ser Leu Gln Ile Asp Val 20 25 30tta tca gag tta gaa ctt ggg gag tcc aca gct gga gtg cgc caa gtc 144Leu Ser Glu Leu Glu Leu Gly Glu Ser Thr Ala Gly Val Arg Gln Val 35 40 45cca gga ctg cat aat ggg acg aaa gcc ttc ctc ttc caa gat tcc ccc 192Pro Gly Leu His Asn Gly Thr Lys Ala Phe Leu Phe Gln Asp Ser Pro 50 55 60aga agc ata aaa gca ccc att gct aca gct gag cgg ttt ttc cag aag 240Arg Ser Ile Lys Ala Pro Ile Ala Thr Ala Glu Arg Phe Phe Gln Lys65 70 75 80ctg agg aat aaa cac gag ttc aca att ctg gtg acc ctg aaa cag atc 288Leu Arg Asn Lys His Glu Phe Thr Ile Leu Val Thr Leu Lys Gln Ile 85 90 95cac tta aat tcg gga gtc att ctc tcc atc cac cac ttg gat cac agg 336His Leu Asn Ser Gly Val Ile Leu Ser Ile His His Leu Asp His Arg 100 105 110tac ctg gaa ctg gaa agc agc ggc cac cgg aat gag atc aga ctg cat 384Tyr Leu Glu Leu Glu Ser Ser Gly His Arg Asn Glu Ile Arg Leu His 115 120 125tac cgc tct gga act cac cgc ccg cac acg gaa gtg ttt cct tat att 432Tyr Arg Ser Gly Thr His Arg Pro His Thr Glu Val Phe Pro Tyr Ile 130 135 140ttg gct gat gcc aag tgg cac aag ctc tcc tta gcc ttc agt gcc tcc 480Leu Ala Asp Ala Lys Trp His Lys Leu Ser Leu Ala Phe Ser Ala Ser145 150 155 160cac tta att tta cac atc gac tgc aac aag atc tat gaa cga gtg gtg 528His Leu Ile Leu His Ile Asp Cys Asn Lys Ile Tyr Glu Arg Val Val 165 170 175gaa atg cct tct aca gac ttg cct ctg ggc acc aca ttt tgg ttg gga 576Glu Met Pro Ser Thr Asp Leu Pro Leu Gly Thr Thr Phe Trp Leu Gly 180 185 190cag aga aat aac gca cac ggg tat ttt aag gga ata atg caa gat gtg 624Gln Arg Asn Asn Ala His Gly Tyr Phe Lys Gly Ile Met Gln Asp Val 195 200 205caa tta ctt gtc atg ccc cag ggg ttc atc gct cag tgc ccg gat ctt 672Gln Leu Leu Val Met Pro Gln Gly Phe Ile Ala Gln Cys Pro Asp Leu 210 215 220aat cga acc tgt cca aca tgc aac gac ttc cat ggg ctt gtg cag aaa 720Asn Arg Thr Cys Pro Thr Cys Asn Asp Phe His Gly Leu Val Gln Lys225 230 235 240atc atg gag ctg cag gac att tta tcg aag acg tca gcc aag ttg tct 768Ile Met Glu Leu Gln Asp Ile Leu Ser Lys Thr Ser Ala Lys Leu Ser 245 250 255aga gct gaa caa cga atg aac agg ctg gat cag tgc tac tgt gag cgg 816Arg Ala Glu Gln Arg Met Asn Arg Leu Asp Gln Cys Tyr Cys Glu Arg 260 265 270acg tgc acc atg aag gga gcc acc tac cgg gag ttc gag tcc tgg aca 864Thr Cys Thr Met Lys Gly Ala Thr Tyr Arg Glu Phe Glu Ser Trp Thr 275 280 285gac ggc tgc aag aac tgc aca tgc ttg aat ggg acc atc cag tgc gag 912Asp Gly Cys Lys Asn Cys Thr Cys Leu Asn Gly Thr Ile Gln Cys Glu 290 295 300act ctg gtc tgc cct gct ccc gac tgc ccg gct aaa tcg gct cca gcg 960Thr Leu Val Cys Pro Ala Pro Asp Cys Pro Ala Lys Ser Ala Pro Ala305 310 315 320tac gtg gat ggc aag tgc tgt aag gag tgc aag tcc acc tgc cag ttc 1008Tyr Val Asp Gly Lys Cys Cys Lys Glu Cys Lys Ser Thr Cys Gln Phe 325 330 335cag ggg cgg agc tac ttt gag gga gaa agg agc aca gtc ttc tca gct 1056Gln Gly Arg Ser Tyr Phe Glu Gly Glu Arg Ser Thr Val Phe Ser Ala 340 345 350tcc gga atg tgc gtc ttg tat gaa tgc aag gat cag acc atg aag ctt 1104Ser Gly Met Cys Val Leu Tyr Glu Cys Lys Asp Gln Thr Met Lys Leu 355 360 365gtt gag aac gcc ggc tgc ccg gct tta gat tgc ccc gag tct cat cag 1152Val Glu Asn Ala Gly Cys Pro Ala Leu Asp Cys Pro Glu Ser His Gln 370 375 380atc gcc ttg tct cac agc tgc tgc aag gtt tgc aaa ggt tat gac ttc 1200Ile Ala Leu Ser His Ser Cys Cys Lys Val Cys Lys Gly Tyr Asp Phe385 390 395 400tgt tct gag aag cat aca tgc atg gag aac tca gtc tgc agg aac ctg 1248Cys Ser Glu Lys His Thr Cys Met Glu Asn Ser Val Cys Arg Asn Leu 405 410 415aac gac agg gca gtg tgc agc tgc cgg gat ggt ttc cgg gcc ctc cgg 1296Asn Asp Arg Ala Val Cys Ser Cys Arg Asp Gly Phe Arg Ala Leu Arg 420 425 430gag gac aat gcc tac tgt gaa gac att gac gag tgt gca gag ggg cgc 1344Glu Asp Asn Ala Tyr Cys Glu Asp Ile Asp Glu Cys Ala Glu Gly Arg 435 440 445cat tac tgc cgt gag aac acc atg tgt gtg aac aca ccg ggc tct ttc 1392His Tyr Cys Arg Glu Asn Thr Met Cys Val Asn Thr Pro Gly Ser Phe 450 455 460ctg tgt atc tgc caa aca ggg tac atc aga atc gac gat tac tcg tgt 1440Leu Cys Ile Cys Gln Thr Gly Tyr Ile Arg Ile Asp Asp Tyr Ser Cys465 470 475 480acg gaa cat gac gag tgc ctc aca aac cag cac aac tgt gac gag aac 1488Thr Glu His Asp Glu Cys Leu Thr Asn Gln His Asn Cys Asp Glu Asn 485 490 495gct ttg tgc ttt aac acc gtt gga ggt cac aac tgc gtc tgc aag cct 1536Ala Leu Cys Phe Asn Thr Val Gly Gly His Asn Cys Val Cys Lys Pro 500 505 510ggg tac act ggg aat gga acc acg tgc aaa gct ttc tgc aaa gac ggc 1584Gly Tyr Thr Gly Asn Gly Thr Thr Cys Lys Ala Phe Cys Lys Asp Gly 515 520 525tgc aaa aac gga ggt gcc tgc att gct gcc aat gtc tgt gct tgc cca 1632Cys Lys Asn Gly Gly Ala Cys Ile Ala Ala Asn Val Cys Ala Cys Pro 530 535 540caa ggc ttc acc gga ccc agc tgt gag aca gac att gat gag tgc tct 1680Gln Gly Phe Thr Gly Pro Ser Cys Glu Thr Asp Ile Asp Glu Cys Ser545 550 555 560gag ggc ttt gtt cag tgt gac agc cgt gcc aac tgc att aac ctg cct 1728Glu Gly Phe Val Gln Cys Asp Ser Arg Ala Asn Cys Ile Asn Leu Pro 565 570 575ggg tgg tac cac tgt gag tgc aga gat ggc tac cat gac aat ggg atg 1776Gly Trp Tyr His Cys Glu Cys Arg Asp Gly Tyr His Asp Asn Gly Met 580 585 590ttt gcg cca ggt gga gaa tcc tgt gaa gat att gat gaa tgt ggg act 1824Phe Ala Pro Gly Gly Glu Ser Cys Glu Asp Ile Asp Glu Cys Gly Thr 595 600 605ggg agg cac agc tgt gcc aat gac acc att tgc ttc aac ttg gac ggt 1872Gly Arg His Ser Cys Ala Asn Asp Thr Ile Cys Phe Asn Leu Asp Gly 610 615 620ggc tac gat tgc cgg tgt ccc cat gga aag aac tgc aca ggg gac tgc 1920Gly Tyr Asp Cys Arg Cys Pro His Gly Lys Asn Cys Thr Gly Asp Cys625 630 635 640gtg cac gac ggg aaa gtc aaa cac aac ggc cag atc tgg gtg ctg gag 1968Val His Asp Gly Lys Val Lys His Asn Gly Gln Ile Trp Val Leu Glu 645 650 655aac gac agg tgc tct gtg tgt tcc tgc cag act gga ttt gtt atg tgc 2016Asn Asp Arg Cys Ser Val Cys Ser Cys Gln Thr Gly Phe Val Met Cys 660 665 670caa cgg atg gtc tgt gac tgc gaa aac ccc aca gtt gac ctc tcc tgc 2064Gln Arg Met Val Cys Asp Cys Glu Asn Pro Thr Val Asp Leu Ser Cys 675 680 685tgc cct gag tgc gac cca agg ctg agc agc cag tgc ctg cat caa aac 2112Cys Pro Glu Cys Asp Pro Arg Leu Ser Ser Gln Cys Leu His Gln Asn 690 695 700ggg gaa acc gtg tac aac agc ggt gac acc tgg gcc cag gat tgc cgt 2160Gly Glu Thr Val Tyr Asn Ser Gly Asp Thr Trp Ala Gln Asp Cys Arg705 710 715 720cag tgc cgc tgc ttg caa gaa gaa gtt gac tgc tgg ccc ctg gct tgc 2208Gln Cys Arg Cys Leu Gln Glu Glu Val Asp Cys Trp Pro Leu Ala Cys 725 730 735cca gag gta gag tgt gaa ttt agt gtc ctt cct gag aac gag tgc tgc 2256Pro Glu Val Glu Cys Glu Phe Ser Val Leu Pro Glu Asn Glu Cys Cys 740 745 750cca cgc tgt gtc acc gat cct tgt cag gct gac acc atc cgc aat gac 2304Pro Arg Cys Val Thr Asp Pro Cys Gln Ala Asp Thr Ile Arg Asn Asp 755 760 765atc acc aaa acc tgc ctg gac gag atg aac gtg gtt cgc ttc act ggg 2352Ile Thr Lys Thr Cys Leu Asp Glu Met Asn Val Val Arg Phe Thr Gly 770 775 780tct tcc tgg atc aag cac ggc acg gag tgc acc ctc tgc cag tgc aag 2400Ser Ser Trp Ile Lys His Gly Thr Glu Cys Thr Leu Cys Gln Cys Lys785 790 795 800aac ggc cac gtg tgc tgc tca gtg gac cca cag tgc ctc cag gag ctg 2448Asn Gly His Val Cys Cys Ser Val Asp Pro Gln Cys Leu Gln Glu Leu 805 810 815tga 245110816PRTRattus norvegicus 10Met Glu Ser Arg Val Leu Leu Arg Thr Phe Cys Val Ile Leu Gly Leu1 5 10 15Glu Ala Val Trp Gly Leu Gly Val Asp Pro Ser Leu Gln Ile Asp Val 20 25 30Leu Ser Glu Leu Glu Leu Gly Glu Ser Thr Ala Gly Val Arg Gln Val 35 40 45Pro Gly Leu His Asn Gly Thr Lys Ala Phe Leu Phe Gln Asp Ser Pro 50 55 60Arg Ser Ile Lys Ala Pro Ile Ala Thr Ala Glu Arg Phe Phe Gln Lys65 70 75 80Leu Arg Asn Lys His Glu Phe Thr Ile Leu Val Thr Leu Lys Gln Ile 85 90 95His Leu Asn Ser Gly Val Ile Leu Ser Ile His His Leu Asp His Arg 100 105 110Tyr Leu Glu Leu Glu Ser Ser Gly His Arg Asn Glu Ile Arg Leu His 115 120 125Tyr Arg Ser Gly Thr His Arg Pro His Thr Glu Val Phe Pro Tyr Ile 130 135 140Leu Ala Asp Ala Lys Trp His Lys Leu Ser Leu Ala Phe Ser Ala Ser145 150 155 160His Leu Ile Leu His Ile Asp Cys Asn Lys Ile Tyr Glu Arg Val Val 165 170 175Glu Met Pro Ser Thr Asp Leu Pro Leu Gly Thr Thr Phe Trp Leu Gly 180 185 190Gln Arg Asn Asn Ala His Gly Tyr Phe Lys Gly Ile Met Gln Asp Val 195 200 205Gln Leu Leu Val Met Pro Gln Gly Phe Ile Ala Gln Cys Pro Asp Leu 210 215 220Asn Arg Thr Cys Pro Thr Cys Asn Asp Phe His Gly Leu Val Gln Lys225 230 235 240Ile Met Glu Leu Gln Asp Ile Leu Ser Lys Thr Ser Ala Lys Leu Ser 245 250 255Arg Ala Glu Gln Arg Met Asn Arg Leu Asp Gln Cys Tyr Cys Glu Arg 260 265 270Thr Cys Thr Met Lys Gly Ala Thr Tyr Arg Glu Phe Glu Ser Trp Thr 275 280 285Asp Gly Cys Lys Asn Cys Thr Cys Leu Asn Gly Thr Ile Gln Cys Glu 290 295 300Thr Leu Val Cys Pro Ala Pro Asp Cys Pro Ala Lys Ser Ala Pro Ala305 310 315 320Tyr Val Asp Gly Lys Cys Cys Lys Glu Cys Lys Ser Thr Cys Gln Phe 325 330 335Gln Gly Arg Ser Tyr Phe Glu Gly Glu Arg Ser Thr Val Phe Ser Ala 340 345 350Ser Gly Met Cys Val Leu Tyr Glu Cys Lys Asp Gln Thr Met Lys Leu 355 360 365Val Glu Asn Ala Gly Cys Pro Ala Leu Asp Cys Pro Glu Ser His Gln 370 375 380Ile Ala Leu Ser His Ser Cys Cys Lys Val Cys Lys Gly Tyr Asp Phe385 390 395 400Cys Ser Glu Lys His Thr Cys Met Glu Asn Ser Val Cys Arg Asn Leu 405 410 415Asn Asp Arg Ala Val Cys Ser Cys Arg Asp Gly Phe Arg Ala Leu Arg 420 425 430Glu Asp Asn Ala Tyr Cys Glu Asp Ile Asp Glu Cys Ala Glu Gly Arg 435 440 445His Tyr Cys Arg Glu Asn Thr Met Cys Val Asn Thr Pro Gly Ser Phe 450 455 460Leu Cys Ile Cys Gln Thr Gly Tyr Ile Arg Ile Asp Asp Tyr Ser Cys465 470 475 480Thr Glu His Asp Glu Cys Leu Thr Asn Gln His Asn Cys Asp Glu Asn 485 490 495Ala Leu Cys Phe Asn Thr Val Gly Gly His Asn Cys Val Cys Lys Pro 500 505 510Gly Tyr Thr Gly Asn Gly Thr Thr Cys Lys Ala Phe Cys Lys Asp Gly 515 520 525Cys Lys Asn Gly Gly Ala Cys Ile Ala Ala Asn Val Cys Ala Cys Pro 530 535 540Gln Gly Phe Thr Gly Pro Ser Cys Glu Thr Asp Ile Asp Glu Cys Ser545 550 555 560Glu Gly Phe Val Gln Cys Asp Ser Arg Ala Asn Cys Ile Asn Leu Pro 565 570 575Gly Trp Tyr His Cys Glu Cys Arg Asp Gly Tyr His Asp Asn Gly Met 580 585 590Phe Ala Pro Gly Gly Glu Ser Cys Glu Asp Ile Asp Glu Cys Gly Thr 595 600 605Gly Arg His Ser Cys Ala Asn Asp Thr Ile Cys Phe Asn Leu Asp Gly 610 615 620Gly Tyr Asp Cys Arg Cys Pro His Gly Lys Asn Cys Thr Gly Asp Cys625 630 635 640Val His Asp Gly Lys Val Lys His Asn Gly Gln Ile Trp Val Leu Glu 645 650 655Asn Asp Arg Cys Ser Val Cys Ser Cys Gln Thr Gly Phe Val Met Cys 660 665 670Gln Arg Met Val Cys Asp Cys Glu Asn Pro Thr Val Asp Leu Ser Cys 675 680 685Cys Pro Glu Cys Asp Pro Arg Leu Ser Ser Gln Cys Leu His Gln Asn 690 695 700Gly Glu Thr Val Tyr Asn Ser Gly Asp Thr Trp Ala Gln Asp Cys Arg705 710 715 720Gln Cys Arg Cys Leu Gln Glu Glu Val Asp Cys Trp Pro Leu Ala Cys 725 730 735Pro Glu Val Glu Cys Glu Phe Ser Val Leu Pro Glu Asn Glu Cys Cys 740 745 750Pro Arg Cys Val Thr Asp Pro Cys Gln Ala Asp Thr Ile Arg Asn Asp 755 760 765Ile Thr Lys Thr Cys Leu Asp Glu Met Asn Val Val Arg Phe Thr Gly 770 775 780Ser Ser Trp Ile Lys His Gly Thr Glu Cys Thr Leu Cys Gln Cys Lys785 790 795 800Asn Gly His Val Cys Cys Ser Val Asp Pro Gln Cys Leu Gln Glu Leu 805 810 815112460DNAMus musculusCDS(1)..(2457) 11atg cac gcc atg gaa tcc cgg gtg tta ctg aga acg ttc tgc gtg atc 48Met His Ala Met Glu Ser Arg Val Leu Leu Arg Thr Phe Cys Val Ile1 5 10 15ctc ggc ctt gga gcg gtt tgg ggg ctt ggt gtg gac ccc tcc cta cag 96Leu Gly Leu Gly Ala Val Trp Gly Leu Gly Val Asp Pro Ser Leu Gln 20 25 30att gac gtc tta aca gag tta gaa ctt ggg gag tct aca gat gga gtg 144Ile Asp Val Leu Thr Glu Leu Glu Leu Gly Glu Ser Thr Asp Gly Val 35 40 45cgc caa gtc ccg gga ctg cat aat ggg acg aaa gcc ttc ctc ttc caa 192Arg Gln Val Pro Gly Leu His Asn Gly Thr Lys Ala Phe Leu Phe Gln 50 55 60gag tcc ccc aga agc ata aag gca tcc act gct aca gct gag cgg ttt 240Glu Ser Pro Arg Ser Ile Lys Ala Ser Thr Ala Thr Ala Glu Arg Phe65 70 75 80ctc cag aag ctg aga aat aaa cac gag ttc aca atc ttg gtg acc tta 288Leu Gln Lys Leu

Arg Asn Lys His Glu Phe Thr Ile Leu Val Thr Leu 85 90 95aaa cag atc cac tta aat tcg gga gtt atc ctc tcc atc cac cac ttg 336Lys Gln Ile His Leu Asn Ser Gly Val Ile Leu Ser Ile His His Leu 100 105 110gat cac agg tac ctg gaa ctg gaa agc agt ggc cat cgg aat gag atc 384Asp His Arg Tyr Leu Glu Leu Glu Ser Ser Gly His Arg Asn Glu Ile 115 120 125aga ctc cac tac cgc tct ggc act cac cgc ccc cac acg gaa gtg ttt 432Arg Leu His Tyr Arg Ser Gly Thr His Arg Pro His Thr Glu Val Phe 130 135 140cct tat att ttg gct gat gcc aag tgg cac aag ctc tcc tta gcc ttc 480Pro Tyr Ile Leu Ala Asp Ala Lys Trp His Lys Leu Ser Leu Ala Phe145 150 155 160agt gcc tct cac tta att tta cac atc gac tgc aat aag atc tat gaa 528Ser Ala Ser His Leu Ile Leu His Ile Asp Cys Asn Lys Ile Tyr Glu 165 170 175cga gtg gtg gaa atg ccc ttc aca gac ttg gct ctg ggc aca aca ttt 576Arg Val Val Glu Met Pro Phe Thr Asp Leu Ala Leu Gly Thr Thr Phe 180 185 190tgg ttg gga cag aga aat aat gca cat ggc tat ttt aag gga ata atg 624Trp Leu Gly Gln Arg Asn Asn Ala His Gly Tyr Phe Lys Gly Ile Met 195 200 205cag gat gtg cac gtc ctt gtc atg cct cag ggc ttc att gct cag tgc 672Gln Asp Val His Val Leu Val Met Pro Gln Gly Phe Ile Ala Gln Cys 210 215 220ccg gac ctt aat cga acc tgt cca aca tgc aac gac ttc cat ggg ctt 720Pro Asp Leu Asn Arg Thr Cys Pro Thr Cys Asn Asp Phe His Gly Leu225 230 235 240gtg cag aaa atc atg gag ctg cag gac att tta tca aag acg tca gcc 768Val Gln Lys Ile Met Glu Leu Gln Asp Ile Leu Ser Lys Thr Ser Ala 245 250 255aag ctg tcc cga gct gaa caa aga atg aac agg ctg gat cag tgc tac 816Lys Leu Ser Arg Ala Glu Gln Arg Met Asn Arg Leu Asp Gln Cys Tyr 260 265 270tgt gag cgg aca tgc act gtg aag gga acc acc tac cga gag tct gag 864Cys Glu Arg Thr Cys Thr Val Lys Gly Thr Thr Tyr Arg Glu Ser Glu 275 280 285tcc tgg aca gac ggc tgt aag aac tgc aca tgc ttg aac ggg acc atc 912Ser Trp Thr Asp Gly Cys Lys Asn Cys Thr Cys Leu Asn Gly Thr Ile 290 295 300cag tgc gag act ctg gtc tgc cct gct cct gac tgc cct cct aaa tcg 960Gln Cys Glu Thr Leu Val Cys Pro Ala Pro Asp Cys Pro Pro Lys Ser305 310 315 320gcc cct gcg tat gtg gat ggc aag tgc tgt aag gag tgc aaa tca acc 1008Ala Pro Ala Tyr Val Asp Gly Lys Cys Cys Lys Glu Cys Lys Ser Thr 325 330 335tgc cag ttc cag gga cgg agc tac ttt gag gga gaa agg aac acg gca 1056Cys Gln Phe Gln Gly Arg Ser Tyr Phe Glu Gly Glu Arg Asn Thr Ala 340 345 350tac tca tct tct gga atg tgt gtc tta tat gaa tgc aag gat cag acc 1104Tyr Ser Ser Ser Gly Met Cys Val Leu Tyr Glu Cys Lys Asp Gln Thr 355 360 365atg aag ctt gtt gag aac att ggc tgc cca ccc tta gat tgt ccc gag 1152Met Lys Leu Val Glu Asn Ile Gly Cys Pro Pro Leu Asp Cys Pro Glu 370 375 380tct cat cag att gcc ttg tct cac agc tgc tgc aag gtt tgt aaa ggt 1200Ser His Gln Ile Ala Leu Ser His Ser Cys Cys Lys Val Cys Lys Gly385 390 395 400tat gac ttc tgt tct gag aag cat acc tgc atg gag aac tcg gtc tgc 1248Tyr Asp Phe Cys Ser Glu Lys His Thr Cys Met Glu Asn Ser Val Cys 405 410 415agg aac ctg aac gac agg gtt gtg tgc agc tgc agg gat ggt ttt cgg 1296Arg Asn Leu Asn Asp Arg Val Val Cys Ser Cys Arg Asp Gly Phe Arg 420 425 430gct ctc cga gag gac aac gcc tac tgt gaa gac att gac gag tgt gca 1344Ala Leu Arg Glu Asp Asn Ala Tyr Cys Glu Asp Ile Asp Glu Cys Ala 435 440 445gaa ggg cgc cat tac tgc cgt gag aac acc atg tgt gtg aat aca cct 1392Glu Gly Arg His Tyr Cys Arg Glu Asn Thr Met Cys Val Asn Thr Pro 450 455 460ggt tct ttc atg tgt gtc tgc aaa act ggg tac atc agg atc gac gat 1440Gly Ser Phe Met Cys Val Cys Lys Thr Gly Tyr Ile Arg Ile Asp Asp465 470 475 480tac tca tgt aca gaa cat gat gag tgt ctc aca acc cag cac aat tgt 1488Tyr Ser Cys Thr Glu His Asp Glu Cys Leu Thr Thr Gln His Asn Cys 485 490 495gat gaa aac gct ttg tgc ttt aac act gtt gga gga cac aac tgt gtc 1536Asp Glu Asn Ala Leu Cys Phe Asn Thr Val Gly Gly His Asn Cys Val 500 505 510tgc aag cct ggc tac acc ggg aat gga acc acg tgc aaa gct ttc tgc 1584Cys Lys Pro Gly Tyr Thr Gly Asn Gly Thr Thr Cys Lys Ala Phe Cys 515 520 525aaa gat ggc tgt aga aac gga gga gcg tgc att gct gcc aat gtg tgt 1632Lys Asp Gly Cys Arg Asn Gly Gly Ala Cys Ile Ala Ala Asn Val Cys 530 535 540gcc tgc cca caa ggc ttc acg gga ccc agc tgt gag aca gac att gac 1680Ala Cys Pro Gln Gly Phe Thr Gly Pro Ser Cys Glu Thr Asp Ile Asp545 550 555 560gag tgc tct gag ggc ttt gtt cag tgt gac agc cgt gcc aac tgc atc 1728Glu Cys Ser Glu Gly Phe Val Gln Cys Asp Ser Arg Ala Asn Cys Ile 565 570 575aac ctg cct ggg tgg tat cac tgt gag tgc aga gac ggc tac cat gac 1776Asn Leu Pro Gly Trp Tyr His Cys Glu Cys Arg Asp Gly Tyr His Asp 580 585 590aat ggg atg ttt gcg cca ggc gga gaa tcc tgt gaa gat att gac gaa 1824Asn Gly Met Phe Ala Pro Gly Gly Glu Ser Cys Glu Asp Ile Asp Glu 595 600 605tgc ggg act ggg agg cac agc tgc acc aac gac acc att tgc ttc aac 1872Cys Gly Thr Gly Arg His Ser Cys Thr Asn Asp Thr Ile Cys Phe Asn 610 615 620ttg gac ggg gga tac gat tgc cgg tgt ccc cat ggg aag aac tgc act 1920Leu Asp Gly Gly Tyr Asp Cys Arg Cys Pro His Gly Lys Asn Cys Thr625 630 635 640ggg gac tgc gtg cac gag ggg aaa gtg aag cac acc ggc cag atc tgg 1968Gly Asp Cys Val His Glu Gly Lys Val Lys His Thr Gly Gln Ile Trp 645 650 655gtg ctg gaa aac gac agg tgc tcc gtg tgt tcc tgg cag act ggg ttt 2016Val Leu Glu Asn Asp Arg Cys Ser Val Cys Ser Trp Gln Thr Gly Phe 660 665 670gtc atg tgt cga cgg atg gtc tgc gac tgc gaa aac ccc aca gat gac 2064Val Met Cys Arg Arg Met Val Cys Asp Cys Glu Asn Pro Thr Asp Asp 675 680 685ctt tcc tgc tgc cct gag tgt gac cca agg ctg agc agt cag tgc ctg 2112Leu Ser Cys Cys Pro Glu Cys Asp Pro Arg Leu Ser Ser Gln Cys Leu 690 695 700cat caa aac ggg gaa acc gtg tac aac agc ggc gac acc tgg gtc cag 2160His Gln Asn Gly Glu Thr Val Tyr Asn Ser Gly Asp Thr Trp Val Gln705 710 715 720gat tgc cgt cag tgc cgc tgc ttg caa gga gaa gtt gac tgt tgg ccc 2208Asp Cys Arg Gln Cys Arg Cys Leu Gln Gly Glu Val Asp Cys Trp Pro 725 730 735ctg gct tgc cca gag gta gaa tgt gaa ttt agc gtc ctt cct gag aac 2256Leu Ala Cys Pro Glu Val Glu Cys Glu Phe Ser Val Leu Pro Glu Asn 740 745 750gag tgc tgc cca cgc tgt gtc acc gat cct tgt cag gcc gac acc atc 2304Glu Cys Cys Pro Arg Cys Val Thr Asp Pro Cys Gln Ala Asp Thr Ile 755 760 765cgc aat gac atc acc aaa acc tgc ctg gac gag atg aac gtg gtt cgc 2352Arg Asn Asp Ile Thr Lys Thr Cys Leu Asp Glu Met Asn Val Val Arg 770 775 780ttc acc ggg tct tcc tgg atc aag cac ggc acg gag tgt acc ctc tgc 2400Phe Thr Gly Ser Ser Trp Ile Lys His Gly Thr Glu Cys Thr Leu Cys785 790 795 800cag tgc aag aat ggc cat ttg tgc tgc tca gtg gat cca cag tgc ctt 2448Gln Cys Lys Asn Gly His Leu Cys Cys Ser Val Asp Pro Gln Cys Leu 805 810 815cag gag ctg tga 2460Gln Glu Leu12819PRTMus musculus 12Met His Ala Met Glu Ser Arg Val Leu Leu Arg Thr Phe Cys Val Ile1 5 10 15Leu Gly Leu Gly Ala Val Trp Gly Leu Gly Val Asp Pro Ser Leu Gln 20 25 30Ile Asp Val Leu Thr Glu Leu Glu Leu Gly Glu Ser Thr Asp Gly Val 35 40 45Arg Gln Val Pro Gly Leu His Asn Gly Thr Lys Ala Phe Leu Phe Gln 50 55 60Glu Ser Pro Arg Ser Ile Lys Ala Ser Thr Ala Thr Ala Glu Arg Phe65 70 75 80Leu Gln Lys Leu Arg Asn Lys His Glu Phe Thr Ile Leu Val Thr Leu 85 90 95Lys Gln Ile His Leu Asn Ser Gly Val Ile Leu Ser Ile His His Leu 100 105 110Asp His Arg Tyr Leu Glu Leu Glu Ser Ser Gly His Arg Asn Glu Ile 115 120 125Arg Leu His Tyr Arg Ser Gly Thr His Arg Pro His Thr Glu Val Phe 130 135 140Pro Tyr Ile Leu Ala Asp Ala Lys Trp His Lys Leu Ser Leu Ala Phe145 150 155 160Ser Ala Ser His Leu Ile Leu His Ile Asp Cys Asn Lys Ile Tyr Glu 165 170 175Arg Val Val Glu Met Pro Phe Thr Asp Leu Ala Leu Gly Thr Thr Phe 180 185 190Trp Leu Gly Gln Arg Asn Asn Ala His Gly Tyr Phe Lys Gly Ile Met 195 200 205Gln Asp Val His Val Leu Val Met Pro Gln Gly Phe Ile Ala Gln Cys 210 215 220Pro Asp Leu Asn Arg Thr Cys Pro Thr Cys Asn Asp Phe His Gly Leu225 230 235 240Val Gln Lys Ile Met Glu Leu Gln Asp Ile Leu Ser Lys Thr Ser Ala 245 250 255Lys Leu Ser Arg Ala Glu Gln Arg Met Asn Arg Leu Asp Gln Cys Tyr 260 265 270Cys Glu Arg Thr Cys Thr Val Lys Gly Thr Thr Tyr Arg Glu Ser Glu 275 280 285Ser Trp Thr Asp Gly Cys Lys Asn Cys Thr Cys Leu Asn Gly Thr Ile 290 295 300Gln Cys Glu Thr Leu Val Cys Pro Ala Pro Asp Cys Pro Pro Lys Ser305 310 315 320Ala Pro Ala Tyr Val Asp Gly Lys Cys Cys Lys Glu Cys Lys Ser Thr 325 330 335Cys Gln Phe Gln Gly Arg Ser Tyr Phe Glu Gly Glu Arg Asn Thr Ala 340 345 350Tyr Ser Ser Ser Gly Met Cys Val Leu Tyr Glu Cys Lys Asp Gln Thr 355 360 365Met Lys Leu Val Glu Asn Ile Gly Cys Pro Pro Leu Asp Cys Pro Glu 370 375 380Ser His Gln Ile Ala Leu Ser His Ser Cys Cys Lys Val Cys Lys Gly385 390 395 400Tyr Asp Phe Cys Ser Glu Lys His Thr Cys Met Glu Asn Ser Val Cys 405 410 415Arg Asn Leu Asn Asp Arg Val Val Cys Ser Cys Arg Asp Gly Phe Arg 420 425 430Ala Leu Arg Glu Asp Asn Ala Tyr Cys Glu Asp Ile Asp Glu Cys Ala 435 440 445Glu Gly Arg His Tyr Cys Arg Glu Asn Thr Met Cys Val Asn Thr Pro 450 455 460Gly Ser Phe Met Cys Val Cys Lys Thr Gly Tyr Ile Arg Ile Asp Asp465 470 475 480Tyr Ser Cys Thr Glu His Asp Glu Cys Leu Thr Thr Gln His Asn Cys 485 490 495Asp Glu Asn Ala Leu Cys Phe Asn Thr Val Gly Gly His Asn Cys Val 500 505 510Cys Lys Pro Gly Tyr Thr Gly Asn Gly Thr Thr Cys Lys Ala Phe Cys 515 520 525Lys Asp Gly Cys Arg Asn Gly Gly Ala Cys Ile Ala Ala Asn Val Cys 530 535 540Ala Cys Pro Gln Gly Phe Thr Gly Pro Ser Cys Glu Thr Asp Ile Asp545 550 555 560Glu Cys Ser Glu Gly Phe Val Gln Cys Asp Ser Arg Ala Asn Cys Ile 565 570 575Asn Leu Pro Gly Trp Tyr His Cys Glu Cys Arg Asp Gly Tyr His Asp 580 585 590Asn Gly Met Phe Ala Pro Gly Gly Glu Ser Cys Glu Asp Ile Asp Glu 595 600 605Cys Gly Thr Gly Arg His Ser Cys Thr Asn Asp Thr Ile Cys Phe Asn 610 615 620Leu Asp Gly Gly Tyr Asp Cys Arg Cys Pro His Gly Lys Asn Cys Thr625 630 635 640Gly Asp Cys Val His Glu Gly Lys Val Lys His Thr Gly Gln Ile Trp 645 650 655Val Leu Glu Asn Asp Arg Cys Ser Val Cys Ser Trp Gln Thr Gly Phe 660 665 670Val Met Cys Arg Arg Met Val Cys Asp Cys Glu Asn Pro Thr Asp Asp 675 680 685Leu Ser Cys Cys Pro Glu Cys Asp Pro Arg Leu Ser Ser Gln Cys Leu 690 695 700His Gln Asn Gly Glu Thr Val Tyr Asn Ser Gly Asp Thr Trp Val Gln705 710 715 720Asp Cys Arg Gln Cys Arg Cys Leu Gln Gly Glu Val Asp Cys Trp Pro 725 730 735Leu Ala Cys Pro Glu Val Glu Cys Glu Phe Ser Val Leu Pro Glu Asn 740 745 750Glu Cys Cys Pro Arg Cys Val Thr Asp Pro Cys Gln Ala Asp Thr Ile 755 760 765Arg Asn Asp Ile Thr Lys Thr Cys Leu Asp Glu Met Asn Val Val Arg 770 775 780Phe Thr Gly Ser Ser Trp Ile Lys His Gly Thr Glu Cys Thr Leu Cys785 790 795 800Gln Cys Lys Asn Gly His Leu Cys Cys Ser Val Asp Pro Gln Cys Leu 805 810 815Gln Glu Leu132453DNAGallus gallusCDS(1)..(2448) 13atg gag tcc ggc tgc ggc tta ggc acg ctt tgc ctt ctc ctc tgc ctg 48Met Glu Ser Gly Cys Gly Leu Gly Thr Leu Cys Leu Leu Leu Cys Leu1 5 10 15ggg cca gtc gta ggc ttc ggc gtg gac ccc tcg ctg cag atc gac gtg 96Gly Pro Val Val Gly Phe Gly Val Asp Pro Ser Leu Gln Ile Asp Val 20 25 30ctg tcc gag ctg ggg ctg ccg ggc tac gcg gcg ggc gtg cgc cag gtg 144Leu Ser Glu Leu Gly Leu Pro Gly Tyr Ala Ala Gly Val Arg Gln Val 35 40 45ccg ggg ctg cac aac ggg agc aaa gcc ttc ctc ttc cca gat act tca 192Pro Gly Leu His Asn Gly Ser Lys Ala Phe Leu Phe Pro Asp Thr Ser 50 55 60aga agt gta aag gcg tct cca gaa aca gct gaa atc ttt ttt cag aag 240Arg Ser Val Lys Ala Ser Pro Glu Thr Ala Glu Ile Phe Phe Gln Lys65 70 75 80ttg aga aat aaa tat gaa ttc aca atc ctg gtg acc tta aaa caa gcc 288Leu Arg Asn Lys Tyr Glu Phe Thr Ile Leu Val Thr Leu Lys Gln Ala 85 90 95cat tta aat tca ggg gtt att ttc tct att cat cac tta gat cac agg 336His Leu Asn Ser Gly Val Ile Phe Ser Ile His His Leu Asp His Arg 100 105 110tat ctg gaa ttg gaa agc agc ggt cat cga aat gaa atc agg ttg cat 384Tyr Leu Glu Leu Glu Ser Ser Gly His Arg Asn Glu Ile Arg Leu His 115 120 125tac cgt aca ggc agt cat cgc tcc cac aca gaa gta ttc cca tac atc 432Tyr Arg Thr Gly Ser His Arg Ser His Thr Glu Val Phe Pro Tyr Ile 130 135 140ctg gca gac gat aag tgg cac agg ctt tcc tta gca atc agt gcc tct 480Leu Ala Asp Asp Lys Trp His Arg Leu Ser Leu Ala Ile Ser Ala Ser145 150 155 160cac ttg att tta cac gtg gac tgc aat aaa atc tat gaa aga gtt gtg 528His Leu Ile Leu His Val Asp Cys Asn Lys Ile Tyr Glu Arg Val Val 165 170 175gag aag ccc ttc atg gac tta cct gtg ggt aca acc ttt tgg cta gga 576Glu Lys Pro Phe Met Asp Leu Pro Val Gly Thr Thr Phe Trp Leu Gly 180 185 190cag agg aat aat gca cac ggt tat ttt aag ggc ata atg caa gat gtg 624Gln Arg Asn Asn Ala His Gly Tyr Phe Lys Gly Ile Met Gln Asp Val 195 200 205caa tta ctt gtc atg cct caa gga ttt att tct cag tgc cca gat ctt 672Gln Leu Leu Val Met Pro Gln Gly Phe Ile Ser Gln Cys Pro Asp Leu 210 215 220aat cgg aca tgc cca act tgt aat gat ttc cat gga ctt gtg cag aaa 720Asn Arg Thr Cys Pro Thr Cys Asn Asp Phe His Gly Leu Val Gln Lys225 230 235 240att atg gaa ctg caa gac att tta gct aaa acg tca gct aag ctg tcg 768Ile Met Glu Leu Gln Asp Ile Leu Ala Lys Thr Ser Ala Lys Leu Ser 245 250 255caa gct gag cag agg atg aac aag ttg gat cag tgc tat tgt gaa agg 816Gln Ala Glu Gln Arg Met Asn Lys Leu Asp Gln Cys Tyr Cys Glu Arg 260 265 270acc tgc aca atg aaa ggc atg aca tac aga gaa ttt gaa tcc tgg aca 864Thr Cys Thr Met Lys Gly Met Thr Tyr Arg Glu Phe Glu Ser Trp Thr 275 280 285gat ggt tgt aag aac tgc act

tgc atg aat ggc act gtg cag tgt gaa 912Asp Gly Cys Lys Asn Cys Thr Cys Met Asn Gly Thr Val Gln Cys Glu 290 295 300gct ttg att tgc tcc ctc tct gac tgt cca cct aat tct gcc ctg tca 960Ala Leu Ile Cys Ser Leu Ser Asp Cys Pro Pro Asn Ser Ala Leu Ser305 310 315 320tac gtg gat ggc aag tgc tgc aaa gaa tgt caa tcg gtg tgc ata ttt 1008Tyr Val Asp Gly Lys Cys Cys Lys Glu Cys Gln Ser Val Cys Ile Phe 325 330 335gaa ggc aga acc tac ttt gaa gga caa aga gaa acg gtg tat tca agc 1056Glu Gly Arg Thr Tyr Phe Glu Gly Gln Arg Glu Thr Val Tyr Ser Ser 340 345 350tca ggg gac tgt gtt ctg ttt gag tgc aag gac cac aaa atg cag cgt 1104Ser Gly Asp Cys Val Leu Phe Glu Cys Lys Asp His Lys Met Gln Arg 355 360 365att cca aaa gac agt tgt gca act ttg aac tgc ccg gaa tct caa cag 1152Ile Pro Lys Asp Ser Cys Ala Thr Leu Asn Cys Pro Glu Ser Gln Gln 370 375 380atc cca tta tct cac agt tgc tgc aaa atc tgt aaa ggc cat gac ttt 1200Ile Pro Leu Ser His Ser Cys Cys Lys Ile Cys Lys Gly His Asp Phe385 390 395 400tgc act gaa gga cat aac tgt atg gag cat tct gtc tgc cga aac cta 1248Cys Thr Glu Gly His Asn Cys Met Glu His Ser Val Cys Arg Asn Leu 405 410 415gat gac aga gct gtc tgt agc tgc cga gat ggc ttc cgg gcc ctt cgg 1296Asp Asp Arg Ala Val Cys Ser Cys Arg Asp Gly Phe Arg Ala Leu Arg 420 425 430gag gac aat gcc tac tgt gaa gat gtt gat gag tgt gcc gag ggg cag 1344Glu Asp Asn Ala Tyr Cys Glu Asp Val Asp Glu Cys Ala Glu Gly Gln 435 440 445cac tac tgt cgg gag aac acc atg tgt gta aat aca cca gga tcc ttc 1392His Tyr Cys Arg Glu Asn Thr Met Cys Val Asn Thr Pro Gly Ser Phe 450 455 460atg tgc atc tgc aaa aca gga tat ata cgc att gat gac tat tca tgt 1440Met Cys Ile Cys Lys Thr Gly Tyr Ile Arg Ile Asp Asp Tyr Ser Cys465 470 475 480aca gag cac gat gaa tgt gta aca aac cag cac aac tgt gat gaa aat 1488Thr Glu His Asp Glu Cys Val Thr Asn Gln His Asn Cys Asp Glu Asn 485 490 495gcg cta tgt ttc aac acg gtg ggt ggg cac aac tgt gtc tgc aag ctg 1536Ala Leu Cys Phe Asn Thr Val Gly Gly His Asn Cys Val Cys Lys Leu 500 505 510ggt tac aca gga aat ggg acg gtg tgt aaa gca ttt tgc aaa gat ggg 1584Gly Tyr Thr Gly Asn Gly Thr Val Cys Lys Ala Phe Cys Lys Asp Gly 515 520 525tgc agg aat gga gga gcc tgt att gct tcc aac gtg tgt gcc tgc cca 1632Cys Arg Asn Gly Gly Ala Cys Ile Ala Ser Asn Val Cys Ala Cys Pro 530 535 540caa ggc ttc act ggc ccc agc tgt gaa act gac att gat gaa tgc tct 1680Gln Gly Phe Thr Gly Pro Ser Cys Glu Thr Asp Ile Asp Glu Cys Ser545 550 555 560gat ggc ttt gtg cag tgt gac agc cgt gct aat tgc atc aat ctg cca 1728Asp Gly Phe Val Gln Cys Asp Ser Arg Ala Asn Cys Ile Asn Leu Pro 565 570 575ggg tgg tac cac tgt gaa tgc agg gat ggc tac cat gac aat ggg atg 1776Gly Trp Tyr His Cys Glu Cys Arg Asp Gly Tyr His Asp Asn Gly Met 580 585 590ttt tca cca agt gga gaa tcc tgt gaa gac att gat gaa tgt gca act 1824Phe Ser Pro Ser Gly Glu Ser Cys Glu Asp Ile Asp Glu Cys Ala Thr 595 600 605gga agg cat agc tgt gcc aat gac act gtt tgc ttt aac ctg gat ggt 1872Gly Arg His Ser Cys Ala Asn Asp Thr Val Cys Phe Asn Leu Asp Gly 610 615 620ggg tat gac tgt cga tgt cca cat ggc aag aac tgc aca gga gac tgt 1920Gly Tyr Asp Cys Arg Cys Pro His Gly Lys Asn Cys Thr Gly Asp Cys625 630 635 640atc cat gaa gac aaa atc aag cac aat ggt cag att tgg gtg ctg gag 1968Ile His Glu Asp Lys Ile Lys His Asn Gly Gln Ile Trp Val Leu Glu 645 650 655aac gac aga tgc tct gtc tgc tca tgc cag agt gga tac gtg atg tgc 2016Asn Asp Arg Cys Ser Val Cys Ser Cys Gln Ser Gly Tyr Val Met Cys 660 665 670cgg cga atg gtc tgt gac tgt gaa aat ccc act gtt gac ctc ttt tgc 2064Arg Arg Met Val Cys Asp Cys Glu Asn Pro Thr Val Asp Leu Phe Cys 675 680 685tgt cct gag tgt gac cca agg ctc agc agt caa tgt tta cat cag agt 2112Cys Pro Glu Cys Asp Pro Arg Leu Ser Ser Gln Cys Leu His Gln Ser 690 695 700ggg gag ctt tcc tac aac agt ggt gac tcc tgg ata caa aac tgt cag 2160Gly Glu Leu Ser Tyr Asn Ser Gly Asp Ser Trp Ile Gln Asn Cys Gln705 710 715 720cag tgt cgc tgc ttg caa gga gag gtt gac tgt tgg ccc tta ccg tgc 2208Gln Cys Arg Cys Leu Gln Gly Glu Val Asp Cys Trp Pro Leu Pro Cys 725 730 735cca gag gta gac tgt gag ttc agt gtc ctc cct gag aat gag tgc tgc 2256Pro Glu Val Asp Cys Glu Phe Ser Val Leu Pro Glu Asn Glu Cys Cys 740 745 750cca cgc tgt gtc act gac ccc tgc caa gcg gac acc atc cgt aat gac 2304Pro Arg Cys Val Thr Asp Pro Cys Gln Ala Asp Thr Ile Arg Asn Asp 755 760 765atc acc aaa acc tgc ctg gat gaa acc aat gtt gtt cgc ttc act gga 2352Ile Thr Lys Thr Cys Leu Asp Glu Thr Asn Val Val Arg Phe Thr Gly 770 775 780tct tct tgg att aag cat ggc aca gag tgc aca ctc tgc caa tgt aag 2400Ser Ser Trp Ile Lys His Gly Thr Glu Cys Thr Leu Cys Gln Cys Lys785 790 795 800aat ggc cac gtc tgt tgc tca gtg gat cca cag tgc ctt cag gaa ctg 2448Asn Gly His Val Cys Cys Ser Val Asp Pro Gln Cys Leu Gln Glu Leu 805 810 815tgaca 245314816PRTGallus gallus 14Met Glu Ser Gly Cys Gly Leu Gly Thr Leu Cys Leu Leu Leu Cys Leu1 5 10 15Gly Pro Val Val Gly Phe Gly Val Asp Pro Ser Leu Gln Ile Asp Val 20 25 30Leu Ser Glu Leu Gly Leu Pro Gly Tyr Ala Ala Gly Val Arg Gln Val 35 40 45Pro Gly Leu His Asn Gly Ser Lys Ala Phe Leu Phe Pro Asp Thr Ser 50 55 60Arg Ser Val Lys Ala Ser Pro Glu Thr Ala Glu Ile Phe Phe Gln Lys65 70 75 80Leu Arg Asn Lys Tyr Glu Phe Thr Ile Leu Val Thr Leu Lys Gln Ala 85 90 95His Leu Asn Ser Gly Val Ile Phe Ser Ile His His Leu Asp His Arg 100 105 110Tyr Leu Glu Leu Glu Ser Ser Gly His Arg Asn Glu Ile Arg Leu His 115 120 125Tyr Arg Thr Gly Ser His Arg Ser His Thr Glu Val Phe Pro Tyr Ile 130 135 140Leu Ala Asp Asp Lys Trp His Arg Leu Ser Leu Ala Ile Ser Ala Ser145 150 155 160His Leu Ile Leu His Val Asp Cys Asn Lys Ile Tyr Glu Arg Val Val 165 170 175Glu Lys Pro Phe Met Asp Leu Pro Val Gly Thr Thr Phe Trp Leu Gly 180 185 190Gln Arg Asn Asn Ala His Gly Tyr Phe Lys Gly Ile Met Gln Asp Val 195 200 205Gln Leu Leu Val Met Pro Gln Gly Phe Ile Ser Gln Cys Pro Asp Leu 210 215 220Asn Arg Thr Cys Pro Thr Cys Asn Asp Phe His Gly Leu Val Gln Lys225 230 235 240Ile Met Glu Leu Gln Asp Ile Leu Ala Lys Thr Ser Ala Lys Leu Ser 245 250 255Gln Ala Glu Gln Arg Met Asn Lys Leu Asp Gln Cys Tyr Cys Glu Arg 260 265 270Thr Cys Thr Met Lys Gly Met Thr Tyr Arg Glu Phe Glu Ser Trp Thr 275 280 285Asp Gly Cys Lys Asn Cys Thr Cys Met Asn Gly Thr Val Gln Cys Glu 290 295 300Ala Leu Ile Cys Ser Leu Ser Asp Cys Pro Pro Asn Ser Ala Leu Ser305 310 315 320Tyr Val Asp Gly Lys Cys Cys Lys Glu Cys Gln Ser Val Cys Ile Phe 325 330 335Glu Gly Arg Thr Tyr Phe Glu Gly Gln Arg Glu Thr Val Tyr Ser Ser 340 345 350Ser Gly Asp Cys Val Leu Phe Glu Cys Lys Asp His Lys Met Gln Arg 355 360 365Ile Pro Lys Asp Ser Cys Ala Thr Leu Asn Cys Pro Glu Ser Gln Gln 370 375 380Ile Pro Leu Ser His Ser Cys Cys Lys Ile Cys Lys Gly His Asp Phe385 390 395 400Cys Thr Glu Gly His Asn Cys Met Glu His Ser Val Cys Arg Asn Leu 405 410 415Asp Asp Arg Ala Val Cys Ser Cys Arg Asp Gly Phe Arg Ala Leu Arg 420 425 430Glu Asp Asn Ala Tyr Cys Glu Asp Val Asp Glu Cys Ala Glu Gly Gln 435 440 445His Tyr Cys Arg Glu Asn Thr Met Cys Val Asn Thr Pro Gly Ser Phe 450 455 460Met Cys Ile Cys Lys Thr Gly Tyr Ile Arg Ile Asp Asp Tyr Ser Cys465 470 475 480Thr Glu His Asp Glu Cys Val Thr Asn Gln His Asn Cys Asp Glu Asn 485 490 495Ala Leu Cys Phe Asn Thr Val Gly Gly His Asn Cys Val Cys Lys Leu 500 505 510Gly Tyr Thr Gly Asn Gly Thr Val Cys Lys Ala Phe Cys Lys Asp Gly 515 520 525Cys Arg Asn Gly Gly Ala Cys Ile Ala Ser Asn Val Cys Ala Cys Pro 530 535 540Gln Gly Phe Thr Gly Pro Ser Cys Glu Thr Asp Ile Asp Glu Cys Ser545 550 555 560Asp Gly Phe Val Gln Cys Asp Ser Arg Ala Asn Cys Ile Asn Leu Pro 565 570 575Gly Trp Tyr His Cys Glu Cys Arg Asp Gly Tyr His Asp Asn Gly Met 580 585 590Phe Ser Pro Ser Gly Glu Ser Cys Glu Asp Ile Asp Glu Cys Ala Thr 595 600 605Gly Arg His Ser Cys Ala Asn Asp Thr Val Cys Phe Asn Leu Asp Gly 610 615 620Gly Tyr Asp Cys Arg Cys Pro His Gly Lys Asn Cys Thr Gly Asp Cys625 630 635 640Ile His Glu Asp Lys Ile Lys His Asn Gly Gln Ile Trp Val Leu Glu 645 650 655Asn Asp Arg Cys Ser Val Cys Ser Cys Gln Ser Gly Tyr Val Met Cys 660 665 670Arg Arg Met Val Cys Asp Cys Glu Asn Pro Thr Val Asp Leu Phe Cys 675 680 685Cys Pro Glu Cys Asp Pro Arg Leu Ser Ser Gln Cys Leu His Gln Ser 690 695 700Gly Glu Leu Ser Tyr Asn Ser Gly Asp Ser Trp Ile Gln Asn Cys Gln705 710 715 720Gln Cys Arg Cys Leu Gln Gly Glu Val Asp Cys Trp Pro Leu Pro Cys 725 730 735Pro Glu Val Asp Cys Glu Phe Ser Val Leu Pro Glu Asn Glu Cys Cys 740 745 750Pro Arg Cys Val Thr Asp Pro Cys Gln Ala Asp Thr Ile Arg Asn Asp 755 760 765Ile Thr Lys Thr Cys Leu Asp Glu Thr Asn Val Val Arg Phe Thr Gly 770 775 780Ser Ser Trp Ile Lys His Gly Thr Glu Cys Thr Leu Cys Gln Cys Lys785 790 795 800Asn Gly His Val Cys Cys Ser Val Asp Pro Gln Cys Leu Gln Glu Leu 805 810 8151524PRTHomo sapiens 15Met Ala Val Met Ala Pro Arg Thr Leu Val Leu Leu Leu Ser Gly Ala1 5 10 15Leu Ala Leu Thr Gln Thr Trp Ala 201624PRTHomo sapiens 16Met Ala Val Met Ala Pro Arg Thr Leu Leu Leu Leu Leu Ser Gly Ala1 5 10 15Leu Ala Leu Thr Gln Thr Trp Ala 201724PRTHomo sapiens 17Met Ala Val Met Ala Pro Arg Thr Leu Val Leu Leu Leu Ser Gly Ala1 5 10 15Leu Ala Leu Thr Gln Thr Trp Ala 201824PRTHomo sapiens 18Met Ala Val Met Ala Pro Arg Thr Leu Val Leu Leu Leu Ser Gly Ala1 5 10 15Leu Ala Leu Thr Gln Thr Trp Ala 201924PRTHomo sapiens 19Met Ala Val Met Ala Pro Arg Thr Leu Leu Leu Leu Leu Ser Gly Ala1 5 10 15Leu Ala Leu Thr His Thr Trp Ala 202024PRTHomo sapiens 20Met Ala Val Met Ala Pro Arg Thr Leu Leu Leu Leu Leu Leu Gly Ala1 5 10 15Leu Ala Leu Thr Gln Thr Trp Ala 202124PRTHomo sapiens 21Met Ala Val Met Ala Pro Arg Thr Leu Leu Leu Leu Leu Leu Gly Ala1 5 10 15Leu Ala Leu Thr Gln Thr Trp Ala 202224PRTHomo sapiens 22Met Ala Val Met Ala Pro Arg Thr Leu Val Leu Leu Leu Ser Gly Ala1 5 10 15Leu Ala Leu Thr Gln Thr Trp Ala 202324PRTHomo sapiens 23Met Ala Val Met Pro Pro Arg Thr Leu Leu Leu Leu Leu Ser Gly Ala1 5 10 15Leu Ala Leu Thr Gln Thr Trp Ala 202424PRTHomo sapiens 24Met Leu Val Met Ala Pro Arg Thr Val Leu Leu Leu Leu Ser Ala Ala1 5 10 15Leu Ala Leu Thr Glu Thr Trp Ala 202524PRTHomo sapiens 25Met Arg Val Thr Ala Pro Arg Thr Val Leu Leu Leu Leu Ser Gly Ala1 5 10 15Leu Ala Leu Thr Glu Thr Trp Ala 202624PRTHomo sapiens 26Met Arg Val Thr Ala Pro Arg Thr Leu Leu Leu Leu Leu Trp Gly Ala1 5 10 15Val Ala Leu Thr Glu Thr Trp Ala 202724PRTHomo sapiens 27Met Arg Val Thr Ala Pro Arg Thr Leu Leu Leu Leu Leu Trp Gly Ala1 5 10 15Val Ala Leu Thr Glu Thr Trp Ala 202824PRTHomo sapiens 28Met Arg Val Thr Ala Pro Arg Thr Leu Leu Leu Leu Leu Trp Gly Ala1 5 10 15Val Ala Leu Thr Glu Thr Trp Ala 202924PRTHomo sapiens 29Met Leu Val Met Ala Pro Arg Thr Val Leu Leu Leu Leu Ser Ala Ala1 5 10 15Leu Ala Leu Thr Glu Thr Trp Ala 203024PRTHomo sapiens 30Met Arg Val Thr Ala Pro Arg Thr Val Leu Leu Leu Leu Trp Gly Ala1 5 10 15Val Ala Leu Thr Glu Thr Trp Ala 203124PRTHomo sapiens 31Met Arg Val Thr Ala Pro Arg Thr Leu Leu Leu Leu Leu Trp Gly Ala1 5 10 15Leu Ala Leu Thr Glu Thr Trp Ala 203224PRTHomo sapiens 32Met Arg Val Thr Ala Pro Arg Thr Val Leu Leu Leu Leu Trp Gly Ala1 5 10 15Val Ala Leu Thr Glu Thr Trp Ala 203324PRTHomo sapiens 33Met Arg Val Met Ala Pro Arg Thr Leu Ile Leu Leu Leu Ser Gly Ala1 5 10 15Leu Ala Leu Thr Glu Thr Trp Ala 203424PRTHomo sapiens 34Met Arg Val Met Ala Pro Arg Thr Leu Ile Leu Leu Leu Ser Gly Ala1 5 10 15Leu Ala Leu Thr Glu Thr Trp Ala 203524PRTHomo sapiens 35Met Arg Val Met Ala Pro Arg Thr Leu Ile Leu Leu Leu Ser Gly Ala1 5 10 15Leu Ala Leu Thr Glu Thr Trp Ala 203624PRTHomo sapiens 36Met Arg Val Met Ala Pro Arg Ala Leu Leu Leu Leu Leu Ser Gly Gly1 5 10 15Leu Ala Leu Thr Glu Thr Trp Ala 203724PRTHomo sapiens 37Met Arg Val Met Ala Pro Arg Thr Leu Ile Leu Leu Leu Ser Gly Ala1 5 10 15Leu Ala Leu Thr Glu Thr Trp Ala 203824PRTHomo sapiens 38Met Arg Val Met Ala Pro Arg Thr Leu Leu Leu Leu Leu Ser Gly Ala1 5 10 15Leu Ala Leu Thr Glu Thr Trp Ala 203924PRTHomo sapiens 39Met Arg Val Met Ala Pro Arg Thr Leu Ile Leu Leu Leu Ser Gly Ala1 5 10 15Leu Ala Leu Thr Glu Thr Trp Ala 204024PRTHomo sapiens 40Met Arg Val Met Ala Pro Gln Ala Leu Leu Leu Leu Leu Ser Gly Ala1 5 10 15Leu Ala Leu Ile Glu Thr Trp Ala 204124PRTHomo sapiens 41Met Arg Val Met Ala Pro Arg Ala Leu Leu Leu Leu Leu Ser Gly Gly1 5 10 15Leu Ala Leu Thr Glu Thr Trp Ala 204229PRTHomo sapiens 42Met Val Cys Leu Lys Leu Pro Gly Gly Ser Cys Met Thr Ala Leu Thr1 5 10 15Val Thr Leu Met Val Leu Ser Ser Pro Leu Ala Leu Ala 20 254329PRTHomo sapiens 43Met Val Cys Leu Lys Phe Pro Gly Gly Ser Cys Met Ala Ala Leu Thr1 5 10 15Val Thr Leu Met Val Leu Ser Ser Pro Leu Ala Leu Ala 20 254429PRTHomo sapiens 44Met Val Cys Leu Lys Leu Pro Gly Gly Ser Cys Met Ala Ala Leu Thr1 5 10 15Val Thr Leu Met Val Leu Ser Ser Pro Leu Ala Leu Ala 20 254529PRTHomo sapiens 45Met Val Cys Leu Arg Leu Pro Gly Gly Ser Cys Met Ala Val Leu Thr1 5 10

15Val Thr Leu Met Val Leu Ser Ser Pro Leu Ala Leu Ala 20 254629PRTHomo sapiens 46Met Val Cys Leu Arg Leu Pro Gly Gly Ser Cys Met Ala Val Leu Thr1 5 10 15Val Thr Leu Met Val Leu Ser Ser Pro Leu Ala Leu Ala 20 254729PRTHomo sapiens 47Met Val Cys Leu Lys Leu Pro Gly Gly Ser Ser Leu Ala Ala Leu Thr1 5 10 15Val Thr Leu Met Val Leu Ser Ser Arg Leu Ala Phe Ala 20 254826PRTHomo sapiens 48Met Gly Ser Gly Trp Val Pro Trp Val Val Ala Leu Leu Val Asn Leu1 5 10 15Thr Arg Leu Asp Ser Ser Met Thr Gln Gly 20 254926PRTHomo sapiens 49Met Val Ser Arg Met Val Ser Thr Met Leu Ser Gly Leu Leu Phe Trp1 5 10 15Leu Ala Ser Gly Trp Thr Pro Ala Phe Ala 20 255024PRTHomo sapiens 50Met Pro Ser Ser Val Ser Trp Gly Ile Leu Leu Leu Ala Gly Leu Cys1 5 10 15Cys Leu Val Pro Val Ser Leu Ala 205135PRTHomo sapiens 51Met Ser Ser Trp Ser Arg Gln Arg Pro Lys Ser Pro Gly Gly Ile Gln1 5 10 15Pro His Val Ser Arg Thr Leu Phe Leu Leu Leu Leu Leu Ala Ala Ser 20 25 30Ala Trp Gly 355223PRTHomo sapiens 52Met Gly Lys Asn Lys Leu Leu His Pro Ser Leu Val Leu Leu Leu Leu1 5 10 15Val Leu Leu Pro Thr Asp Ala 205319PRTHomo sapiens 53Met Pro Ala Leu Gly Trp Ala Val Ala Ala Ile Leu Met Leu Gln Thr1 5 10 15Ala Met Ala5431PRTHomo sapiens 54Met Gly Gln Gly Trp Ala Thr Ala Gly Leu Pro Ser Leu Leu Phe Leu1 5 10 15Leu Leu Cys Tyr Gly His Pro Leu Leu Val Pro Ser Gln Glu Ala 20 25 305523PRTHomo sapiens 55Met Thr Pro Gly Ala Leu Leu Met Leu Leu Gly Ala Leu Gly Ala Pro1 5 10 15Leu Ala Pro Gly Val Arg Gly 205620PRTHomo sapiens 56Met Ala Arg Ala Pro Leu Gly Val Leu Leu Leu Leu Gly Leu Leu Gly1 5 10 15Arg Gly Val Gly 205719PRTHomo sapiens 57Met Val Glu Met Leu Pro Thr Ala Ile Leu Leu Val Leu Ala Val Ser1 5 10 15Val Val Ala5816PRTHomo sapiens 58Met Phe Arg Leu Trp Leu Leu Leu Ala Gly Leu Cys Gly Leu Leu Ala1 5 10 155918PRTHomo sapiens 59Met Leu Leu Leu Gly Ala Val Leu Leu Leu Leu Ala Leu Pro Gly His1 5 10 15Asp Gln6021PRTHomo sapiens 60Met Lys Leu Val Ser Val Ala Leu Met Tyr Leu Gly Ser Leu Ala Phe1 5 10 15Leu Gly Ala Asp Thr 206131PRTHomo sapiens 61Met Gln Leu Arg Asn Pro Glu Leu His Leu Gly Cys Ala Leu Ala Leu1 5 10 15Arg Phe Leu Ala Leu Val Ser Trp Asp Ile Pro Gly Ala Arg Ala 20 25 306220PRTHomo sapiens 62Met Glu Lys Ile Pro Val Ser Ala Phe Leu Leu Leu Val Ala Leu Ser1 5 10 15Tyr Thr Leu Ala 206321PRTHomo sapiens 63Met Met Leu His Ser Ala Leu Gly Leu Cys Leu Leu Leu Val Thr Val1 5 10 15Ser Ser Asn Leu Ala 206419PRTHomo sapiens 64Met Arg Ser Leu Gly Ala Leu Leu Leu Leu Leu Ser Ala Cys Leu Ala1 5 10 15Val Ser Ala6516PRTHomo sapiens 65Met Arg Ser Thr Ile Leu Leu Phe Cys Leu Leu Gly Ser Thr Arg Ser1 5 10 156625PRTHomo sapiens 66Met Ser Ser Phe Ser Thr Thr Thr Val Ser Phe Leu Leu Leu Leu Ala1 5 10 15Phe Gln Leu Leu Gly Gln Thr Arg Ala 20 256724PRTHomo sapiens 67Met Val Met Gly Leu Gly Val Leu Leu Leu Val Phe Val Leu Gly Leu1 5 10 15Gly Leu Thr Pro Pro Thr Leu Ala 206816PRTHomo sapiens 68Met Phe Thr Ile Lys Leu Leu Leu Phe Ile Val Pro Leu Val Ile Ser1 5 10 156926PRTHomo sapiens 69Met Leu Lys Lys Pro Leu Ser Ala Val Thr Trp Leu Cys Ile Phe Ile1 5 10 15Val Ala Phe Val Ser His Pro Ala Trp Leu 20 257033PRTHomo sapiens 70Met Arg Lys Arg Ala Pro Gln Ser Glu Met Ala Pro Ala Gly Val Ser1 5 10 15Leu Arg Ala Thr Ile Leu Cys Leu Leu Ala Trp Ala Gly Leu Ala Ala 20 25 30Gly7132PRTHomo sapiens 71Met Pro Gly Pro Arg Arg Pro Ala Gly Ser Arg Leu Arg Leu Leu Leu1 5 10 15Leu Leu Leu Leu Pro Pro Leu Leu Leu Leu Leu Arg Gly Ser His Ala 20 25 307218PRTHomo sapiens 72Met Lys Leu Leu Ala Ala Thr Val Leu Leu Leu Thr Ile Cys Ser Leu1 5 10 15Glu Gly7320PRTHomo sapiens 73Met Phe Leu Lys Ala Val Val Leu Thr Leu Ala Leu Val Ala Val Ala1 5 10 15Gly Ala Arg Ala 207419PRTHomo sapiens 74Met Glu His Lys Glu Val Val Leu Leu Leu Leu Leu Phe Leu Lys Ser1 5 10 15Ala Ala Pro7526PRTHomo sapiens 75Met Arg Leu Phe Leu Ser Leu Pro Val Leu Val Val Val Leu Ser Ile1 5 10 15Val Leu Glu Gly Pro Ala Pro Ala Gln Gly 20 257622PRTHomo sapiens 76Met Gly Thr Arg Leu Leu Pro Ala Leu Phe Leu Val Leu Leu Val Leu1 5 10 15Gly Phe Glu Val Gln Gly 207720PRTHomo sapiens 77Met Gln Pro Arg Val Leu Leu Val Val Ala Leu Leu Ala Leu Leu Ala1 5 10 15Ser Ala Arg Ala 207820PRTHomo sapiens 78Met Val Met Leu Leu Leu Leu Leu Ser Ala Leu Ala Gly Leu Phe Gly1 5 10 15Ala Ala Glu Gly 207918PRTHomo sapiens 79Met Lys Val Leu Trp Ala Ala Leu Leu Val Thr Phe Leu Ala Gly Cys1 5 10 15Gln Ala8019PRTHomo sapiens 80Met Ile Ser Pro Val Leu Ile Leu Phe Ser Ser Phe Leu Cys His Val1 5 10 15Ala Ile Ala8130PRTHomo sapiens 81Met Ala Pro His Gly Pro Gly Ser Leu Thr Thr Leu Val Pro Trp Ala1 5 10 15Ala Ala Leu Leu Leu Ala Leu Gly Val Glu Arg Ala Leu Ala 20 25 308246PRTHomo sapiens 82Met Pro Arg Tyr Gly Ala Ser Leu Arg Gln Ser Cys Pro Arg Ser Gly1 5 10 15Arg Glu Gln Gly Gln Asp Gly Thr Ala Gly Ala Pro Gly Leu Leu Trp 20 25 30Met Gly Leu Val Leu Ala Leu Ala Leu Ala Leu Ala Leu Ala 35 40 458323PRTHomo sapiens 83Met Ala Arg Lys Ser Asn Leu Pro Val Leu Leu Val Pro Phe Leu Leu1 5 10 15Cys Gln Ala Leu Val Arg Cys 208420PRTHomo sapiens 84Met Asp Arg His Ser Ser Tyr Ile Phe Ile Trp Leu Gln Leu Glu Leu1 5 10 15Cys Ala Met Ala 208521PRTHomo sapiens 85Met Ala Ala Ala Leu Phe Val Leu Leu Gly Phe Ala Leu Leu Gly Thr1 5 10 15His Gly Ala Ser Gly 208623PRTHomo sapiens 86Met Pro Gly Phe Leu Val Arg Ile Leu Leu Leu Leu Leu Val Leu Leu1 5 10 15Leu Leu Gly Pro Thr Arg Gly 208722PRTHomo sapiens 87Met Ala Arg Gly Ser Ala Val Ala Trp Ala Ala Leu Gly Pro Leu Leu1 5 10 15Trp Gly Cys Ala Leu Gly 208830PRTHomo sapiens 88Met Leu Arg Gly Thr Met Thr Ala Trp Arg Gly Met Arg Pro Glu Val1 5 10 15Thr Leu Ala Cys Leu Leu Leu Ala Thr Ala Gly Cys Phe Ala 20 25 308920PRTHomo sapiens 89Met Ala Trp Ala Ser Arg Leu Gly Leu Leu Leu Ala Leu Leu Leu Pro1 5 10 15Val Val Gly Ala 209031PRTHomo sapiens 90Met Arg Glu Asn Met Ala Arg Gly Pro Cys Asn Ala Pro Arg Trp Val1 5 10 15Ser Leu Met Val Leu Val Ala Ile Gly Thr Ala Val Thr Ala Ala 20 25 309129PRTHomo sapiens 91Met Lys Met Ala Ser Ser Leu Ala Phe Leu Leu Leu Asn Phe His Val1 5 10 15Ser Leu Phe Leu Val Gln Leu Leu Thr Pro Cys Ser Ala 20 259217PRTHomo sapiens 92Met Ala Leu Met Leu Ser Leu Val Leu Ser Leu Leu Lys Leu Gly Ser1 5 10 15Gly9329PRTHomo sapiens 93Met Glu Ala Pro Gly Pro Arg Ala Leu Arg Thr Ala Leu Cys Gly Gly1 5 10 15Cys Cys Cys Leu Leu Leu Cys Ala Gln Leu Ala Val Ala 20 259415PRTHomo sapiens 94Met Arg Pro Leu Leu Val Leu Leu Leu Leu Gly Leu Ala Ala Gly1 5 10 159527PRTHomo sapiens 95Met Val Thr Ala Ala Leu Gly Pro Val Trp Ala Ala Leu Leu Leu Phe1 5 10 15Leu Leu Met Cys Glu Ile Pro Met Val Glu Leu 20 259617PRTHomo sapiens 96Met Trp Leu Leu Tyr Leu Leu Val Pro Ala Leu Phe Cys Arg Ala Gly1 5 10 15Gly9715PRTHomo sapiens 97Met Trp Cys Ile Val Leu Phe Ser Leu Leu Ala Trp Val Tyr Ala1 5 10 159848PRTHomo sapiens 98Met His Pro Pro Lys Thr Pro Ser Gly Ala Leu His Arg Lys Arg Lys1 5 10 15Met Ala Ala Trp Pro Phe Ser Arg Leu Trp Lys Val Ser Asp Pro Ile 20 25 30Leu Phe Gln Met Thr Leu Ile Ala Ala Leu Leu Pro Ala Val Leu Gly 35 40 459925PRTHomo sapiens 99Met Ala Gly Pro Ala Ile His Thr Ala Pro Met Leu Phe Leu Val Leu1 5 10 15Leu Leu Pro Leu Glu Leu Ser Leu Ala 20 2510024PRTHomo sapiens 100Met Gly Ala Pro Ala Ala Ser Leu Leu Leu Leu Leu Leu Leu Phe Ala1 5 10 15Cys Cys Trp Ala Pro Gly Gly Ala 2010137PRTHomo sapiens 101Met Ala Pro Leu Cys Pro Ser Pro Trp Leu Pro Leu Leu Ile Pro Ala1 5 10 15Pro Ala Pro Gly Leu Thr Val Gln Leu Leu Leu Ser Leu Leu Leu Leu 20 25 30Val Pro Val His Pro 3510224PRTHomo sapiens 102Met Arg Phe Thr Phe Thr Ser Arg Cys Leu Ala Leu Phe Leu Leu Leu1 5 10 15Asn His Pro Thr Pro Ile Leu Pro 2010322PRTHomo sapiens 103Met Glu Lys Lys Cys Thr Leu Tyr Phe Leu Val Leu Leu Pro Phe Phe1 5 10 15Met Ile Leu Val Thr Ala 2010417PRTHomo sapiens 104Met Leu Leu Ser Val Pro Leu Leu Leu Gly Leu Leu Gly Leu Ala Val1 5 10 15Ala10526PRTHomo sapiens 105Met Thr Arg Leu Thr Val Leu Ala Leu Leu Ala Gly Leu Leu Ala Ser1 5 10 15Ser Arg Ala Gly Ser Ser Pro Leu Leu Asp 20 2510627PRTHomo sapiens 106Met Glu Ser Ser Arg Val Arg Leu Leu Pro Leu Leu Gly Ala Ala Leu1 5 10 15Leu Leu Met Leu Pro Leu Leu Gly Thr Arg Ala 20 2510715PRTHomo sapiens 107Met Arg Leu Leu Ile Leu Thr Cys Leu Val Ala Val Ala Leu Ala1 5 10 1510815PRTHomo sapiens 108Met Lys Val Leu Ile Leu Ala Cys Leu Val Ala Leu Ala Leu Ala1 5 10 1510920PRTHomo sapiens 109Met Lys Ser Phe Leu Leu Val Val Asn Ala Leu Ala Leu Thr Leu Pro1 5 10 15Phe Leu Ala Val 2011024PRTHomo sapiens 110Met Gly Ala Gly Pro Ser Leu Leu Leu Ala Ala Leu Leu Leu Leu Leu1 5 10 15Ser Gly Asp Gly Ala Val Arg Cys 2011117PRTHomo sapiens 111Met Lys Thr Leu Leu Leu Leu Leu Leu Val Leu Leu Glu Leu Gly Glu1 5 10 15Ala11218PRTHomo sapiens 112Met Gln Pro Leu Leu Leu Leu Leu Ala Phe Leu Leu Pro Thr Gly Ala1 5 10 15Glu Ala11321PRTHomo sapiens 113Met Ala Leu Thr Ala His Pro Ser Cys Leu Leu Ala Leu Leu Val Ala1 5 10 15Gly Leu Ala Gln Gly 2011422PRTHomo sapiens 114Met Pro Leu Leu Leu Tyr Thr Cys Leu Leu Trp Leu Pro Thr Ser Gly1 5 10 15Leu Trp Thr Val Gln Ala 2011532PRTHomo sapiens 115Met Leu Gly Ala Lys Pro His Trp Leu Pro Gly Pro Leu His Ser Pro1 5 10 15Gly Leu Pro Leu Val Leu Val Leu Leu Ala Leu Gly Ala Gly Trp Ala 20 25 3011627PRTHomo sapiens 116Met Gly Ser Gly Arg Arg Ala Leu Ser Ala Val Pro Ala Val Leu Leu1 5 10 15Val Leu Thr Leu Pro Gly Leu Pro Val Trp Ala 20 2511716PRTHomo sapiens 117Met Arg Gly Leu Leu Val Leu Ser Val Leu Leu Gly Ala Val Phe Gly1 5 10 1511815PRTHomo sapiens 118Met Arg Leu Ile Leu Pro Val Gly Leu Ile Ala Thr Thr Leu Ala1 5 10 1511915PRTHomo sapiens 119Met Leu Ala Leu Leu Val Leu Val Thr Val Ala Leu Ala Ser Ala1 5 10 1512020PRTHomo sapiens 120Met Ser Asp Leu Leu Ser Val Phe Leu His Leu Leu Leu Leu Phe Lys1 5 10 15Leu Val Ala Pro 2012123PRTHomo sapiens 121Met Lys Val Ser Ala Ala Leu Leu Trp Leu Leu Leu Ile Ala Ala Ala1 5 10 15Phe Ser Pro Gln Gly Leu Ala 2012221PRTHomo sapiens 122Met Lys Val Ser Val Ala Ala Leu Ser Cys Leu Met Leu Val Ala Val1 5 10 15Leu Gly Ser Gln Ala 2012321PRTHomo sapiens 123Met Ala Leu Leu Leu Ala Leu Ser Leu Leu Val Leu Trp Thr Ser Pro1 5 10 15Ala Pro Thr Leu Ser 2012423PRTHomo sapiens 124Met Gln Ile Ile Thr Thr Ala Leu Val Cys Leu Leu Leu Ala Gly Met1 5 10 15Trp Pro Glu Asp Val Asp Ser 2012524PRTHomo sapiens 125Met Ala Arg Leu Gln Thr Ala Leu Leu Val Val Leu Val Leu Leu Ala1 5 10 15Val Ala Leu Gln Ala Thr Glu Ala 2012626PRTHomo sapiens 126Met Ala Gly Leu Met Thr Ile Val Thr Ser Leu Leu Phe Leu Gly Val1 5 10 15Cys Ala His His Ile Ile Pro Thr Gly Ser 20 2512723PRTHomo sapiens 127Met Lys Val Ser Ala Ala Leu Leu Cys Leu Leu Leu Ile Ala Ala Thr1 5 10 15Phe Ile Pro Gln Gly Leu Ala 2012823PRTHomo sapiens 128Met Lys Leu Cys Val Thr Val Leu Ser Leu Leu Met Leu Val Ala Ala1 5 10 15Phe Cys Ser Pro Ala Leu Ser 2012923PRTHomo sapiens 129Met Lys Val Ser Ala Ala Ala Leu Ala Val Ile Leu Ile Ala Thr Ala1 5 10 15Leu Cys Ala Pro Ala Ser Ala 2013023PRTHomo sapiens 130Met Lys Ala Ser Ala Ala Leu Leu Cys Leu Leu Leu Thr Ala Ala Ala1 5 10 15Phe Ser Pro Gln Gly Leu Ala 2013123PRTHomo sapiens 131Met Ala Phe Asp Val Ser Cys Phe Phe Trp Val Val Leu Phe Ser Ala1 5 10 15Gly Cys Lys Val Ile Thr Ser 2013216PRTHomo sapiens 132Met Leu Phe Leu Leu Leu Pro Leu Leu Ala Val Leu Pro Gly Asp Gly1 5 10 1513321PRTHomo sapiens 133Met Leu Gly Gln Val Val Thr Leu Ile Leu Leu Leu Leu Leu Lys Val1 5 10 15Tyr Gln Gly Lys Gly 2013428PRTHomo sapiens 134Met Leu Arg Arg Arg Gly Ser Pro Gly Met Gly Val His Val Gly Ala1 5 10 15Ala Leu Gly Ala Leu Trp Phe Cys Leu Thr Gly Ala 20 2513519PRTHomo sapiens 135Met Ala Arg Pro His Pro Trp Trp Leu Cys Val Leu Gly Thr Leu Val1 5 10 15Gly Leu Ser13618PRTHomo sapiens 136Met Leu Arg Leu Leu Leu Ala Leu Asn Leu Phe Pro Ser Ile Gln Val1 5 10 15Thr Gly13724PRTHomo sapiens 137Met Ser Phe Pro Cys Lys Phe Val Ala Ser Phe Leu Leu Ile Phe Asn1 5 10 15Val Ser Ser Lys Gly Ala Val Ser 2013835PRTHomo sapiens 138Met Ser Gly Gly Trp Met Ala Gln Val Gly Ala Trp Arg Thr Gly Ala1 5 10 15Leu Gly Leu Ala Leu Leu Leu Leu Leu Gly Leu Gly Leu Gly Leu Glu 20 25 30Ala Ala Ala 3513931PRTHomo sapiens 139Met Leu Val Arg Arg Gly Ala Arg Ala Gly Pro Arg Met Pro Arg Gly1 5 10 15Trp Thr Ala Leu Cys Leu Leu Ser

Leu Leu Pro Ser Gly Phe Met 20 25 3014022PRTHomo sapiens 140Met Gln Ser Gly Thr His Trp Arg Val Leu Gly Leu Cys Leu Leu Ser1 5 10 15Val Gly Val Trp Gly Gln 2014122PRTHomo sapiens 141Met Glu Gln Gly Lys Gly Leu Ala Val Leu Ile Leu Ala Ile Ile Leu1 5 10 15Leu Gln Gly Thr Leu Ala 2014221PRTHomo sapiens 142Met Lys Trp Lys Ala Leu Phe Thr Ala Ala Ile Leu Gln Ala Gln Leu1 5 10 15Pro Ile Thr Glu Ala 2014323PRTHomo sapiens 143Met Tyr Leu Trp Leu Lys Leu Leu Ala Phe Gly Phe Ala Phe Leu Asp1 5 10 15Thr Glu Val Phe Val Thr Gly 2014419PRTHomo sapiens 144Met Ala Leu Leu Phe Ser Leu Ile Leu Ala Ile Cys Thr Arg Pro Gly1 5 10 15Phe Leu Ala14524PRTHomo sapiens 145Met Pro Met Gly Ser Leu Gln Pro Leu Ala Thr Leu Tyr Leu Leu Gly1 5 10 15Met Leu Val Ala Ser Cys Leu Gly 2014619PRTHomo sapiens 146Met Ser Arg Gly Leu Gln Leu Leu Leu Leu Ser Cys Ala Tyr Ser Leu1 5 10 15Ala Pro Ala14721PRTHomo sapiens 147Met Arg Pro Arg Leu Trp Leu Leu Leu Ala Ala Gln Leu Thr Val Leu1 5 10 15His Gly Asn Ser Val 2014822PRTHomo sapiens 148Met Ala Arg Gly Ala Ala Leu Ala Leu Leu Leu Phe Gly Leu Leu Gly1 5 10 15Val Leu Val Ala Ala Pro 2014934PRTHomo sapiens 149Met Gly His Leu Ser Ala Pro Leu His Arg Val Arg Val Pro Trp Gln1 5 10 15Gly Leu Leu Leu Thr Ala Ser Leu Leu Thr Phe Trp Asn Pro Pro Thr 20 25 30Thr Ala15017PRTHomo sapiens 150Met His Leu Leu Leu Phe Gln Leu Leu Val Leu Leu Pro Leu Gly Lys1 5 10 15Thr15119PRTHomo sapiens 151Met Lys Ile Leu Ile Leu Gly Ile Phe Leu Phe Leu Cys Ser Thr Pro1 5 10 15Ala Trp Ala15217PRTHomo sapiens 152Met Leu Ala Ala Thr Val Leu Thr Leu Ala Leu Leu Gly Asn Ala His1 5 10 15Ala15321PRTHomo sapiens 153Met Ala Ala Ala Leu Ala Leu Val Ala Gly Val Leu Ser Gly Ala Val1 5 10 15Leu Pro Leu Trp Ser 2015425PRTHomo sapiens 154Met Gly Ser Asn Leu Ser Pro Gln Leu Cys Leu Met Pro Phe Ile Leu1 5 10 15Gly Leu Leu Ser Gly Gly Val Thr Thr 20 2515518PRTHomo sapiens 155Met Arg Leu Leu Ala Lys Ile Ile Cys Leu Met Leu Trp Ala Ile Cys1 5 10 15Val Ala15618PRTHomo sapiens 156Met Lys Leu Leu His Val Phe Leu Leu Phe Leu Cys Phe His Leu Arg1 5 10 15Phe Cys15721PRTHomo sapiens 157Met Gly Val Lys Ala Ser Gln Thr Gly Phe Val Val Leu Val Leu Leu1 5 10 15Gln Cys Cys Ser Ala 2015826PRTHomo sapiens 158Met Gly Ala Thr Thr Met Asp Gln Lys Ser Leu Trp Ala Gly Val Val1 5 10 15Val Leu Leu Leu Leu Gln Gly Gly Ser Ala 20 2515921PRTHomo sapiens 159Met Val Arg Ser Val Ala Trp Ala Gly Phe Met Val Leu Leu Met Ile1 5 10 15Pro Trp Gly Ser Ala 2016023PRTHomo sapiens 160Met Gln Val Ser Thr Ala Ala Leu Ala Val Leu Leu Cys Thr Met Ala1 5 10 15Leu Cys Asn Gln Val Leu Ser 2016121PRTHomo sapiens 161Met Gln Ala Ala Trp Leu Leu Gly Ala Leu Val Val Pro Gln Leu Leu1 5 10 15Gly Phe Gly His Gly 2016221PRTHomo sapiens 162Met Arg Pro Ala Phe Ala Leu Cys Leu Leu Trp Gln Ala Leu Trp Pro1 5 10 15Gly Pro Gly Gly Gly 2016319PRTHomo sapiens 163Met Pro Leu Leu Thr Leu Tyr Leu Leu Leu Phe Trp Leu Ser Gly Tyr1 5 10 15Ser Ile Ala16418PRTHomo sapiens 164Met Arg Leu Leu Val Leu Leu Trp Gly Cys Leu Leu Leu Pro Gly Tyr1 5 10 15Glu Ala16522PRTHomo sapiens 165Met Met Lys Thr Leu Leu Leu Phe Val Gly Leu Leu Leu Thr Trp Glu1 5 10 15Ser Gly Gln Val Leu Gly 2016619PRTHomo sapiens 166Met Leu Leu Leu Pro Leu Pro Leu Leu Leu Phe Leu Leu Cys Ser Arg1 5 10 15Ala Glu Ala16718PRTHomo sapiens 167Met Arg Ser Ala Ala Val Leu Ala Leu Leu Leu Cys Ala Gly Gln Val1 5 10 15Thr Ala16822PRTHomo sapiens 168Met Phe Ser Phe Val Asp Leu Arg Leu Leu Leu Leu Leu Ala Ala Thr1 5 10 15Ala Leu Leu Thr His Gly 2016920PRTHomo sapiens 169Met Gly Pro Leu Met Val Leu Phe Cys Leu Leu Phe Leu Tyr Pro Gly1 5 10 15Leu Ala Asp Ser 2017022PRTHomo sapiens 170Met Gly Pro Thr Ser Gly Pro Ser Leu Leu Leu Leu Leu Leu Thr His1 5 10 15Leu Pro Leu Ala Leu Gly 2017125PRTHomo sapiens 171Met Gly Arg Asp Gln Arg Ala Val Ala Gly Pro Ala Leu Arg Arg Trp1 5 10 15Leu Leu Leu Gly Thr Val Thr Val Gly 20 2517226PRTHomo sapiens 172Met Met Ala Asn Trp Ala Glu Ala Arg Pro Leu Leu Ile Leu Ile Val1 5 10 15Leu Leu Gly Gln Phe Val Ser Ile Lys Ala 20 2517319PRTHomo sapiens 173Met Arg Ala Ala Arg Ala Leu Leu Pro Leu Leu Leu Gln Ala Cys Trp1 5 10 15Thr Ala Ala17421PRTHomo sapiens 174Met Ala Arg Arg Ser Val Leu Tyr Phe Ile Leu Leu Asn Ala Leu Ile1 5 10 15Asn Lys Gly Gln Ala 2017522PRTHomo sapiens 175Met Lys Val Ile Ser Leu Phe Ile Leu Val Gly Phe Ile Gly Glu Phe1 5 10 15Gln Ser Phe Ser Ser Ala 2017623PRTHomo sapiens 176Met Lys Thr Cys Trp Lys Ile Pro Val Phe Phe Phe Val Cys Ser Phe1 5 10 15Leu Glu Pro Trp Ala Ser Ala 2017721PRTHomo sapiens 177Met Ser Ala Cys Arg Ser Phe Ala Val Ala Ile Cys Ile Leu Glu Ile1 5 10 15Ser Ile Leu Thr Ala 2017821PRTHomo sapiens 178Met Trp Val Ser Trp Ala Pro Gly Leu Trp Leu Leu Gly Leu Trp Ala1 5 10 15Thr Phe Gly His Gly 2017926PRTHomo sapiens 179Met Pro Arg Ser Cys Cys Ser Arg Ser Gly Ala Leu Leu Leu Ala Leu1 5 10 15Leu Leu Gln Ala Ser Met Glu Val Arg Gly 20 2518017PRTHomo sapiens 180Met Glu Lys Ile Leu Ile Leu Leu Leu Val Ala Leu Ser Val Ala Tyr1 5 10 15Ala18120PRTHomo sapiens 181Met Gly Ala Ala Gly Leu Leu Gly Val Phe Leu Ala Leu Val Ala Pro1 5 10 15Gly Val Leu Gly 2018225PRTHomo sapiens 182Met Val Pro Glu Val Arg Val Leu Ser Ser Leu Leu Gly Leu Ala Leu1 5 10 15Leu Trp Phe Pro Leu Asp Ser His Ala 20 2518331PRTHomo sapiens 183Met Ala Gly Leu Ser Arg Gly Ser Ala Arg Ala Leu Leu Ala Ala Leu1 5 10 15Leu Ala Ser Thr Leu Leu Ala Leu Leu Val Ser Pro Ala Arg Gly 20 25 3018424PRTHomo sapiens 184Met Ser Pro Asn Phe Lys Leu Gln Cys His Phe Ile Leu Ile Phe Leu1 5 10 15Thr Ala Leu Arg Gly Glu Ser Arg 2018534PRTHomo sapiens 185Met Tyr Leu Val Ala Gly Asp Arg Gly Leu Ala Gly Cys Gly His Leu1 5 10 15Leu Val Ser Leu Leu Gly Leu Leu Leu Leu Leu Ala Arg Ser Gly Thr 20 25 30Arg Ala18621PRTHomo sapiens 186Met Glu Ile Lys His Leu Leu Phe Leu Val Ala Ala Ala Cys Leu Leu1 5 10 15Pro Met Leu Ser Met 2018737PRTHomo sapiens 187Met Pro Ala Gly Arg Arg Gly Pro Ala Ala Gln Ser Ala Arg Arg Pro1 5 10 15Pro Pro Leu Leu Pro Leu Leu Leu Leu Leu Cys Val Leu Gly Ala Pro 20 25 30Arg Ala Gly Ser Gly 3518818PRTHomo sapiens 188Met Glu Lys Leu Leu Cys Phe Leu Val Leu Thr Ser Leu Ser His Ala1 5 10 15Phe Gly18922PRTHomo sapiens 189Met Leu Leu Leu Val Thr Ser Leu Leu Leu Cys Glu Leu Pro His Pro1 5 10 15Ala Phe Leu Leu Ile Pro 2019017PRTHomo sapiens 190Met Trp Leu Gln Ser Leu Leu Leu Leu Gly Thr Val Ala Cys Ser Ile1 5 10 15Ser19124PRTHomo sapiens 191Met Ala Arg Leu Gly Asn Cys Ser Leu Thr Trp Ala Ala Leu Ile Ile1 5 10 15Leu Leu Leu Pro Gly Ser Leu Glu 2019220PRTHomo sapiens 192Met Phe Ile Asn Ile Lys Ser Ile Leu Trp Met Cys Ser Thr Leu Ile1 5 10 15Val Thr His Ala 2019328PRTHomo sapiens 193Met Leu Gly Leu Pro Trp Lys Gly Gly Leu Ser Trp Ala Leu Leu Leu1 5 10 15Leu Leu Leu Gly Ser Gln Ile Leu Leu Ile Tyr Ala 20 2519428PRTHomo sapiens 194Met Ser Ser Pro Gln Arg Arg Lys Ala Met Pro Trp Ala Leu Ser Leu1 5 10 15Leu Leu Met Gly Phe Gln Leu Leu Val Thr Tyr Ala 20 2519530PRTHomo sapiens 195Met Arg Pro Gln Gly Pro Ala Ala Ser Pro Gln Arg Leu Arg Gly Leu1 5 10 15Leu Leu Leu Leu Leu Leu Gln Leu Pro Ala Pro Ser Ser Ala 20 25 3019618PRTHomo sapiens 196Met Ala Phe Leu Trp Leu Leu Ser Cys Trp Ala Leu Leu Gly Thr Thr1 5 10 15Phe Gly19734PRTHomo sapiens 197Met Ser Leu Arg Leu Asp Thr Thr Pro Ser Cys Asn Ser Ala Arg Pro1 5 10 15Leu His Ala Leu Gln Val Leu Leu Leu Leu Ser Leu Leu Leu Thr Ala 20 25 30Leu Ala19821PRTHomo sapiens 198Met Asn Gln Thr Ala Ile Leu Ile Cys Cys Leu Ile Phe Leu Thr Leu1 5 10 15Ser Gly Ile Gln Gly 2019926PRTHomo sapiens 199Met Ala Gly Pro Leu Arg Ala Pro Leu Leu Leu Leu Ala Ile Leu Ala1 5 10 15Val Ala Leu Ala Val Ser Pro Ala Ala Gly 20 2520022PRTHomo sapiens 200Met Arg Thr Pro Gly Pro Leu Pro Val Leu Leu Leu Leu Leu Ala Gly1 5 10 15Ala Pro Ala Ala Arg Pro 2020120PRTHomo sapiens 201Met Ala Gln His Leu Ser Thr Leu Leu Leu Leu Leu Ala Thr Leu Ala1 5 10 15Val Ala Leu Ala 2020220PRTHomo sapiens 202Met Ala Arg Pro Leu Cys Thr Leu Leu Leu Leu Met Ala Thr Leu Ala1 5 10 15Gly Ala Leu Ala 2020320PRTHomo sapiens 203Met Ala Trp Pro Leu Cys Thr Leu Leu Leu Leu Leu Ala Thr Gln Ala1 5 10 15Val Ala Leu Ala 2020422PRTHomo sapiens 204Met Arg Ile His Tyr Leu Leu Phe Ala Leu Leu Phe Leu Phe Leu Val1 5 10 15Pro Val Pro Gly His Gly 2020520PRTHomo sapiens 205Met Gly Leu Phe Met Ile Ile Ala Ile Leu Leu Phe Gln Lys Pro Thr1 5 10 15Val Thr Glu Gln 2020619PRTHomo sapiens 206Met Arg Phe Met Thr Leu Leu Phe Leu Thr Ala Leu Ala Gly Ala Leu1 5 10 15Val Cys Ala20719PRTHomo sapiens 207Met Arg Thr Leu Ala Ile Leu Ala Ala Ile Leu Leu Val Ala Leu Gln1 5 10 15Ala Gln Ala20831PRTHomo sapiens 208Met Met Ala Leu Gly Ala Ala Gly Ala Thr Arg Val Phe Val Ala Met1 5 10 15Val Ala Ala Ala Leu Gly Gly His Pro Leu Leu Gly Val Ser Ala 20 25 3020921PRTHomo sapiens 209Met Gln Arg Leu Gly Ala Thr Leu Leu Cys Leu Leu Leu Ala Ala Ala1 5 10 15Val Pro Thr Ala Pro 2021018PRTHomo sapiens 210Met Val Ala Ala Val Leu Leu Gly Leu Ser Trp Leu Cys Ser Pro Leu1 5 10 15Gly Ala21123PRTHomo sapiens 211Met Thr Ala Thr Glu Ala Leu Leu Arg Val Leu Leu Leu Leu Leu Ala1 5 10 15Phe Gly His Ser Thr Tyr Gly 2021226PRTHomo sapiens 212Met Ala Ala Ala Ser Arg Ser Ala Ser Gly Trp Ala Leu Leu Leu Leu1 5 10 15Val Ala Leu Trp Gln Gln Arg Ala Ala Gly 20 2521322PRTHomo sapiens 213Met Arg Gly Met Lys Leu Leu Gly Ala Leu Leu Ala Leu Ala Ala Leu1 5 10 15Leu Gln Gly Ala Val Ser 2021427PRTHomo sapiens 214Met Val Pro Lys Leu Phe Thr Ser Gln Ile Cys Leu Leu Leu Leu Leu1 5 10 15Gly Leu Met Gly Val Glu Gly Ser Leu His Ala 20 2521526PRTHomo sapiens 215Met Ala His Val Gly Asp Cys Thr Gln Thr Pro Trp Leu Pro Val Leu1 5 10 15Val Val Ser Leu Met Cys Ser Ala Arg Ala 20 2521627PRTHomo sapiens 216Met Ala Arg Pro Gly Gln Arg Trp Leu Gly Lys Trp Leu Val Ala Met1 5 10 15Val Val Trp Ala Leu Cys Arg Leu Ala Thr Pro 20 2521727PRTHomo sapiens 217Met Gly Pro Pro His Ser Gly Pro Gly Gly Val Arg Val Gly Ala Leu1 5 10 15Leu Leu Leu Gly Val Leu Gly Leu Val Ser Gly 20 2521825PRTHomo sapiens 218Met Gly Ser Arg Ala Glu Leu Cys Thr Leu Leu Gly Gly Phe Ser Phe1 5 10 15Leu Leu Leu Leu Ile Pro Gly Glu Gly 20 2521924PRTHomo sapiens 219Met Arg Pro Ser Gly Thr Ala Gly Ala Ala Leu Leu Ala Leu Leu Ala1 5 10 15Ala Leu Cys Pro Ala Ser Arg Ala 2022025PRTHomo sapiens 220Met Asp Arg Gly Thr Leu Pro Leu Ala Val Ala Leu Leu Leu Ala Ser1 5 10 15Cys Ser Leu Ser Pro Thr Ser Leu Ala 20 2522116PRTHomo sapiens 221Met Ile Arg Thr Leu Leu Leu Ser Thr Leu Val Ala Gly Ala Leu Ser1 5 10 1522216PRTHomo sapiens 222Met Ile Arg Thr Leu Leu Leu Ser Thr Leu Val Ala Gly Ala Leu Ser1 5 10 1522322PRTHomo sapiens 223Met Arg Ala Ser Ser Phe Leu Ile Val Val Val Phe Leu Ile Ala Gly1 5 10 15Thr Leu Val Leu Glu Ala 2022421PRTHomo sapiens 224Met Arg Ala Leu Trp Val Leu Gly Leu Cys Cys Val Leu Leu Thr Phe1 5 10 15Gly Ser Val Arg Ala 2022521PRTHomo sapiens 225Met Arg Gly Leu Ala Val Leu Leu Thr Val Ala Leu Ala Thr Leu Leu1 5 10 15Ala Pro Gly Ala Gly 2022622PRTHomo sapiens 226Met Ala Leu Gly Val Pro Ile Ser Val Tyr Leu Leu Phe Asn Ala Met1 5 10 15Thr Ala Leu Thr Glu Glu 2022717PRTHomo sapiens 227Met Ala Leu Asp Tyr Leu Leu Leu Leu Leu Leu Ala Ser Ala Val Ala1 5 10 15Ala22816PRTHomo sapiens 228Met Val Cys Ser Leu Trp Val Leu Leu Leu Val Ser Ser Val Leu Ala1 5 10 1522924PRTHomo sapiens 229Met Asp His Leu Gly Ala Ser Leu Trp Pro Gln Val Gly Ser Leu Cys1 5 10 15Leu Leu Leu Ala Gly Ala Ala Trp 2023027PRTHomo sapiens 230Met Gly Val His Glu Cys Pro Ala Trp Leu Trp Leu Leu Leu Ser Leu1 5 10 15Leu Ser Leu Pro Leu Gly Leu Pro Val Leu Gly 20 2523129PRTHomo sapiens 231Met Ile Ser Leu Pro Gly Pro Leu Val Thr Asn Leu Leu Arg Phe Leu1 5 10 15Phe Leu Gly Leu Ser Ala Leu Ala Pro Pro Ser Arg Ala 20 2523218PRTHomo sapiens 232Met Trp Leu Arg Ala Phe Ile Leu Ala Thr Leu Ser Ala Ser Ala Ala1 5 10 15Trp Gly23320PRTHomo sapiens 233Met Arg Leu Lys Asn Leu Thr Phe Ile Ile Ile Leu Ile Ile Ser Gly1 5 10 15Glu Leu Tyr Ala 2023418PRTHomo sapiens 234Met Ile Phe Leu Tyr Gln Val Val His Phe Ile Leu Phe Thr Ser Val1 5 10 15Ser Gly23528PRTHomo sapiens 235Met Phe Pro Gly Cys Pro Arg Leu Trp Val Leu Val Val Leu Gly Thr1 5 10 15Ser Trp Val Gly Trp Gly Ser Gln Gly Thr Glu Ala 20 2523619PRTHomo sapiens 236Met Gln Ile Glu Leu Ser Thr Cys Phe Phe Leu Cys Leu Leu Arg Phe1 5 10 15Cys Phe Ser23715PRTHomo

sapiens 237Met Trp Phe Leu Thr Thr Leu Leu Leu Trp Val Pro Val Asp Gly1 5 10 1523823PRTHomo sapiens 238Met Gly Val Pro Arg Pro Gln Pro Trp Ala Leu Gly Leu Leu Leu Phe1 5 10 15Leu Leu Pro Gly Ser Leu Gly 2023929PRTHomo sapiens 239Met Glu Leu Ser Gly Ala Thr Met Ala Arg Gly Leu Ala Val Leu Leu1 5 10 15Val Leu Phe Leu His Ile Lys Asn Leu Pro Ala Gln Ala 20 2524023PRTHomo sapiens 240Met Asp Leu Leu Trp Ile Leu Pro Ser Leu Trp Leu Leu Leu Leu Gly1 5 10 15Gly Pro Ala Cys Leu Lys Thr 2024119PRTHomo sapiens 241Met Leu Leu Trp Ser Leu Leu Val Ile Phe Asp Ala Val Thr Glu Gln1 5 10 15Ala Asp Ser24227PRTHomo sapiens 242Met Lys Leu Gly Cys Val Leu Met Ala Trp Ala Leu Tyr Leu Ser Leu1 5 10 15Gly Val Leu Trp Val Ala Gln Met Leu Leu Ala 20 2524318PRTHomo sapiens 243Met Lys Ser Leu Val Leu Leu Leu Cys Leu Ala Gln Leu Trp Gly Cys1 5 10 15His Ser24424PRTHomo sapiens 244Met Arg Ser Gly Cys Val Val Val His Val Trp Ile Leu Ala Gly Leu1 5 10 15Trp Leu Ala Val Ala Gly Arg Pro 2024528PRTHomo sapiens 245Met Asp Ser Asp Glu Thr Gly Phe Glu His Ser Gly Leu Trp Val Ser1 5 10 15Val Leu Ala Gly Leu Leu Leu Gly Ala Cys Gln Ala 20 2524624PRTHomo sapiens 246Met Leu Gly Ala Arg Leu Arg Leu Trp Val Cys Ala Leu Cys Ser Val1 5 10 15Cys Ser Met Ser Val Leu Arg Ala 2024722PRTHomo sapiens 247Met Gly Ala Pro Ala Cys Ala Leu Ala Leu Cys Val Ala Val Ala Ile1 5 10 15Val Ala Gly Ala Ser Ser 2024821PRTHomo sapiens 248Met Arg Leu Leu Leu Ala Leu Leu Gly Val Leu Leu Ser Val Pro Gly1 5 10 15Pro Pro Val Leu Ser 2024924PRTHomo sapiens 249Met Thr Pro Ser Pro Leu Leu Leu Leu Leu Leu Pro Pro Leu Leu Leu1 5 10 15Gly Ala Phe Pro Pro Ala Ala Ala 2025019PRTHomo sapiens 250Met Phe Ser Met Arg Ile Val Cys Leu Val Leu Ser Val Val Gly Thr1 5 10 15Ala Trp Thr25126PRTHomo sapiens 251Met Ser Trp Ser Leu His Pro Arg Asn Leu Ile Leu Tyr Phe Tyr Ala1 5 10 15Leu Leu Phe Leu Ser Ser Thr Cys Val Ala 20 2525219PRTHomo sapiens 252Met Arg Leu Phe Leu Trp Asn Ala Val Leu Thr Leu Phe Val Thr Ser1 5 10 15Leu Ile Gly25321PRTHomo sapiens 253Met Arg Leu Ser Trp Phe Arg Val Leu Thr Val Leu Ser Ile Cys Leu1 5 10 15Ser Ala Val Ala Thr 2025435PRTHomo sapiens 254Met Gly Leu Gln Thr Thr Lys Trp Pro Ser His Gly Ala Phe Phe Leu1 5 10 15Lys Ser Trp Leu Ile Ile Ser Leu Gly Leu Tyr Ser Gln Val Ser Lys 20 25 30Leu Leu Ala 3525518PRTHomo sapiens 255Met Lys Thr Leu Gln Phe Phe Phe Leu Phe Cys Cys Trp Lys Ala Ile1 5 10 15Cys Cys25620PRTHomo sapiens 256Met Trp Lys Arg Trp Leu Ala Leu Ala Leu Ala Leu Val Ala Val Ala1 5 10 15Trp Val Arg Ala 2025726PRTHomo sapiens 257Met Arg Pro Gly Ala Pro Gly Pro Leu Trp Pro Leu Pro Trp Gly Ala1 5 10 15Leu Ala Trp Ala Val Gly Phe Val Ser Ser 20 2525829PRTHomo sapiens 258Met Val Arg Ala Arg His Gln Pro Gly Gly Leu Cys Leu Leu Leu Leu1 5 10 15Leu Leu Cys Gln Phe Met Glu Asp Arg Ser Ala Gln Ala 20 2525922PRTHomo sapiens 259Met Ala Met Thr Trp Ile Val Phe Ser Leu Trp Pro Leu Thr Val Phe1 5 10 15Met Gly His Ile Gly Gly 2026017PRTHomo sapiens 260Met Ala Val Phe Leu Gln Leu Leu Pro Leu Leu Leu Ser Arg Ala Gln1 5 10 15Gly26126PRTHomo sapiens 261Met Thr Ala Ala Ala Gly Ser Ala Gly Arg Ala Ala Val Pro Leu Leu1 5 10 15Leu Cys Ala Leu Leu Ala Pro Gly Gly Ala 20 2526219PRTHomo sapiens 262Met Asn Trp His Leu Pro Leu Phe Leu Leu Ala Ser Val Thr Leu Pro1 5 10 15Ser Ile Cys26327PRTHomo sapiens 263Met Ala Pro His Arg Pro Ala Pro Ala Leu Leu Cys Ala Leu Ser Leu1 5 10 15Ala Leu Cys Ala Leu Ser Leu Pro Val Arg Ala 20 2526432PRTHomo sapiens 264Met Gly Val Pro Thr Ala Leu Glu Ala Gly Ser Trp Arg Trp Gly Ser1 5 10 15Leu Leu Phe Ala Leu Phe Leu Ala Ala Ser Leu Gly Pro Val Ala Ala 20 25 3026524PRTHomo sapiens 265Met Asp Tyr Tyr Arg Lys Tyr Ala Ala Ile Phe Leu Val Thr Leu Ser1 5 10 15Val Phe Leu His Val Leu His Ser 2026619PRTHomo sapiens 266Met Tyr Gly Lys Ile Ile Phe Val Leu Leu Leu Ser Ala Ile Val Ser1 5 10 15Ile Ser Ala26719PRTHomo sapiens 267Met Tyr Gly Lys Ile Ile Phe Val Leu Leu Leu Ser Glu Ile Val Ser1 5 10 15Ile Ser Ala26819PRTHomo sapiens 268Met Tyr Gly Lys Ile Ile Phe Val Leu Leu Leu Ser Gly Ile Val Ser1 5 10 15Ile Ser Ala26920PRTHomo sapiens 269Met Lys Ser Ile Tyr Phe Val Ala Gly Leu Phe Val Met Leu Val Gln1 5 10 15Gly Ser Trp Gln 2027036PRTHomo sapiens 270Met Arg Leu Leu Pro Leu Ala Pro Gly Arg Leu Arg Arg Gly Ser Pro1 5 10 15Arg His Leu Pro Ser Cys Ser Pro Ala Leu Leu Leu Leu Val Leu Gly 20 25 30Gly Cys Leu Gly 3527116PRTHomo sapiens 271Met Pro Leu Leu Leu Leu Leu Leu Leu Leu Pro Ser Pro Leu His Pro1 5 10 1527227PRTHomo sapiens 272Met Ala Val Thr Asp Ser Leu Ser Arg Ala Ala Thr Val Leu Ala Thr1 5 10 15Val Leu Leu Leu Ser Phe Gly Ser Val Ala Ala 20 2527316PRTHomo sapiens 273Met Pro Ala Trp Gly Ala Leu Phe Leu Leu Trp Ala Thr Ala Glu Ala1 5 10 1527425PRTHomo sapiens 274Met Thr Pro Gln Ser Leu Leu Gln Thr Thr Leu Phe Leu Leu Ser Leu1 5 10 15Leu Phe Leu Val Gln Gly Ala His Gly 20 2527520PRTHomo sapiens 275Met Ala Thr Pro Arg Gly Leu Gly Ala Leu Leu Leu Leu Leu Leu Leu1 5 10 15Pro Thr Ser Gly 2027618PRTHomo sapiens 276Met Gln Pro Ile Leu Leu Leu Leu Ala Phe Leu Leu Leu Pro Arg Ala1 5 10 15Asp Ala27724PRTHomo sapiens 277Met Ser Arg Thr Ala Tyr Thr Val Gly Ala Leu Leu Leu Leu Leu Gly1 5 10 15Thr Leu Leu Pro Ala Ala Glu Gly 2027834PRTHomo sapiens 278Met Ala Arg Ala Ala Leu Ser Ala Ala Pro Ser Asn Pro Arg Leu Leu1 5 10 15Arg Val Ala Leu Leu Leu Leu Leu Leu Val Ala Ala Gly Arg Arg Ala 20 25 30Ala Gly27918PRTHomo sapiens 279Met Lys Leu Ser Leu Val Ala Ala Met Leu Leu Leu Leu Ser Ala Ala1 5 10 15Arg Ala28023PRTHomo sapiens 280Met Arg Gly Ser Glu Leu Pro Leu Val Leu Leu Ala Leu Val Leu Cys1 5 10 15Leu Ala Pro Arg Gly Arg Ala 2028123PRTHomo sapiens 281Met Ile Leu Asn Lys Ala Leu Met Leu Gly Ala Leu Ala Leu Thr Thr1 5 10 15Val Met Ser Pro Cys Gly Gly 2028223PRTHomo sapiens 282Met Ile Leu Asn Lys Ala Leu Met Leu Gly Ala Leu Ala Leu Thr Thr1 5 10 15Val Met Ser Pro Cys Gly Gly 2028323PRTHomo sapiens 283Met Ile Leu Asn Lys Ala Leu Leu Leu Gly Ala Leu Ala Leu Thr Thr1 5 10 15Val Met Ser Pro Cys Gly Gly 2028423PRTHomo sapiens 284Met Ile Leu Asn Lys Ala Leu Met Leu Gly Ser Leu Ala Leu Thr Thr1 5 10 15Val Met Ser Pro Cys Gly Gly 2028532PRTHomo sapiens 285Met Ser Trp Lys Lys Ala Leu Arg Ile Pro Gly Gly Leu Arg Ala Ala1 5 10 15Thr Val Thr Leu Met Leu Ser Met Leu Ser Thr Pro Val Ala Glu Gly 20 25 3028632PRTHomo sapiens 286Met Ser Trp Lys Lys Ala Leu Arg Ile Pro Gly Gly Leu Arg Val Ala1 5 10 15Thr Val Thr Leu Met Leu Ala Met Leu Ser Thr Ser Val Ala Glu Gly 20 25 3028732PRTHomo sapiens 287Met Ser Trp Lys Lys Ala Leu Arg Ile Pro Gly Gly Leu Arg Val Ala1 5 10 15Thr Val Thr Leu Met Leu Ala Met Leu Ser Thr Pro Val Ala Glu Gly 20 25 3028832PRTHomo sapiens 288Met Ser Trp Lys Lys Ala Leu Arg Ile Pro Gly Asp Leu Arg Val Ala1 5 10 15Thr Val Thr Leu Met Leu Ala Met Leu Ser Ser Leu Leu Ala Glu Gly 20 25 3028929PRTHomo sapiens 289Met Val Cys Leu Arg Leu Pro Gly Gly Ser Cys Met Ala Val Leu Thr1 5 10 15Val Thr Leu Met Val Leu Ser Ser Pro Leu Ala Leu Ala 20 2529029PRTHomo sapiens 290Met Val Cys Leu Arg Leu Pro Gly Gly Ser Cys Met Ala Val Leu Thr1 5 10 15Val Thr Leu Met Val Leu Ser Ser Pro Leu Ala Leu Ala 20 2529129PRTHomo sapiens 291Met Val Cys Leu Lys Leu Pro Gly Gly Ser Cys Met Ala Ala Leu Thr1 5 10 15Val Thr Leu Thr Val Leu Ser Ser Pro Leu Ala Leu Ala 20 2529219PRTHomo sapiens 292Met Lys His Ser Leu Asn Ala Leu Leu Ile Phe Leu Ile Ile Thr Ser1 5 10 15Ala Trp Gly29335PRTHomo sapiens 293Met Gly Arg Trp Ala Trp Val Pro Ser Pro Trp Pro Pro Pro Gly Leu1 5 10 15Gly Pro Phe Leu Leu Leu Leu Leu Leu Leu Leu Leu Leu Pro Arg Gly 20 25 30Phe Gln Pro 3529419PRTHomo sapiens 294Met Lys Phe Phe Val Phe Ala Leu Val Leu Ala Leu Met Ile Ser Met1 5 10 15Ile Ser Ala29519PRTHomo sapiens 295Met Lys Phe Phe Val Phe Ala Leu Ile Leu Ala Leu Met Leu Ser Met1 5 10 15Thr Gly Ala29621PRTHomo sapiens 296Met Val Asp Gly Thr Leu Leu Leu Leu Leu Ser Glu Ala Leu Ala Leu1 5 10 15Thr Gln Thr Trp Ala 2029735PRTHomo sapiens 297Met Leu Leu Arg Ser Lys Pro Ala Leu Pro Pro Pro Leu Met Leu Leu1 5 10 15Leu Leu Gly Pro Leu Gly Pro Leu Ser Pro Gly Ala Leu Pro Arg Pro 20 25 30Ala Gln Ala 3529818PRTHomo sapiens 298Met Ser Ala Leu Gly Ala Val Ile Ala Leu Leu Leu Trp Gly Gln Leu1 5 10 15Phe Ala29919PRTHomo sapiens 299Met Asp Trp Thr Trp Arg Ile Leu Phe Leu Val Ala Ala Ala Thr Gly1 5 10 15Ala His Ser30019PRTHomo sapiens 300Met Glu Phe Gly Leu Ser Trp Leu Phe Leu Val Ala Ile Leu Lys Gly1 5 10 15Val Gln Cys30121PRTHomo sapiens 301Met Leu Pro Cys Leu Val Val Leu Leu Ala Ala Leu Leu Ser Leu Arg1 5 10 15Leu Gly Ser Asp Ala 2030219PRTHomo sapiens 302Met Ala Trp Ser Leu Gly Ser Trp Leu Gly Gly Cys Leu Leu Val Ser1 5 10 15Ala Leu Gly30332PRTHomo sapiens 303Met Gly Ala Ala Arg Ser Pro Pro Ser Ala Val Pro Gly Pro Leu Leu1 5 10 15Gly Leu Leu Leu Leu Leu Leu Gly Val Leu Ala Pro Gly Gly Ala Ser 20 25 3030417PRTHomo sapiens 304Met Ser Leu Val Leu Leu Ser Leu Ala Ala Leu Cys Arg Ser Ala Val1 5 10 15Pro30520PRTHomo sapiens 305Met Pro Val Pro Trp Phe Leu Leu Ser Leu Ala Leu Gly Arg Ser Pro1 5 10 15Val Val Leu Ser 2030628PRTHomo sapiens 306Met Arg His Asn Trp Thr Pro Asp Leu Ser Pro Leu Trp Val Leu Leu1 5 10 15Leu Cys Ala His Val Val Thr Leu Leu Val Arg Ala 20 2530729PRTHomo sapiens 307Met Arg Ala Pro Gly Arg Pro Ala Leu Arg Pro Leu Pro Leu Pro Pro1 5 10 15Leu Leu Leu Leu Leu Leu Ala Ala Pro Trp Gly Arg Ala 20 2530829PRTHomo sapiens 308Met Gln Thr Phe Thr Met Val Leu Glu Glu Ile Trp Thr Ser Leu Phe1 5 10 15Met Trp Phe Phe Tyr Ala Leu Ile Pro Cys Leu Leu Thr 20 2530921PRTHomo sapiens 309Met Met Pro Lys His Cys Phe Leu Gly Phe Leu Ile Ser Phe Phe Leu1 5 10 15Thr Gly Val Ala Gly 2031025PRTHomo sapiens 310Met Ser Glu Val Pro Val Ala Arg Val Trp Leu Val Leu Leu Leu Leu1 5 10 15Thr Val Gln Val Gly Val Thr Ala Gly 20 2531139PRTHomo sapiens 311Met Leu Pro Arg Val Gly Cys Pro Ala Leu Pro Leu Pro Pro Pro Pro1 5 10 15Leu Leu Pro Leu Leu Pro Leu Leu Leu Leu Leu Leu Gly Ala Ser Gly 20 25 30Gly Gly Gly Gly Ala Arg Ala 3531227PRTHomo sapiens 312Met Gln Arg Ala Arg Pro Thr Leu Trp Ala Ala Ala Leu Thr Leu Leu1 5 10 15Val Leu Leu Arg Gly Pro Pro Val Ala Arg Ala 20 2531326PRTHomo sapiens 313Met Glu Arg Pro Ser Leu Arg Ala Leu Leu Leu Gly Ala Ala Gly Leu1 5 10 15Leu Leu Leu Leu Leu Pro Leu Ser Ser Ser 20 2531423PRTHomo sapiens 314Met Ala Leu Ser Phe Ser Leu Leu Met Ala Val Leu Val Leu Ser Tyr1 5 10 15Lys Ser Ile Cys Ser Leu Gly 2031523PRTHomo sapiens 315Met Ala Leu Thr Phe Ala Leu Leu Val Ala Leu Leu Val Leu Ser Cys1 5 10 15Lys Ser Ser Cys Ser Val Gly 2031623PRTHomo sapiens 316Met Ala Leu Ser Phe Ser Leu Leu Met Ala Val Leu Val Leu Ser Tyr1 5 10 15Lys Ser Ile Cys Ser Leu Gly 2031721PRTHomo sapiens 317Met Ala Leu Pro Phe Val Leu Leu Met Ala Leu Val Val Leu Asn Cys1 5 10 15Lys Ser Ile Cys Ser 2031820PRTHomo sapiens 318Met Ala Leu Pro Phe Ala Leu Leu Met Ala Leu Val Val Leu Ser Cys1 5 10 15Lys Ser Ser Cys 2031923PRTHomo sapiens 319Met Ala Arg Ser Phe Ser Leu Leu Met Val Val Leu Val Leu Ser Tyr1 5 10 15Lys Ser Ile Cys Ser Leu Gly 2032027PRTHomo sapiens 320Met Ser Thr Lys Pro Asp Met Ile Gln Lys Cys Leu Trp Leu Glu Ile1 5 10 15Leu Met Gly Ile Phe Ile Ala Gly Thr Leu Ser 20 2532121PRTHomo sapiens 321Met Ala Leu Leu Phe Pro Leu Leu Ala Ala Leu Val Met Thr Ser Tyr1 5 10 15Ser Pro Val Gly Ser 2032224PRTHomo sapiens 322Met Gly Ile Pro Met Gly Lys Ser Met Leu Val Leu Leu Thr Phe Leu1 5 10 15Ala Phe Ala Ser Cys Cys Ile Ala 2032324PRTHomo sapiens 323Met Ala Pro Arg Gly Cys Ile Val Ala Val Phe Ala Ile Phe Cys Ile1 5 10 15Ser Arg Leu Leu Cys Ser His Gly 2032424PRTHomo sapiens 324Met Arg Pro Arg Cys Cys Ile Leu Ala Leu Val Cys Trp Ile Thr Val1 5 10 15Phe Leu Leu Gln Cys Ser Lys Gly 2032518PRTHomo sapiens 325Met His Ser Ser Ala Leu Leu Cys Cys Leu Val Leu Leu Thr Gly Val1 5 10 15Arg Ala32622PRTHomo sapiens 326Met Cys Pro Ala Arg Ser Leu Leu Leu Val Ala Thr Leu Val Leu Leu1 5 10 15Asp His Leu Ser Leu Ala 2032722PRTHomo sapiens 327Met Cys His Gln Gln Leu Val Ile Ser Trp Phe Ser Leu Val Phe Leu1 5 10 15Ala Ser Pro Leu Val Ala 2032820PRTHomo sapiens 328Met Val Lys Tyr Leu Leu Leu Ser Ile Leu Gly Leu Ala Phe Leu Ser1 5 10 15Glu Ala Ala Ala 2032923PRTHomo sapiens 329Met Thr Pro Gly Lys Thr Ser Leu Val Ser Leu Leu Leu Leu Leu Ser1 5 10 15Leu Glu Ala Ile Val Lys Ala 2033024PRTHomo sapiens 330Met Lys Leu Gln Cys Val Ser Leu Trp Leu Leu Gly

Thr Ile Leu Ile1 5 10 15Leu Cys Ser Val Asp Asn His Gly 2033117PRTHomo sapiens 331Met Lys Val Leu Leu Arg Leu Ile Cys Phe Ile Ala Leu Leu Ile Ser1 5 10 15Ser33225PRTHomo sapiens 332Met Glu Ile Cys Arg Gly Leu Arg Ser His Leu Ile Thr Leu Leu Leu1 5 10 15Phe Leu Phe His Ser Glu Thr Ile Cys 20 2533324PRTHomo sapiens 333Met Lys Ala Ser Ser Leu Ala Phe Ser Leu Leu Ser Ala Ala Phe Tyr1 5 10 15Leu Leu Trp Thr Pro Ser Thr Gly 2033419PRTHomo sapiens 334Met Pro Arg Gly Trp Ala Ala Pro Leu Leu Leu Leu Leu Leu Gln Gly1 5 10 15Gly Trp Gly33533PRTHomo sapiens 335Met Ala Ala Leu Gln Lys Ser Val Ser Ser Phe Leu Met Gly Thr Leu1 5 10 15Ala Thr Ser Cys Leu Leu Leu Leu Ala Leu Leu Val Gln Gly Gly Ala 20 25 30Ala33651PRTHomo sapiens 336Met Asn Phe Gln Gln Arg Leu Gln Ser Leu Trp Thr Leu Ala Arg Pro1 5 10 15Phe Cys Pro Pro Leu Leu Ala Thr Ala Ser Gln Met Gln Met Val Val 20 25 30Leu Pro Cys Leu Gly Phe Thr Leu Leu Leu Trp Ser Gln Val Ser Gly 35 40 45Ala Gln Gly 5033732PRTHomo sapiens 337Met Arg Glu Arg Pro Arg Leu Gly Glu Asp Ser Ser Leu Ile Ser Leu1 5 10 15Phe Leu Gln Val Val Ala Phe Leu Ala Met Val Met Gly Thr His Thr 20 25 3033821PRTHomo sapiens 338Met Asp Ser Tyr Leu Leu Met Trp Gly Leu Leu Thr Phe Ile Met Val1 5 10 15Pro Gly Cys Gln Ala 2033926PRTHomo sapiens 339Met Ala Ala Pro Ala Leu Ser Trp Arg Leu Pro Leu Leu Ile Leu Leu1 5 10 15Leu Pro Leu Ala Thr Ser Trp Ala Ser Ala 20 2534022PRTHomo sapiens 340Met Leu Lys Pro Ser Leu Pro Phe Thr Ser Leu Leu Phe Leu Gln Leu1 5 10 15Pro Leu Leu Gly Val Gly 2034120PRTHomo sapiens 341Met Tyr Arg Met Gln Leu Leu Ser Cys Ile Ala Leu Ser Leu Ala Leu1 5 10 15Val Thr Asn Ser 2034219PRTHomo sapiens 342Met Ser Arg Leu Pro Val Leu Leu Leu Leu Gln Leu Leu Val Arg Pro1 5 10 15Gly Leu Gln34324PRTHomo sapiens 343Met Gly Leu Thr Ser Gln Leu Leu Pro Pro Leu Phe Phe Leu Leu Ala1 5 10 15Cys Ala Gly Asn Phe Val His Gly 2034420PRTHomo sapiens 344Met Ile Ile Val Ala His Val Leu Leu Ile Leu Leu Gly Ala Thr Glu1 5 10 15Ile Leu Gln Ala 2034519PRTHomo sapiens 345Met Leu Ala Val Gly Cys Ala Leu Leu Ala Ala Leu Leu Ala Ala Pro1 5 10 15Gly Ala Ala34620PRTHomo sapiens 346Met Thr Ile Leu Gly Thr Thr Phe Gly Met Val Phe Ser Leu Leu Gln1 5 10 15Val Val Ser Gly 2034725PRTHomo sapiens 347Met Phe His Val Ser Phe Arg Tyr Ile Phe Gly Leu Pro Pro Leu Ile1 5 10 15Leu Val Leu Leu Pro Val Ala Ser Ser 20 2534818PRTHomo sapiens 348Met Leu Leu Ala Met Val Leu Thr Ser Ala Leu Leu Leu Cys Ser Val1 5 10 15Ala Gly34918PRTHomo sapiens 349Met Gly Phe Trp Ile Leu Ala Ile Leu Thr Ile Leu Met Tyr Ser Thr1 5 10 15Ala Ala35026PRTHomo sapiens 350Met Leu Leu Ser Gln Asn Ala Phe Ile Phe Arg Ser Leu Asn Leu Val1 5 10 15Leu Met Val Tyr Ile Ser Leu Val Phe Gly 20 2535118PRTHomo sapiens 351Met Val Leu His Leu Leu Leu Phe Leu Leu Leu Thr Pro Gln Gly Gly1 5 10 15His Ser35220PRTHomo sapiens 352Met Asp Pro Arg Leu Pro Ala Trp Ala Leu Val Leu Leu Gly Pro Ala1 5 10 15Leu Val Phe Ala 2035325PRTHomo sapiens 353Met Ala Ser Leu Phe Arg Ser Tyr Leu Pro Ala Ile Trp Leu Leu Leu1 5 10 15Ser Gln Leu Leu Arg Glu Ser Leu Ala 20 2535422PRTHomo sapiens 354Met Lys Gly Ser Ile Phe Thr Leu Phe Leu Phe Ser Val Leu Phe Ala1 5 10 15Ile Ser Glu Val Arg Ser 2035524PRTHomo sapiens 355Met Ala Leu Trp Met Arg Leu Leu Pro Leu Leu Ala Leu Leu Ala Leu1 5 10 15Trp Gly Pro Asp Pro Ala Ala Ala 2035619PRTHomo sapiens 356Met Gln Leu Phe Leu Leu Leu Cys Leu Val Leu Leu Ser Pro Gln Gly1 5 10 15Ala Ser Leu35717PRTHomo sapiens 357Met Met Arg Glu Trp Val Leu Leu Met Ser Val Leu Leu Cys Gly Leu1 5 10 15Ala35823PRTHomo sapiens 358Met Lys Leu Ser Gly Met Phe Leu Leu Leu Ser Leu Ala Leu Phe Cys1 5 10 15Phe Leu Thr Gly Val Phe Ser 2035931PRTHomo sapiens 359Met Ala Arg Ala Leu Cys Pro Leu Gln Ala Leu Trp Leu Leu Glu Trp1 5 10 15Val Leu Leu Leu Leu Gly Pro Cys Ala Ala Pro Pro Ala Trp Ala 20 25 3036029PRTHomo sapiens 360Met Gly Pro Glu Arg Thr Gly Ala Ala Pro Leu Pro Leu Leu Leu Val1 5 10 15Leu Ala Leu Ser Gln Gly Ile Leu Asn Cys Cys Leu Ala 20 2536132PRTHomo sapiens 361Met Gly Pro Gly Pro Ser Arg Ala Pro Arg Ala Pro Arg Leu Met Leu1 5 10 15Cys Ala Leu Ala Leu Met Val Ala Ala Gly Gly Cys Val Val Ser Ala 20 25 3036239PRTHomo sapiens 362Met Phe Pro Thr Glu Ser Ala Trp Leu Gly Lys Arg Gly Ala Asn Pro1 5 10 15Gly Pro Glu Ala Ala Val Arg Glu Thr Val Met Leu Leu Leu Cys Leu 20 25 30Gly Val Pro Thr Gly Arg Pro 3536323PRTHomo sapiens 363Met Ala Ala Ala Gly Gln Leu Cys Leu Leu Tyr Leu Ser Ala Gly Leu1 5 10 15Leu Ser Arg Leu Gly Ala Ala 2036433PRTHomo sapiens 364Met Ala Gly Ala Arg Ser Arg Asp Pro Trp Gly Ala Ser Gly Ile Cys1 5 10 15Tyr Leu Phe Gly Ser Leu Leu Val Glu Leu Leu Phe Ser Arg Ala Val 20 25 30Ala36518PRTHomo sapiens 365Met Trp Leu Phe His Thr Leu Leu Cys Ile Ala Ser Leu Ala Leu Leu1 5 10 15Ala Ala36625PRTHomo sapiens 366Met Lys Asp Ser Cys Ile Thr Val Met Ala Met Ala Leu Leu Ser Gly1 5 10 15Phe Phe Phe Phe Ala Pro Ala Ser Ser 20 2536730PRTHomo sapiens 367Met Ala Phe Pro Pro Arg Arg Arg Leu Arg Leu Gly Pro Arg Gly Leu1 5 10 15Pro Leu Leu Leu Ser Gly Leu Leu Leu Pro Leu Cys Arg Ala 20 25 3036819PRTHomo sapiens 368Met Thr Arg Thr Arg Ala Ala Leu Leu Leu Phe Thr Ala Leu Ala Thr1 5 10 15Ser Leu Gly36922PRTHomo sapiens 369Met Leu Gly Leu Arg Pro Pro Leu Leu Ala Leu Val Gly Leu Leu Ser1 5 10 15Leu Gly Cys Val Leu Ser 2037027PRTHomo sapiens 370Met Ala Gly Pro Arg Pro Ser Pro Trp Ala Arg Leu Leu Leu Ala Ala1 5 10 15Leu Ile Ser Val Ser Leu Ser Gly Thr Leu Ala 20 2537128PRTHomo sapiens 371Met Lys Pro Pro Arg Pro Val Arg Thr Cys Ser Lys Val Leu Val Leu1 5 10 15Leu Ser Leu Leu Ala Ile His Gln Thr Thr Thr Ala 20 2537227PRTHomo sapiens 372Met Gly Thr Lys Ala Gln Val Glu Arg Lys Leu Leu Cys Leu Phe Ile1 5 10 15Leu Ala Ile Leu Leu Cys Ser Leu Ala Leu Gly 20 2537328PRTHomo sapiens 373Met Ala Arg Arg Ser Arg His Arg Leu Leu Leu Leu Leu Leu Arg Tyr1 5 10 15Leu Val Val Ala Leu Gly Tyr His Lys Ala Tyr Gly 20 2537431PRTHomo sapiens 374Met Ala Leu Arg Arg Pro Pro Arg Leu Arg Leu Cys Ala Arg Leu Pro1 5 10 15Asp Phe Phe Leu Leu Leu Leu Phe Arg Gly Cys Leu Ile Gly Ala 20 25 3037519PRTHomo sapiens 375Met Phe Cys Pro Leu Lys Leu Ile Leu Leu Pro Val Leu Leu Asp Tyr1 5 10 15Ser Leu Gly37630PRTHomo sapiens 376Met Leu Pro Pro Pro Arg Pro Ala Ala Ala Leu Ala Leu Pro Val Leu1 5 10 15Leu Leu Leu Leu Val Val Leu Thr Pro Pro Pro Thr Gly Ala 20 25 3037721PRTHomo sapiens 377Met Ser Leu Leu Val Val Ser Met Ala Cys Val Gly Phe Phe Leu Leu1 5 10 15Gln Gly Ala Trp Pro 2037820PRTHomo sapiens 378Met Leu Arg Met Arg Val Pro Ala Leu Leu Val Leu Leu Phe Cys Phe1 5 10 15Arg Gly Arg Ala 2037917PRTHomo sapiens 379Met Trp Val Pro Val Val Phe Leu Thr Leu Ser Val Thr Trp Ile Gly1 5 10 15Ala38019PRTHomo sapiens 380Met Ile Leu Phe Lys Gln Ala Thr Tyr Phe Ile Ser Leu Phe Ala Thr1 5 10 15Val Ser Cys38118PRTHomo sapiens 381Met Lys Leu Ile Thr Ile Leu Phe Leu Cys Ser Arg Leu Leu Leu Ser1 5 10 15Leu Thr38223PRTHomo sapiens 382Met Glu Trp Trp Ala Ser Ser Pro Leu Arg Leu Trp Leu Leu Leu Phe1 5 10 15Leu Leu Pro Ser Ala Gln Gly 2038320PRTHomo sapiens 383Met Val Leu Gln Thr Gln Val Phe Ile Ser Leu Leu Leu Trp Ile Ser1 5 10 15Gly Ala Tyr Gly 2038420PRTHomo sapiens 384Met Val Leu Gln Thr Gln Val Phe Ile Ser Leu Leu Leu Trp Ile Ser1 5 10 15Gly Ala Tyr Gly 2038519PRTHomo sapiens 385Met Val Val Ala Leu Arg Tyr Val Trp Pro Leu Leu Leu Cys Ser Pro1 5 10 15Cys Leu Leu38619PRTHomo sapiens 386Met Arg Phe Phe Val Pro Leu Phe Leu Val Gly Ile Leu Phe Pro Ala1 5 10 15Ile Leu Ala38721PRTHomo sapiens 387Met Gly Leu Leu Gln Leu Leu Ala Phe Ser Phe Leu Ala Leu Cys Arg1 5 10 15Ala Arg Val Arg Ala 2038833PRTHomo sapiens 388Met Arg Gly Ser His Arg Ala Ala Pro Ala Leu Arg Pro Arg Gly Arg1 5 10 15Leu Trp Pro Val Leu Ala Val Leu Ala Ala Ala Ala Ala Ala Gly Cys 20 25 30Ala38927PRTHomo sapiens 389Met Ala Pro Arg Ser Ala Arg Arg Pro Leu Leu Leu Leu Leu Pro Val1 5 10 15Ala Ala Ala Arg Pro His Ala Leu Ser Ser Ala 20 2539028PRTHomo sapiens 390Met Val Cys Phe Arg Leu Phe Pro Val Pro Gly Ser Gly Leu Val Leu1 5 10 15Val Cys Leu Val Leu Gly Ala Val Arg Ser Tyr Ala 20 2539125PRTHomo sapiens 391Met Gly Ala Leu Ala Arg Ala Leu Pro Ser Ile Leu Leu Ala Leu Leu1 5 10 15Leu Thr Ser Thr Pro Glu Ala Leu Gly 20 2539224PRTHomo sapiens 392Met Gly Pro Pro Gly Ser Pro Trp Gln Trp Val Thr Leu Leu Leu Gly1 5 10 15Leu Leu Leu Pro Pro Ala Ala Pro 2039318PRTHomo sapiens 393Met Lys Pro Leu Leu Leu Ala Val Ser Leu Gly Leu Ile Ala Ala Leu1 5 10 15Gln Ala39421PRTHomo sapiens 394Met Lys Pro Val Trp Val Ala Thr Leu Leu Trp Met Leu Leu Leu Val1 5 10 15Pro Arg Leu Gly Ala 2039519PRTHomo sapiens 395Met Ala Thr Leu Leu Leu Leu Leu Gly Val Leu Val Val Ser Pro Asp1 5 10 15Ala Leu Gly39618PRTHomo sapiens 396Met Thr Pro Pro Arg Leu Phe Trp Val Trp Leu Leu Val Ala Gly Thr1 5 10 15Gln Gly39722PRTHomo sapiens 397Met Lys Val Leu Ala Ala Gly Val Val Pro Leu Leu Leu Val Leu His1 5 10 15Trp Lys His Gly Ala Gly 2039819PRTHomo sapiens 398Met Trp Leu Leu Leu Thr Met Ala Ser Leu Ile Ser Val Leu Gly Thr1 5 10 15Thr His Gly39916PRTHomo sapiens 399Met Leu Pro Leu Trp Thr Leu Ser Leu Leu Leu Gly Ala Val Ala Gly1 5 10 1540023PRTHomo sapiens 400Met Thr Pro Ile Leu Thr Val Leu Ile Cys Leu Gly Leu Ser Leu Asp1 5 10 15Pro Arg Thr His Val Gln Ala 2040130PRTHomo sapiens 401Met Ala Gly Ser Arg Gln Arg Gly Leu Arg Ala Arg Val Arg Pro Leu1 5 10 15Phe Cys Ala Leu Leu Leu Ser Leu Gly Arg Phe Val Arg Gly 20 25 3040219PRTHomo sapiens 402Met Glu Leu Ser Trp His Val Val Phe Ile Ala Leu Leu Ser Phe Ser1 5 10 15Cys Trp Gly40347PRTHomo sapiens 403Met Gly Ser Leu Gln His Cys Cys Cys Leu Leu Pro Lys Met Gly Asp1 5 10 15Thr Trp Ala Gln Leu Pro Trp Pro Gly Pro Pro His Pro Ala Met Leu 20 25 30Leu Ile Ser Leu Leu Leu Ala Ala Gly Leu Met His Ser Asp Ala 35 40 4540425PRTHomo sapiens 404Met Ala Arg Met Ser Phe Val Ile Ala Ala Cys Gln Leu Val Leu Gly1 5 10 15Leu Leu Met Thr Ser Leu Thr Glu Ser 20 2540520PRTHomo sapiens 405Met Glu Met Leu Gln Gly Leu Leu Leu Leu Leu Leu Leu Ser Met Gly1 5 10 15Gly Ala Trp Ala 2040618PRTHomo sapiens 406Met Ser Leu Ser Ala Phe Thr Leu Phe Leu Ala Leu Ile Gly Gly Thr1 5 10 15Ser Gly40731PRTHomo sapiens 407Met Glu Pro Pro Asp Ala Pro Ala Gln Ala Arg Gly Ala Pro Arg Leu1 5 10 15Leu Leu Leu Ala Val Leu Leu Ala Ala His Pro Asp Ala Gln Ala 20 25 3040819PRTHomo sapiens 408Met Ala Trp Ala Pro Leu Leu Leu Thr Leu Leu Ala His Cys Thr Asp1 5 10 15Cys Trp Ala40920PRTHomo sapiens 409Met Lys Gly Phe Thr Ala Thr Leu Phe Leu Trp Thr Leu Ile Phe Pro1 5 10 15Ser Cys Ser Gly 2041021PRTHomo sapiens 410Met Ile Ala Ser Gln Phe Leu Ser Ala Leu Thr Leu Val Leu Leu Ile1 5 10 15Lys Glu Ser Gly Ala 2041133PRTHomo sapiens 411Met Gly Leu His Leu Arg Pro Tyr Arg Val Gly Leu Leu Pro Asp Gly1 5 10 15Leu Leu Phe Leu Leu Leu Leu Leu Met Leu Leu Ala Asp Pro Ala Leu 20 25 30Pro41222PRTHomo sapiens 412Met Glu Pro Gly Pro Ala Leu Ala Trp Leu Leu Leu Leu Ser Leu Leu1 5 10 15Ala Asp Cys Leu Lys Ala 2041318PRTHomo sapiens 413Met Lys Ala Leu Ile Val Leu Gly Leu Val Leu Leu Ser Val Thr Val1 5 10 15Gln Gly41420PRTHomo sapiens 414Met Ser Leu Phe Pro Ser Leu Pro Leu Leu Leu Leu Ser Met Val Ala1 5 10 15Ala Ser Tyr Ser 2041534PRTHomo sapiens 415Met Glu Pro Pro Gly Arg Arg Glu Cys Pro Phe Pro Ser Trp Arg Phe1 5 10 15Pro Gly Leu Leu Leu Ala Ala Met Val Leu Leu Leu Tyr Ser Phe Ser 20 25 30Asp Ala41621PRTHomo sapiens 416Met Lys Ala Leu Leu Ala Leu Pro Leu Leu Leu Leu Leu Ser Thr Pro1 5 10 15Pro Cys Ala Pro Gln 2041719PRTHomo sapiens 417Met Lys Ser Leu Ile Leu Leu Ala Ile Leu Ala Ala Leu Ala Val Val1 5 10 15Thr Leu Cys41824PRTHomo sapiens 418Met Ala Arg Ser Leu Val Cys Leu Gly Val Ile Ile Leu Leu Ser Ala1 5 10 15Phe Ser Gly Pro Gly Val Arg Gly 2041920PRTHomo sapiens 419Met Lys Thr Leu Gln Ser Thr Leu Leu Leu Leu Leu Leu Val Pro Leu1 5 10 15Ile Lys Pro Ala 2042034PRTHomo sapiens 420Met Ala Arg Ala Thr Leu Ser Ala Ala Pro Ser Asn Pro Arg Leu Leu1 5 10 15Arg Val Ala Leu Leu Leu Leu Leu Leu Val Ala Ala Ser Arg Arg Ala 20 25 30Ala Gly42134PRTHomo sapiens 421Met Ala His Ala Thr Leu Ser Ala Ala Pro Ser Asn Pro Arg Leu Leu1 5 10 15Arg Val Ala Leu Leu Leu Leu Leu Leu Val Ala Ala Ser Arg Arg Ala 20 25 30Ala Gly42220PRTHomo sapiens 422Met Gln His Arg Gly Phe Leu Leu Leu Thr Leu Leu Ala Leu Leu Ala1 5 10 15Leu Thr Ser Ala

2042319PRTHomo sapiens 423Met His Ser Phe Pro Pro Leu Leu Leu Leu Leu Phe Trp Gly Val Val1 5 10 15Ser His Ser42425PRTHomo sapiens 424Met Val Ser Arg Lys Ala Val Ala Ala Leu Leu Val Val His Val Ala1 5 10 15Ala Met Leu Ala Ser Gln Thr Glu Ala 20 2542528PRTHomo sapiens 425Met Leu Cys Pro Trp Arg Thr Ala Asn Leu Gly Leu Leu Leu Ile Leu1 5 10 15Thr Ile Phe Leu Val Ala Ala Ser Ser Ser Leu Cys 20 2542626PRTHomo sapiens 426Met Phe Pro Phe Tyr Ser Cys Trp Arg Thr Gly Leu Leu Leu Leu Leu1 5 10 15Leu Ala Val Ala Val Arg Glu Ser Trp Gln 20 2542740PRTHomo sapiens 427Met Gly Ala Ala Ala Gly Arg Ser Pro His Leu Gly Pro Ala Pro Ala1 5 10 15Arg Arg Pro Gln Arg Ser Leu Leu Leu Leu Gln Leu Leu Leu Leu Val 20 25 30Ala Ala Pro Gly Ser Thr Gln Ala 35 4042831PRTHomo sapiens 428Met Gln Gln Arg Gly Ala Ala Gly Ser Arg Gly Cys Ala Leu Phe Pro1 5 10 15Leu Leu Gly Val Leu Phe Phe Gln Gly Val Tyr Ile Val Phe Ser 20 25 3042920PRTHomo sapiens 429Met Asn Val Leu Leu Gly Ser Val Val Ile Phe Ala Thr Phe Val Thr1 5 10 15Leu Cys Asn Ala 2043029PRTHomo sapiens 430Met Ala Pro Gly Ala Pro Ser Ser Ser Pro Ser Pro Ile Leu Ala Val1 5 10 15Leu Leu Phe Ser Ser Leu Val Leu Ser Pro Ala Gln Ala 20 2543117PRTHomo sapiens 431Met Leu Leu Lys Thr Val Leu Leu Leu Gly His Val Ala Gln Val Leu1 5 10 15Met43221PRTHomo sapiens 432Met Glu Ser Arg Val Leu Leu Arg Thr Phe Cys Leu Ile Phe Gly Leu1 5 10 15Gly Ala Val Trp Gly 2043322PRTHomo sapiens 433Met Ala Leu Glu Arg Leu Cys Ser Val Leu Lys Val Leu Leu Ile Thr1 5 10 15Val Leu Val Val Glu Gly 2043419PRTHomo sapiens 434Met Ala Gly Pro Ser Leu Ala Cys Cys Leu Leu Gly Leu Leu Ala Leu1 5 10 15Thr Ser Ala43519PRTHomo sapiens 435Met Pro Asp Thr Met Leu Pro Ala Cys Phe Leu Gly Leu Leu Ala Phe1 5 10 15Ser Ser Ala43620PRTHomo sapiens 436Met Pro Leu Gly Leu Leu Trp Leu Gly Leu Ala Leu Leu Gly Ala Leu1 5 10 15His Ala Gln Ala 2043728PRTHomo sapiens 437Met Leu Ala Ser Ser Ser Arg Ile Arg Ala Ala Trp Thr Arg Ala Leu1 5 10 15Leu Leu Pro Leu Leu Leu Ala Gly Pro Val Gly Cys 20 2543830PRTHomo sapiens 438Met Glu Gly Asp Arg Val Ala Gly Arg Pro Val Leu Ser Ser Leu Pro1 5 10 15Val Leu Leu Leu Leu Gln Leu Leu Met Leu Arg Ala Ala Ala 20 25 3043941PRTHomo sapiens 439Met Ser Arg Pro Gln Gly Leu Leu Trp Leu Pro Leu Leu Phe Thr Pro1 5 10 15Val Cys Val Met Leu Asn Ser Asn Val Leu Leu Trp Leu Thr Ala Leu 20 25 30Ala Ile Lys Phe Thr Leu Ile Asp Ser 35 4044024PRTHomo sapiens 440Met Ala Arg Arg Ala Gly Gly Ala Arg Met Phe Gly Ser Leu Leu Leu1 5 10 15Phe Ala Leu Leu Ala Ala Gly Val 2044131PRTHomo sapiens 441Met Gln Ser Val Gln Ser Thr Ser Phe Cys Leu Arg Lys Gln Cys Leu1 5 10 15Cys Leu Thr Phe Leu Leu Leu His Leu Leu Gly Gln Val Ala Ala 20 25 3044228PRTHomo sapiens 442Met Ser Gly Ser Ser Leu Pro Ser Ala Leu Ala Leu Ser Leu Leu Leu1 5 10 15Val Ser Gly Ser Leu Leu Pro Gly Pro Gly Ala Ala 20 2544328PRTHomo sapiens 443Met Leu Gly Asn Lys Arg Leu Gly Leu Ser Gly Leu Thr Leu Ala Leu1 5 10 15Ser Leu Leu Val Cys Leu Gly Ala Leu Ala Glu Ala 20 2544421PRTHomo sapiens 444Met Glu Arg Gly Leu Pro Leu Leu Cys Ala Val Leu Ala Leu Val Leu1 5 10 15Ala Pro Ala Gly Ala 2044531PRTHomo sapiens 445Met Ser Ser Trp Ile Arg Trp His Gly Pro Ala Met Ala Arg Leu Trp1 5 10 15Gly Phe Cys Trp Leu Val Val Gly Phe Trp Arg Ala Ala Phe Ala 20 25 3044622PRTHomo sapiens 446Met Gln Leu Thr Arg Cys Cys Phe Val Phe Leu Val Gln Gly Ser Leu1 5 10 15Tyr Leu Val Ile Cys Gly 2044728PRTHomo sapiens 447Met Met Val Ala Leu Arg Gly Ala Ser Ala Leu Leu Val Leu Phe Leu1 5 10 15Ala Ala Phe Leu Pro Pro Pro Gln Cys Thr Gln Asp 20 2544817PRTHomo sapiens 448Met Ala Arg Ile Leu Leu Leu Phe Leu Pro Gly Leu Val Ala Val Cys1 5 10 15Ala44921PRTHomo sapiens 449Met Ala Pro Leu Ala Leu His Leu Leu Val Leu Val Pro Ile Leu Leu1 5 10 15Ser Leu Val Ala Ser 2045021PRTHomo sapiens 450Met Leu Leu Ala Trp Val Gln Ala Phe Leu Val Ser Asn Met Leu Leu1 5 10 15Ala Glu Ala Tyr Gly 2045129PRTHomo sapiens 451Met Ala Ala Ala Arg Leu Cys Leu Ser Leu Leu Leu Leu Ser Thr Cys1 5 10 15Val Ala Leu Leu Leu Gln Pro Leu Leu Gly Ala Gln Gly 20 2545220PRTHomo sapiens 452Met Val Tyr Lys Thr Leu Phe Ala Leu Cys Ile Leu Thr Ala Gly Trp1 5 10 15Arg Val Gln Ser 2045326PRTHomo sapiens 453Met Ala Val Arg Glu Leu Cys Phe Pro Arg Gln Arg Gln Val Leu Phe1 5 10 15Leu Phe Leu Phe Trp Gly Val Ser Leu Ala 20 2545423PRTHomo sapiens 454Met Arg Gly Ala Asn Ala Trp Ala Pro Leu Cys Leu Leu Leu Ala Ala1 5 10 15Ala Thr Gln Leu Ser Arg Gln 2045522PRTHomo sapiens 455Met Ala Arg Ala Pro Pro Leu Leu Ala Ala Leu Thr Ala Leu Leu Ala1 5 10 15Ala Ala Ala Ala Gly Gly 2045620PRTHomo sapiens 456Met Arg Thr Leu Ala Cys Leu Leu Leu Leu Gly Cys Gly Tyr Leu Ala1 5 10 15His Val Leu Ala 2045717PRTHomo sapiens 457Met Leu Arg Arg Ala Leu Leu Cys Leu Ala Val Ala Ala Leu Val Arg1 5 10 15Ala45824PRTHomo sapiens 458Met Arg Leu Arg Arg Leu Ala Leu Phe Pro Gly Val Ala Leu Leu Leu1 5 10 15Ala Ala Ala Arg Leu Ala Ala Ala 2045920PRTHomo sapiens 459Met Ala Trp Gln Gly Leu Val Leu Ala Ala Cys Leu Leu Met Phe Pro1 5 10 15Ser Thr Thr Ala 2046022PRTHomo sapiens 460Met Gly Trp Thr Met Arg Leu Val Thr Ala Ala Leu Leu Leu Gly Leu1 5 10 15Met Met Val Val Thr Gly 2046127PRTHomo sapiens 461Met Gln Pro Arg Trp Ala Gln Gly Ala Thr Met Trp Leu Gly Val Leu1 5 10 15Leu Thr Leu Leu Leu Cys Ser Ser Leu Glu Gly 20 2546219PRTHomo sapiens 462Met Lys Leu Ala Ser Gly Phe Leu Val Leu Trp Leu Ser Leu Gly Gly1 5 10 15Gly Leu Ala46323PRTHomo sapiens 463Met Gly Thr Ser His Pro Ala Phe Leu Val Leu Gly Cys Leu Leu Thr1 5 10 15Gly Leu Ser Leu Ile Leu Cys 2046432PRTHomo sapiens 464Met Arg Leu Pro Gly Ala Met Pro Ala Leu Ala Leu Lys Gly Glu Leu1 5 10 15Leu Leu Leu Ser Leu Leu Leu Leu Leu Glu Pro Gln Ile Ser Gln Gly 20 25 3046523PRTHomo sapiens 465Met Ser Arg Ser Leu Leu Leu Arg Phe Leu Leu Phe Leu Leu Leu Leu1 5 10 15Pro Pro Leu Pro Val Leu Leu 2046621PRTHomo sapiens 466Met Ala Gln Gly Val Leu Trp Ile Leu Leu Gly Leu Leu Leu Trp Ser1 5 10 15Asp Pro Gly Thr Ala 2046721PRTHomo sapiens 467Met Ala Ala Ala Met Pro Leu Ala Leu Leu Val Leu Leu Leu Leu Gly1 5 10 15Pro Gly Gly Trp Cys 2046828PRTHomo sapiens 468Met Arg Leu Leu Gln Leu Leu Phe Arg Ala Ser Pro Ala Thr Leu Leu1 5 10 15Leu Val Leu Cys Leu Gln Leu Gly Ala Asn Lys Ala 20 2546941PRTHomo sapiens 469Met Val Gly Gln Met Tyr Cys Tyr Pro Gly Ser His Leu Ala Arg Ala1 5 10 15Leu Thr Arg Ala Leu Ala Leu Ala Leu Val Leu Ala Leu Leu Val Gly 20 25 30Pro Phe Leu Ser Gly Leu Ala Gly Ala 35 4047031PRTHomo sapiens 470Met Ser Ser Ala Ala Gly Phe Cys Ala Ser Arg Pro Gly Leu Leu Phe1 5 10 15Leu Gly Leu Leu Leu Leu Pro Leu Val Val Ala Phe Ala Ser Ala 20 25 3047118PRTHomo sapiens 471Met Arg Pro Leu Leu Leu Leu Ala Leu Leu Gly Trp Leu Leu Leu Ala1 5 10 15Glu Ala47226PRTHomo sapiens 472Met Gly Leu Gly Ala Arg Gly Ala Trp Ala Ala Leu Leu Leu Gly Thr1 5 10 15Leu Gln Val Leu Ala Leu Leu Gly Ala Ala 20 2547332PRTHomo sapiens 473Met Ile Thr Gly Val Phe Ser Met Arg Leu Trp Thr Pro Val Gly Val1 5 10 15Leu Thr Ser Leu Ala Tyr Cys Leu His Gln Arg Arg Val Ala Leu Ala 20 25 3047432PRTHomo sapiens 474Met Arg Ala Ala Pro Leu Leu Leu Ala Arg Ala Ala Ser Leu Ser Leu1 5 10 15Gly Phe Leu Phe Leu Leu Phe Phe Trp Leu Asp Arg Ser Val Leu Ala 20 25 3047528PRTHomo sapiens 475Met Ile Arg Ala Ala Pro Pro Pro Leu Phe Leu Leu Leu Leu Leu Leu1 5 10 15Leu Leu Leu Val Ser Trp Ala Ser Arg Gly Glu Ala 20 2547625PRTHomo sapiens 476Met Lys Val Leu Leu Ala Ala Ala Leu Ile Ala Gly Ser Val Phe Phe1 5 10 15Leu Leu Leu Pro Gly Pro Ser Ala Ala 20 2547716PRTHomo sapiens 477Met Leu Leu Ile Leu Leu Ser Val Ala Leu Leu Ala Leu Ser Ser Ala1 5 10 1547824PRTHomo sapiens 478Met Lys Glu Asn Val Ala Ser Ala Thr Val Phe Thr Leu Leu Leu Phe1 5 10 15Leu Asn Thr Cys Leu Leu Asn Gly 2047928PRTHomo sapiens 479Met Asn Ile Lys Gly Ser Pro Trp Lys Gly Ser Leu Leu Leu Leu Leu1 5 10 15Val Ser Asn Leu Leu Leu Cys Gln Ser Val Ala Pro 20 2548019PRTHomo sapiens 480Met Arg Gly Ala Thr Arg Val Ser Ile Met Leu Leu Leu Val Thr Val1 5 10 15Ser Asp Cys48127PRTHomo sapiens 481Met Arg Ser Leu Cys Cys Ala Pro Leu Leu Leu Leu Leu Leu Leu Pro1 5 10 15Pro Leu Leu Leu Thr Pro Arg Ala Gly Asp Ala 20 2548227PRTHomo sapiens 482Met Ile Thr Glu Gly Ala Gln Ala Pro Arg Leu Leu Leu Pro Pro Leu1 5 10 15Leu Leu Leu Leu Thr Leu Pro Ala Thr Gly Ser 20 2548323PRTHomo sapiens 483Met Ala Gly Cys Val Pro Leu Leu Gln Gly Leu Val Leu Val Leu Ala1 5 10 15Leu His Arg Val Glu Pro Ser 2048416PRTHomo sapiens 484Met Leu Leu Ile Leu Leu Ser Val Ala Leu Leu Ala Leu Ser Ser Ala1 5 10 1548516PRTHomo sapiens 485Met Leu Leu Ile Leu Leu Ser Val Ala Leu Leu Ala Phe Ser Ser Ala1 5 10 1548627PRTHomo sapiens 486Met Ala Ser Ser Pro Trp Gly Cys Val Cys Gly Leu Leu Leu Leu Leu1 5 10 15Leu Pro Leu Leu Gly Thr Gly Pro Ala Leu Gly 20 2548722PRTHomo sapiens 487Met Ala Thr His His Thr Leu Trp Met Gly Leu Ala Leu Leu Gly Val1 5 10 15Leu Gly Asp Leu Gln Ala 2048825PRTHomo sapiens 488Met Ile Pro Ala Lys Asp Met Ala Lys Val Met Ile Val Met Leu Ala1 5 10 15Ile Cys Phe Leu Thr Lys Ser Asp Gly 20 2548919PRTHomo sapiens 489Met Arg Arg Leu Leu Glu Pro Cys Trp Trp Ile Leu Phe Leu Lys Ile1 5 10 15Thr Ser Ser49028PRTHomo sapiens 490Met Val Phe Val Arg Arg Pro Trp Pro Ala Leu Thr Thr Val Leu Leu1 5 10 15Ala Leu Leu Val Cys Leu Gly Ala Leu Val Asp Ala 20 2549125PRTHomo sapiens 491Met Arg Lys Asp Arg Leu Leu His Leu Cys Leu Val Leu Leu Leu Ile1 5 10 15Leu Leu Ser Ala Ser Asp Ser Asn Ser 20 2549222PRTHomo sapiens 492Met Ala Gln Thr Ser Ser Tyr Phe Met Leu Ile Ser Cys Leu Met Phe1 5 10 15Leu Ser Gln Ser Gln Gly 2049326PRTHomo sapiens 493Met Leu Pro Pro Met Ala Leu Pro Ser Val Ser Trp Met Leu Leu Ser1 5 10 15Cys Leu Ile Leu Leu Cys Gln Val Gln Gly 20 2549423PRTHomo sapiens 494Met Glu Ala Pro Ala Ala Gly Leu Phe Leu Leu Leu Leu Leu Gly Thr1 5 10 15Trp Ala Pro Ala Pro Gly Ser 2049522PRTHomo sapiens 495Met Ala Pro Pro Gly Ser Ser Thr Val Phe Leu Leu Ala Leu Thr Ile1 5 10 15Ile Ala Ser Thr Trp Ala 2049626PRTHomo sapiens 496Met Glu Leu Ala Leu Arg Arg Ser Pro Val Pro Arg Trp Leu Leu Leu1 5 10 15Leu Pro Leu Leu Leu Gly Leu Asn Ala Gly 20 2549728PRTHomo sapiens 497Met Ala Leu Glu Lys Ser Leu Val Arg Leu Leu Leu Leu Val Leu Ile1 5 10 15Leu Leu Val Leu Gly Trp Val Gln Pro Ser Leu Gly 20 2549828PRTHomo sapiens 498Met Ala Leu Gln Arg Thr His Ser Leu Leu Leu Leu Leu Leu Leu Thr1 5 10 15Leu Leu Gly Leu Gly Leu Val Gln Pro Ser Tyr Gly 20 2549928PRTHomo sapiens 499Met Ala Arg Lys Leu Ser Val Ile Leu Ile Leu Thr Phe Ala Leu Ser1 5 10 15Val Thr Asn Pro Leu His Glu Leu Lys Ala Ala Ala 20 2550018PRTHomo sapiens 500Met Arg Leu Phe Thr Gly Ile Val Phe Cys Ser Leu Val Met Gly Val1 5 10 15Thr Ser50118PRTHomo sapiens 501Met Lys Leu Leu Thr Gly Leu Val Phe Cys Ser Leu Val Leu Gly Val1 5 10 15Ser Ser50219PRTHomo sapiens 502Met Asn Lys Pro Leu Leu Trp Ile Ser Val Leu Thr Ser Leu Leu Glu1 5 10 15Ala Phe Ala50320PRTHomo sapiens 503Met Gln Pro Thr Leu Leu Leu Ser Leu Leu Gly Ala Val Gly Leu Ala1 5 10 15Ala Val Asn Ser 2050420PRTHomo sapiens 504Met Lys Leu Met Val Leu Val Phe Thr Ile Gly Leu Thr Leu Leu Leu1 5 10 15Gly Val Gln Ala 2050538PRTHomo sapiens 505Met Gly Leu Arg Ser Trp Leu Ala Ala Pro Trp Gly Ala Leu Pro Pro1 5 10 15Arg Pro Pro Leu Leu Leu Leu Leu Leu Leu Leu Leu Leu Leu Gln Pro 20 25 30Pro Pro Pro Thr Trp Ala 3550625PRTHomo sapiens 506Met Gln Thr Pro Arg Ala Ser Pro Pro Arg Pro Ala Leu Leu Leu Leu1 5 10 15Leu Leu Leu Leu Gly Gly Ala His Gly 20 2550723PRTHomo sapiens 507Met Lys Pro Asn Ile Ile Phe Val Leu Ser Leu Leu Leu Ile Leu Glu1 5 10 15Lys Gln Ala Ala Val Met Gly 2050823PRTHomo sapiens 508Met Lys Ser Ile Ile Leu Phe Val Leu Ser Leu Leu Leu Ile Leu Glu1 5 10 15Lys Gln Ala Ala Val Met Gly 2050919PRTHomo sapiens 509Met Trp Arg Ser Leu Gly Leu Ala Leu Ala Leu Cys Leu Leu Pro Ser1 5 10 15Gly Gly Thr51024PRTHomo sapiens 510Met Leu Gln Gly Pro Gly Ser Leu Leu Leu Leu Phe Leu Ala Ser His1 5 10 15Cys Cys Leu Gly Ser Ala Arg Gly 2051132PRTHomo sapiens 511Met Val Cys Gly Ser Pro Gly Gly Met Leu Leu Leu Arg Ala Gly Leu1 5 10 15Leu Ala Leu Ala Ala Leu Cys Leu Leu Arg Val Pro Gly Ala Arg Ala 20 25 3051219PRTHomo sapiens 512Met Gly Ser Gly Leu Pro Leu Val Leu Leu Leu Thr Leu Leu Gly Ser1 5 10 15Ser His Gly51321PRTHomo sapiens 513Met Arg Leu Ser Val Cys Leu Leu Met Val Ser Leu Ala Leu Cys Cys1 5

10 15Tyr Gln Ala His Ala 2051420PRTHomo sapiens 514Met Lys Leu Ala Ala Leu Leu Gly Leu Cys Val Ala Leu Ser Cys Ser1 5 10 15Ser Ala Ala Ala 2051529PRTHomo sapiens 515Met Glu Ser Arg Gly Pro Leu Ala Thr Ser Arg Leu Leu Leu Leu Leu1 5 10 15Leu Leu Leu Leu Leu Arg His Thr Arg Gln Gly Trp Ala 20 2551616PRTHomo sapiens 516Met Lys Thr Ala Leu Ile Leu Leu Ser Ile Leu Gly Met Ala Cys Ala1 5 10 1551718PRTHomo sapiens 517Met Phe Ala Leu Gly Leu Pro Phe Leu Val Leu Leu Val Ala Ser Val1 5 10 15Glu Ser51821PRTHomo sapiens 518Met Leu Trp Leu Phe Gln Ser Leu Leu Phe Val Phe Cys Phe Gly Pro1 5 10 15Gly Asn Val Val Ser 2051922PRTHomo sapiens 519Met Ala Gly Ser Pro Thr Cys Leu Thr Leu Ile Tyr Ile Leu Trp Gln1 5 10 15Leu Thr Gly Ser Ala Ala 2052022PRTHomo sapiens 520Met Val Met Arg Pro Leu Trp Ser Leu Leu Leu Trp Glu Ala Leu Leu1 5 10 15Pro Ile Thr Val Thr Gly 2052125PRTHomo sapiens 521Met Lys Ser Ser Gly Leu Phe Pro Phe Leu Val Leu Leu Ala Leu Gly1 5 10 15Thr Leu Ala Pro Trp Ala Val Glu Gly 20 2552222PRTHomo sapiens 522Met Lys Ser Leu Thr Trp Ile Leu Gly Leu Trp Ala Leu Ala Ala Cys1 5 10 15Phe Thr Pro Gly Glu Ser 2052324PRTHomo sapiens 523Met Leu Ser Cys Arg Leu Gln Cys Ala Leu Ala Ala Leu Ser Ile Val1 5 10 15Leu Ala Leu Gly Cys Val Thr Gly 2052418PRTHomo sapiens 524Met Leu Ala Leu Leu Cys Ser Cys Leu Leu Leu Ala Ala Gly Ala Ser1 5 10 15Asp Ala52523PRTHomo sapiens 525Met Leu Pro Pro Ala Ile His Phe Tyr Leu Leu Pro Leu Ala Cys Ile1 5 10 15Leu Met Lys Ser Cys Leu Ala 2052623PRTHomo sapiens 526Met Gln Leu Pro Leu Ala Leu Cys Leu Val Cys Leu Leu Val His Thr1 5 10 15Ala Phe Arg Val Val Glu Gly 2052735PRTHomo sapiens 527Met Ala Pro Ala Arg Thr Met Ala Arg Ala Arg Leu Ala Pro Ala Gly1 5 10 15Ile Pro Ala Val Ala Leu Trp Leu Leu Cys Thr Leu Gly Leu Gln Gly 20 25 30Thr Gln Ala 3552827PRTHomo sapiens 528Met Ala Gln Leu Cys Gly Leu Arg Arg Ser Arg Ala Phe Leu Ala Leu1 5 10 15Leu Gly Ser Leu Leu Leu Ser Gly Val Leu Ala 20 2552928PRTHomo sapiens 529Met Gly His His Arg Pro Trp Leu His Ala Ser Val Leu Trp Ala Gly1 5 10 15Val Ala Ser Leu Leu Leu Pro Pro Ala Met Thr Gln 20 2553027PRTHomo sapiens 530Met Met Gln Lys Leu Leu Lys Cys Ser Arg Leu Val Leu Ala Leu Ala1 5 10 15Leu Ile Leu Val Leu Glu Ser Ser Val Gln Gly 20 2553119PRTHomo sapiens 531Met Lys Phe Leu Val Phe Ala Phe Ile Leu Ala Leu Met Val Ser Met1 5 10 15Ile Gly Ala53217PRTHomo sapiens 532Met Leu Gln Asn Ser Ala Val Leu Leu Val Leu Val Ile Ser Ala Ser1 5 10 15Ala53323PRTHomo sapiens 533Met Arg Gln Ser His Gln Leu Pro Leu Val Gly Leu Leu Leu Phe Ser1 5 10 15Phe Ile Pro Ser Gln Leu Cys 2053418PRTHomo sapiens 534Met Arg His Leu Gly Ala Phe Leu Phe Leu Leu Gly Val Leu Gly Ala1 5 10 15Leu Thr53522PRTHomo sapiens 535Met Gly Ala Met Thr Gln Leu Leu Ala Gly Val Phe Leu Ala Phe Leu1 5 10 15Ala Leu Ala Thr Glu Gly 2053621PRTHomo sapiens 536Met Glu Leu Trp Gly Ala Tyr Leu Leu Leu Cys Leu Phe Ser Leu Leu1 5 10 15Thr Gln Val Thr Thr 2053724PRTHomo sapiens 537Met Ala Thr Met Glu Asn Lys Val Ile Cys Ala Leu Val Leu Val Ser1 5 10 15Met Leu Ala Leu Gly Thr Leu Ala 2053821PRTHomo sapiens 538Met Ala Ala Arg Ala Leu Cys Met Leu Gly Leu Val Leu Ala Leu Leu1 5 10 15Ser Ser Ser Ser Ala 2053928PRTHomo sapiens 539Met Ile Tyr Thr Met Lys Lys Val His Ala Leu Trp Ala Ser Val Cys1 5 10 15Leu Leu Leu Asn Leu Ala Pro Ala Pro Leu Asn Ala 20 2554022PRTHomo sapiens 540Met Gly Arg Gly Leu Leu Arg Gly Leu Trp Pro Leu His Ile Val Leu1 5 10 15Trp Thr Arg Ile Ala Ser 2054120PRTHomo sapiens 541Met Ser Pro Phe Leu Tyr Leu Val Leu Leu Val Leu Gly Leu His Ala1 5 10 15Thr Ile His Cys 2054219PRTHomo sapiens 542Met Ala Leu Val Leu Glu Ile Phe Thr Leu Leu Ala Ser Ile Cys Trp1 5 10 15Val Ser Ala54322PRTHomo sapiens 543Met Arg Ala Pro Gly Cys Gly Arg Leu Val Leu Pro Leu Leu Leu Leu1 5 10 15Ala Ala Ala Ala Leu Ala 2054421PRTHomo sapiens 544Met Val Trp Arg Val Pro Pro Phe Leu Leu Pro Ile Leu Phe Leu Ala1 5 10 15Ser His Val Gly Ala 2054522PRTHomo sapiens 545Met Asp Ser Leu Ala Ser Leu Val Leu Cys Gly Val Ser Leu Leu Leu1 5 10 15Ser Gly Thr Val Glu Gly 2054623PRTHomo sapiens 546Met Ala Pro Phe Glu Pro Leu Ala Ser Gly Ile Leu Leu Leu Leu Trp1 5 10 15Leu Ile Ala Pro Ser Arg Ala 2054726PRTHomo sapiens 547Met Gly Ala Ala Ala Arg Thr Leu Arg Leu Ala Leu Gly Leu Leu Leu1 5 10 15Leu Ala Thr Leu Leu Arg Pro Ala Asp Ala 20 2554823PRTHomo sapiens 548Met Thr Pro Trp Leu Gly Leu Ile Val Leu Leu Gly Ser Trp Ser Leu1 5 10 15Gly Asp Trp Gly Ala Glu Ala 2054921PRTHomo sapiens 549Met Trp Arg Cys Pro Leu Gly Leu Leu Leu Leu Leu Pro Leu Ala Gly1 5 10 15His Leu Ala Leu Gly 2055024PRTHomo sapiens 550Met Thr Ser Ile Phe His Phe Ala Ile Ile Phe Met Leu Ile Leu Gln1 5 10 15Ile Arg Ile Gln Leu Ser Glu Glu 2055123PRTHomo sapiens 551Met Arg Gln Thr Leu Pro Cys Ile Tyr Phe Trp Gly Gly Leu Leu Pro1 5 10 15Phe Gly Met Leu Cys Ala Ser 2055223PRTHomo sapiens 552Met Met Ser Ala Ser Arg Leu Ala Gly Thr Leu Ile Pro Ala Met Ala1 5 10 15Phe Leu Ser Cys Val Arg Pro 2055320PRTHomo sapiens 553Met Gly Asp His Leu Asp Leu Leu Leu Gly Val Val Leu Met Ala Gly1 5 10 15Pro Val Phe Gly 2055437PRTHomo sapiens 554Met Ala Ala Ala Trp Pro Ser Gly Pro Ser Ala Pro Glu Ala Val Thr1 5 10 15Ala Arg Leu Val Gly Val Leu Trp Phe Val Ser Val Thr Thr Gly Pro 20 25 30Trp Gly Ala Val Ala 3555522PRTHomo sapiens 555Met Gly Ser Pro Gly Met Val Leu Gly Leu Leu Val Gln Ile Trp Ala1 5 10 15Leu Gln Glu Ala Ser Ser 2055626PRTHomo sapiens 556Met Ala Leu Pro Pro Gly Pro Ala Ala Leu Arg His Thr Leu Leu Leu1 5 10 15Leu Pro Ala Leu Leu Ser Ser Gly Trp Gly 20 2555733PRTHomo sapiens 557Met Trp Gly Ala Arg Arg Ser Ser Val Ser Ser Ser Trp Asn Ala Ala1 5 10 15Ser Leu Leu Gln Leu Leu Leu Ala Ala Leu Leu Ala Ala Gly Ala Arg 20 25 30Ala55830PRTHomo sapiens 558Met Ala Ala Ala Cys Gly Pro Gly Ala Ala Gly Tyr Cys Leu Leu Leu1 5 10 15Gly Leu His Leu Phe Leu Leu Thr Ala Gly Pro Ala Leu Gly 20 25 3055933PRTHomo sapiens 559Met Ala Thr Leu Trp Gly Gly Leu Leu Arg Leu Gly Ser Leu Leu Ser1 5 10 15Leu Ser Cys Leu Ala Leu Ser Val Leu Leu Leu Ala Gln Leu Ser Asp 20 25 30Ala56034PRTHomo sapiens 560Met Thr Pro Pro Glu Arg Leu Phe Leu Pro Arg Val Cys Gly Thr Thr1 5 10 15Leu His Leu Leu Leu Leu Gly Leu Leu Leu Val Leu Leu Pro Gly Ala 20 25 30Gln Gly56138PRTHomo sapiens 561Met Glu Pro Pro Gly Asp Trp Gly Pro Pro Pro Trp Arg Ser Thr Pro1 5 10 15Lys Thr Asp Val Leu Arg Leu Val Leu Tyr Leu Thr Phe Leu Gly Ala 20 25 30Pro Cys Tyr Ala Pro Ala 3556228PRTHomo sapiens 562Met Gly Ala Gly Ala Thr Gly Arg Ala Met Asp Gly Pro Arg Leu Leu1 5 10 15Leu Leu Leu Leu Leu Gly Val Ser Leu Gly Gly Ala 20 2556325PRTHomo sapiens 563Met Ala Gln His Gly Ala Met Gly Ala Phe Arg Ala Leu Cys Gly Leu1 5 10 15Ala Leu Leu Cys Ala Leu Ser Leu Gly 20 2556429PRTHomo sapiens 564Met Ala Leu Lys Val Leu Leu Glu Gln Glu Lys Thr Phe Phe Thr Leu1 5 10 15Leu Val Leu Leu Gly Tyr Leu Ser Cys Lys Val Thr Cys 20 2556522PRTHomo sapiens 565Met Ala Pro Val Ala Val Trp Ala Ala Leu Ala Val Gly Leu Glu Leu1 5 10 15Trp Ala Ala Ala His Ala 2056620PRTHomo sapiens 566Met Val Arg Leu Pro Leu Gln Cys Val Leu Trp Gly Cys Leu Leu Thr1 5 10 15Ala Val His Pro 2056729PRTHomo sapiens 567Met Arg Ala Leu Glu Gly Pro Gly Leu Ser Leu Leu Cys Leu Val Leu1 5 10 15Ala Leu Pro Ala Leu Leu Pro Val Pro Ala Val Arg Gly 20 2556818PRTHomo sapiens 568Met Arg Val Leu Leu Ala Ala Leu Gly Leu Leu Phe Leu Gly Ala Leu1 5 10 15Arg Ala56923PRTHomo sapiens 569Met Gly Asn Ser Cys Tyr Asn Ile Val Ala Thr Leu Leu Leu Val Leu1 5 10 15Asn Phe Glu Arg Thr Arg Ser 2057021PRTHomo sapiens 570Met Glu Leu Thr Glu Leu Leu Leu Val Val Met Leu Leu Leu Thr Ala1 5 10 15Arg Leu Thr Leu Ser 2057118PRTHomo sapiens 571Met Gly Thr Gln Glu Gly Trp Cys Leu Leu Leu Cys Leu Ala Leu Ser1 5 10 15Gly Ala57220PRTHomo sapiens 572Met Lys Ser Leu Ser Leu Leu Leu Ala Val Ala Leu Gly Leu Ala Thr1 5 10 15Ala Val Ser Ala 2057355PRTHomo sapiens 573Met Gly Leu Trp Gly Gln Ser Val Pro Thr Ala Ser Ser Ala Arg Ala1 5 10 15Gly Arg Tyr Pro Gly Ala Arg Thr Ala Ser Gly Thr Arg Pro Trp Leu 20 25 30Leu Asp Pro Lys Ile Leu Lys Phe Val Val Phe Ile Val Ala Val Leu 35 40 45Leu Pro Val Arg Val Asp Ser 50 5557421PRTHomo sapiens 574Met Asn Lys Leu Leu Cys Cys Ala Leu Val Phe Leu Asp Ile Ser Ile1 5 10 15Lys Trp Thr Thr Gln 2057525PRTHomo sapiens 575Met Lys Pro Ser Leu Leu Cys Arg Pro Leu Ser Cys Phe Leu Met Leu1 5 10 15Leu Pro Trp Pro Leu Ala Thr Leu Thr 20 2557618PRTHomo sapiens 576Met Leu Gly Val Leu Val Leu Gly Ala Leu Ala Leu Ala Gly Leu Gly1 5 10 15Phe Pro57719PRTHomo sapiens 577Met Arg Leu Ala Val Gly Ala Leu Leu Val Cys Ala Val Leu Gly Leu1 5 10 15Cys Leu Ala57819PRTHomo sapiens 578Met Lys Leu Val Phe Leu Val Leu Leu Phe Leu Gly Ala Leu Gly Leu1 5 10 15Cys Leu Ala57915PRTHomo sapiens 579Met Asn Pro Leu Leu Ile Leu Thr Phe Val Ala Ala Ala Leu Ala1 5 10 1558015PRTHomo sapiens 580Met Asn Leu Leu Leu Ile Leu Thr Phe Val Ala Ala Ala Val Ala1 5 10 1558120PRTHomo sapiens 581Met Thr Ala Leu Phe Leu Met Ser Met Leu Phe Gly Leu Ala Cys Gly1 5 10 15Gln Ala Met Ser 2058218PRTHomo sapiens 582Met Gly Leu Ala Trp Gly Leu Gly Val Leu Phe Leu Met His Val Cys1 5 10 15Gly Thr58327PRTHomo sapiens 583Met Ala Met Leu Leu Gly Ala Ser Val Leu Ile Leu Trp Leu Gln Pro1 5 10 15Asp Trp Val Asn Ser Gln Gln Lys Asn Asp Asp 20 2558421PRTHomo sapiens 584Met Gly Thr Ser Leu Leu Cys Trp Met Ala Leu Cys Leu Leu Gly Ala1 5 10 15Asp His Ala Asp Thr 2058526PRTHomo sapiens 585Met Glu Thr Arg Pro Arg Leu Gly Ala Thr Cys Leu Leu Gly Phe Ser1 5 10 15Phe Leu Leu Leu Val Ile Ser Ser Asp Gly 20 2558629PRTHomo sapiens 586Met His Pro Ala Val Phe Leu Ser Leu Pro Asp Leu Arg Cys Ser Leu1 5 10 15Leu Leu Leu Val Thr Trp Val Phe Thr Pro Val Thr Thr 20 2558724PRTHomo sapiens 587Met Ser Ala Pro Lys Leu Leu Ser Leu Gly Cys Ile Phe Phe Pro Leu1 5 10 15Leu Leu Phe Gln Gln Ala Arg Ala 2058820PRTHomo sapiens 588Met Arg Ala Leu Leu Ala Arg Leu Leu Leu Cys Val Leu Val Val Ser1 5 10 15Asp Ser Lys Gly 2058921PRTHomo sapiens 589Met Lys Leu Ala Val Thr Leu Thr Leu Val Thr Leu Ala Leu Cys Cys1 5 10 15Ser Ser Ala Ser Ala 2059020PRTHomo sapiens 590Met Tyr Lys Leu Ala Ser Cys Cys Leu Leu Phe Ile Gly Phe Leu Asn1 5 10 15Pro Leu Leu Ser 2059124PRTHomo sapiens 591Met Pro Gly Lys Met Val Val Ile Leu Gly Ala Ser Asn Ile Leu Trp1 5 10 15Ile Met Phe Ala Ala Ser Gln Ala 2059226PRTHomo sapiens 592Met Asn Phe Leu Leu Ser Trp Val His Trp Ser Leu Ala Leu Leu Leu1 5 10 15Tyr Leu His His Ala Lys Trp Ser Gln Ala 20 2559331PRTHomo sapiens 593Met His Leu Leu Gly Phe Phe Ser Val Ala Cys Ser Leu Leu Ala Ala1 5 10 15Ala Leu Leu Pro Gly Pro Arg Glu Ala Pro Ala Ala Ala Ala Ala 20 25 3059424PRTHomo sapiens 594Met Gln Arg Gly Ala Ala Leu Cys Leu Arg Leu Trp Leu Cys Leu Gly1 5 10 15Leu Leu Asp Gly Leu Val Ser Gly 2059524PRTHomo sapiens 595Met Glu Arg Gly Ala Gly Ala Lys Leu Leu Pro Leu Leu Leu Leu Leu1 5 10 15Arg Ala Thr Gly Phe Thr Cys Ala 2059623PRTHomo sapiens 596Met Ala Glu Leu Pro Gly Pro Phe Leu Cys Gly Ala Leu Leu Gly Phe1 5 10 15Leu Cys Leu Ser Gly Leu Ala 2059719PRTHomo sapiens 597Met Gly Ile Leu Leu Gly Leu Leu Leu Leu Gly His Leu Thr Val Asp1 5 10 15Thr Tyr Gly59816PRTHomo sapiens 598Met Thr Ala Glu Phe Leu Ser Leu Leu Cys Leu Gly Leu Cys Leu Gly1 5 10 1559919PRTHomo sapiens 599Met Ala Pro Leu Arg Pro Leu Leu Ile Leu Ala Leu Leu Ala Trp Val1 5 10 15Ala Leu Ala60022PRTHomo sapiens 600Met Ile Pro Ala Arg Phe Ala Gly Val Leu Leu Ala Leu Ala Leu Ile1 5 10 15Leu Pro Gly Thr Leu Cys 2060123PRTHomo sapiens 601Met Arg Gly Thr Pro Lys Thr His Leu Leu Ala Phe Ser Leu Leu Cys1 5 10 15Leu Leu Ser Lys Val Arg Thr 2060224PRTHomo sapiens 602Met Ala Pro Ile Ser Leu Ser Trp Leu Leu Arg Leu Ala Thr Phe Cys1 5 10 15His Leu Thr Val Leu Leu Ala Gly 2060321PRTHomo sapiens 603Met Arg Leu Leu Ile Leu Ala Leu Leu Gly Ile Cys Ser Leu Thr Ala1 5 10 15Tyr Ile Val Glu Gly 2060423PRTHomo sapiens 604Met Asp Ser Leu Arg Lys Met Leu Ile Ser Val Ala Met Leu Gly Ala1 5 10 15Gly Ala Gly Val Gly Tyr Ala 2060520PRTHomo sapiens 605Met Gly Leu Pro Gly Leu Phe Cys Leu Ala Val Leu Ala Ala Ser Ser1 5 10 15Phe Ser Lys Ala 2060617PRTHomo sapiens 606Met Val Pro Val Leu Leu Ser Leu Leu Leu Leu Leu Gly Pro Ala Val1 5 10 15Pro60716PRTHomo sapiens 607Met Leu Thr Val Ala Leu Leu Ala Leu Leu Cys Ala Ser Ala Ser Gly1 5 10 1560838PRTHomo sapiens 608Met Ala Cys Arg Gln Arg Gly Gly Ser Trp Ser Pro Ser Gly Trp Phe1 5

10 15Asn Ala Gly Trp Ser Thr Tyr Arg Ser Ile Ser Leu Phe Phe Ala Leu 20 25 30Val Thr Ser Gly Asn Ser 356092520DNAArtificial SequenceSynthetic construct 609atg aaa ttc tta gtc aac gtt gca cta gtt ttt atg gtc gtg tac att 48Met Lys Phe Leu Val Asn Val Ala Leu Val Phe Met Val Val Tyr Ile1 5 10 15tct tac atc tat gcg atg ccg atg gat gtg att tta gtt ttg tgg ttc 96Ser Tyr Ile Tyr Ala Met Pro Met Asp Val Ile Leu Val Leu Trp Phe 20 25 30tgt gta tgc acc gcc agg aca gtg ttg ggc ttt ggg atg gac cct gac 144Cys Val Cys Thr Ala Arg Thr Val Leu Gly Phe Gly Met Asp Pro Asp 35 40 45ctt cag ctg gac atc atc tca gag ctc gac ctg gtg aac acc acc ctg 192Leu Gln Leu Asp Ile Ile Ser Glu Leu Asp Leu Val Asn Thr Thr Leu 50 55 60gga gtc acg cag gtg gct gga ctg cac aac gcc agt aaa gca ttt cta 240Gly Val Thr Gln Val Ala Gly Leu His Asn Ala Ser Lys Ala Phe Leu65 70 75 80ttt caa gat gta cag aga gag atc cat tcg gcc cct cac gtg agt gag 288Phe Gln Asp Val Gln Arg Glu Ile His Ser Ala Pro His Val Ser Glu 85 90 95aag ctg atc cag cta ttc cgg aat aag agc gag ttc acc ttt ttg gct 336Lys Leu Ile Gln Leu Phe Arg Asn Lys Ser Glu Phe Thr Phe Leu Ala 100 105 110aca gtg cag cag aaa cca tcc acc tca ggg gtg ata ctg tcc atc cgg 384Thr Val Gln Gln Lys Pro Ser Thr Ser Gly Val Ile Leu Ser Ile Arg 115 120 125gag ctg gag cac agc tat ttt gaa ctg gag agc agt ggc cca aga gaa 432Glu Leu Glu His Ser Tyr Phe Glu Leu Glu Ser Ser Gly Pro Arg Glu 130 135 140gag ata cgc tac cat tac ata cat ggt gga aag ccc agg act gag gcc 480Glu Ile Arg Tyr His Tyr Ile His Gly Gly Lys Pro Arg Thr Glu Ala145 150 155 160ctt ccc tac cgc atg gca gac gga caa tgg cac aag gtc gcg ctg tca 528Leu Pro Tyr Arg Met Ala Asp Gly Gln Trp His Lys Val Ala Leu Ser 165 170 175gtg agc gcc tct cac ctc ctg ctc cac atc gac tgc aat agg att tac 576Val Ser Ala Ser His Leu Leu Leu His Ile Asp Cys Asn Arg Ile Tyr 180 185 190gag cgt gtg ata gac cct ccg gag acc aac ctt cct cca gga agc aat 624Glu Arg Val Ile Asp Pro Pro Glu Thr Asn Leu Pro Pro Gly Ser Asn 195 200 205ctg tgg ctt ggg caa cgt aac caa aag cat ggc ttt ttc aaa gga atc 672Leu Trp Leu Gly Gln Arg Asn Gln Lys His Gly Phe Phe Lys Gly Ile 210 215 220atc caa gat ggt aag atc atc ttc atg ccg aat ggt ttc atc aca cag 720Ile Gln Asp Gly Lys Ile Ile Phe Met Pro Asn Gly Phe Ile Thr Gln225 230 235 240tgt ccc aac ctc aat cgc act tgc cca aca tgc agt gac ttc ctg agc 768Cys Pro Asn Leu Asn Arg Thr Cys Pro Thr Cys Ser Asp Phe Leu Ser 245 250 255ctg gtt caa gga ata atg gat ttg caa gag ctt ttg gcc aag atg act 816Leu Val Gln Gly Ile Met Asp Leu Gln Glu Leu Leu Ala Lys Met Thr 260 265 270gca aaa ctg aat tat gca gag acg aga ctt ggt caa ctg gaa aat tgc 864Ala Lys Leu Asn Tyr Ala Glu Thr Arg Leu Gly Gln Leu Glu Asn Cys 275 280 285cac tgt gag aag acc tgc caa gtg agt ggg ctg ctc tac agg gac caa 912His Cys Glu Lys Thr Cys Gln Val Ser Gly Leu Leu Tyr Arg Asp Gln 290 295 300gac tcc tgg gtg gat ggt gac aac tgt ggg aac tgc acg tgc aaa agt 960Asp Ser Trp Val Asp Gly Asp Asn Cys Gly Asn Cys Thr Cys Lys Ser305 310 315 320ggt gcc gtg gag tgc cgc agg atg tcc tgt ccc ccg ctc aac tgt tcc 1008Gly Ala Val Glu Cys Arg Arg Met Ser Cys Pro Pro Leu Asn Cys Ser 325 330 335ccg gac tca ctt cct gtg cac att tcc ggc cag tgt tgt aaa gtt tgc 1056Pro Asp Ser Leu Pro Val His Ile Ser Gly Gln Cys Cys Lys Val Cys 340 345 350aga cca aaa tgt atc tat gga gga aaa gtt ctt gct gag ggc cag cgg 1104Arg Pro Lys Cys Ile Tyr Gly Gly Lys Val Leu Ala Glu Gly Gln Arg 355 360 365att tta acc aag acc tgc cgg gaa tgt cga ggt gga gtc ttg gta aaa 1152Ile Leu Thr Lys Thr Cys Arg Glu Cys Arg Gly Gly Val Leu Val Lys 370 375 380atc aca gaa gct tgc cct cct ttg aac tgc tca gca aag gat cat att 1200Ile Thr Glu Ala Cys Pro Pro Leu Asn Cys Ser Ala Lys Asp His Ile385 390 395 400ctt cca gag aat cag tgc tgc agg gtc tgc cca ggt cat aac ttc tgt 1248Leu Pro Glu Asn Gln Cys Cys Arg Val Cys Pro Gly His Asn Phe Cys 405 410 415gca gaa gca cct aag tgc gga gaa aac tcg gaa tgc aaa aat tgg aat 1296Ala Glu Ala Pro Lys Cys Gly Glu Asn Ser Glu Cys Lys Asn Trp Asn 420 425 430aca aaa gca acc tgt gag tgc aag aat gga tac atc tct gtc cag ggc 1344Thr Lys Ala Thr Cys Glu Cys Lys Asn Gly Tyr Ile Ser Val Gln Gly 435 440 445aac tct gca tac tgt gaa gat att gat gag tgt gca gct aaa atg cac 1392Asn Ser Ala Tyr Cys Glu Asp Ile Asp Glu Cys Ala Ala Lys Met His 450 455 460tat tgt cat gcc aac acc gtg tgt gtc aac ttg ccg ggg ttg tat cgc 1440Tyr Cys His Ala Asn Thr Val Cys Val Asn Leu Pro Gly Leu Tyr Arg465 470 475 480tgt gac tgc gtc cca ggg tac atc cgt gtg gat gac ttc tct tgt acg 1488Cys Asp Cys Val Pro Gly Tyr Ile Arg Val Asp Asp Phe Ser Cys Thr 485 490 495gag cat gat gat tgt ggc agc gga caa cac aac tgc gac aaa aat gcc 1536Glu His Asp Asp Cys Gly Ser Gly Gln His Asn Cys Asp Lys Asn Ala 500 505 510atc tgt acc aac aca gtc cag gga cac agc tgc acc tgc cag ccg ggt 1584Ile Cys Thr Asn Thr Val Gln Gly His Ser Cys Thr Cys Gln Pro Gly 515 520 525tac gtg gga aat ggc acc atc tgc aaa gca ttc tgt gaa gag ggt tgc 1632Tyr Val Gly Asn Gly Thr Ile Cys Lys Ala Phe Cys Glu Glu Gly Cys 530 535 540aga tac gga ggt acc tgt gtg gct cct aac aag tgt gtc tgt cct tct 1680Arg Tyr Gly Gly Thr Cys Val Ala Pro Asn Lys Cys Val Cys Pro Ser545 550 555 560gga ttc acg gga agc cac tgt gag aaa gat att gat gaa tgc gca gag 1728Gly Phe Thr Gly Ser His Cys Glu Lys Asp Ile Asp Glu Cys Ala Glu 565 570 575gga ttc gtt gaa tgc cac aac tac tcc cgc tgt gtt aac ctg cca ggg 1776Gly Phe Val Glu Cys His Asn Tyr Ser Arg Cys Val Asn Leu Pro Gly 580 585 590tgg tac cac tgt gag tgc aga agc ggt ttc cat gac gat ggg acc tac 1824Trp Tyr His Cys Glu Cys Arg Ser Gly Phe His Asp Asp Gly Thr Tyr 595 600 605tca ctg tcc ggg gag tcc tgc att gat atc gat gaa tgt gcc tta aga 1872Ser Leu Ser Gly Glu Ser Cys Ile Asp Ile Asp Glu Cys Ala Leu Arg 610 615 620act cac act tgt tgg aat gac tct gcc tgc atc aac tta gca gga gga 1920Thr His Thr Cys Trp Asn Asp Ser Ala Cys Ile Asn Leu Ala Gly Gly625 630 635 640ttt gac tgc ctg tgt ccc tct ggg ccc tcc tgc tct ggt gac tgt ccc 1968Phe Asp Cys Leu Cys Pro Ser Gly Pro Ser Cys Ser Gly Asp Cys Pro 645 650 655cac gaa gga ggg ctg aag cat aat ggg cag gtg tgg att ctg aga gaa 2016His Glu Gly Gly Leu Lys His Asn Gly Gln Val Trp Ile Leu Arg Glu 660 665 670gac agg tgt tca gtc tgt tcc tgc aag gat ggg aag ata ttc tgc cgg 2064Asp Arg Cys Ser Val Cys Ser Cys Lys Asp Gly Lys Ile Phe Cys Arg 675 680 685cgg aca gct tgt gat tgc cag aat cca aat gtt gac ctt ttt tgc tgc 2112Arg Thr Ala Cys Asp Cys Gln Asn Pro Asn Val Asp Leu Phe Cys Cys 690 695 700cca gag tgc gat acc agg gtc acc agc caa tgt tta gat caa agt gga 2160Pro Glu Cys Asp Thr Arg Val Thr Ser Gln Cys Leu Asp Gln Ser Gly705 710 715 720cag aag ctc tat cga agt gga gac aac tgg acc cac agc tgc cag cag 2208Gln Lys Leu Tyr Arg Ser Gly Asp Asn Trp Thr His Ser Cys Gln Gln 725 730 735tgc cga tgt ctg gaa gga gag gca gac tgc tgg cct ctg gct tgc cct 2256Cys Arg Cys Leu Glu Gly Glu Ala Asp Cys Trp Pro Leu Ala Cys Pro 740 745 750agt ttg ggc tgt gaa tac aca gcc atg ttt gaa ggg gag tgt tgt ccc 2304Ser Leu Gly Cys Glu Tyr Thr Ala Met Phe Glu Gly Glu Cys Cys Pro 755 760 765cga tgt gtc agt gac ccc tgc ctg gct ggt aat att gcc tat gac atc 2352Arg Cys Val Ser Asp Pro Cys Leu Ala Gly Asn Ile Ala Tyr Asp Ile 770 775 780aga aaa act tgc ctg gac agc ttt ggt gtt tcg agg ctg agc gga gcc 2400Arg Lys Thr Cys Leu Asp Ser Phe Gly Val Ser Arg Leu Ser Gly Ala785 790 795 800gtg tgg aca atg gct gga tct cct tgt aca acc tgc aaa tgc aag aat 2448Val Trp Thr Met Ala Gly Ser Pro Cys Thr Thr Cys Lys Cys Lys Asn 805 810 815ggg aga gtc tgc tgc tct gtg gat ctg gag tgt att gag aat aac tga 2496Gly Arg Val Cys Cys Ser Val Asp Leu Glu Cys Ile Glu Asn Asn 820 825 830gac tac aag gac gac gat gac aag 2520Asp Tyr Lys Asp Asp Asp Asp Lys 835610839PRTArtificial SequenceSynthetic Construct 610Met Lys Phe Leu Val Asn Val Ala Leu Val Phe Met Val Val Tyr Ile1 5 10 15Ser Tyr Ile Tyr Ala Met Pro Met Asp Val Ile Leu Val Leu Trp Phe 20 25 30Cys Val Cys Thr Ala Arg Thr Val Leu Gly Phe Gly Met Asp Pro Asp 35 40 45Leu Gln Leu Asp Ile Ile Ser Glu Leu Asp Leu Val Asn Thr Thr Leu 50 55 60Gly Val Thr Gln Val Ala Gly Leu His Asn Ala Ser Lys Ala Phe Leu65 70 75 80Phe Gln Asp Val Gln Arg Glu Ile His Ser Ala Pro His Val Ser Glu 85 90 95Lys Leu Ile Gln Leu Phe Arg Asn Lys Ser Glu Phe Thr Phe Leu Ala 100 105 110Thr Val Gln Gln Lys Pro Ser Thr Ser Gly Val Ile Leu Ser Ile Arg 115 120 125Glu Leu Glu His Ser Tyr Phe Glu Leu Glu Ser Ser Gly Pro Arg Glu 130 135 140Glu Ile Arg Tyr His Tyr Ile His Gly Gly Lys Pro Arg Thr Glu Ala145 150 155 160Leu Pro Tyr Arg Met Ala Asp Gly Gln Trp His Lys Val Ala Leu Ser 165 170 175Val Ser Ala Ser His Leu Leu Leu His Ile Asp Cys Asn Arg Ile Tyr 180 185 190Glu Arg Val Ile Asp Pro Pro Glu Thr Asn Leu Pro Pro Gly Ser Asn 195 200 205Leu Trp Leu Gly Gln Arg Asn Gln Lys His Gly Phe Phe Lys Gly Ile 210 215 220Ile Gln Asp Gly Lys Ile Ile Phe Met Pro Asn Gly Phe Ile Thr Gln225 230 235 240Cys Pro Asn Leu Asn Arg Thr Cys Pro Thr Cys Ser Asp Phe Leu Ser 245 250 255Leu Val Gln Gly Ile Met Asp Leu Gln Glu Leu Leu Ala Lys Met Thr 260 265 270Ala Lys Leu Asn Tyr Ala Glu Thr Arg Leu Gly Gln Leu Glu Asn Cys 275 280 285His Cys Glu Lys Thr Cys Gln Val Ser Gly Leu Leu Tyr Arg Asp Gln 290 295 300Asp Ser Trp Val Asp Gly Asp Asn Cys Gly Asn Cys Thr Cys Lys Ser305 310 315 320Gly Ala Val Glu Cys Arg Arg Met Ser Cys Pro Pro Leu Asn Cys Ser 325 330 335Pro Asp Ser Leu Pro Val His Ile Ser Gly Gln Cys Cys Lys Val Cys 340 345 350Arg Pro Lys Cys Ile Tyr Gly Gly Lys Val Leu Ala Glu Gly Gln Arg 355 360 365Ile Leu Thr Lys Thr Cys Arg Glu Cys Arg Gly Gly Val Leu Val Lys 370 375 380Ile Thr Glu Ala Cys Pro Pro Leu Asn Cys Ser Ala Lys Asp His Ile385 390 395 400Leu Pro Glu Asn Gln Cys Cys Arg Val Cys Pro Gly His Asn Phe Cys 405 410 415Ala Glu Ala Pro Lys Cys Gly Glu Asn Ser Glu Cys Lys Asn Trp Asn 420 425 430Thr Lys Ala Thr Cys Glu Cys Lys Asn Gly Tyr Ile Ser Val Gln Gly 435 440 445Asn Ser Ala Tyr Cys Glu Asp Ile Asp Glu Cys Ala Ala Lys Met His 450 455 460Tyr Cys His Ala Asn Thr Val Cys Val Asn Leu Pro Gly Leu Tyr Arg465 470 475 480Cys Asp Cys Val Pro Gly Tyr Ile Arg Val Asp Asp Phe Ser Cys Thr 485 490 495Glu His Asp Asp Cys Gly Ser Gly Gln His Asn Cys Asp Lys Asn Ala 500 505 510Ile Cys Thr Asn Thr Val Gln Gly His Ser Cys Thr Cys Gln Pro Gly 515 520 525Tyr Val Gly Asn Gly Thr Ile Cys Lys Ala Phe Cys Glu Glu Gly Cys 530 535 540Arg Tyr Gly Gly Thr Cys Val Ala Pro Asn Lys Cys Val Cys Pro Ser545 550 555 560Gly Phe Thr Gly Ser His Cys Glu Lys Asp Ile Asp Glu Cys Ala Glu 565 570 575Gly Phe Val Glu Cys His Asn Tyr Ser Arg Cys Val Asn Leu Pro Gly 580 585 590Trp Tyr His Cys Glu Cys Arg Ser Gly Phe His Asp Asp Gly Thr Tyr 595 600 605Ser Leu Ser Gly Glu Ser Cys Ile Asp Ile Asp Glu Cys Ala Leu Arg 610 615 620Thr His Thr Cys Trp Asn Asp Ser Ala Cys Ile Asn Leu Ala Gly Gly625 630 635 640Phe Asp Cys Leu Cys Pro Ser Gly Pro Ser Cys Ser Gly Asp Cys Pro 645 650 655His Glu Gly Gly Leu Lys His Asn Gly Gln Val Trp Ile Leu Arg Glu 660 665 670Asp Arg Cys Ser Val Cys Ser Cys Lys Asp Gly Lys Ile Phe Cys Arg 675 680 685Arg Thr Ala Cys Asp Cys Gln Asn Pro Asn Val Asp Leu Phe Cys Cys 690 695 700Pro Glu Cys Asp Thr Arg Val Thr Ser Gln Cys Leu Asp Gln Ser Gly705 710 715 720Gln Lys Leu Tyr Arg Ser Gly Asp Asn Trp Thr His Ser Cys Gln Gln 725 730 735Cys Arg Cys Leu Glu Gly Glu Ala Asp Cys Trp Pro Leu Ala Cys Pro 740 745 750Ser Leu Gly Cys Glu Tyr Thr Ala Met Phe Glu Gly Glu Cys Cys Pro 755 760 765Arg Cys Val Ser Asp Pro Cys Leu Ala Gly Asn Ile Ala Tyr Asp Ile 770 775 780Arg Lys Thr Cys Leu Asp Ser Phe Gly Val Ser Arg Leu Ser Gly Ala785 790 795 800Val Trp Thr Met Ala Gly Ser Pro Cys Thr Thr Cys Lys Cys Lys Asn 805 810 815Gly Arg Val Cys Cys Ser Val Asp Leu Glu Cys Ile Glu Asn Asn Asp 820 825 830Tyr Lys Asp Asp Asp Asp Lys 83561116PRTHomo sapiens 611Met Pro Met Asp Leu Ile Leu Val Val Trp Phe Cys Val Cys Thr Ala1 5 10 1561221PRTHomo sapiens 612Met Glu Ser Arg Val Leu Leu Arg Thr Phe Cys Leu Ile Phe Gly Leu1 5 10 15Gly Ala Val Trp Gly 2061320PRTArtificial SequenceSynthetic peptide 613Met Tyr Arg Met Gln Leu Leu Ser Cys Ile Ala Leu Ser Leu Ala Leu1 5 10 15Val Thr Asn Ser 2061419PRTArtificial SequenceSynthetic peptide 614Met Pro His His His His His His Gly Gly Gly Asp Asp Asp Asp Lys1 5 10 15Asp Pro Met

Claims

1. A method of expressing a peptide in a mammalian cell comprising: providing a nucleic acid construct including at least a nucleic acid encoding at least a NELL peptide in frame with a nucleic acid encoding a non-insect signal peptide; transfecting a mammalian cell with the nucleic acid construct; and culturing the mammalian cell under conditions that permit expression of the NELL peptide, wherein the non-insect signal peptide is a non-insect secretory signal peptide.

2. The method of claim 1, wherein the mammalian cell is a Chinese hamster ovary (CHO) cell.

3. The method of claim 2, wherein the nucleic acid encodes NELL1 or NELL2, wherein NELL1 is selected from the group comprising: SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, and SEQ ID NO:6, wherein NELL2 is selected from the group consisting of: SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, and SEQ ID NO:14.

4. The method of claim 2, further comprising collecting NELL peptide secreted from the cell line; and substantially purifying the NELL peptide.

5. The method of claim 3, further comprising collecting NELL peptide secreted from the cell line; and substantially purifying the NELL peptide.

6. The method of claim 5, further comprising testing the activity of the NELL peptide to induce bone formation.

7. The method of claim 6, further comprising testing the activity of the NELL peptide to induce bone formation.

8. The method of claim 1, wherein the purifying includes chromatography purification.

9. The method of claim 1, wherein the non-insect secretory signal peptide is a plant secretory signal peptide or an animal secretory signal peptide, wherein the animal secretory signal peptide is a mammalian secretory signal peptide.

10. A nucleic acid construct for expressing a NELL peptide in a mammalian cell, the nucleic acid construct comprising at least a nucleic acid encoding at least a NELL peptide in frame with a nucleic acid encoding a non-insect signal peptide that is a non-insect secretory signal peptide.

11. The nucleic acid construct of claim 10, wherein the nucleic acid encodes NELL1 or NELL2, wherein the NELL1 is selected from the group comprising: SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, and SEQ ID NO:6, wherein NELL2 is selected from the group consisting of: SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, and SEQ ID NO:14.

12. The nucleic acid construct of claim 10, wherein the mammalian cell is a CHO cell.

13. The nucleic acid construct of claim 10, wherein the non-insect secretory signal peptide is a plant secretory signal peptide or an animal secretory signal peptide, wherein the animal secretory signal peptide is a mammalian secretory signal peptide.

14. A mammalian cell line for expressing a NELL peptide, the cell line including a nucleic acid construct comprising at least a nucleic acid encoding at least a NELL peptide in frame with a nucleic acid encoding a non-insect signal peptide that is a non-insect secretory signal peptide.

15. The cell of claim 14, wherein the mammalian cell line comprises a CHO cell.

16. The cell of claim 14, wherein the CHO cell secretes NELL1 or NELL2 peptide.

17. The cell of claim 14, wherein the nucleic acid encodes NELL or NELL2 peptide, wherein NELL1 is selected from the group comprising: SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, or SEQ ID NO:6, and wherein NELL2 is selected from the group consisting of: SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, and SEQ ID NO:14.

18. The cell line of claim 14, wherein the non-insect secretory signal peptide is a plant secretory signal peptide or an animal secretory signal peptide, wherein the animal secretory signal peptide is a mammalian secretory signal peptide.

19. A recombinant peptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, and combinations thereof, and a non-insect secretory signal peptide.

20. The combinant peptide of claim 19, wherein the non-insect secretory signal peptide is a plant secretory signal peptide or an animal secretory signal peptide, wherein the animal secretory signal peptide is a mammalian secretory signal peptide.

21. A method of purifying a NELL peptide, comprising providing a crude solution containing a NELL peptide, and subjecting the crude solution to membrane chromotography to obtain a purified NELL peptide.

22. The method of claim 21, wherein the membrane chromatography is anion-exchange membrane chromatography or cation-exchange membrane chromatography.

23. The method of claim 21, wherein the NELL peptide is NELL-1 peptide or NELL-2 peptide.

24. A method of purifying a NELLpeptide, comprising providing a crude solution containing a NELL peptide, and subjecting the crude solution to chromotography process to obtain a purified NELL peptide, wherein the chromatography process comprises a medium comprising a metal ion bearing two or more charges.

25. The method of claim 24, wherein the metal ion is calcium ion.

26. The method of claim 24, wherein the NELL peptide is NELL-1 or NELL-2 peptide.