U.S. patent application number 13/098668 was filed with the patent office on 2011-10-27 for il-13 binding agents.
This patent application is currently assigned to Wyeth LLC. Invention is credited to Debra D. Donaldson, Davinder Gill, Samuel J. Goldman, Bruce Jacobson, Macy X. Jin, Marion T. Kasaian, John Knopf, Xiang-Yang Tan, Lioudmila Tchistiakova, Angela M. Widom.
Application Number | 20110262435 13/098668 |
Document ID | / |
Family ID | 36125806 |
Filed Date | 2011-10-27 |
United States Patent
Application |
20110262435 |
Kind Code |
A1 |
Tchistiakova; Lioudmila ; et
al. |
October 27, 2011 |
IL-13 BINDING AGENTS
Abstract
Agents (e.g., antibodies and fragments thereof) that bind
specifically to IL 13 and modulate the ability of IL-13 to interact
with IL-13 receptors and signaling mediators are disclosed.
Inventors: |
Tchistiakova; Lioudmila;
(Andover, MA) ; Kasaian; Marion T.; (Cambridge,
MA) ; Donaldson; Debra D.; (Medford, MA) ;
Tan; Xiang-Yang; (Reading, MA) ; Gill; Davinder;
(Burlington, MA) ; Jin; Macy X.; (Reading, MA)
; Jacobson; Bruce; (Framingham, MA) ; Goldman;
Samuel J.; (Acton, MA) ; Knopf; John;
(Carlisle, MA) ; Widom; Angela M.; (Acton,
MA) |
Assignee: |
Wyeth LLC
Madison
NJ
|
Family ID: |
36125806 |
Appl. No.: |
13/098668 |
Filed: |
May 2, 2011 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
12358111 |
Jan 22, 2009 |
7943342 |
|
|
13098668 |
|
|
|
|
11155843 |
Jun 17, 2005 |
7501121 |
|
|
12358111 |
|
|
|
|
11149025 |
Jun 9, 2005 |
|
|
|
11155843 |
|
|
|
|
60581078 |
Jun 17, 2004 |
|
|
|
Current U.S.
Class: |
424/133.1 ;
424/158.1 |
Current CPC
Class: |
C07K 2317/565 20130101;
C07K 2317/76 20130101; C07K 2317/71 20130101; C07K 2317/92
20130101; A61P 37/02 20180101; C07K 2317/56 20130101; A61P 31/12
20180101; C07K 16/244 20130101; C07K 2317/24 20130101; A61P 1/00
20180101; C07K 2317/52 20130101; A61P 35/00 20180101; A61P 11/00
20180101; A61K 2039/505 20130101; A61P 29/00 20180101; A61P 11/06
20180101 |
Class at
Publication: |
424/133.1 ;
424/158.1 |
International
Class: |
A61K 39/395 20060101
A61K039/395; A61P 11/00 20060101 A61P011/00; A61P 1/00 20060101
A61P001/00; A61P 35/00 20060101 A61P035/00; A61P 37/02 20060101
A61P037/02; A61P 29/00 20060101 A61P029/00; A61P 11/06 20060101
A61P011/06; A61P 31/12 20060101 A61P031/12 |
Claims
1-35. (canceled)
36. A method of treating an immune disorder in patient comprising
administering to the patient an effective amount of an IL-13
antibody comprising a heavy chain immunoglobulin variable domain
sequence and a light chain immunoglobulin variable domain that
binds to IL-13 with a K.sub.D of less than 10.sup.-7 M, wherein the
heavy chain variable domain comprises the amino acid sequence of:
TABLE-US-00060 (SEQ ID NO: 48) (i) G-(YF)-(NT)-I-K-D-T-Y-(MI)-H in
CDR1, (SEQ ID NO: 49) (ii)
(WR)-I-D-P-(GA)-N-D-N-I-K-Y-(SD)-(PQ)-K-F-Q-G in CDR2, and (SEQ ID
NO: 17) (iii) SEENWYDFFDY in CDR3;
and wherein the light chain variable domain comprises the amino
acid sequence of: TABLE-US-00061 (SEQ ID NO: 25) (i)
(RK)-S-S-Q-S-(LI)-(KV)-H-S-(ND)-G-N-(TN)-Y- L-(EDNQYAS) in CDR1,
(SEQ ID NO: 27) (ii) K-(LVI)-S-(NY)-(RW)-(FD)-S in CDR2, and (SEQ
ID NO: 28) (iii) Q-(GSA)-(ST)-(HEQ)-I-P in CDR3.
37. The method of claim 36, wherein the heavy chain variable domain
comprises: GFNIKDTYIH (SEQ ID NO:15), in CDR1, RIDPANDNIKYDPKFQG
(SEQ ID NO:16), in CDR2, and SEENWYDFFDY (SEQ ID NO:17), in CDR3;
and wherein the light chain variable domain sequence comprises:
RSSQSIVHSNGNTYLE (SEQ ID NO:18), in CDR1, KVSNRFS (SEQ ID NO:19),
in CDR2, and FQGSHIPYT (SEQ ID NO:20), in CDR3.
38. The method of claim 36, wherein the antibody is a recombinant
IgG that includes an Fc domain.
39. The method of claim 36, wherein the antibody comprises an Fc
domain that is mutated to reduce on or more of Fc receptor binding,
antibody glycosylation, number of cysteine residues, effector cell
function or complement function.
40. The method of claim 36, wherein the antibody is a Fab or
scFv.
41. The method of claim 36, wherein the antibody comprises human
framework regions, a human Fc region, or both.
42. The method of claim 36, wherein the frameworks of the heavy
chain domain sequence comprise: (i) at a position corresponding to
49, Gly; (ii) at a position corresponding to 72, Ala; (iii) at a
position corresponding to 48, Ile, and to 49, Gly; (iv) at a
position corresponding to 48, Ile, to 49, Gly, and to 72, Ala; (v)
at a position corresponding to 67, Lys, to 68, Ala, and to 72, Ala;
and/or (vi) at a position corresponding to 48, Ile, to 49, Gly, to
72, Ala, to 79, Ala.
43. The method of claim 36, wherein the heavy chain variable domain
sequence comprises the amino acid sequence of one or more of:
GFNIKDTYIH (SEQ ID NO:15), in CDR1, R1DPANDNIKYDPKFQG (SEQ ID
NO:16), in CDR2, or SEENWYDFFDY (SEQ ID NO:17), in CDR3.
44. The method of claim 36, wherein the light chain variable domain
sequence comprises the amino acid sequence of one more more of:
RSSQSIVHSNGNTYLE (SEQ ID NO:18), in CDR1, KVSNRFS (SEQ ID NO:19),
in CDR2, or FQGSHIPYT (SEQ ID NO:20), in CDR3.
45. The method of claim 36, wherein the antibody molecule is an
isolated, recombinant IgG antibody that comprises two polypeptide
chains: a light chain that comprises the light chain variable
domain of V2.11 (SEQ ID NO:36) and a heavy chain that comprises the
heavy chain variable domain of V2.1 (SEQ ID NO:71), V2.3 (SEQ ID
NO:73), V2.4 (SEQ ID NO:74), V2.5 (SEQ ID NO:75), V2.6 (SEQ ID
NO:76), V2.7 (SEQ ID NO:77), or V2.11 (SEQ ID NO:80).
46. The method of claim 36, wherein the immune disorder is an IL-13
related disorder.
47. The method of claim 36, wherein the immune disorder is selected
from the group consisting of: asthmatic disorders, atopic
disorders, chronic obstructive pulmonary disease, conditions
involving airway inflammation, eosinophilia, fibrosis and excess
mucus production, inflammatory conditions, autoimmune conditions,
tumors or cancers, viral infection, inflammatory bowel disease,
Crohn's disease, and ulcerative colitis.
48. The method of claim 47, wherein the immune disorder is
ulcerative colitis.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. patent
application Ser. No. 11/155,843, filed on Jun. 17, 2005. This
application claims priority to U.S. Patent Application Ser. No.
60/581,078, filed on Jun. 17, 2004, under 35 U.S.C. .sctn.119, and
is a continuation-in-part of U.S. patent application Ser. No.
11/149,025, filed on Jun. 9, 2005. The contents of the
aforementioned applications are hereby incorporated by reference.
This application also incorporates by reference PCT/US2005/021454,
filed with the U.S. Receiving Office on Jun. 17, 2005.
SEQUENCE LISTING
[0002] This application incorporates by reference the sequence
listing submitted herewith in computer readable format (CRF) and
paper format.
BACKGROUND
[0003] Interleukin-13 (IL-13) is a cytokine secreted by T
lymphocytes and mast cells (McKenzie et al. (1993) Proc. Natl.
Acad. Sci. USA 90:3735-39; Bost et al. (1996) Immunology
87:663-41). IL-13 shares several biological activities with IL-4.
For example, either IL-4 or IL-13 can cause IgE isotype switching
in B cells (Tomkinson et al. (2001) J. Immunol. 166:5792-5800).
Additionally, increased levels of cell surface CD23 and serum CD23
(sCD23) have been reported in asthmatic patients (Sanchez-Guererro
et al. (1994) Allergy 49:587-92; DiLorenzo et al. (1999) Allergy
Asthma Proc. 20:119-25). In addition, either IL-4 or IL-13 can
upregulate the expression of MHC class II and the low-affinity IgE
receptor (CD23) on B cells and monocytes, which results in enhanced
antigen presentation and regulated macrophage function (Tomkinson
et al., supra). Importantly, either IL-4 or IL-13 can increase the
expression of VCAM-1 on endothelial cells, which facilitates
preferential recruitment of eosinophils (and T cells) to the airway
tissues (Tomkinson et al., supra). Either IL-4 or IL-13 can also
increase airway mucus secretion, which can exacerbate airway
responsiveness (Tomkinson et al., supra). These observations
suggest that although IL-13 is not necessary for, or even capable
of, inducing Th2 development, IL-13 may be a key player in the
development of airway eosinophilia and AHR (Tomkinson et al.,
supra; Wills-Karp et al. (1998) Science 282:2258-61).
SUMMARY
[0004] We have discovered, inter alia, IL-13 binding agents, in
particular, anti-IL-13 antibody molecules can bind to human IL-13
and/or cynomolgus monkey IL-13, with high affinity and specificity.
In one embodiment, the antibody molecules reduce at least one
IL-13-associated activity, e.g., modulation of an inflammatory
condition. For example, the anti-IL-13 antibody molecules can bind
to IL-13 and modulate, e.g., inhibit, an interaction (e.g.,
binding) between IL-13 and an IL-13 receptor, e.g., IL-13 receptor
cd ("IL-13R.alpha.1), IL-13 receptor a2 ("IL-13R.alpha.2"), and/or
the interleukin-4 receptor alpha chain ("IL-4RI"), thereby reducing
or preventing signal transduction.
[0005] An IL-13 binding agent, such as an anti-IL-13 antibody
molecule can be used to modulate (e.g., inhibit) at least one
IL-13-associated activity in vivo. The IL-13 binding agent can be
used to treat or prevent an IL-13 associated-disorder, or to
ameliorate at least one symptom thereof. Exemplary IL-13 associated
disorders include inflammatory disorders (e.g., lung inflammation),
respiratory disorders (e.g., asthma, including allergic and
non-allergic asthma, chronic obstructive pulmonary disease (COPD)),
as well as conditions involving airway inflammation, eosinophilia,
fibrotic disorders (e.g., cystic fibrosis, liver fibrosis, and
pulmonary fibrosis), scleroderma, excess mucus production; atopic
disorders (e.g., atopic dermatitis, urticaria, eczema, allergic
rhinitis, and allergic enterogastritis), an IL-13 associated cancer
(e.g., a leukemia, glioblastoma, or lymphoma, e.g., Hodgkin's
lymphoma), gastrointestinal disorders (e.g., inflammatory bowel
diseases), liver disorders (e.g., cirrhosis), and viral
infections.
[0006] An IL-13 binding agent can be a protein, e.g., an antibody
molecule, a peptide, or a scaffold domain, that interacts with,
e.g., binds to and/or inhibits IL-13, in particular, mammalian
IL-13, e.g., human or nonhuman primate IL-13. The antibody molecule
can be an isolated antibody molecule. In one embodiment, the
binding agent is an antagonist, e.g., a binding agent that
neutralizes, reduces and/or inhibits one or more IL-13-associated
activities, including but not limited to, induction of CD23
expression; production of IgE by human B cells; phosphorylation of
a transcription factor, e.g., STAT protein (e.g., STAT6 protein);
antigen-induced eosinophilia in vivo; antigen-induced
bronchoconstriction in vivo; or drug-induced airway hyperreactivity
in vivo, among others. For example, the binding agent has a
statistically significant effect in one or more assays described
herein. Beside anti-IL-13 antibody molecules, other IL-13 binding
agents that can be used include IL-13 receptor-Fc fusions, other
soluble forms of the IL-13 receptor, soluble forms of IL-4R1,
antibodies that bind to IL-13R, and other molecules that inhibit
the interaction between IL-13 and one of its receptors.
[0007] In one aspect, the invention features an IL-13 binding agent
that that binds to IL-13, e.g., with an affinity corresponding to a
K.sub.D of less than 5.times.10.sup.-7M, 1.times.10.sup.-7M,
5.times.10.sup.-8, 1.times.10.sup.-8, 5.times.10.sup.-9,
1.times.10.sup.-9 M, more typically less than
5.times.10.sup.-1.degree., 1.times.10.sup.-10, 5.times.10.sup.-11
M, 1.times.10.sup.-11 M, or better. The IL-13 binding agent can be,
for example, an antibody molecule that includes first and second
immunoglobulin variable domain sequences that include at least a
sufficient portion of an immunoglobulin variable domain to form an
antigen-binding site that binds to IL-13. Typically, the first and
second immunoglobulin variable domain sequences correspond to
immunoglobulin variable domain sequences of a heavy and light
chain, e.g., a paired or otherwise compatible heavy and light
chain.
[0008] In one embodiment, the IL-13 binding agent binds to one or
more of the following peptides:
[0009] FVKDLLVHLKKLFREGQ.sub.130FN (SEQ ID NO:1),
[0010] FVKDLLVHLKKLFREGR.sub.130FN (SEQ ID NO:2),
[0011] FVKDLLLHLKKLFREGQ.sub.130FN (SEQ ID NO:3),
[0012] FVKDLLLHLKKLFREGR.sub.130FN (SEQ ID NO:4),
[0013] FVKDLLVHLKKLFREG (SEQ ID NO:5), and
[0014] FVKDLLLHLKKLFREG (SEQ ID NO:6), e.g., as isolated peptides,
or to an amino acid within such a peptide when the peptide is
folded in the structure of a mature IL-13 protein.
[0015] For example, the IL-13 binding agent can bind to a peptide
or to an IL-13 with comparable affinity (e.g., affinities that
differ by less than a factor of 8, 5, 4, or 2), regardless of
whether R or Q is present at position 130. In particular, the IL-13
binding agent may bind with equal affinity to the peptide or the
IL-13 regardless of whether R or Q is present at position 130.
[0016] The IL-13 binding agent may bind to one or more of the
following peptides:
[0017] KDLLVHLKKLFREGQFN (SEQ ID NO:7),
[0018] KDLLVHLKKLFREGRFN (SEQ ID NO:8),
[0019] KDLLLHLKKLFREGQFN (SEQ ID NO:9),
[0020] KDLLLHLKKLFREGRFN (SEQ ID NO:10),
[0021] KDLLVHLKKLFRE (SEQ ID NO:11),
[0022] KDLLLHLKKLFRE (SEQ ID NO:12), and
HLKKLFRE (SEQ ID NO:13), e.g., as isolated peptides, or to an amino
acid within such a peptide when the peptide is folded in the
structure of a mature IL-13 protein. The IL-13 binding agent can
bind to an epitope on IL-13 that includes at least one (e.g., one,
two, three or four) amino acid residues from a peptide sequence
recited herein (e.g., in FIG. 1B), or a corresponding peptide which
differs by at least one, but no more than one, two or three amino
acid residues, e.g., a corresponding peptide from human IL-13.
[0023] In one embodiment, the IL-13 binding agent contacts (e.g.,
makes a van der Waals contact with) an amino acid residue in helix
D (amino acid residues 114-130) of full-length IL-13 (SEQ ID NO:24
or SEQ ID NO:178), e.g., one or more of the following amino acid
residues: residue 116, 117, 118, 122, 123, 124, 125, 126, 127, or
128 of SEQ ID NO:24 or SEQ ID NO:178. In one embodiment, the IL-13
binding agent binds to an epitope on helix D, or an epitope that
includes at least one amino acid residue (e.g., at least one, two,
three, or four) on helix D, and/or may inhibit interaction of IL-13
with one or both of IL-13R.alpha.1 and/or IL-13R.alpha.2. Helix D
corresponds to amino acid residues 95-111 of mature, processed
IL-13 (SEQ ID NO:14 or SEQ ID NO:124).
[0024] In one embodiment, the IL-13 binding agent specifically
binds to an epitope, e.g., a linear or a conformational epitope, of
IL-13, e.g., mammalian, e.g., human IL-13. For example, the IL-13
binding agent competes with MJ 2-7 and/or C65 for binding to IL-13,
e.g., to human IL-13. The IL-13 binding agent may competitively
inhibit binding of MJ 2-7 and/or C65 to IL-13. The IL-13 binding
agent may specifically bind at least one amino acid in an epitope
defined by MJ 2-7 binding to human IL-13 or an epitope defined by
C65 binding to human IL-13. In one embodiment, the IL-13 binding
agent may bind to an epitope that overlaps with that of MJ 2-7 or
C65, e.g., includes at least one, two, three, or four amino acids
in common, or an epitope that, when bound, sterically prevents
interaction with MJ 2-7 or C65.
[0025] In still another embodiment, the IL-13 binding agent
specifically binds at least one amino acid in an epitope defined by
IL-13R.alpha.1 binding to human IL-13 or an epitope defined by
IL-13R.alpha.2 binding to human IL-13, or an epitope that overlaps
with such epitopes. The IL-13 binding agent may compete with
IL-13R.alpha.1 and/or IL-13R.alpha.2 for binding to IL-13, e.g., to
human IL-13. The IL-13 binding agent may competitively inhibit
binding of IL-13R.alpha.1 and/or IL-13R.alpha.2 to IL-13. The IL-13
binding agent may interact with an epitope on IL-13 which, when
bound, sterically prevents interaction with IL-13R.alpha.1 and/or
IL-13R.alpha.2.
[0026] In one embodiment, the IL-13 binding agent has a functional
activity comparable to IL-13R.alpha.2, e.g., the IL-13 binding
agent reduces or inhibits IL-13 interaction with IL-13R.alpha.1.
The IL-13 binding agent may prevent formation of a complex between
IL-13 and IL-13R.alpha.1 or disrupt or destabilize a complex
between IL-13 and IL-13R.alpha.1. In one embodiment, the IL-13
binding agent inhibits ternary complex formation, e.g., formation
of a complex between IL 13, IL-13R.alpha.1 and IL4-R.
[0027] In one embodiment, the IL-13 binding agent can inhibit one
or more IL-13-associated activities with an IC.sub.50 of about 50
nM to 5 pM, typically about 100 to 250 pM or less, e.g., better
inhibition. Agents that inhibit at least one activity of IL-13 are
considered IL-13 antagonists. In one embodiment, the IL-13 binding
agent can associate with IL-13 with kinetics in the range of
10.sup.3 to 10.sup.8 M.sup.-1s.sup.-1, typically 10.sup.4 to
10.sup.7 M.sup.-1s.sup.-1. In yet another embodiment, the IL-13
binding agent has dissociation kinetics in the range of 10.sup.-2
to 10.sup.-6 s.sup.-1, typically 10.sup.-2 to 10.sup.-5 s.sup.-1.
In one embodiment, the IL-13 binding agent binds to IL-13, e.g.,
human IL-13, with an affinity and/or kinetics similar (e.g., within
a factor 20, 10, or 5) to monoclonal antibody MJ 2-7 or C65, or
modified forms thereof, e.g., chimeric forms or humanized forms
thereof (e.g., a humanized form described herein). The affinity and
binding kinetics of an IL-13 binding agent can be tested using,
e.g., biosensor technology (BIACORE.TM.).
[0028] The IL-13 binding agent can be an antibody molecule, e.g.,
an antigen-binding fragment of an antibody (such as a Fab, F(ab')2,
Fv or a single chain Fv fragment) or an antibody that includes an
Fc domain. Typically, an anti-IL-13 antibody molecule is monoclonal
or a mono-specific.
[0029] The IL-13 binding agent, particularly an anti-IL-13 antibody
molecule, can be an effectively human, human, humanized,
CDR-grafted, chimeric, mutated, affinity matured, deimmunized,
synthetic or otherwise in vitro-generated protein. In one
embodiment, the IL-13 binding agent is a humanized antibody. In one
embodiment, the IL-13 binding agent is not antigenic in humans or
does not cause a HAMA response.
[0030] In one embodiment, the IL-13 antibody molecule includes a
heavy and light chain. The heavy and light chains of an anti-IL-13
antibody molecule can be substantially full-length (e.g., an
antibody molecule can include at least one, and preferably two
heavy chains, and at least one, and preferably two light chains) or
can include an antigen-binding fragment (e.g., a Fab, F(ab')2, Fv
or a single chain Fv fragment). In yet other embodiments, the
antibody molecule has a heavy chain constant region chosen from,
e.g., the heavy chain constant regions of IgG1, IgG2, IgG3, IgG4,
IgM, IgA1, IgA2, IgD, and IgE; particularly, chosen from, e.g., the
heavy chain constant regions of IgG1, IgG2, IgG3, and IgG4, more
particularly, the heavy chain constant regions IgG1 (e.g., human
IgG1). Typically the heavy chain constant region is human or a
modified form of a human constant region (e.g., as described in
Example 5). In another embodiment, the antibody molecule has a
light chain constant region chosen from, e.g., the light chain
constant regions of kappa or lambda, preferably kappa (e.g., human
kappa). In one embodiment, the constant region is altered, e.g.,
mutated, to modify the properties of the antibody molecule (e.g.,
to increase or decrease one or more of: Fc receptor binding,
antibody glycosylation, the number of cysteine residues, effector
cell function, or complement function). For example, the human IgG1
constant region can be mutated at one or more residues, e.g., one
or more of residues 234 and 237, as described in Example 5.
[0031] In one embodiment, the IL-13 binding agent (e.g., the
anti-IL-13 binding molecule) includes at least one, two and
preferably three CDRs from the light or heavy chain variable domain
of an antibody disclosed herein, e.g., MJ 2-7. For example, the
protein includes one or more of the following sequences within a
CDR region:
[0032] GFNIKDTYIH (SEQ ID NO:15),
[0033] RIDPANDNIKYDPKFQG (SEQ ID NO:16),
[0034] SEENWYDFFDY (SEQ ID NO:17),
[0035] RSSQSIVHSNGNTYLE (SEQ ID NO:18),
[0036] KVSNRFS (SEQ ID NO:19), and
[0037] FQGSHIPYT (SEQ ID NO:20), or a CDR having an amino acid
sequence that differs by no more than 4, 3, 2.5, 2, 1.5, 1, or 0.5
alterations (e.g., substitutions, insertions or deletions) for
every 10 amino acids (e.g., the number of differences being
proportional to the CDR length) relative to a sequence listed
above, e.g., at least one alteration but not more than two, three,
or four per CDR.
[0038] For example, the IL-13 binding agent can include, in the
light chain variable domain sequence, at least one, two, or three
of the following sequences within a CDR region:
[0039] RSSQSIVHSNGNTYLE (SEQ ID NO:18),
[0040] KVSNRFS (SEQ ID NO:19), and
[0041] FQGSHIPYT (SEQ ID NO:20), or an amino acid sequence that
differs by no more than 4, 3, 2.5, 2, 1.5, 1, or 0.5 substitutions,
insertions or deletions for every 10 amino acids relative to a
sequence listed above.
[0042] The IL-13 binding agent can include, in the heavy chain
variable domain sequence, at least one, two, or three of the
following sequences within a CDR region:
[0043] GFNIKDTYIH (SEQ ID NO:15),
[0044] RIDPANDNIKYDPKFQG (SEQ ID NO:16), and
[0045] SEENWYDFFDY (SEQ ID NO:17), or an amino acid sequence that
differs by no more than 4, 3, 2.5, 2, 1.5, 1, or 0.5 substitutions,
insertions or deletions for every 10 amino acids relative to a
sequence listed above. The heavy chain CDR3 region can be less than
13 or less than 12 amino acids in length, e.g., 11 amino acids in
length (either using Chothia or Kabat definitions).
[0046] In another example, the IL-13 binding agent can include, in
the light chain variable domain sequence, at least one, two, or
three of the following sequences within a CDR region (amino acids
in parentheses represent alternatives for a particular
position):
TABLE-US-00001 (i) (SEQ ID NO: 25)
(RK)-S-S-Q-S-(LI)-(KV)-H-S-(ND)-G-N-(TN)-Y-L- (EDNQYAS) or (SEQ ID
NO: 26) (RK)-S-S-Q-S-(LI)-(KV)-H-S-(ND)-G-N-(TN)-Y-L-E, or (SEQ ID
NO: 21) (RK)-S-S-Q-S-(LI)-(KV)-H-S-N-G-N-T-Y-L-(EDNQYAS), (ii) (SEQ
ID NO: 27) K-(LVI)-S-(NY)-(RW)-(FD)-S, or (SEQ ID NO: 22)
K-(LV)-S-(NY)-R-F-S, and (iii) (SEQ ID NO: 28)
Q-(GSA)-(ST)-(HEQ)-I-P, (SEQ ID NO: 23)
F-Q-(GSA)-(SIT)-(HEQ)-(IL)-P, or (SEQ ID NO: 194)
Q-(GSA)-(ST)-(HEQ)-I-P-Y-T, or (SEQ ID NO: 29)
F-Q-(GSA)-(SIT)-(HEQ)-(IL)-P-Y-T.
[0047] In one preferred embodiment, the IL-13 binding agent
includes all six CDR's from MJ 2-7 or closely related CDRs, e.g.,
CDRs which are identical or which have at least one amino acid
alteration, but not more than two, three or four alterations (e.g.,
substitutions, deletions, or insertions). The IL-13 binding agent
can include at least two, three, four, five, six, or seven IL-13
contacting amino acid residues of MJ 2-7
[0048] In still another example, the IL-13 binding agent includes
at least one, two, or three CDR regions that have the same
canonical structures and the corresponding CDR regions of MJ 2-7,
e.g., at least CDR1 and CDR2 of the heavy and/or light chain
variable domains of MJ 2-7.
[0049] The IL-13 binding agent can include one of the following
sequences:
TABLE-US-00002 (SEQ ID NO: 30)
DIVMTQTPLSLPVTPGEPASISCRSSQSIVHSNGNTYLEWYLQKPGQS
PQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQG SHIPYT (SEQ ID NO:
31) DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGNTYLEWFQQRPGQS
PRRLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQG SHIPYT (SEQ ID NO:
32) DIVMTQTPLSLSVTPGQPASISCRSSQSIVHSNGNTYLEWYLQKPGQS
PQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQG SHIPYT (SEQ ID NO:
33) DIVMTQTPLSLSVTPGQPASISCRSSQSIVHSNGNTYLEWYLQKPGQP
PQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQG SHIPYT (SEQ ID NO:
34) DIVMTQSPLSLPVTPGEPASISCRSSQSIVHSNGNTYLEWYLQKPGQS
PQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQG SHIPYT (SEQ ID NO:
35) DIVMTQTPLSSPVTLGQPASISCRSSQSIVHSNGNTYLEWLQQRPGQP
PRLLIYKVSNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCFQG SHIPYT (SEQ ID NO:
36) DIQMTQSPSSLSASVGDRVTITCRSSQSIVHSNGNTYLEWYQQKPGKA
PKLLIYKVSNRFSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCFQG SHIPYT (SEQ ID NO:
37) DVVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLNWFQQRPGQS
PRRLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQG SHIPYT (SEQ ID NO:
38) DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQS
PKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQG SHIPYT
or a sequence that has fewer than eight, seven, six, five, four,
three, or two alterations (e.g., substitutions, insertions or
deletions, e.g., conservative substitutions or a substitution for
an amino acid residue at a corresponding position in MJ 2-7).
Exemplary substitutions are at one of the following Kabat
positions: 2, 4, 6, 35, 36, 38, 44, 47, 49, 62, 64-69, 85, 87, 98,
99, 101, and 102. The substitutions can, for example, substitute an
amino acid at a corresponding position from MJ 2-7 into a human
framework region.
[0050] The IL-13 binding agent may also include one of the
following sequences:
TABLE-US-00003 (SEQ ID NO: 39)
DIVMTQTPLSLPVTPGEPASISC-(RK)-S-S-Q-S-(LI)-(KV)-H-
S-(ND)-G-N-(TN)-Y-L-(EDNQYAS)WYLQKPGQSPQLLIYK-
(LVI)-S-(NY)-(RW)-(FD)- SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYC
F-Q-(GSA)- (SIT)-(HEQ)-(IL)-P (SEQ ID NO: 40)
DVVMTQSPLSLPVTLGQPASISC-(RK)-S-S-Q-S-(LI)-(KV)-H-
S-(ND)-G-N-(TN)-Y-L-(EDNQYAS)WFQQRPGQSPRRLIYK-
(LVI)-S-(NY)-(RW)-(FD)-
SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCF-Q-(GSA)-(SIT)- (HEQ)-(IL)-P (SEQ
ID NO: 41) DIVMTQTPLSLSVTPGQPASISC-(RK)-S-S-Q-S-(LI)-(KV)-H-
S-(ND)-G-N-(TN)-Y-L-(EDNQYAS)WYLQKPGQSPQLLIYK-
(LVI)-S-(NY)-(RW)-(FD)-
SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCF-Q-(GSA)-(SIT)- (HEQ)-(IL)-P (SEQ
ID NO: 42) DIVMTQTPLSLSVTPGQPASISC(RK)-S-S-Q-S-(LI)-(KV)-H-
S-(ND)-G-N-(TN)-Y-L-(EDNQYAS)WYLQKPGQPPQLLIYK-
(LVI)-S-(NY)-(RW)-(FD)-
SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCF-Q-(GSA)-(SIT)- (HEQ)-(IL)-P (SEQ
ID NO: 43) DIVMTQSPLSLPVTPGEPASISC(RK)-S-S-Q-S-(LI)-(KV)-H-
S-(ND)-G-N-(TN)-Y-L-(EDNQYAS)WYLQKPGQSPQLLIYK-
(LVI)-S-(NY)-(RW)-(FD)-
SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCF-Q-(GSA)-(SIT)- (HEQ)-(IL)-P (SEQ
ID NO: 44) DIVMTQTPLSSPVTLGQPASISC(RK)-S-S-Q-S-(LI)-(KV)-H-
S-(ND)-G-N-(TN)-Y-L-(EDNQYAS)WLQQRPGQPPRLLIYK-
(LVI)-S-(NY)-(RW)-(FD)-
SGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCF-Q-(GSA)-(SIT)- (HEQ)-(IL)-P (SEQ
ID NO: 45) DIQMTQSPSSLSASVGDRVTITC(RK)-S-S-Q-S-(LI)-(KV)-H-
S-(ND)-G-N-(TN)-Y-L-(EDNQYAS)WYQQKPGKAPKLLIYK-
(LVI)-S-(NY)-(RW)-(FD)-
SGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCF-Q-(GSA)-(SIT)- (HEQ)-(IL)-P (SEQ
ID NO: 46) DVLMTQTPLSLPVSLGDQASISC(RK)-S-S-Q-S-(LI)-(KV)-H-
S-(ND)-G-N-(TN)-Y-L-(EDNQYAS)WYLQKPGQSPKLLIYK-
(LVI)-S-(NY)-(RW)-(FD)-
SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCF-Q-(GSA)-(SIT)- (HEQ)-(IL)-P
or a sequence that has fewer than eight, seven, six, five, four,
three, or two alterations (e.g., substitutions, insertions or
deletions, e.g., conservative substitutions or a substitution for
an amino acid residue at a corresponding position in MJ 2-7) in the
framework region. Exemplary substitutions are at one or more of the
following Kabat positions: 2, 4, 6, 35, 36, 38, 44, 47, 49, 62,
64-69, 85, 87, 98, 99, 101, and 102. The substitutions can, for
example, substitute an amino acid at a corresponding position from
MJ 2-7 into a human framework region. The sequences may also be
followed by the dipeptide Tyr-Thr. The FR4 region can include,
e.g., the sequence FGGGTKVEIKR (SEQ ID NO:47).
[0051] In another example, the IL-13 binding agent can include, in
the heavy chain variable domain sequence, at least one, two, or
three of the following sequences within a CDR region (amino acids
in parentheses represent alternatives for a particular
position):
TABLE-US-00004 (i) (SEQ ID NO: 48) G-(YF)-(NT)-I-K-D-T-Y-(MI)-H,
(ii) (SEQ ID NO: 49) (WR)-I-D-P-(GA)-N-D-N-I-K-Y-(SD)-(PQ)-K-F-Q-G,
and (iii) (SEQ ID NO: 17) SEENWYDFFDY.
[0052] The IL-13 binding agent can include one of the following
sequences:
TABLE-US-00005 (SEQ ID NO: 50)
QVQLVQSGAEVKKPGASVKVSCKASGFNIKDTYIHWVRQAPGQGLEWMG
RIDPANDNIKYDPKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 51) QVQLVQSGAEVKKPGASVKVSCKASGFNIKDTYIHWVRQAPGQRLEWMG
RIDPANDNIKYDPKFQGRVTITRDTSASTAYMELSSLRSEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 52) QVQLVQSGAEVKKPGASVKVSCKASGFNIKDTYIHWVRQATGQGLEWMG
RIDPANDNIKYDPKFQGRVTMTRNTSISTAYMELSSLRSEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 53) QVQLVQSGAEVKKPGASVKVSCKASGFNIKDTYIHWVRQAPGQGLEWMG
RIDPANDNIKYDPKFQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 54) QVQLVQSGAEVKKPGASVKVSCKVSGFNIKDTYIHWVRQAPGKGLEWMG
RIDPANDNIKYDPKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT SEENWYDFFDY (SEQ
ID NO: 55) QMQLVQSGAEVKKTGSSVKVSCKASGFNIKDTYIHWVRQAPGQALEWMG
RIDPANDNIKYDPKFQGRVTITRDRSMSTAYMELSSLRSEDTAMYYCAR SEENWYDFFDY (SEQ
ID NO: 56) QVQLVQSGAEVKKPGASVKVSCKASGFNIKDTYIHWVRQAPGQGLEWMG
RIDPANDNIKYDPKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 57) QMQLVQSGPEVKKPGTSVKVSCKASGFNIKDTYIHWVRQARGQRLEWIG
RIDPANDNIKYDPKFQGRVTITRDMSTSTAYMELSSLRSEDTAVYYCAA SEENWYDFFDY (SEQ
ID NO: 58) EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVA
RIDPANDNIKYDPKFQGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 59) EVQLVESGGGLVQPGRSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVS
RIDPANDNIKYDPKFQGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAK DSEENWYDFFDY (SEQ
ID NO: 60) QVQLVESGGGLVKPGGSLRLSCAASGFNIKDTYIHWIRQAPGKGLEWVS
RIDPANDNIKYDPKFQGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 61) EVQLVESGGGLVKPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVG
RIDPANDNIKYDPKFQGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT SEENWYDFFDY (SEQ
ID NO: 62) EVQLVESGGGVVRPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVS
RIDPANDNIKYDPKFQGRFTISRDNAKNSLYLQMNSLRAEDTALYHCAR SEENWYDFFDY (SEQ
ID NO: 63) EVQLVESGGGLVKPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVS
RIDPANDNIKYDPKFQGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 64) EVQLLESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVS
RIDPANDNIKYDPKFQGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK SEENWYDFFDY (SEQ
ID NO: 65) QVQLVESGGGVVQPGRSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVA
RIDPANDNIKYDPKFQGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK SEENWYDFFDY (SEQ
ID NO: 66) QVQLVESGGGVVQPGRSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVA
RIDPANDNIKYDPKFQGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 67) EVQLVESGGVVVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVS
RIDPANDNIKYDPKFQGRFTISRDNSKNSLYLQMNSLRTEDTALYYCAK DSEENWYDFFDY (SEQ
ID NO: 68) EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVS
RIDPANDNIKYDPKFQGRFTISRDNAKNSLYLQMNSLRDEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 69) EVQLVESGGGLVQPGRSLRLSCTASGFNIKDTYIHWFRQAPGKGLEWVG
RIDPANDNIKYDPKFQGRFTISRDGSKSIAYLQMNSLKTEDTAVYYCTR SEENWYDFFDY (SEQ
ID NO: 70) EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEYVS
RIDPANDNIKYDPKFQGRFTISRDNSKNTLYLQMGSLRAEDMAVYYCAR SEENWYDFFDY (SEQ
ID NO: 71) EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWIG
RIDPANDNIKYDPKFQGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 72) EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVA
RIDPANDNIKYDPKFQGKATISRDNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 73) EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVA
RIDPANDNIKYDPKFQGRFTISADNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 74) EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVG
RIDPANDNIKYDPKFQGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 75) EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVA
RIDPANDNIKYDPKFQGKATISADNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 76) EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWIG
RIDPANDNIKYDPKFQGRFTISADNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 77) EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVG
RIDPANDNIKYDPKFQGRFTISADNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 78) EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVA
RIDPANDNIKYDPKFQGRFTISRDNAKNSAYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 79) EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVG
RIDPANDNIKYDPKFQGRFTISADNAKNSAYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 80) EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWIG
RIDPANDNIKYDPKFQGRFTISADNAKNSAYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 81) EVQLVESGGGLVQPGGSLRLSCTGSGFNIKDTYIHWVRQAPGKGLEWIG
RIDPANDNIKYDPKFQGRFTISADNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 82) EVQLQQSGAELVKPGASVKLSCTGSGFNIKDTYIHWVKQRPEQGLEWIG
RIDPANDNIKYDPKFQGKATITADTSSNTAYLQLNSLTSEDTAVYYCAR SEENWYDFFDY
or a sequence that has fewer than eight, seven, six, five, four,
three, or two alterations (e.g., substitutions, insertions or
deletions, e.g., conservative substitutions or a substitution for
an amino acid residue at a corresponding position in MJ 2-7).
Exemplary substitutions are at one or more of the following Kabat
positions: 2, 4, 6, 25, 36, 37, 39, 47, 48, 93, 94, 103, 104, 106,
and 107. Exemplary substitutions can also be at one or more of the
following positions (accordingly to sequential numbering): 48, 49,
67, 68, 72, and 79. The substitutions can, for example, substitute
an amino acid at a corresponding position from MJ 2-7 into a human
framework region. In one embodiment, the sequence includes
(accordingly to sequential numbering) one or more of the following:
Ile at 48, Gly at 49, Lys at 67, Ala at 68, Ala at 72, and Ala at
79; preferably, e.g., Be at 48, Gly at 49, Ala at 72, and Ala at
79.
[0053] Further, the frameworks of the heavy chain variable domain
sequence can include: (i) at a position corresponding to 49, Gly;
(ii) at a position corresponding to 72, Ala; (iii) at positions
corresponding to 48, Ile, and to 49, Gly; (iv) at positions
corresponding to 48, Ile, to 49, Gly, and to 72, Ala; (v) at
positions corresponding to 67, Lys, to 68, Ala, and to 72, Ala;
and/or (vi) at positions corresponding to 48, Ile, to 49, Gly, to
72, Ala, to 79, Ala.
[0054] The IL-13 binding agent may also include one of the
following sequences:
TABLE-US-00006 (SEQ ID NO: 83)
QVQLVQSGAEVKKPGASVKVSCKASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGQGLEWMG(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRVTMTRDTSISTAYMELSRLRSDDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 84) QVQLVQSGAEVKKPGASVKVSCKASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGQRLEWMG(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRVTITRDTSASTAYMELSSLRSEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 85) QVQLVQSGAEVKKPGASVKVSCKASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQATGQGLEWMG(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRVTMTRNTSISTAYMELSSLRSEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 86) QVQLVQSGAEVKKPGASVKVSCKASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGQGLEWMG(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRVTMTTDTSTSTAYMELRSLRSDDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 87) QVQLVQSGAEVKKPGASVKVSCKVSG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWMG(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT SEENWYDFFDY (SEQ
ID NO: 88) QMQLVQSGAEVKKTGSSVKVSCKASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGQALEWMG(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRVTITRDRSMSTAYMELSSLRSEDTAMYYCAR SEENWYDFFDY (SEQ
ID NO: 89) QVQLVQSGAEVKKPGASVKVSCKASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGQGLEWMG(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 90) QMQLVQSGPEVKKPGTSVKVSCKASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQARGQRLEWIG(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRVTITRDMSTSTAYMELSSLRSEDTAVYYCAA SEENWYDFFDY (SEQ
ID NO: 91) EVQLVESGGGLVQPGGSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWVA(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 92) EVQLVESGGGLVQPGRSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWVS(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISRDNAKNSLYLQMNSLRAEDTALYYCAK DSEENWYDFFDY (SEQ
ID NO: 93) QVQLVESGGGLVKPGGSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WIRQAPGKGLEWVS(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 94) EVQLVESGGGLVKPGGSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWVG(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT SEENWYDFFDY (SEQ
ID NO: 95) EVQLVESGGGVVRPGGSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWVS(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISRDNAKNSLYLQMNSLRAEDTALYHCAR SEENWYDFFDY (SEQ
ID NO: 96) EVQLVESGGGLVKPGGSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWVS(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 97) EVQLLESGGGLVQPGGSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWVS(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK SEENWYDFFDY (SEQ
ID NO: 98) QVQLVESGGGVVQPGRSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWVA(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK SEENWYDFFDY (SEQ
ID NO: 99) QVQLVESGGGVVQPGRSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWVA(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 100) EVQLVESGGVVVQPGGSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWVS(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISRDNSKNSLYLQMNSLRTEDTALYYCAK DSEENWYDFFDY (SEQ
ID NO: 101) EVQLVESGGGLVQPGGSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWVS(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISRDNAKNSLYLQMNSLRDEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 102) EVQLVESGGGLVQPGRSLRLSCTASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WFRQAPGKGLEWVG(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISRDGSKSIAYLQMNSLKTEDTAVYYCTR SEENWYDFFDY (SEQ
ID NO: 103) EVQLVESGGGLVQPGGSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEYVS(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISRDNSKNTLYLQMGSLRAEDMAVYYCAR SEENWYDFFDY (SEQ
ID NO: 104) EVQLVESGGGLVQPGGSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWIG(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 105) EVQLVESGGGLVQPGGSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWVA(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GKATISRDNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 106) EVQLVESGGGLVQPGGSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWVA(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISADNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 107) EVQLVESGGGLVQPGGSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWVG(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 108) EVQLVESGGGLVQPGGSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWVA(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GKATISADNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 109) EVQLVESGGGLVQPGGSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWIG(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISADNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 110) EVQLVESGGGLVQPGGSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWVG(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISADNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 111) EVQLVESGGGLVQPGGSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWVA(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISRDNAKNSAYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 112) EVQLVESGGGLVQPGGSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWVG(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISADNAKNSAYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 113) EVQLVESGGGLVQPGGSLRLSCAASG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWIG(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISADNAKNSAYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 114) EVQLVESGGGLVQPGGSLRLSCTGSG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVRQAPGKGLEWIG(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GRFTISADNAKNSLYLQMNSLRAEDTAVYYCAR SEENWYDFFDY (SEQ
ID NO: 115) EVQLQQSGAELVKPGASVKLSCTGSG-(YF)-(NT)-I-K-D-T-Y-
(MI)-H,WVKQRPEQGLEWIG(WR)-I-D-P-(GA)-N-D-N-I-K-Y-
(SD)-(PQ)-K-F-Q-GKATITADTSSNTAYLQLNSLTSEDTAVYYCAR SEENWYDFFDY
or a sequence that has fewer than eight, seven, six, five, four,
three, or two alterations (e.g., substitutions, insertions or
deletions, e.g., conservative substitutions or a substitution for
an amino acid residue at a corresponding position in MJ 2-7) in the
framework region. Exemplary substitutions are at one or more of the
following Kabat positions: 2, 4, 6, 25, 36, 37, 39, 47, 48, 93, 94,
103, 104, 106, and 107. The substitutions can, for example,
substitute an amino acid at a corresponding position from MJ 2-7
into a human framework region. The FR4 region can include, e.g.,
the sequence WGQGTTLTVSS (SEQ ID NO:116) or WGQGTLVTVSS (SEQ ID
NO:117).
[0055] In one embodiment, the heavy chain variable domain sequence
is at least 90, 92, 93, 94, 95, 96, 97, 98, 99% identical or
identical to the heavy chain variable domain of V2.1, V2.2, V2.3,
V2.4, V2.5, V2.6, V2.7, V2.11, or other heavy chain variable domain
described herein. In one embodiment, the heavy chain variable
domain sequence includes variable domain sequence comprises a
sequence encoded by a nucleic acid that hybridizes under high
stringency conditions to the complement of a nucleic acid encoding
the heavy chain variable domain of V2.1, V2.2, V2.3, V2.4, V2.5,
V2.6, V2.7, V2.11, or other heavy chain variable domain described
herein. In one embodiment, the light chain variable domain sequence
is at least 90, 92, 93, 94, 95, 96, 97, 98, 99% identical or
identical to the light chain variable domain of V2.11 or other
light chain variable domain described herein. In one embodiment,
the light chain variable domain sequence comprises a sequence
encoded by a nucleic acid that hybridizes under high stringency
conditions to the complement of a nucleic acid encoding the light
chain variable domain of V2.11 or other light chain variable domain
described herein.
[0056] In one embodiment, the heavy chain framework (e.g., FR1,
FR2, FR3, individually, or a sequence encompassing FR1, FR2, and
FR3, but excluding CDRs) includes an amino acid sequence, which is
at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or higher identical to
the heavy chain framework of one of the following germline V
segment sequences: DP-25, DP-1, DP-12, DP-9, DP-7, DP-31, DP-32,
DP-33, DP-58, or DP-54, or another V gene which is compatible with
the canonical structure class 1-3 (see, e.g., Chothia et al. (1992)
J. Mol. Biol. 227:799-817; Tomlinson et al. (1992) J. Mol. Biol.
227:776-798). Other frameworks compatible with the canonical
structure class 1-3 include frameworks with the one or more of the
following residues according to Kabat numbering: Ala, Gly, Thr, or
Val at position 26; Gly at position 26; Tyr, Phe, or Gly at
position 27; Phe, Val, Ile, or Leu at position 29; Met, Ile, Leu,
Val, Thr, Trp, or Ile at position 34; Arg, Thr, Ala, Lys at
position 94; Gly, Ser, Asn, or Asp at position 54; and Arg at
position 71.
[0057] In one embodiment, the light chain framework (e.g., FR1,
FR2, FR3, individually, or a sequence encompassing FR1, FR2, and
FR3, but excluding CDRs) includes an amino acid sequence, which is
at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or higher identical to
the light chain framework of a V.kappa. II subgroup germline
sequence or one of the following germline V segment sequences: A17,
A1, A18, A2, A19/A3, or A23 or another V gene which is compatible
with the canonical structure class 4-1 (see, e.g., Tomlinson et al.
(1995) EMBO J. 14:4628). Other frameworks compatible with the
canonical structure class 4-1 include frameworks with the one or
more of the following residues according to Kabat numbering: Val or
Leu or Be at position 2; Ser or Pro at position 25; Ile or Leu at
position 29; Gly at position 31d; Phe or Leu at position 33; and
Phe at position 71.
[0058] In another embodiment, the light chain framework (e.g., FR1,
FR2, FR3, individually, or a sequence encompassing FR1, FR2, and
FR3, but excluding CDRs) includes an amino acid sequence, which is
at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or higher identical to
the light chain framework of a V.kappa. I subgroup germline
sequence, e.g., a DPK9 sequence.
[0059] In another embodiment, the heavy chain framework (e.g., FR1,
FR2, FR3, individually, or a sequence encompassing FR1, FR2, and
FR3, but excluding CDRs) includes an amino acid sequence, which is
at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or higher identical to
the light chain framework of a VH I subgroup germline sequence,
e.g., a DP-25 sequence or a VH III subgroup germline sequence,
e.g., a DP-54 sequence.
[0060] In one embodiment, the IL-13 binding agent includes at least
one, two and preferably three CDR's from the light or heavy chain
variable domain of an antibody disclosed herein, e.g., C65. For
example, the IL-13 binding agent includes one or more of the
following sequences within a CDR region:
[0061] QASQGTSINLN (SEQ ID NO:118),
[0062] GASNLED (SEQ ID NO:119), and
[0063] LQHSYLPWT (SEQ ID NO:120)
[0064] GFSLTGYGVN (SEQ ID NO:121),
[0065] IIWGDGSTDYNSAL (SEQ ID NO:122), and
[0066] DKTFYYDGFYRGRMDY (SEQ ID NO:123), or a CDR having an amino
acid sequence that differs by no more than 4, 3, 2.5, 2, 1.5, 1, or
0.5 substitutions, insertions or deletions for every 10 amino acids
(e.g., the number of differences being proportional to the CDR
length) relative to a sequence listed above, e.g., at least one
alteration but not more than two, three, or four per CDR. For
example, the protein can include, in the light chain variable
domain sequence, at least one, two, or three of the following
sequences within a CDR region:
[0067] QASQGTSINLN (SEQ ID NO:118),
[0068] GASNLED (SEQ ID NO:119), and
[0069] LQHSYLPWT (SEQ ID NO:120), or an amino acid sequence that
differs by no more than 4, 3, 2.5, 2, 1.5, 1, or 0.5 substitutions,
insertions or deletions for every 10 amino acids relative to a
sequence listed above.
[0070] The IL-13 binding agent can include, in the heavy chain
variable domain sequence, at least one, two, or three of the
following sequences within a CDR region:
[0071] GFSLTGYGVN (SEQ ID NO:121),
[0072] IIWGDGSTDYNSAL (SEQ ID NO:122), and
[0073] DKTFYYDGFYRGRMDY (SEQ ID NO:123), or an amino acid sequence
that differs by no more than 4, 3, 2.5, 2, 1.5, 1, or 0.5
substitutions, insertions or deletions for every 10 amino acids
relative to a sequence listed above.
[0074] In one preferred embodiment, the IL-13 binding agent
includes all six CDRs from C65 or closely related CDRs, e.g., CDRs
which are identical or which have at least one amino acid
alteration, but not more than two, three or four alterations (e.g.,
substitutions, deletions, or insertions).
[0075] In still another embodiment, the IL-13 binding agent
includes at least one, two or three CDR regions that have the same
canonical structures and the corresponding CDR regions of C65,
e.g., at least CDR1 and CDR2 of the heavy and/or light chain
variable domains of C65.
[0076] In one embodiment, the heavy chain framework (e.g., FR1,
FR2, FR3, individually, or a sequence encompassing FR1, FR2, and
FR3, but excluding CDRs) includes an amino acid sequence, which is
at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or higher identical to
the heavy chain framework of one of the following germline V
segment sequences: DP-71 or DP-67 or another V gene which is
compatible with the canonical structure class of C65 (see, e.g.,
Chothia et al. (1992) J. Mol. Biol. 227:799-817; Tomlinson et al.
(1992) J. Mol. Biol. 227:776-798).
[0077] In one embodiment, the light chain framework (e.g., FR1,
FR2, FR3, individually, or a sequence encompassing FR1, FR2, and
FR3, but excluding CDRs) includes an amino acid sequence, which is
at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or higher identical to
the light chain framework of DPK-1 or DPK-9 germline sequence or
another V gene which is compatible with the canonical structure
class of C65 (see, e.g., Tomlinson et al. (1995) EMBO J.
14:4628).
[0078] In another embodiment, the light chain framework (e.g., FR1,
FR2, FR3, individually, or a sequence encompassing FR1, FR2, and
FR3, but excluding CDRs) includes an amino acid sequence, which is
at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or higher identical to
the light chain framework of a V.kappa. I subgroup germline
sequence, e.g., a DPK-9 or DPK-1 sequence.
[0079] In another embodiment, the heavy chain framework (e.g., FR1,
FR2, FR3, individually, or a sequence encompassing FR1, FR2, and
FR3, but excluding CDRs) includes an amino acid sequence, which is
at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or higher identical to
the light chain framework of a VH IV subgroup germline sequence,
e.g., a DP-71 or DP-67 sequence.
[0080] In one embodiment, the light or the heavy chain variable
framework (e.g., the region encompassing at least FR1, FR2, FR3,
and optionally FR4) can be chosen from: (a) a light or heavy chain
variable framework including at least 80%, 85%, 90%, 95%, or 100%
of the amino acid residues from a human light or heavy chain
variable framework, e.g., a light or heavy chain variable framework
residue from a human mature antibody, a human germline sequence, a
human consensus sequence, or a human antibody described herein; (b)
a light or heavy chain variable framework including from 20% to
80%, 40% to 60%, 60% to 90%, or 70% to 95% of the amino acid
residues from a human light or heavy chain variable framework,
e.g., a light or heavy chain variable framework residue from a
human mature antibody, a human germline sequence, a human consensus
sequence; (c) a non-human framework (e.g., a rodent framework); or
(d) a non-human framework that has been modified, e.g., to remove
antigenic or cytotoxic determinants, e.g., deimmunized, or
partially humanized. In one embodiment, the heavy chain variable
domain sequence includes human residues or human consensus sequence
residues at one or more of the following positions (preferably at
least five, ten, twelve, or all): (in the FR of the variable domain
of the light chain) 4L, 35L, 36L, 38L, 43L, 44L, 58L, 46L, 62L,
63L, 64L, 65L, 66L, 67L, 68L, 69L, 70L, 71L, 73L, 85L, 87L, 98L,
and/or (in the FR of the variable domain of the heavy chain) 2H,
4H, 24H, 36H, 37H, 39H, 43H, 45H, 49H, 58H, 60H, 67H, 68H, 69H,
70H, 73H, 74H, 75H, 78H, 91H, 92H, 93H, and/or 103H (according to
the Kabat numbering).
[0081] In one embodiment, the IL-13 binding agent includes at least
one non-human CDR, e.g., a murine CDR, e.g., a CDR from MJ 2-7 or
C65, or a mutant thereof, and at least one framework which differs
from a framework of MJ 2-7 or C65 by at least one amino acid, e.g.,
at least 5, 8, 10, 12, 15, or 18 amino acids. For example, the
proteins include one, two, three, four, five, or six such non-human
CDRs and includes at least one amino acid difference in at least
three of HC FR1, HC FR2, HC FR3, LC FR1, LC FR2, and LC FR3.
[0082] In one embodiment, the heavy or light chain variable domain
sequence of the anti-IL-13 antibody molecule includes an amino acid
sequence, which is at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or
higher identical to a variable domain sequence of an antibody
described herein, e.g., MJ 2-7 or C65; or which differs at least 1
or 5 residues, but less than 40, 30, 20, or 10 residues, from a
variable domain sequence of an antibody described herein, e.g., MJ
2-7 or C65. In one embodiment, the heavy or light chain variable
domain sequence of the protein includes an amino acid sequence
encoded by a nucleic acid sequence described herein or a nucleic
acid that hybridizes to a nucleic acid sequence described herein or
its complement, e.g., under low stringency, medium stringency, high
stringency, or very high stringency conditions.
[0083] In one embodiment, one or both of the variable domain
sequences include amino acid positions in the framework region that
are variously derived from both a non-human antibody (e.g., a
murine antibody such as mAb13.2) and a human antibody or germline
sequence. For example, a variable domain sequence can include a
number of positions at which the amino acid residue is identical to
both the non-human antibody and the human antibody (or human
germline sequence) because the two are identical at that position.
Of the remaining framework positions where the non-human and human
differ, at least 50, 60, 70, 80, or 90% of the positions of the
variable domain are preferably identical to the human antibody (or
human germline sequence) rather than the non-human. For example,
none, or at least one, two, three, or four of such remaining
framework position may be identical to the non-human antibody
rather than to the human. For example, in HC FR1, one or two such
positions can be non-human; in HC FR2, one or two such positions
can be non-human; in FR3, one, two, three, or four such positions
can be non-human; in LC FR1, one, two, three, or four such
positions can be non-human; in LC FR2, one or two such positions
can be non-human; in LC FR3, one or two such positions can be
non-human. The frameworks can include additional non-human
positions.
[0084] The IL-13 binding agent, e.g., anti-IL-13 antibody molecule,
can be derivatized or linked to another functional molecule, e.g.,
another peptide or protein (e.g., an Fab fragment). For example,
the binding agent can be functionally linked (e.g., by chemical
coupling, genetic fusion, noncovalent association or otherwise) to
one or more other molecular entities, such as another antibody
molecule (e.g., to form a bispecific or a multispecific antibody
molecule), toxins, radioisotopes, cytotoxic or cytostatic agents,
among others.
[0085] In another embodiment, the IL-13 binding agent, e.g.,
anti-IL-13 antibody molecule, interferes with the interaction of
IL-13 with the receptor IL-13RI1. In one embodiment, the IL-13
binding agent can interfere with the interaction of Phe107 of IL-13
(SEQ ID NO:124; FIG. 13A) with a hydrophobic pocket of
IL-13R.alpha.1 formed by the side chains of residues Leu319,
Cys257, Arg256, and Cys320 (SEQ ID NO:125; FIG. 13B), e.g., by
direct binding to these residues or steric hindrance. In another
embodiment, the IL-13 binding agent can interfere with van der
Waals interactions between amino acid residues Ile254, Ser255,
Arg256, Lys318, Cys320, and Tyr321 of IL-13R.alpha.1 (SEQ ID
NO:125) and amino acid residues Arg11, Glu12, Leu13, Ile14, Glu15,
Lys104, Lys105, Leu106, Phe107, and Arg108 of IL-13 (SEQ ID
NO:124), e.g., by direct binding to these residues or steric
hindrance.
[0086] In one embodiment, the IL-13 binding agent, e.g., the
anti-IL-13 antibody, molecule has no significant cross-reactivity
when screened against at least half, two-thirds, three-quarter,
90%, or all the tissues on the "suggested list of human tissues to
be used for immunohistochemical investigations of cross-reactivity"
in Annex II of the DC CPMP Guideline III/5271/94 Draft 5,
"Production and quality control of monoclonal antibodies" and at
least half, two-thirds, three-quarter, 90%, or all of the tissues
recommended in Table 2 of the 1997 US FDA/CBER "Points to Consider
in the Manufacture and Testing of Monoclonal Antibody Products for
Human Use."
[0087] In one embodiment, the IL-13 binding agent, e.g., the
anti-IL-13 antibody, specifically binds to IL-13, e.g., a mammalian
IL-13, e.g., human or non-human primate IL-13. For example, the
binding agent binds to IL-13 with an affinity that is at least
two-fold, 10-fold, 50-fold, 100-fold, or better (smaller K.sub.d)
than its affinity for binding to a non-specific antigen (e.g., BSA,
casein) other than IL-13, or with an affinity that is at least
two-fold, 10-fold, 50-fold, 100-fold, or better (smaller K.sub.d)
than its affinity for binding to another human interleukin other
than IL-13. In some embodiments, the IL-13 binding agent only
detects a single prominent band when blotted against the crude
sample of human IL-13 described in Example 1 ("Quaternary Screen").
In some embodiments, a precipitate made by pulling down proteins
from that crude sample using beads to which the IL-13 binding agent
is immobilized is a composition in which IL-13 is at least 5%, 10%,
50%, or 80% pure.
[0088] In another aspect, an IL-13 binding agent, e.g., an
anti-IL-13 antibody molecule, or a pharmaceutical composition
thereof, is administered to treat or prevent an IL-13-associated
disorder. Treating refers to improving or maintaining (or so
attempting) the condition of subject. In a typical case, treating
improves the condition of the subject to an extent discernable to a
physician or prevents worsening of the condition. Examples of
IL-13-associated disorders include, but are not limited to,
disorders chosen from one or more of: respiratory disorders, e.g.,
asthma (e.g., allergic and nonallergic asthma (e.g., asthma due to
infection with, e.g., respiratory syncytial virus (RSV), e.g., in
younger children)), chronic obstructive pulmonary disease (COPD),
and other conditions involving airway inflammation, eosinophilia,
fibrosis and excess mucus production, e.g., cystic fibrosis and
pulmonary fibrosis; atopic disorders, e.g., resulting from an
increased sensitivity to IL-13, (e.g., atopic dermatitis,
urticaria, eczema, allergic rhinitis, and allergic
enterogastritis); inflammatory and/or autoimmune conditions of, the
skin (e.g., atopic dermatitis), gastrointestinal disorders (e.g.,
inflammatory bowel diseases (IBD), such as ulcerative colitis
and/or Crohn's disease), liver (e.g., cirrhosis, hepatocellular
carcinoma), and scleroderma; tumors or cancers (e.g., soft tissue
or solid tumors), such as leukemia, glioblastoma, and lymphoma,
e.g., Hodgkin's lymphoma; viral infections (e.g., from HTLV-1);
fibrosis of other organs, e.g., fibrosis of the liver, (e.g.,
fibrosis caused by a hepatitis B and/or C virus); and suppression
of expression of protective type 1 immune responses, (e.g., during
vaccination), e.g., as described herein.
[0089] The IL-13 binding agent (e.g., the anti-IL-13 antibody
molecule, such as one described herein) can be in administered in
an amount effective to treat or prevent the disorder. In the case
of prophylactic use (e.g., to prevent onset or delay onset), the
subject may or may not have one or more symptoms of the disorder.
The amount can also be selected to be effective to ameliorate at
least one symptom of the disorder. Preferably, the subject is a
mammal, e.g., a human suffering from an IL-13-associated disorder
as described herein. For respiratory disorders, e.g., asthma, the
IL-13 binding agent can be delivered by inhalation.
[0090] In one embodiment, the method includes administering doses
of an antibody molecule that binds to IL-13. For example, the
antibody molecule inhibits or neutralizes IL-13. In one embodiment,
each dose is administered subcutaneously, e.g., in an amount of
about 0.5-10 mg/kg (e.g., 0.7-3.3 mg/kg) at a frequency of no more
than once per week, e.g., every other week or once or twice
monthly. In one embodiment, the antibody is an antibody described
herein. For example, the antibody is an antibody that inhibits
binding of IL-13R.alpha.1. The antibody can, e.g., confers a
post-injection protective effect against exposure to Ascaris
antigen in a sheep model at least 6 weeks after injection.
[0091] In one embodiment, the IL-13 binding agent is administered
in combination with another therapeutic agent. The combination
therapy can include an IL-13 binding agent, e.g., an anti-IL-13
antibody molecule, coformulated with and/or coadministered with one
or more additional therapeutic agents, e.g., one or more cytokine
and growth factor inhibitors, immunosuppressants, anti-inflammatory
agents (e.g., systemic anti-inflammatory agents), metabolic
inhibitors, enzyme inhibitors, and/or cytotoxic or cytostatic
agents, as described in more herein. The IL-13 binding agent and
the other therapeutic can also be administered separately.
[0092] Examples of preferred additional therapeutic agents that can
be coadministered and/or coformulated with an IL-13 binding agent
include: inhaled steroids; beta-agonists, e.g., short-acting or
long-acting beta-agonists; antagonists of leukotrienes or
leukotriene receptors; combination drugs such as ADVAIR.RTM.; IgE
inhibitors, e.g., anti-IgE antibodies (e.g., XOLAIR.RTM.);
phosphodiesterase inhibitors (e.g., PDE4 inhibitors); xanthines;
anticholinergic drugs; mast cell-stabilizing agents such as
cromolyn; IL-4 inhibitors; IL-5 inhibitors; eotaxin/CCR3
inhibitors; and antihistamines. Such combinations can be used to
treat asthma and other respiratory disorders. Additional examples
of therapeutic agents that can be coadministered and/or
coformulated with an IL-13 binding agent include one or more of:
TNF antagonists (e.g., a soluble fragment of a TNF receptor, e.g.,
p55 or p75 human TNF receptor or derivatives thereof, e.g., 75 kd
TNFR-IgG (75 kD TNF receptor-IgG fusion protein, ENBREL.TM.)); TNF
enzyme antagonists, e.g., TNF.alpha. converting enzyme (TACE)
inhibitors; muscarinic receptor antagonists; TGF-.upsilon.
antagonists; interferon gamma; perfenidone; chemotherapeutic
agents, e.g., methotrexate, leflunomide, or a sirolimus (rapamycin)
or an analog thereof, e.g., CCI-779; COX2 and cPLA2 inhibitors;
NSAIDs; immunomodulators; p38 inhibitors, TPL-2, Mk-2 and NFPB
inhibitors, among others.
[0093] In another aspect, this application provides compositions,
e.g., pharmaceutical compositions, that include a pharmaceutically
acceptable carrier and at least one IL-13 binding agent, e.g., an
anti-IL-13 antibody molecule. In one embodiment, the compositions,
e.g., pharmaceutical compositions, comprise a combination of two or
more IL-13 binding agents, e.g., two or more anti-IL-13 antibody
molecules. Combinations of the IL-13 binding agent, e.g., the
anti-IL-13 antibody molecule, and a drug, e.g., a therapeutic agent
(e.g., one or more cytokine and growth factor inhibitors,
immunosuppressants, anti-inflammatory agents (e.g., systemic
anti-inflammatory agents), metabolic inhibitors, enzyme inhibitors,
and/or cytotoxic or cytostatic agents, as described herein, can
also be used.
[0094] This application also features nucleic acids that include
nucleotide sequences that encode an IL-13 binding agent described
herein or a component thereof, e.g., a heavy and/or light chain
variable domain sequence of an anti-IL-13 antibody molecule, e.g.,
an antibody molecule described herein. For example, the application
features a first and second nucleic acid encoding heavy and light
chain variable domain sequences, respectively, of an anti-IL-13
antibody chosen from one or more of, e.g., MJ 2-7 or C65, e.g., as
described herein. In another aspect, the application features host
cells and vectors containing the nucleic acids described
herein.
[0095] The invention also features the epitope of IL-13, e.g.,
human IL-13, recognized by one or more of, e.g., MJ 2-7 or C65. For
example, proteins and peptides that include the epitope can be used
to generate or screen for other binding compounds that interact
with the epitope, e.g., proteins such as antibodies or small
molecules. For example, a peptide that includes the epitope can be
used as an immunogen or as a target for screening an expression
library. It is also possible to evaluate compounds for ability to
interact with the peptide, or, by mapping or structure
determination, to evaluate compounds for ability to interact with
the epitope, e.g., in the context of a mature IL-13.
[0096] In another aspect, this application features a method of
modulating, e.g., interfering with (e.g., inhibiting, blocking or
otherwise reducing), an interaction, e.g., binding, between IL-13
and a cognate IL-13 binding protein, e.g., an IL-13 receptor
complex, e.g., a complex comprising IL-13RI1 and IL-4R1, or a
subunit thereof. The modulating can be effected in vivo or in
vitro. In other embodiments, the IL-13 binding agent, e.g., the
anti-IL-13 antibody molecule, binds to IL-13, and interferes with
(e.g., inhibits, blocks or otherwise reduces) an interaction, e.g.,
binding, between IL-13 and a subunit of the IL-13 receptor complex,
e.g., IL-13RI1 or IL-4R1, individually. In yet another embodiment,
the IL-13 binding agent, e.g., the anti-IL-13 antibody molecule,
binds to IL-13, and interferes with (e.g., inhibits, blocks or
otherwise reduces) an interaction, e.g., binding, between IL-13 and
IL-13RI1. In another embodiment, the IL-13 binding agent, e.g., the
anti-IL-13 antibody molecule, binds to IL-13, and interferes with
(e.g., inhibits, blocks or otherwise reduces) an interaction, e.g.,
binding, between IL-13 and IL-13RI1. Typically, the anti-IL-13
antibody molecule interferes with (e.g., inhibits, blocks or
otherwise reduces) an interaction, e.g., binding, of IL-13 and
IL-13RI1.
[0097] In another aspect, this application features a method of
modulating interaction between IL-13 and an IL-13 receptor protein,
e.g., IL-13R.alpha.1 or IL-13R.alpha.2. For example, an IL-13
binding agent, e.g., an agent described herein, can be used to
reduce or inhibit binding, between IL-13 and IL-13R.alpha.1 or
IL-13R.alpha.2, or to reduce formation of a complex that includes
IL-13R.alpha.1 and IL-4RI (e.g., a complex as described herein).
The method comprises contacting IL-13 or a complex that contains
IL-13 with an IL-13 binding agent, e.g., a protein described
herein.
[0098] The subject methods can be used on cells in vitro (e.g., in
a cell-free system), in culture, e.g. in vitro or ex vivo. For
example, IL-13 receptor-expressing cells can be cultured in vitro
in culture medium and the contacting step can be effected by adding
an IL-13 binding agent to the culture medium. Alternatively, the
method can be performed on cells present in a subject, e.g., as
part of an in vivo (e.g., therapeutic or prophylactic) protocol.
For example, the IL-13 binding agent can be delivered locally or
systemically.
[0099] The method can include contacting IL-13 with the IL-13
receptor complex, or subunit thereof, under conditions that allow
an interaction between IL-13 and the IL-13 receptor complex, or
subunit thereof, to occur to thereby form an IL-13/IL-13 receptor
mixture. Generally, the IL-13 binding agent is provided in an
effective amount, e.g., so that contacting the IL-13/IL-13 receptor
mixture modulates, e.g., interferes with (e.g., inhibits, blocks or
otherwise reduces) the interaction between IL-13 and the receptor
protein or at least one function of IL-13, e.g., IL-13 mediated
signaling.
[0100] In another aspect, this application provides a method for
detecting the presence of IL-13 in a sample in vitro (e.g., a
biological sample, such as serum, plasma, tissue, biopsy). The
subject method can be used to diagnose a disorder, e.g., an immune
cell-associated disorder. The method includes: (i) contacting the
sample or a control sample with an IL-13 binding agent, e.g., an
anti-IL-13 antibody molecule, e.g., as described herein; and (ii)
detecting formation of a complex between the IL-13 binding agent
and the sample or the control sample, wherein a statistically
significant change in the formation of the complex in the sample
relative to the control sample is indicative of the presence of the
IL-13 in the sample.
[0101] In yet another aspect, this application provides a method
for detecting the presence of IL-13 in vivo (e.g., in vivo imaging
in a subject). The subject method can be used to diagnose a
disorder, e.g., an IL-13-associated disorder. The method includes:
(i) administering an IL-13 binding agent, e.g., an anti-IL-13
antibody molecule, e.g., as described herein, to a subject or a
control subject under conditions that allow binding of the binding
agent to IL-13; and (ii) detecting formation of a complex between
the binding agent and IL-13, wherein a statistically significant
change in the formation of the complex in the subject relative to
the control subject is indicative of the presence of IL-13.
[0102] For example, the antibody molecule is directly or indirectly
labeled with a detectable substance to facilitate detection of the
bound or unbound antibody. Suitable detectable substances include
various enzymes, prosthetic groups, fluorescent materials,
luminescent materials and radioactive materials.
[0103] Methods for delivering or targeting an agent, e.g., a
therapeutic or a cytotoxic agent, to an IL-13-expressing cell in
vivo are also disclosed.
[0104] In one aspect, the invention features a polypeptide that
comprises the sequence, or a functional fragment thereof:
TABLE-US-00007 (SEQ ID NO: 14)
SPVPPSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALE
SLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVK
DLLVHLKKLFREGQFN
[0105] The polypeptide can further include:
TABLE-US-00008 MALLLTMVIALTCLGGFASP, (SEQ ID NO: 127)
e.g., as an N-terminal signal sequence. For example, the
polypeptide is an IL-13 protein from cynomolgus monkey (herein,
"NHP-IL-13"). The, NHP-IL-13 can be a mature IL-13 protein or an
unprocessed full length IL-13 protein. Peptides of the above
sequence, e.g., peptides that differ from corresponding peptides in
human IL-13, can be used, e.g., as an immunogen or target
compound.
[0106] Also featured are related polypeptides that differ from
human IL-13 at one or more of the boldfaced positions above but are
identical to human IL-13 at the non-boldface positions above. For
example, one or more of the boldfaced positions can be an alanine,
or a conservative substitution of the corresponding residue in the
cynomolgus sequence (above) or the corresponding residue in the
human sequence. The invention also features peptides, e.g., of at
least 5 or 6 amino acids from the above sequence. The peptides can
be included in a heterologous protein (e.g., a protein other than
an IL-13), a chimeric protein (e.g., a human IL-13) or can be in an
isolated peptide, e.g., one that does not include other sequences.
The peptides can also be fused or conjugated to other compounds,
e.g., a carrier. In one embodiment, the peptide includes at least
one amino acid residue that differs from human IL-13. Exemplary
peptides are described below.
[0107] Also featured are nucleic acids encoding the cynomolgus
IL-13 sequence and variants thereof. The polypeptide can be used to
provide an IL-13 binding agent that binds the cynomolgus monkey
IL-13, and, optionally, also an IL-13 protein from another species,
e.g., a human IL-13.
[0108] In one aspect, the invention features a method of providing
a target binding molecule that specifically binds to a human target
protein. For example, the target binding molecule is an antibody
molecule. The method includes: providing a target protein that
comprises at least a portion of a non-human protein, the portion
being homologous to (at least 70, 75, 80, 85, 87, 90, 92, 94, 95,
96, 97, or 98% identical to) a corresponding portion of a human
target protein, but differing by at least one amino acid (e.g., at
least one, two, three, four, five, six, seven, eight, or nine amino
acids); obtaining a binding agent that specifically binds to the
antigen; and evaluating if the binding agent specifically binds to
the human target protein or evaluating efficacy of the binding
agent in modulating activity of the human target protein. The
method can further include administering the binding agent (e.g.,
an antibody molecule) or a derivative (e.g., a humanized antibody
molecule) to a human subject. In one embodiment, the human target
protein is a cytokine, e.g., an interleukin, e.g., IL-13 or IL-4.
The non-human protein can be from a non-human primate, e.g., a
rhesus monkey, a cynomolgus monkey, or a pigtail macaque.
[0109] In one embodiment, the step of obtaining comprises using a
protein expression library, e.g., a phage or ribosome display
library. For example, the library displays antibody molecules such
as Fab's or scFv's. In one embodiment, the step of obtaining
comprises immunizing an animal using the antigen as an immunogen.
For example, the animal can be a rodent, e.g., a mouse or rat. The
animal can be a transgenic animal that has at least one human
immunoglobulin gene.
[0110] All publications, patent applications, patents, and other
references mentioned herein are incorporated by reference in their
entirety.
DEFINITIONS
[0111] The term "IL-13 binding agent," as used herein, refers to
any compound, such as a protein (e.g., a multi-chain polypeptide, a
polypeptide) or a peptide, that includes an interface that binds to
an IL-13 protein, e.g., a mammalian IL-13, particularly a human or
non-human primate IL-13. The binding agent generally binds with a
Kd of less than 5.times.10.sup.-7 M. An exemplary IL-13 binding
agent is a protein that includes an antigen binding site, e.g., an
antibody molecule.
[0112] As used herein, the term "antibody molecule" refers to a
protein comprising at least one immunoglobulin variable domain
sequence. The term antibody molecule includes, for example,
full-length, mature antibodies and antigen-binding fragments of an
antibody. For example, an antibody molecule can include a heavy (H)
chain variable domain sequence (abbreviated herein as VH), and a
light (L) chain variable domain sequence (abbreviated herein as
VL). In another example, an antibody molecule includes two heavy
(H) chain variable domain sequences and two light (L) chain
variable domain sequence, thereby forming two antigen binding
sites. Examples of antigen-binding fragments include: (i) a Fab
fragment, a monovalent fragment consisting of the VL, VH, CL and
CH1 domains; (ii) a F(ab')2 fragment, a bivalent fragment
comprising two Fab fragments linked by a disulfide bridge at the
hinge region; (iii) a Fd fragment consisting of the VH and CH1
domains; (iv) a Fv fragment consisting of the VL and VH domains of
a single arm of an antibody, (v) a dAb fragment, which consists of
a VH domain; (vi) a camelid or camelized variable domain; and (vii)
a single chain Fv (scFv).
[0113] The VH and VL regions can be further subdivided into regions
of hypervariability, termed "complementarity determining regions"
(CDR), interspersed with regions that are more conserved, termed
"framework regions" (FR). The extent of the framework region and
CDRs has been precisely defined by a number of methods (see, Kabat,
E. A., et al. (1991) Sequences of Proteins of Immunological
Interest, Fifth Edition, U.S. Department of Health and Human
Services, NIH Publication No. 91-3242; Chothia, C. et al. (1987) J.
Mol. Biol. 196:901-917; and the AbM definition used by Oxford
Molecular's AbM antibody modelling software. See, generally, e.g.,
Protein Sequence and Structure Analysis of Antibody Variable
Domains. In: Antibody Engineering Lab Manual (Ed.: Duebel, S, and
Kontermann, R., Springer-Verlag, Heidelberg). Generally, unless
specifically indicated, the following definitions are used: AbM
definition of CDR1 of the heavy chain variable domain and Kabat
definitions for the other CDRs. In addition, embodiments of the
invention described with respect to Kabat or AbM CDRs may also be
implemented using Chothia hypervariable loops. Each VH and VL
typically includes three CDRs and four FRs, arranged from
amino-terminus to carboxy-terminus in the following order: FR1,
CDR1, FR2, CDR2, FR3, CDR3, FR4.
[0114] As used herein, an "immunoglobulin variable domain sequence"
refers to an amino acid sequence which can form the structure of an
immunoglobulin variable domain. For example, the sequence may
include all or part of the amino acid sequence of a
naturally-occurring variable domain. For example, the sequence may
or may not include one, two, or more N- or C-terminal amino acids,
or may include other alterations that are compatible with formation
of the protein structure.
[0115] The term "antigen-binding site" refers to the part of an
IL-13 binding agent that comprises determinants that form an
interface that binds to the IL-13, e.g., a mammalian IL-13, e.g.,
human or non-human primate IL-13, or an epitope thereof. With
respect to proteins (or protein mimetics), the antigen-binding site
typically includes one or more loops (of at least four amino acids
or amino acid mimics) that form an interface that binds to IL-13.
Typically, the antigen-binding site of an antibody molecule
includes at least one or two CDRs, or more typically at least
three, four, five or six CDRs.
[0116] The terms "monoclonal antibody" or "monoclonal antibody
composition" as used herein refer to a preparation of antibody
molecules of single molecular composition. A monoclonal antibody
composition displays a single binding specificity and affinity for
a particular epitope. A monoclonal antibody can be made by
hybridoma technology or by methods that do not use hybridoma
technology (e.g., recombinant methods).
[0117] An "effectively human" protein is a protein that does not
evoke a neutralizing antibody response, e.g., the human anti-murine
antibody (HAMA) response. HAMA can be problematic in a number of
circumstances, e.g., if the antibody molecule is administered
repeatedly, e.g., in treatment of a chronic or recurrent disease
condition. A HAMA response can make repeated antibody
administration potentially ineffective because of an increased
antibody clearance from the serum (see, e.g., Saleh et al., Cancer
Immunol. Immunother., 32:180-190 (1990)) and also because of
potential allergic reactions (see, e.g., LoBuglio et al.,
Hybridoma, 5:5117-5123 (1986)).
[0118] The term "isolated" refers to a molecule that is
substantially free of its natural environment. For instance, an
isolated protein is substantially free of cellular material or
other proteins from the cell or tissue source from which it is
derived. The term refers to preparations where the isolated protein
is sufficiently pure to be administered as a therapeutic
composition, or at least 70% to 80% (w/w) pure, more preferably, at
least 80%-90% (w/w) pure, even more preferably, 90-95% pure; and,
most preferably, at least 95%, 96%, 97%, 98%, 99%, or 100% (w/w)
pure. A "separated" compound refers to a compound that is removed
from at least 90% of at least one component of a sample from which
the compound was obtained. Any compound described herein can be
provided as an isolated or separated compound.
[0119] An "epitope" refers to the site on a target compound that is
bound by a binding agent, e.g., an antibody molecule. An epitope
can be a linear or conformational epitope, or a combination
thereof. In the case where the target compound is a protein, for
example, an epitope may refer to the amino acids that are bound by
the binding agent. Overlapping epitopes include at least one common
amino acid residue.
[0120] As used herein, the term "hybridizes under low stringency,
medium stringency, high stringency, or very high stringency
conditions" describes conditions for hybridization and washing.
Guidance for performing hybridization reactions can be found in
Current Protocols in Molecular Biology, John Wiley & Sons, N.Y.
(1989), 6.3.1-6.3.6. Aqueous and nonaqueous methods are described
in that reference and either can be used. Specific hybridization
conditions referred to herein are as follows: 1) low stringency
hybridization conditions in 6.times. sodium chloride/sodium citrate
(SSC) at about 45.degree. C., followed by two washes in
0.2.times.SSC, 0.1% SDS at least at 50.degree. C. (the temperature
of the washes can be increased to 55.degree. C. for low stringency
conditions); 2) medium stringency hybridization conditions in
6.times.SSC at about 45.degree. C., followed by one or more washes
in 0.2.times.SSC, 0.1% SDS at 60.degree. C.; 3) high stringency
hybridization conditions in 6.times.SSC at about 45.degree. C.,
followed by one or more washes in 0.2.times.SSC, 0.1% SDS at
65.degree. C.; and preferably 4) very high stringency hybridization
conditions are 0.5 M sodium phosphate, 7% SDS at 65.degree. C.,
followed by one or more washes at 0.2.times.SSC, 1% SDS at
65.degree. C. Very high stringency conditions (4) are the preferred
conditions and the ones that are used unless otherwise
specified.
[0121] An "IL-13 associated disorder" is one in which IL-13
contributes to a pathology or symptom of the disorder. Accordingly,
an IL-13 binding agent, e.g., an IL-13 binding agent that is an
antagonist of one or more IL-13 associated activities, can be used
to treat or prevent the disorder.
[0122] The term "IL-13" includes the full length unprocessed form
of the cytokines known in the art as IL-13 (irrespective of species
origin, and including mammalian, e.g., human and non-human primate
IL-13) as well as mature, processed forms thereof, as well as any
fragment (of at least 5 amino acids) or variant of such cytokines.
Positions within the IL-13 sequence can be designated in accordance
to the numbering for the full length, unprocessed human IL-13
sequence. For an exemplary full-length monkey IL-13, see SEQ ID
NO:24; for mature, processed monkey IL-13, see SEQ ID NO:14; for
full-length human IL-13, see SEQ ID NO:178, and for mature,
processed human IL-13, see SEQ ID NO:124. An exemplary sequence is
recited as follows:
TABLE-US-00009 (SEQ ID NO: 178)
MALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLC
NGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSA
GQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
[0123] For example, position 130 is a site of a common
polymorphism.
[0124] Exemplary sequences of IL-13 receptor proteins (e.g.,
IL-13R.alpha.1 and IL-13R.alpha.2) are described, e.g., in
Donaldson et al. (1998) J Immunol. 161:2317-24; U.S. Pat. No.
6,214,559; U.S. Pat. No. 6,248,714; and U.S. Pat. No.
6,268,480.
BRIEF DESCRIPTION OF THE DRAWINGS
[0125] FIG. 1A is an alignment of full-length human and cynomolgus
monkey IL-13, SEQ ID NO:178 and SEQ ID NO:24, respectively.
[0126] FIG. 1B is a list of exemplary peptides from cynomolgus
monkey IL-13, (SEQ ID NOs:179-188, respectively).
[0127] FIG. 2 is a graph depicting the neutralization of NHP IL-13
activity by various IL-13 binding agents, as measured by percentage
of CD23.sup.+ monocytes (y-axis). Concentration of MJ2-7 (.DELTA.),
C65 (), and sIL-13RI2-Fc ( ) are indicated on the x-axis.
[0128] FIG. 3 is a graph depicting the neutralization of NHP IL-13
activity by MJ2-7 (murine; ) or humanized MJ2-7 v2.11
(.smallcircle.). NHP IL-13 activity was measured by phosphorylation
of STAT6 (y-axis) as a function of antibody concentration
(x-axis).
[0129] FIG. 4 is a graph depicting the neutralization of NHP IL-13
activity by MJ2-7 v2.11 (.smallcircle.) or sIL-13RI2-Fc () NHP
IL-13 activity was measured by phosphorylation of STAT6 (y-axis) as
a function of antagonist concentration (x-axis).
[0130] FIG. 5 is a graph depicting the neutralization of NHP IL-13
activity by MJ2-7 (.DELTA.), C65 (), or sIL-13RI2-Fc ( ). NHP IL-13
activity was measured by phosphorylation of STAT6 (y-axis) as a
function of antagonist concentration (x-axis).
[0131] FIG. 6A is a graph depicting induction of tenascin
production (y-axis) by native human IL-13 (x-axis).
[0132] FIG. 6B is a graph depicting the neutralization of NHP IL-13
activity by MJ2-7, as measured by inhibition of induction of
tenascin production (y-axis) as a function of antibody
concentration (x-axis).
[0133] FIG. 7 is a graph depicting binding of MJ2-7 or control
antibodies to NHP-IL-13 bound to sIL-13RI2-Fc coupled to a SPR
chip.
[0134] FIG. 8 is a graph depicting binding of varying
concentrations (0.09-600 nM) of NHP IL-13 to captured hMJ2-7 V2-11
antibody.
[0135] FIG. 9 is a graph depicting the neutralization of NHP IL-13
activity by mouse MJ2-7 ( ) or humanized Version 1 (.smallcircle.),
Version 2 (), or Version 3 (A) antibodies. NHP IL-13 activity was
measured by phosphorylation of STAT6 (y-axis) as a function of
antibody concentration (x-axis).
[0136] FIG. 10 is a graph depicting the neutralization of NHP IL-13
activity by antibodies including mouse MJ2-7 VH and VL (O), mouse
VH and humanized Version 2 VL (.DELTA.), or Version 2 VH and VL (),
NHP IL-13 activity was measured by phosphorylation of STAT6
(y-axis) as a function of antibody concentration (x-axis).
[0137] FIGS. 11A and 11B are graphs depicting inhibition of binding
of IL-13 to immobilized IL-13 receptor by MJ2-7 antibody, as
measured by ELISA. Binding is depicted as absorbance at 450 nm
(y-axis). Concentration of MJ2-7 antibody is depicted on the
x-axis. FIG. 11A depicts binding to IL-13RI1. FIG. 11B depicts
binding to IL-13RI2.
[0138] FIG. 12 is an alignment of DPK18 germline amino acid
sequence (SEQ ID NO:126) and humanized MJ2-7 Version 3 VL (SEQ ID
NO:190).
[0139] FIG. 13A is an amino acid sequence (SEQ ID NO:124) of
mature, processed human IL-13.
[0140] FIG. 13B is an amino acid sequence (SEQ ID NO:125) of human
IL-13R.alpha.1.
DETAILED DESCRIPTION
[0141] Binding agents (e.g., anti-IL13 antibody molecules) that
bind specifically to IL-13 and modulate the ability of IL-13 to
interact with IL-13 receptors and signaling mediators are
disclosed. The agents can be used to modulate (e.g., inhibit) one
or more IL-13-associated activities. IL-13 binding agents, e.g., as
described herein, can be used to modulate one or more
IL-13-associated activities, e.g., in vivo, e.g., to treat or
prevent IL-13-mediated disorders (e.g., asthma, airway
inflammation, atopic disorders, allergic responses, eosinophilia,
fibrosis, and IL-13 associated cancers).
[0142] Anti-IL-13 Antibody Molecules
[0143] Numerous methods are available for obtaining antibody
molecules. One exemplary method includes screening protein
expression libraries, e.g., phage or ribosome display libraries.
Phage display is described, for example, in Ladner et al., U.S.
Pat. No. 5,223,409; Smith (1985) Science 228:1315-1317; WO
92/18619; WO 91/17271; WO 92/20791; WO 92/15679; WO 93/01288; WO
92/01047; WO 92/09690; and WO 90/02809. In addition to the use of
display libraries, other methods can be used to obtain an
anti-IL-13 antibody molecule. For example, an IL-13 protein or a
peptide thereof can be used as an antigen in a non-human animal,
e.g., a rodent, e.g., a mouse, hamster, or rat.
[0144] In one embodiment, the non-human animal includes at least a
part of a human immunoglobulin gene. For example, it is possible to
engineer mouse strains deficient in mouse antibody production with
large fragments of the human Ig loci. Using the hybridoma
technology, antigen-specific monoclonal antibodies derived from the
genes with the desired specificity may be produced and selected.
See, e.g., XENOMOUSE.TM., Green et al. (1994) Nature Genetics
7:13-21, US 2003-0070185, WO 96/34096, published Oct. 31, 1996, and
PCT Application No. PCT/US96/05928, filed Apr. 29, 1996.
[0145] In another embodiment, a monoclonal antibody is obtained
from the non-human animal, and then modified, e.g., humanized or
deimmunized. Winter describes an exemplary CDR-grafting method that
may be used to prepare the humanized antibodies described herein
(U.S. Pat. No. 5,225,539). All of the CDRs of a particular human
antibody may be replaced with at least a portion of a non-human
CDR, or only some of the CDRs may be replaced with non-human CDRs.
It is only necessary to replace the number of CDRs required for
binding of the humanized antibody to a predetermined antigen.
[0146] Humanized antibodies can be generated by replacing sequences
of the Fv variable domain that are not directly involved in antigen
binding with equivalent sequences from human Fv variable domains.
Exemplary methods for generating humanized antibody molecules are
provided by Morrison (1985) Science 229:1202-1207; by Oi et al.
(1986) BioTechniques 4:214; and by U.S. Pat. No. 5,585,089; U.S.
Pat. No. 5,693,761; U.S. Pat. No. 5,693,762; U.S. Pat. No.
5,859,205; and U.S. Pat. No. 6,407,213. Those methods include
isolating, manipulating, and expressing the nucleic acid sequences
that encode all or part of immunoglobulin Fv variable domains from
at least one of a heavy or light chain. Such nucleic acids may be
obtained from a hybridoma producing an antibody against a
predetermined target, as described above, as well as from other
sources. The recombinant DNA encoding the humanized antibody
molecule can then be cloned into an appropriate expression
vector.
[0147] An IL-13-binding antibody molecule may also be modified by
specific deletion of human T cell epitopes or "deimmunization" by
the methods disclosed in WO 98/52976 and WO 00/34317. Briefly, the
heavy and light chain variable domains of an antibody can be
analyzed for peptides that bind to MHC Class II; these peptides
represent potential T-cell epitopes (as defined in WO 98/52976 and
WO 00/34317). For detection of potential T-cell epitopes, a
computer modeling approach termed "peptide threading" can be
applied, and in addition a database of human MHC class II binding
peptides can be searched for motifs present in the V.sub.H and
V.sub.L sequences, as described in WO 98/52976 and WO 00/34317.
These motifs bind to any of the 18 major MHC class II DR allotypes,
and thus constitute potential T cell epitopes. Potential T-cell
epitopes detected can be eliminated by substituting small numbers
of amino acid residues in the variable domains, or preferably, by
single amino acid substitutions. Typically, conservative
substitutions are made. Often, but not exclusively, an amino acid
common to a position in human germline antibody sequences may be
used. Human germline sequences, e.g., are disclosed in Tomlinson,
et al. (1992) J. Mol. Biol. 227:776-798; Cook, G. P. et al. (1995)
Immunol. Today Vol. 16 (5): 237-242; Chothia, D. et al. (1992) J.
Mol. Biol. 227:799-817; and Tomlinson et al. (1995) EMBO J.
14:4628-4638. The V BASE directory provides a comprehensive
directory of human immunoglobulin variable region sequences
(compiled by Tomlinson, I. A. et al. MRC Centre for Protein
Engineering, Cambridge, UK). These sequences can be used as a
source of human sequence, e.g., for framework regions and CDRs.
Consensus human framework regions can also be used, e.g., as
described in U.S. Pat. No. 6,300,064.
[0148] Additionally, chimeric, humanized, and single-chain antibody
molecules (e.g., proteins that include both human and nonhuman
portions), may be produced using standard recombinant DNA
techniques. Humanized antibodies may also be produced, for example,
using transgenic mice that express human heavy and light chain
genes, but are incapable of expressing the endogenous mouse
immunoglobulin heavy and light chain genes.
[0149] Additionally, the antibody molecules described herein also
include those that bind to IL-13, interfere with the formation of a
functional IL-13 signaling complex, and have mutations in the
constant regions of the heavy chain. It is sometimes desirable to
mutate and inactivate certain fragments of the constant region. For
example, mutations in the heavy constant region can be made to
produce antibodies with reduced binding to the Fc receptor (FcR)
and/or complement; such mutations are well known in the art. An
example of such a mutation to the amino sequence of the constant
region of the heavy chain of IgG is provided in SEQ ID NO:128.
Certain active fragments of the CL and CH subunits (e.g., CH1) are
covalently link to each other. A further aspect provides a method
for obtaining an antigen-binding site that is specific for a
surface of IL-13 that participates in forming a functional IL-13
signaling complex.
[0150] Exemplary antibody molecules can include sequences of VL
chains as set forth in SEQ ID NOs:30-46, and/or of VH chains as set
forth in and SEQ ID NOs:50-115, but also can include variants of
these sequences that retain IL-13 binding ability. Such variants
may be derived from the provided sequences using techniques well
known in the art. Amino acid substitutions, deletions, or
additions, can be made in either the FRs or in the CDRs. Whereas
changes in the framework regions are usually designed to improve
stability and reduce immunogenicity of the antibody molecule,
changes in the CDRs are usually designed to increase affinity of
the antibody molecule for its target. Such affinity-increasing
changes are typically determined empirically by altering the CDR
region and testing the antibody molecule. Such alterations can be
made according to the methods described in Antibody Engineering,
2nd. ed. (1995), ed. Borrebaeck, Oxford University Press.
[0151] An exemplary method for obtaining a heavy chain variable
domain sequence that is a variant of a heavy chain variable domain
sequence described herein, includes adding, deleting, substituting,
or inserting one or more amino acids in a heavy chain variable
domain sequence described herein, optionally combining the heavy
chain variable domain sequence with one or more light chain
variable domain sequences, and testing a protein that includes the
modified heavy chain variable domain sequence for specific binding
to IL-13, and (preferably) testing the ability of such
antigen-binding domain to modulate one or more IL-13-associated
activities. An analogous method may be employed using one or more
sequence variants of a light chain variable domain sequence
described herein.
[0152] Variants of antibody molecules can be prepared by creating
libraries with one or more varied CDRs and screening the libraries
to find members that bind to IL-13, e.g., with improved affinity.
For example, Marks et al. (Bio/Technology (1992) 10:779-83)
describe methods of producing repertoires of antibody variable
domains in which consensus primers directed at or adjacent to the
5' end of the variable domain area are used in conjunction with
consensus primers to the third framework region of human VH genes
to provide a repertoire of VH variable domains lacking a CDR3. The
repertoire may be combined with a CDR3 of a particular antibody.
Further, the CDR3-derived sequences may be shuffled with
repertoires of VH or VL domains lacking a CDR3, and the shuffled
complete VH or VL domains combined with a cognate VL or VH domain
to provide specific antigen-binding fragments. The repertoire may
then be displayed in a suitable host system such as the phage
display system of WO 92/01047, so that suitable antigen-binding
fragments can be selected. Analogous shuffling or combinatorial
techniques are also disclosed by Stemmer (Nature (1994)
370:389-91). A further alternative is to generate altered VH or VL
regions using random mutagenesis of one or more selected VH and/or
VL genes to generate mutations within the entire variable domain.
See, e.g., Gram et al. Proc. Nat. Acad. Sci. USA (1992)
89:3576-80.
[0153] Another method that may be used is to direct mutagenesis to
CDR regions of VH or VL genes. Such techniques are disclosed by,
e.g., Barbas et al. (Proc. Nat. Acad. Sci. USA (1994) 91:3809-13)
and Schier et al. (J. Mol. Biol. (1996) 263:551-67). Similarly, one
or more, or all three CDRs may be grafted into a repertoire of VH
or VL domains, or even some other scaffold (such as a fibronectin
domain). The resulting protein is evaluated for ability to bind to
IL-13.
[0154] In one embodiment, a binding agent that binds to a target is
modified, e.g., by mutagenesis, to provide a pool of modified
binding agents. The modified binding agents are then evaluated to
identify one or more altered binding agents which have altered
functional properties (e.g., improved binding, improved stability,
lengthened stability in vivo). In one implementation, display
library technology is used to select or screen the pool of modified
binding agents. Higher affinity binding agents are then identified
from the second library, e.g., by using higher stringency or more
competitive binding and washing conditions. Other screening
techniques can also be used.
[0155] In some embodiments, the mutagenesis is targeted to regions
known or likely to be at the binding interface. If, for example,
the identified binding agents are antibody molecules, then
mutagenesis can be directed to the CDR regions of the heavy or
light chains as described herein. Further, mutagenesis can be
directed to framework regions near or adjacent to the CDRs, e.g.,
framework regions, particular within 10, 5, or 3 amino acids of a
CDR junction. In the case of antibodies, mutagenesis can also be
limited to one or a few of the CDRs, e.g., to make step-wise
improvements.
[0156] In one embodiment, mutagenesis is used to make an antibody
more similar to one or more germline sequences. One exemplary
germlining method can include: identifying one or more germline
sequences that are similar (e.g., most similar in a particular
database) to the sequence of the isolated antibody. Then mutations
(at the amino acid level) can be made in the isolated antibody,
either incrementally, in combination, or both. For example, a
nucleic acid library that includes sequences encoding some or all
possible germline mutations is made. The mutated antibodies are
then evaluated, e.g., to identify an antibody that has one or more
additional germline residues relative to the isolated antibody and
that is still useful (e.g., has a functional activity). In one
embodiment, as many germline residues are introduced into an
isolated antibody as possible.
[0157] In one embodiment, mutagenesis is used to substitute or
insert one or more germline residues into a CDR region. For
example, the germline CDR residue can be from a germline sequence
that is similar (e.g., most similar) to the variable domain being
modified. After mutagenesis, activity (e.g., binding or other
functional activity) of the antibody can be evaluated to determine
if the germline residue or residues are tolerated. Similar
mutagenesis can be performed in the framework regions.
[0158] Selecting a germline sequence can be performed in different
ways. For example, a germline sequence can be selected if it meets
a predetermined criteria for selectivity or similarity, e.g., at
least a certain percentage identity, e.g., at least 75, 80, 85, 90,
91, 92, 93, 94, 95, 96, 97, 98, 99, or 99.5% identity. The
selection can be performed using at least 2, 3, 5, or 10 germline
sequences. In the case of CDR1 and CDR2, identifying a similar
germline sequence can include selecting one such sequence. In the
case of CDR3, identifying a similar germline sequence can include
selecting one such sequence, but may including using two germline
sequences that separately contribute to the amino-terminal portion
and the carboxy-terminal portion. In other implementations more
than one or two germline sequences are used, e.g., to form a
consensus sequence.
[0159] In other embodiments, the antibody may be modified to have
an altered glycosylation pattern (i.e., altered from the original
or native glycosylation pattern). As used in this context,
"altered" means having one or more carbohydrate moieties deleted,
and/or having one or more glycosylation sites added to the original
antibody. Addition of glycosylation sites to the presently
disclosed antibodies may be accomplished by altering the amino acid
sequence to contain glycosylation site consensus sequences; such
techniques are well known in the art. Another means of increasing
the number of carbohydrate moieties on the antibodies is by
chemical or enzymatic coupling of glycosides to the amino acid
residues of the antibody. These methods are described in, e.g., WO
87/05330, and Aplin and Wriston (1981) CRC Crit. Rev. Biochem.
22:259-306. Removal of any carbohydrate moieties present on the
antibodies may be accomplished chemically or enzymatically as
described in the art (Hakimuddin et al. (1987) Arch. Biochem.
Biophys. 259:52; Edge et al. (1981) Anal. Biochem. 118:131; and
Thotakura et al. (1987) Meth. Enzymol. 138:350). See, e.g., U.S.
Pat. No. 5,869,046 for a modification that increases in vivo half
life by providing a salvage receptor binding epitope.
[0160] In one embodiment, an antibody molecule has CDR sequences
that differ only insubstantially from those of MJ 2-7 or C65.
Insubstantial differences include minor amino acid changes, such as
substitutions of 1 or 2 out of any of typically 5-7 amino acids in
the sequence of a CDR, e.g., a Chothia or Kabat CDR. Typically, an
amino acid is substituted by a related amino acid having similar
charge, hydrophobic, or stereochemical characteristics. Such
substitutions are within the ordinary skills of an artisan. Unlike
in CDRs, more substantial changes in structure framework regions
(FRs) can be made without adversely affecting the binding
properties of an antibody. Changes to FRs include, but are not
limited to, humanizing a nonhuman-derived framework or engineering
certain framework residues that are important for antigen contact
or for stabilizing the binding site, e.g., changing the class or
subclass of the constant region, changing specific amino acid
residues which might alter an effector function such as Fc receptor
binding (Lund et al. (1991) J. Immunol. 147:2657-62; Morgan et al.
(1995) Immunology 86:319-24), or changing the species from which
the constant region is derived. Antibodies may have mutations in
the CH2 region of the heavy chain that reduce or alter effector
function, e.g., Fc receptor binding and complement activation. For
example, antibodies may have mutations such as those described in
U.S. Pat. Nos. 5,624,821 and 5,648,260. In the IgG1 or IgG2 heavy
chain, for example, such mutations may be made to resemble the
amino acid sequence set forth in SEQ ID NO:17. Antibodies may also
have mutations that stabilize the disulfide bond between the two
heavy chains of an immunoglobulin, such as mutations in the hinge
region of IgG4, as disclosed in the art (e.g., Angal et al. (1993)
Mol. Immunol. 30:105-08).
[0161] The IL-13 binding agents can be in the form of intact
antibodies, antigen-binding fragments of antibodies, e.g., Fab,
F(ab').sub.2, Fd, dAb, and scFv fragments, and intact antibodies
and fragments that have been mutated either in their constant
and/or variable domain (e.g., mutations to produce chimeric,
partially humanized, or fully humanized antibodies, as well as to
produce antibodies with a desired trait, e.g., enhanced IL-13
binding and/or reduced FcR binding).
[0162] Antibody Production. Some antibody molecules, e.g., Fabs,
can be produced in bacterial cells, e.g., E. coli cells. For
example, if the Fab is encoded by sequences in a phage display
vector that includes a suppressible stop codon between the display
entity and a bacteriophage protein (or fragment thereof), the
vector nucleic acid can be transferred into a bacterial cell that
cannot suppress a stop codon. In this case, the Fab is not fused to
the gene III protein and is secreted into the periplasm and/or
media.
[0163] Antibody molecules can also be produced in eukaryotic cells.
In one embodiment, the antibodies (e.g., scFv's) are expressed in a
yeast cell such as Pichia (see, e.g., Powers et al. (2001) J
Immunol Methods. 251:123-35), Hanseula, or Saccharomyces.
[0164] In one preferred embodiment, antibody molecules are produced
in mammalian cells. Preferred mammalian host cells for expressing
the clone antibodies or antigen-binding fragments thereof include
Chinese Hamster Ovary (CHO cells) (including dhfr.sup.- CHO cells,
described in Urlaub and Chasin (1980) Proc. Natl. Acad. Sci. USA
77:4216-4220, used with a DHFR selectable marker, e.g., as
described in Kaufman and Sharp (1982) Mol. Biol. 159:601-621),
lymphocytic cell lines, e.g., NS0 myeloma cells and SP2 cells, COS
cells, and a cell from a transgenic animal, e.g., a transgenic
mammal. For example, the cell is a mammary epithelial cell.
[0165] In addition to the nucleic acid sequences encoding the
antibody molecule, the recombinant expression vectors may carry
additional sequences, such as sequences that regulate replication
of the vector in host cells (e.g., origins of replication) and
selectable marker genes. The selectable marker gene facilitates
selection of host cells into which the vector has been introduced
(see e.g., U.S. Pat. Nos. 4,399,216, 4,634,665 and 5,179,017). For
example, typically the selectable marker gene confers resistance to
drugs, such as G418, hygromycin, or methotrexate, on a host cell
into which the vector has been introduced.
[0166] In an exemplary system for recombinant expression of an
antibody molecule, a recombinant expression vector encoding both
the antibody heavy chain and the antibody light chain is introduced
into dhfr.sup.- CHO cells by calcium phosphate-mediated
transfection. Within the recombinant expression vector, the
antibody heavy and light chain genes are each operatively linked to
enhancer/promoter regulatory elements (e.g., derived from SV40,
CMV, adenovirus and the like, such as a CMV enhancer/AdMLP promoter
regulatory element or an SV40 enhancer/AdMLP promoter regulatory
element) to drive high levels of transcription of the genes. The
recombinant expression vector also carries a DHFR gene, which
allows for selection of CHO cells that have been transfected with
the vector using methotrexate selection/amplification. The selected
transformant host cells can be cultured to allow for expression of
the antibody heavy and light chains and intact antibody is
recovered from the culture medium. Standard molecular biology
techniques can be used to prepare the recombinant expression
vector, transfect the host cells, select for transformants, culture
the host cells and recover the antibody molecule from the culture
medium. For example, some antibody molecules can be isolated by
affinity chromatography with a Protein A or Protein G coupled
matrix.
[0167] For antibody molecules that include an Fc domain, the
antibody production system preferably synthesizes antibodies in
which the Fc region is glycosylated. For example, the Fc domain of
IgG molecules is glycosylated at asparagine 297 in the CH2 domain.
This asparagine is the site for modification with biantennary-type
oligosaccharides. It has been demonstrated that this glycosylation
is required for effector functions mediated by Fc.gamma. receptors
and complement Clq (Burton and Woof (1992) Adv. Immunol. 51:1-84;
Jefferis et al. (1998) Immunol. Rev. 163:59-76). In one embodiment,
the Fc domain is produced in a mammalian expression system that
appropriately glycosylates the residue corresponding to asparagine
297. The Fc domain can also include other eukaryotic
post-translational modifications.
[0168] Antibody molecules can also be produced by a transgenic
animal. For example, U.S. Pat. No. 5,849,992 describes a method of
expressing an antibody in the mammary gland of a transgenic mammal.
A transgene is constructed that includes a milk-specific promoter
and nucleic acids encoding the antibody molecule and a signal
sequence for secretion. The milk produced by females of such
transgenic mammals includes, secreted-therein, the antibody of
interest. The antibody molecule can be purified from the milk, or
for some applications, used directly.
[0169] Characterization
[0170] The binding properties of a binding agent may be measured by
any method, e.g., one of the following methods: BIACORE.TM.
analysis, Enzyme Linked Immunosorbent Assay (ELISA), x-ray
crystallography, sequence analysis and scanning mutagenesis. The
ability of a protein to neutralize and/or inhibit one or more
IL-13-associated activities may be measured by the following
methods: assays for measuring the proliferation of an IL-13
dependent cell line, e.g. TFI; assays for measuring the expression
of IL-13-mediated polypeptides, e.g., flow cytometric analysis of
the expression of CD23; assays evaluating the activity of
downstream signaling molecules, e.g., STATE; assays evaluating
production of tenascin; assays testing the efficiency of an
antibody described herein to prevent asthma in a relevant animal
model, e.g., the cynomolgus monkey, and other assays. An IL-13
binding agent, particularly an IL-13 antibody molecule, can have a
statistically significant effect in one or more of these assays.
Exemplary assays for binding properties include the following.
[0171] The binding interaction of a IL-13 binding agent and a
target (e.g., IL-13) can be analyzed using surface plasmon
resonance (SPR). SPR or Biomolecular Interaction Analysis (BIA)
detects biospecific interactions in real time, without labeling any
of the interactants. Changes in the mass at the binding surface
(indicative of a binding event) of the BIA chip result in
alterations of the refractive index of light near the surface. The
changes in the refractivity generate a detectable signal, which are
measured as an indication of real-time reactions between biological
molecules. Methods for using SPR are described, for example, in
U.S. Pat. No. 5,641,640; Raether (1988) Surface Plasmons Springer
Verlag; Sjolander and Urbaniczky (1991) Anal. Chem. 63:2338-2345;
Szabo et al. (1995) Curr. Opin. Struct. Biol. 5:699-705 and on-line
resources provide by BIAcore International AB (Uppsala,
Sweden).
[0172] Information from SPR can be used to provide an accurate and
quantitative measure of the equilibrium dissociation constant
(K.sub.d), and kinetic parameters, including K.sub.on and
K.sub.off, for the binding of a molecule to a target. Such data can
be used to compare different molecules. Information from SPR can
also be used to develop structure-activity relationships (SAR). For
example, the kinetic and equilibrium binding parameters of
different antibody molecule can be evaluated. Variant amino acids
at given positions can be identified that correlate with particular
binding parameters, e.g., high affinity and slow K.sub.off. This
information can be combined with structural modeling (e.g., using
homology modeling, energy minimization, or structure determination
by x-ray crystallography or NMR). As a result, an understanding of
the physical interaction between the protein and its target can be
formulated and used to guide other design processes.
[0173] Respiratory Disorders
[0174] IL-13 binding agents, e.g., anti-IL-13 antibody molecules,
can be used to treat or prevent respiratory disorders including,
but are not limited to asthma (e.g., allergic and nonallergic
asthma (e.g., due to infection, e.g., with respiratory syncytial
virus (RSV), e.g., in younger children)); bronchitis (e.g., chronic
bronchitis); chronic obstructive pulmonary disease (COPD) (e.g.,
emphysema (e.g., cigarette-induced emphysema); conditions involving
airway inflammation, eosinophilia, fibrosis and excess mucus
production, e.g., cystic fibrosis, pulmonary fibrosis, and allergic
rhinitis. For example, an IL-13 binding agent (e.g., an anti-IL-13
antibody molecule) can be administered in an amount effective to
treat or prevent the disorder or to ameliorate at least one symptom
of the disorder.
[0175] Asthma can be triggered by myriad conditions, e.g.,
inhalation of an allergen, presence of an upper-respiratory or ear
infection, etc. (Opperwall (2003) Nurs. Clin. North Am.
38:697-711). Allergic asthma is characterized by airway
hyperresponsiveness (AHR) to a variety of specific and nonspecific
stimuli, elevated serum immunoglobulin E (IgE), excessive airway
mucus production, edema, and bronchial epithelial injury
(Wills-Karp, supra). Allergic asthma begins when the allergen
provokes an immediate early airway response, which is frequently
followed several hours later by a delayed late-phase airway
response (LAR) (Henderson et al. (2000) J. Immunol. 164:1086-95).
During LAR, there is an influx of eosinophils, lymphocytes, and
macrophages throughout the airway wall and the bronchial fluid.
(Henderson et al., supra). Lung eosinophilia is a hallmark of
allergic asthma and is responsible for much of the damage to the
respiratory epithelium (Li et al. (1999) J. Immunol.
162:2477-87).
[0176] CD4.sup.+ T helper (Th) cells are important for the chronic
inflammation associated with asthma (Henderson et al., supra).
Several studies have shown that commitment of CD4+ cells to type 2
T helper (Th2) cells and the subsequent production of type 2
cytokines (e.g., IL-4, IL-5, IL-10, and IL-13) are important in the
allergic inflammatory response leading to AHR (Tomkinson et al.
(2001) J. Immunol. 166:5792-5800, and references cited therein).
First, CD4.sup.+ T cells have been shown to be necessary for
allergy-induced asthma in murine models. Second, CD4.sup.+ T cells
producing type 2 cytokines undergo expansion not only in these
animal models but also in patients with allergic asthma. Third,
type 2 cytokine levels are increased in the airway tissues of
animal models and asthmatics. Fourth, Th2 cytokines have been
implicated as playing a central role in eosinophil recruitment in
murine models of allergic asthma, and adoptively transferred Th2
cells have been correlated with increased levels of eotaxin (a
potent eosinophil chemoattractant) in the lung as well as lung
eosinophilia (Wills-Karp et al., supra; Li et al., supra).
[0177] The methods for treating or preventing asthma described
herein include those for extrinsic asthma (also known as allergic
asthma or atopic asthma), intrinsic asthma (also known as
non-allergic asthma or non-atopic asthma) or combinations of both,
which has been referred to as mixed asthma. Extrinsic or allergic
asthma includes incidents caused by, or associated with, e.g.,
allergens, such as pollens, spores, grasses or weeds, pet danders,
dust, mites, etc. As allergens and other irritants present
themselves at varying points over the year, these types of
incidents are also referred to as seasonal asthma. Also included in
the group of extrinsic asthma is bronchial asthma and allergic
bronchopulmonary aspergillosis.
[0178] Disorders that can be treated or alleviated by the agents
described herein include those respiratory disorders and asthma
caused by infectious agents, such as viruses (e.g., cold and flu
viruses, respiratory syncytial virus (RSV), paramyxovirus,
rhinovirus and influenza viruses. RSV, rhinovirus and influenza
virus infections are common in children, and are one leading cause
of respiratory tract illnesses in infants and young children.
Children with viral bronchiolitis can develop chronic wheezing and
asthma, which can be treated using the methods described herein.
Also included are the asthma conditions which may be brought about
in some asthmatics by exercise and/or cold air. The methods are
useful for asthmas associated with smoke exposure (e.g.,
cigarette-induced and industrial smoke), as well as industrial and
occupational exposures, such as smoke, ozone, noxious gases, sulfur
dioxide, nitrous oxide, fumes, including isocyanates, from paint,
plastics, polyurethanes, varnishes, etc., wood, plant or other
organic dusts, etc. The methods are also useful for asthmatic
incidents associated with food additives, preservatives or
pharmacological agents. Also included are methods for treating,
inhibiting or alleviating the types of asthma referred to as silent
asthma or cough variant asthma.
[0179] The methods disclosed herein are also useful for treatment
and alleviation of asthma associated with gastroesophageal reflux
(GERD), which can stimulate bronchoconstriction. GERD, along with
retained bodily secretions, suppressed cough, and exposure to
allergens and irritants in the bedroom can contribute to asthmatic
conditions and have been collectively referred to as nighttime
asthma or nocturnal asthma. In methods of treatment, inhibition or
alleviation of asthma associated with GERD, a pharmaceutically
effective amount of the IL-13 binding agent can be used as
described herein in combination with a pharmaceutically effective
amount of an agent for treating GERD. These agents include, but are
not limited to, proton pump inhibiting agents like PROTONIX.RTM.
brand of delayed-release pantoprazole sodium tablets, PRILOSEC.RTM.
brand omeprazole delayed release capsules, ACIPHEX.RTM. brand
rebeprazole sodium delayed release tablets or PREVACID.RTM. brand
delayed release lansoprazole capsules.
[0180] Atopic Disorders and Symptoms Thereof
[0181] It has been observed that cells from atopic patients have
enhanced sensitivity to IL-13. Accordingly, an IL-13 binding agent
(e.g., an IL-13 binding agent such as an antibody molecule
described herein) can be administered in an amount effective to
treat or prevent an atopic disorder. "Atopic" refers to a group of
diseases in which there is often an inherited tendency to develop
an allergic reaction.
[0182] Examples of atopic disorders include allergy, allergic
rhinitis, atopic dermatitis, asthma and hay fever. Asthma is a
phenotypically heterogeneous disorder associated with intermittent
respiratory symptoms such as, e.g., bronchial hyperresponsiveness
and reversible airflow obstruction. Immunohistopathologic features
of asthma include, e.g., denudation of airway epithelium, collagen
deposition beneath the basement membrane; edema; mast cell
activation; and inflammatory cell infiltration (e.g., by
neutrophils, eosinophils, and lymphocytes). Airway inflammation can
further contribute to airway hyperresponsiveness, airflow
limitation, acute bronchoconstriction, mucus plug formation, airway
wall remodeling, and other respiratory symptoms. An IL-13 binding
agent (e.g., an IL-13 binding agent such as an antibody molecule
described herein) can be administered in an amount effective to
ameliorate one or more of these symptoms.
[0183] Symptoms of allergic rhinitis (hay fever) include itchy,
runny, sneezing, or stuffy nose, and itchy eyes. An IL-13 binding
agent can be administered to ameliorate one or more of these
symptoms. Atopic dermatitis is a chronic (long-lasting) disease
that affects the skin. Information about atopic dermatitis is
available, e.g., from NIH Publication No. 03-4272. In atopic
dermatitis, the skin can become extremely itchy, leading to
redness, swelling, cracking, weeping clear fluid, and finally,
crusting and scaling. In many cases, there are periods of time when
the disease is worse (called exacerbations or flares) followed by
periods when the skin improves or clears up entirely (called
remissions). Atopic dermatitis is often referred to as "eczema,"
which is a general term for the several types of inflammation of
the skin. Atopic dermatitis is the most common of the many types of
eczema. Examples of atopic dermatitis include: allergic contact
eczema (dermatitis: a red, itchy, weepy reaction where the skin has
come into contact with a substance that the immune system
recognizes as foreign, such as poison ivy or certain preservatives
in creams and lotions); contact eczema (a localized reaction that
includes redness, itching, and burning where the skin has come into
contact with an allergen (an allergy-causing substance) or with an
irritant such as an acid, a cleaning agent, or other chemical);
dyshidrotic eczema (irritation of the skin on the palms of hands
and soles of the feet characterized by clear, deep blisters that
itch and burn); neurodermatitis (scaly patches of the skin on the
head, lower legs, wrists, or forearms caused by a localized itch
(such as an insect bite) that become intensely irritated when
scratched); nummular eczema (coin-shaped patches of irritated
skin-most common on the arms, back, buttocks, and lower legs-that
may be crusted, scaling, and extremely itchy); seborrheic eczema
(yellowish, oily, scaly patches of skin on the scalp, face, and
occasionally other parts of the body). Additional particular
symptoms include stasis dermatitis, atopic pleat (Dennie-Morgan
fold), cheilitis, hyperlinear palms, hyperpigmented eyelids
(eyelids that have become darker in color from inflammation or hay
fever), ichthyosis, keratosis pilaris, lichenification, papules,
and urticaria. An IL-13 binding agent can be administered to
ameliorate one or more of these symptoms.
[0184] An exemplary method for treating allergic rhinitis or other
allergic disorder can include initiating therapy with an IL-13
binding agent prior to exposure to an allergen, e.g., prior to
seasonal exposure to an allergen, e.g., prior to allergen blooms.
Such therapy can include one or more doses, e.g., doses at regular
intervals.
[0185] Cancer
[0186] IL-13 and its receptors may be involved in the development
of at least some types of cancer, e.g., a cancer derived from
hematopoietic cells or a cancer derived from brain or neuronal
cells (e.g., a glioblastoma). For example, blockade of the IL-13
signaling pathway, e.g., via use of a soluble IL-13 receptor or a
STATE -/- deficient mouse, leads to delayed tumor onset and/or
growth of Hodgkins lymphoma cell lines or a metastatic mammary
carcinoma, respectively (Trieu et al. (2004) Cancer Res. 64:
3271-75; Ostrand-Rosenberg et al. (2000) J. Immunol. 165:
6015-6019). Cancers that express IL-13R(2 (Husain and Puri (2003)
J. Neurooncol. 65:37-48; Mintz et al. (2003) J. Neurooncol.
64:117-23) can be specifically targeted by anti-IL-13 antibodies
described herein. IL-13 binding agents, e.g., anti-IL-13 antibody
molecules, can be useful to inhibit cancer cell proliferation or
other cancer cell activity. A cancer refers to one or more cells
that has a loss of responsiveness to normal growth controls, and
typically proliferates with reduced regulation relative to a
corresponding normal cell.
[0187] Examples of cancers against which IL-13 binding agents
(e.g., an IL-13 binding agent such as an antibody or antigen
binding fragment described herein) can be used for treatment
include leukemias, e.g., B-cell chronic lymphocytic leukemia, acute
myelogenous leukemia, and human T-cell leukemia virus type 1
(HTLV-1) transformed T cells; lymphomas, e.g. T cell lymphoma,
Hodgkin's lymphoma; glioblastomas; pancreatic cancers; renal cell
carcinoma; ovarian carcinoma; and AIDS-Kaposi's sarcoma. For
example, an IL-13 binding agent (e.g., an anti-IL-13 antibody
molecule) can be administered in an amount effective to treat or
prevent the disorder, e.g., to reduce cell proliferation, or to
ameliorate at least one symptom of the disorder.
[0188] Fibrosis
[0189] IL-13 binding agents can also be useful in treating
inflammation and fibrosis, e.g., fibrosis of the liver. IL-13
production has been correlated with the progression of liver
inflammation (e.g., viral hepatitis) toward cirrhosis, and
possibly, hepatocellular carcinoma (de Lalla et al. (2004) J.
Immunol. 173:1417-1425). Fibrosis occurs, e.g., when normal tissue
is replaced by scar tissue, often following inflammation. Hepatitis
B and hepatitis C viruses both cause a fibrotic reaction in the
liver, which can progress to cirrhosis. Cirrhosis, in turn, can
evolve into severe complications such as liver failure or
hepatocellular carcinoma. Blocking IL-13 activity using the IL-13
binding agents, e.g., anti-IL-13 antibodies, described herein can
reduce inflammation and fibrosis, e.g., the inflammation, fibrosis,
and cirrhosis associated with liver diseases, especially hepatitis
B and C. For example, an IL-13 binding agent (e.g., an anti-IL-13
antibody molecule) can be administered in an amount effective to
treat or prevent the disorder or to ameliorate at least one symptom
of the inflammatory and/or fibrotic disorder.
[0190] Inflammatory Bowel Disease
[0191] Inflammatory bowel disease (IBD) is the general name for
diseases that cause inflammation of the intestines. Two examples of
inflammatory bowel disease are Crohn's disease and ulcerative
colitis. IL-13/STATE signaling has been found to be involved in
inflammation-induced hypercontractivity of mouse smooth muscle, a
model of inflammatory bowel disease (Akiho et al. (2002) Am. J.
Physiol. Gastrointest. Liver Physiol. 282:G226-232). For example,
an IL-13 binding agent (e.g., an anti-IL-13 antibody molecule) can
be administered in an amount effective to treat or prevent the
disorder or to ameliorate at least one symptom of the inflammatory
bowel disorder.
[0192] Additional IL-13 Binding Agents
[0193] Also provided are binding agents, other than binding agents
that are antibodies and fragments thereof, that bind to IL-13,
particularly binding agents that compete with MJ2-7 or C65 and
other antibodies described herein for binding to IL-13. For
example, the binding agents can bind to the same epitope or an
overlapping epitope as MJ2-7 or C65 on IL-13. The binding agents
preferably inhibit or neutralize IL-13 activity. For example, the
binding agents inhibit binding of IL-13 to IL13R.alpha.1 and, e.g.,
does not prevent binding of IL-13 to IL-4R.alpha.. Such binding
agents can be used in the methods described herein, e.g., the
methods of treating and preventing disorders. All embodiments
described herein can be adapted for use with IL-13 binding
agents.
[0194] Binding agents can be identified by a number of means,
including modifying a variable domain described herein or grafting
one or more CDRs of a variable domain described herein onto another
scaffold domain. Binding agents can also be identified from diverse
libraries, e.g., by screening. One method for screening protein
libraries uses phage display. Particular regions of a protein are
varied and proteins that interact with IL-13 are identified, e.g.,
by retention on a solid support or by other physical association.
To identify particular binding agents that bind to the same epitope
or an overlapping epitope as MJ2-7 or C65 on IL-13, binding agents
can be eluted by adding MJ2-7 or C65 (or related antibody), or
binding agents can be evaluated in competition experiments with
MJ2-7 or C65 (or related antibody). It is also possible to deplete
the library of agents that bind to other epitopes by contacting the
library to a complex that contains IL-13 and MJ2-7 or C65 (or
related antibody). The depleted library can then be contacted to
IL-13 to obtain a binding agent that binds to IL-13 but not to
IL-13 when it is bound by MJ 2-7 or C65. It is also possible to use
peptides from IL-13 that contain the MJ 2-7 or C65 epitope as a
target.
[0195] Phage display is described, for example, in U.S. Pat. No.
5,223,409; Smith (1985) Science 228:1315-1317; WO 92/18619; WO
91/17271; WO 92/20791; WO 92/15679; WO 93/01288; WO 92/01047; WO
92/09690; WO 90/02809; WO 94/05781; Fuchs et al. (1991)
Bio/Technology 9:1370-1372; Hay et al. (1992) Hum Antibod
Hybridomas 3:81-85; Huse et al. (1989) Science 246:1275-1281;
Griffiths et al. (1993) EMBO J. 12:725-734; Hawkins et al. (1992) J
Mol Biol 226:889-896; Clackson et al. (1991) Nature 352:624-628;
Gram et al. (1992) PNAS 89:3576-3580; Garrard et al. (1991)
Bio/Technology 9:1373-1377; Rebar et al. (1996) Methods Enzymol.
267:129-49; and Barbas et al. (1991) PNAS 88:7978-7982. Yeast
surface display is described, e.g., in Boder and Wittrup (1997)
Nat. Biotechnol. 15:553-557. Another form of display is ribosome
display. See, e.g., Mattheakis et al. (1994) Proc. Natl. Acad. Sci.
USA 91:9022 and Hanes et al. (2000) Nat. Biotechnol. 18:1287-92;
Hanes et al. (2000) Methods Enzymol. 328:404-30. and Schaffitzel et
al. (1999) J Immunol Methods. 231(1-2):119-35.
[0196] Binding agents that bind to IL-13 can have structural
features of one scaffold proteins, e.g., a folded domain. An
exemplary scaffold domain, based on an antibody, is a "minibody"
scaffold has been designed by deleting three beta strands from a
heavy chain variable domain of a monoclonal antibody (Tramontano et
al., 1994, J. Mol. Recognit. 7:9; and Martin et al., 1994, EMBO J.
13:5303-5309). This domain includes 61 residues and can be used to
present two hypervariable loops, e.g., one or more hypervariable
loops of a variable domain described herein or a variant described
herein. In another approach, the binding agent includes a scaffold
domain that is a V-like domain (Coia et al. WO 99/45110). V-like
domains refer to a domain that has similar structural features to
the variable heavy (VH) or variable light (VL) domains of
antibodies. Another scaffold domain is derived from tendamistatin,
a 74 residue, six-strand beta sheet sandwich held together by two
disulfide bonds (McConnell and Hoess, 1995, J. Mol. Biol. 250:460).
This parent protein includes three loops. The loops can be modified
(e.g., using CDRs or hypervariable loops described herein) or
varied, e.g., to select domains that bind to IL-13. WO 00/60070
describes a .beta.-sandwich structure derived from the naturally
occurring extracellular domain of CTLA-4 that can be used as a
scaffold domain.
[0197] Still another scaffold domain for an IL-13 binding agent is
a domain based on the fibronectin type III domain or related
fibronectin-like proteins. The overall fold of the fibronectin type
III (Fn3) domain is closely related to that of the smallest
functional antibody fragment, the variable domain of the antibody
heavy chain. Fn3 is a .beta.-sandwich similar to that of the
antibody VH domain, except that Fn3 has seven .beta.-strands
instead of nine. There are three loops at the end of Fn3; the
positions of BC, DE and FG loops approximately correspond to those
of CDR1, 2 and 3 of the VH domain of an antibody. Fn3 is
advantageous because it does not have disulfide bonds. Therefore,
Fn3 is stable under reducing conditions, unlike antibodies and
their fragments (see WO 98/56915; WO 01/64942; WO 00/34784). An Fn3
domain can be modified (e.g., using CDRs or hypervariable loops
described herein) or varied, e.g., to select domains that bind to
IL-13.
[0198] Still other exemplary scaffold domains include: T-cell
receptors; MHC proteins; extracellular domains (e.g., fibronectin
Type III repeats, EGF repeats); protease inhibitors (e.g., Kunitz
domains, ecotin, BPTI, and so forth); TPR repeats; trifoil
structures; zinc finger domains; DNA-binding proteins; particularly
monomeric DNA binding proteins; RNA binding proteins; enzymes,
e.g., proteases (particularly inactivated proteases), RNase;
chaperones, e.g., thioredoxin, and heat shock proteins; and
intracellular signaling domains (such as SH2 and SH3 domains). US
20040009530 describes examples of some alternative scaffolds.
[0199] Examples of small scaffold domains include: Kunitz domains
(58 amino acids, 3 disulfide bonds), Cucurbida maxima trypsin
inhibitor domains (31 amino acids, 3 disulfide bonds), domains
related to guanylin (14 amino acids, 2 disulfide bonds), domains
related to heat-stable enterotoxin IA from gram negative bacteria
(18 amino acids, 3 disulfide bonds), EGF domains (50 amino acids, 3
disulfide bonds), kringle domains (60 amino acids, 3 disulfide
bonds), fungal carbohydrate-binding domains (35 amino acids, 2
disulfide bonds), endothelin domains (18 amino acids, 2 disulfide
bonds), and Streptococcal G IgG-binding domain (35 amino acids, no
disulfide bonds). Examples of small intracellular scaffold domains
include SH2, SH3, and EVH domains. Generally, any modular domain,
intracellular or extracellular, can be used.
[0200] Exemplary criteria for evaluating a scaffold domain can
include: (1) amino acid sequence, (2) sequences of several
homologous domains, (3) 3-dimensional structure, and/or (4)
stability data over a range of pH, temperature, salinity, organic
solvent, oxidant concentration. In one embodiment, the scaffold
domain is a small, stable protein domains, e.g., a protein of less
than 100, 70, 50, 40 or 30 amino acids. The domain may include one
or more disulfide bonds or may chelate a metal, e.g., zinc.
[0201] Still other binding agents are based on peptides, e.g.,
proteins with an amino acid sequence that are less than 30, 25, 24,
20, 18, 15, or 12 amino acids. Peptides can be incorporated in a
larger protein, but typically a region that can independently bind
to IL-13, e.g., to an epitope described herein. Peptides can be
identified by phage display. See, e.g., US 20040071705.
[0202] An IL-13 binding agent may include non-peptide linkages and
other chemical modification. For example, part or all of the
binding agent may be synthesized as a peptidomimetic, e.g., a
peptoid (see, e.g., Simon et al. (1992) Proc. Natl. Acad. Sci. USA
89:9367-71 and Horwell (1995) Trends Biotechnol. 13:132-4). A
binding agent may include one or more (e.g., all) non-hydrolyzable
bonds. Many non-hydrolyzable peptide bonds are known in the art,
along with procedures for synthesis of peptides containing such
bonds. Exemplary non-hydrolyzable bonds include --[CH.sub.2NH]--
reduced amide peptide bonds, --[COCH.sub.2]-- ketomethylene peptide
bonds, --[CH(CN)NH]-- (cyanomethylene)amino peptide bonds,
--[CH.sub.2CH(OH)]-- hydroxyethylene peptide bonds, --[CH.sub.2O]--
peptide bonds, and --[CH.sub.2S]-- thiomethylene peptide bonds (see
e.g., U.S. Pat. No. 6,172,043).
[0203] Pharmaceutical Compositions
[0204] The IL-13 binding agents, e.g. antibody molecules that bind
to IL-13 (such as those described herein) can be used in vitro, ex
vivo, or in vivo. They can be incorporated into a pharmaceutical
composition, e.g., by combining the IL-13 binding agent with a
pharmaceutically acceptable carrier. Such a composition may
contain, in addition to the IL-13 binding agent and carrier,
various diluents, fillers, salts, buffers, stabilizers,
solubilizers, and other materials well known in the art.
Pharmaceutically acceptable materials is generally a nontoxic
material that does not interfere with the effectiveness of the
biological activity of an IL-13 binding agent. The characteristics
of the carrier can depend on the route of administration.
[0205] The pharmaceutical composition described herein may also
contain other factors, such as, but not limited to, other
anti-cytokine antibody molecules or other anti-inflammatory agents
as described in more detail below. Such additional factors and/or
agents may be included in the pharmaceutical composition to produce
a synergistic effect with an IL-13 binding agent, e.g., anti-IL-13
antibody molecule, described herein. For example, in the treatment
of allergic asthma, a pharmaceutical composition described herein
may include anti-IL-4 antibody molecules or drugs known to reduce
an allergic response.
[0206] The pharmaceutical composition described herein may be in
the form of a liposome in which an IL-13 binding agent, e.g., an
anti-IL-13 antibody molecule, such as one described herein is
combined, in addition to other pharmaceutically acceptable
carriers, with amphipathic agents such as lipids that exist in
aggregated form as micelles, insoluble monolayers, liquid crystals,
or lamellar layers while in aqueous solution. Suitable lipids for
liposomal formulation include, without limitation, monoglycerides,
diglycerides, sulfatides, lysolecithin, phospholipids, saponin,
bile acids, and the like. Exemplary methods for preparing such
liposomal formulations include methods described in U.S. Pat. Nos.
4,235,871; 4,501,728; 4,837,028; and 4,737,323.
[0207] As used herein, the term "therapeutically effective amount"
means the total amount of each active component of the
pharmaceutical composition or method that is sufficient to show a
meaningful patient benefit, e.g., amelioration of symptoms of,
healing of, or increase in rate of healing of such conditions. When
applied to an individual active ingredient, administered alone, the
term refers to that ingredient alone. When applied to a
combination, the term refers to combined amounts of the active
ingredients that result in the therapeutic effect, whether
administered in combination, serially or simultaneously.
[0208] In practicing the method of treatment or use, a
therapeutically effective amount of IL-13 binding agent, e.g., an
anti-IL-13 antibody molecule, e.g., an antibody molecule that binds
to IL-13 and interferes with the formation of a functional IL-13
signaling complex (and, e.g., neutralizes or inhibits one or more
IL-13-associated activities), is administered to a subject, e.g.,
mammal (e.g., a human). An IL-13 binding agent, e.g., an anti-IL-13
antibody molecule, may be administered in accordance with a method
described herein either alone as well as in combination with other
therapies such as treatments employing cytokines, lymphokines or
other hematopoietic factors, cancer therapeutics, or
anti-inflammatory agents. When coadministered with one or more
agents, an IL-13 binding agent, e.g., an anti-IL-13 antibody
molecule, may be administered either simultaneously with the second
agent, or sequentially. If administered sequentially, a physician
can select an appropriate sequence for administering the IL-13
binding agent in combination with other agents.
[0209] Administration of an IL-13 binding agent, e.g., an
anti-IL-13 antibody molecule, used in the pharmaceutical
composition can be carried out in a variety of conventional ways,
such as oral ingestion, inhalation, or cutaneous, subcutaneous, or
intravenous injection. When a therapeutically effective amount of
an IL-13 binding agent, e.g., an anti-IL-13 antibody molecule, is
administered by intravenous, cutaneous or subcutaneous injection,
the binding agent can be prepared as a pyrogen-free, parenterally
acceptable aqueous solution. The composition of such parenterally
acceptable protein solutions can be adapted in view factors such as
pH, isotonicity, stability, and the like, e.g., to optimize the
composition for physiological conditions, binding agent stability,
and so forth. A pharmaceutical composition for intravenous,
cutaneous, or subcutaneous injection can contain, e.g., an isotonic
vehicle such as Sodium Chloride Injection, Ringer's Injection,
Dextrose Injection, Dextrose and Sodium Chloride Injection,
Lactated Ringer's Injection, or other vehicle as known in the art.
The pharmaceutical composition may also contain stabilizers,
preservatives, buffers, antioxidants, or other additive.
[0210] The amount of an IL-13 binding agent, e.g., an anti-IL-13
antibody molecule, in the pharmaceutical composition can depend
upon the nature and severity of the condition being treated, and on
the nature of prior treatments that the patient has undergone. The
pharmaceutical composition can be administered to normal patients
or patients who do not show symptoms, e.g., in a prophylactic mode.
An attending physician may decide the amount of IL-13 binding
agent, e.g., an anti-IL-13 antibody molecule, with which to treat
each individual patient. For example, an attending physician can
administer low doses of antagonist and observe the patient's
response. Larger doses of antagonist may be administered until the
optimal therapeutic effect is obtained for the patient, and at that
point the dosage is not generally increased further. For example, a
pharmaceutical may contain between about 0.1 mg to 50 mg antibody
per kg body weight, e.g., between about 0.1 mg and 5 mg or between
about 8 mg and 50 mg antibody per kg body weight. In one embodiment
in which the antibody is delivered subcutaneously at a frequency of
no more than twice per month, e.g., every other week or monthly,
the composition includes an amount of about 0.7-3.3, e.g., 1.0-3.0
mg/kg, e.g., about 0.8-1.2, 1.2-2.8, or 2.8-3.3 mg/kg.
[0211] The duration of therapy using the pharmaceutical composition
may vary, depending on the severity of the disease being treated
and the condition and potential idiosyncratic response of each
individual patient. In one embodiment, the IL-13 binding agent,
e.g., an anti-IL-13 antibody molecule, can also be administered via
the subcutaneous route, e.g., in the range of once a week, once
every 24, 48, 96 hours, or not more frequently than such intervals.
Exemplary dosages can be in the range of 0.1-20 mg/kg, more
preferably 1-10 mg/kg. The agent can be administered, e.g., by
intravenous infusion at a rate of less than 20, 10, 5, or 1 mg/min
to reach a dose of about 1 to 50 mg/m.sup.2 or about 5 to 20
mg/m.sup.2.
[0212] In one embodiment, an administration of a IL-13 binding
agent to the patient includes varying the dosage of the protein,
e.g., to reduce or minimize side effects. For example, the subject
can be administered a first dosage, e.g., a dosage less than a
therapeutically effective amount. In a subsequent interval, e.g.,
at least 6, 12, 24, or 48 hours later, the patient can be
administered a second dosage, e.g., a dosage that is at least 25,
50, 75, or 100% greater than the first dosage. For example, the
second and/or a comparable third, fourth and fifth dosage can be at
least about 70, 80, 90, or 100% of a therapeutically effective
amount.
[0213] Inhalation
[0214] A composition that includes an IL-13 binding agent, e.g., an
anti-IL-13 antibody molecule, can be formulated for inhalation or
other mode of pulmonary delivery. Accordingly, the IL-13 binding
agent can be administered by inhalation to pulmonary tissue. The
term "pulmonary tissue" as used herein refers to any tissue of the
respiratory tract and includes both the upper and lower respiratory
tract, except where otherwise indicated. An IL-13 binding agent,
e.g., an anti-IL-13 antibody molecule, can be administered in
combination with one or more of the existing modalities for
treating pulmonary diseases.
[0215] In one example the IL-13 binding agent is formulated for a
nebulizer. In one embodiment, the IL-13 binding agent can be stored
in a lyophilized form (e.g., at room temperature) and reconstituted
in solution prior to inhalation. It is also possible to formulate
the IL-13 binding agent for inhalation using a medical device,
e.g., an inhaler. See, e.g., U.S. Pat. No. 6,102,035 (a powder
inhaler) and 6,012,454 (a dry powder inhaler). The inhaler can
include separate compartments for the IL-13 binding agent at a pH
suitable for storage and another compartment for a neutralizing
buffer and a mechanism for combining the IL-13 binding agent with a
neutralizing buffer immediately prior to atomization. In one
embodiment, the inhaler is a metered dose inhaler.
[0216] The three common systems used to deliver drugs locally to
the pulmonary air passages include dry powder inhalers (DPIs),
metered dose inhalers (MDIs) and nebulizers. MDIs, the most popular
method of inhalation administration, may be used to deliver
medicaments in a solubilized form or as a dispersion. Typically
MDIs comprise a Freon or other relatively high vapor pressure
propellant that forces aerosolized medication into the respiratory
tract upon activation of the device. Unlike MDIs, DPIs generally
rely entirely on the inspiratory efforts of the patient to
introduce a medicament in a dry powder form to the lungs.
Nebulizers form a medicament aerosol to be inhaled by imparting
energy to a liquid solution. Direct pulmonary delivery of drugs
during liquid ventilation or pulmonary lavage using a
fluorochemical medium has also been explored. These and other
methods can be used to deliver an IL-13 binding agent, e.g.,
anti-IL-13 antibody molecule. In one embodiment, the IL-13 binding
agent is associated with a polymer, e.g., a polymer that stabilizes
or increases half-life of the compound.
[0217] For example, for administration by inhalation, an IL-13
binding agent, e.g., an anti-IL-13 antibody molecule, is delivered
in the form of an aerosol spray from pressured container or
dispenser which contains a suitable propellant or a nebulizer. The
IL-13 binding agent may be in the form of a dry particle or as a
liquid. Particles that include the IL-13 binding agent can be
prepared, e.g., by spray drying, by drying an aqueous solution of
the IL-13 binding agent, e.g., an anti-IL-13 antibody molecule,
with a charge neutralizing agent and then creating particles from
the dried powder or by drying an aqueous solution in an organic
modifier and then creating particles from the dried powder.
[0218] The IL-13 binding agent may be conveniently delivered in the
form of an aerosol spray presentation from pressurized packs or a
nebulizer, with the use of a suitable propellant, e.g.,
dichlorodifluoromethane, trichlorofluoromethane,
dichlorotetrafluoroethane, carbon dioxide or other suitable gas. In
the case of a pressurized aerosol, the dosage unit may be
determined by providing a valve to deliver a metered amount.
Capsules and cartridges for use in an inhaler or insufflator may be
formulated containing a powder mix of an IL-13 binding agent, e.g.,
an anti-IL-13 antibody molecule, and a suitable powder base such as
lactose or starch, if the particle is a formulated particle. In
addition to the formulated or unformulated compound, other
materials such as 100% DPPC or other surfactants can be mixed with
the IL-13 binding agent to promote the delivery and dispersion of
formulated or unformulated compound. Methods of preparing dry
particles are described, for example, in WO 02/32406.
[0219] An IL-13 binding agent, e.g., an anti-IL-13 antibody
molecule, can be formulated for aerosol delivery, e.g., as dry
aerosol particles, such that when administered it can be rapidly
absorbed and can produce a rapid local or systemic therapeutic
result. Administration can be tailored to provide detectable
activity within 2 minutes, 5 minutes, 1 hour, or 3 hours of
administration. In some embodiments, the peak activity can be
achieved even more quickly, e.g., within one half hour or even
within ten minutes. An IL-13 binding agent, e.g., an anti-IL-13
antibody molecule, can be formulated for longer biological
half-life (e.g., by association with a polymer such as PEG) for use
as an alternative to other modes of administration, e.g., such that
the IL-13 binding agent enters circulation from the lung and is
distributed to other organs or to a particular target organ.
[0220] In one embodiment, the IL-13 binding agent, e.g., an
anti-IL-13 antibody molecule, is delivered in an amount such that
at least 5% of the mass of the polypeptide is delivered to the
lower respiratory tract or the deep lung. Deep lung has an
extremely rich capillary network. The respiratory membrane
separating capillary lumen from the alveolar air space is very thin
(.ltoreq.6 Tm) and extremely permeable. In addition, the liquid
layer lining the alveolar surface is rich in lung surfactants. In
other embodiments, at least 2%, 3%, 5%, 10%, 20%, 30%, 40%, 50%,
60%, 70%, or 80% of the composition of an IL-13 binding agent,
e.g., an anti-IL-13 antibody molecule, is delivered to the lower
respiratory tract or to the deep lung. Delivery to either or both
of these tissues results in efficient absorption of the IL-13
binding agent and high bioavailability. In one embodiment, the
IL-13 binding agent is provided in a metered dose using, e.g., an
inhaler or nebulizer. For example, the IL-13 binding agent is
delivered in a dosage unit form of at least about 0.02, 0.1, 0.5,
1, 1.5, 2, 5, 10, 20, 40, or 50 mg/puff or more. The percent
bioavailability can be calculated as follows: the percent
bioavailability=(AUC.sub.non-invasive/AUC.sub.i.v. or
s.c.).times.(dose.sub.i.v. or
s.c./dose.sub.non-invasive).times.100.
[0221] Although not necessary, delivery enhancers such as
surfactants can be used to further enhance pulmonary delivery. A
"surfactant" as used herein refers to a IL-13 binding agent having
a hydrophilic and lipophilic moiety, which promotes absorption of a
drug by interacting with an interface between two immiscible
phases. Surfactants are useful in the dry particles for several
reasons, e.g., reduction of particle agglomeration, reduction of
macrophage phagocytosis, etc. When coupled with lung surfactant, a
more efficient absorption of the IL-13 binding agent can be
achieved because surfactants, such as DPPC, will greatly facilitate
diffusion of the compound. Surfactants are well known in the art
and include but are not limited to phosphoglycerides, e.g.,
phosphatidylcholines, L-alpha-phosphatidylcholine dipalmitoyl
(DPPC) and diphosphatidyl glycerol (DPPG); hexadecanol; fatty
acids; polyethylene glycol (PEG); polyoxyethylene-9-; auryl ether;
palmitic acid; oleic acid; sorbitan trioleate (Span 85);
glycocholate; surfactin; poloxomer; sorbitan fatty acid ester;
sorbitan trioleate; tyloxapol; and phospholipids.
[0222] Stabilization
[0223] In one embodiment, an IL-13 binding agent, e.g., an
anti-IL-13 antibody molecule, is physically associated with a
moiety that improves its stabilization and/or retention in
circulation, e.g., in blood, serum, lymph, bronchopulmonary lavage,
or other tissues, e.g., by at least 1.5, 2, 5, 10, or 50 fold.
[0224] For example, an IL-13 binding agent, e.g., an anti-IL-13
antibody molecule, can be associated with a polymer, e.g., a
substantially non-antigenic polymers, such as polyalkylene oxides
or polyethylene oxides. Suitable polymers will vary substantially
by weight. Polymers having molecular number average weights ranging
from about 200 to about 35,000 (or about 1,000 to about 15,000, and
2,000 to about 12,500) can be used.
[0225] For example, an IL-13 binding agent, e.g., an anti-IL-13
antibody molecule, can be conjugated to a water soluble polymer,
e.g., hydrophilic polyvinyl polymers, e.g. polyvinylalcohol and
polyvinylpyrrolidone. A non-limiting list of such polymers includes
polyalkylene oxide homopolymers such as polyethylene glycol (PEG)
or polypropylene glycols, polyoxyethylenated polyols, copolymers
thereof and block copolymers thereof, provided that the water
solubility of the block copolymers is maintained. Additional useful
polymers include polyoxyalkylenes such as polyoxyethylene,
polyoxypropylene, and block copolymers of polyoxyethylene and
polyoxypropylene (Pluronics); polymethacrylates; carbomers;
branched or unbranched polysaccharides which comprise the
saccharide monomers D-mannose, D- and L-galactose, fucose,
fructose, D-xylose, L-arabinose, D-glucuronic acid, sialic acid,
D-galacturonic acid, D-mannuronic acid (e.g. polymannuronic acid,
or alginic acid), D-glucosamine, D-galactosamine, D-glucose and
neuraminic acid including homopolysaccharides and
heteropolysaccharides such as lactose, amylopectin, starch,
hydroxyethyl starch, amylose, dextran sulfate, dextran, dextrins,
glycogen, or the polysaccharide subunit of acid
mucopolysaccharides, e.g. hyaluronic acid; polymers of sugar
alcohols such as polysorbitol and polymannitol; heparin or
heparan.
[0226] The conjugates of an IL-13 binding agent, e.g., an
anti-IL-13 antibody molecule, and a polymer can be separated from
the unreacted starting materials, e.g., by gel filtration or ion
exchange chromatography, e.g., HPLC. Heterologous species of the
conjugates are purified from one another in the same fashion.
Resolution of different species (e.g. containing one or two PEG
residues) is also possible due to the difference in the ionic
properties of the unreacted amino acids. See, e.g., WO
96/34015.
[0227] Use of IL-13 Binding Agents to Modulate One or More
IL-13-Associated Activities In Vivo
[0228] In yet another aspect, the invention features a method for
modulating (e.g., decreasing, neutralizing and/or inhibiting) one
or more associated activities of IL-13 in vivo by administering an
IL-13 binding agent, e.g., an anti-IL-13 antibody molecule,
described herein in an amount sufficient to inhibit its activity.
An IL-13 binding agent can also be administered to subjects for
whom inhibition of an IL-13-mediated inflammatory response is
required. These conditions include, e.g., airway inflammation,
asthma, fibrosis, eosinophilia and increased mucus production.
[0229] The efficacy of an IL-13 binding agent, e.g., an anti-IL-13
antibody molecule, described herein can be evaluated, e.g., by
evaluating ability of the antagonist to modulate airway
inflammation in cynomolgus monkeys exposed to an Ascaris suum
allergen. An IL-13 binding agent, particularly one that inhibits at
least one IL-13 activity, can be used to neutralize or inhibit one
or more IL-13-associated activities, e.g., to reduce IL-13 mediated
inflammation in vivo, e.g., for treating or preventing
IL-13-associated pathologies, including asthma and/or its
associated symptoms.
[0230] In one embodiment, an IL-13 binding agent, e.g., an
anti-IL-13 antibody molecule, e.g., pharmaceutical compositions
thereof, is administered in combination therapy, i.e., combined
with other agents, e.g., therapeutic agents, that are useful for
treating pathological conditions or disorders, such as allergic and
inflammatory disorders. The term "in combination" in this context
means that the agents are given substantially contemporaneously,
either simultaneously or sequentially. If given sequentially, at
the onset of administration of the second compound, the first of
the two compounds is preferably still detectable at effective
concentrations at the site of treatment.
[0231] For example, the combination therapy can include one or more
IL-13 binding agents, e.g., anti-IL-13 antibodies and fragments
thereof, e.g., that bind to IL-13 and interfere with the formation
of a functional IL-13 signaling complex, coformulated with, and/or
coadministered with, one or more additional therapeutic agents,
e.g., one or more cytokine and growth factor inhibitors,
immunosuppressants, anti-inflammatory agents, metabolic inhibitors,
enzyme inhibitors, and/or cytotoxic or cytostatic agents, as
described in more detail below. Furthermore, one or more an IL-13
binding agent, e.g., an anti-IL-13 antibody molecule, may be used
in combination with two or more of the therapeutic agents described
herein. Such combination therapies may advantageously utilize lower
dosages of the administered therapeutic agents, thus avoiding
possible toxicities or complications associated with the various
monotherapies. Moreover, the therapeutic agents disclosed herein
act on pathways that differ from the IL-13/IL-13-receptor pathway,
and thus are expected to enhance and/or synergize with the effects
of the IL-13 binding agents.
[0232] Therapeutic agents that interfere with different triggers of
asthma or airway inflammation, e.g., therapeutic agents used in the
treatment of allergy, upper respiratory infections, or ear
infections, may be used in combination with an IL-13 binding agent,
e.g., an anti-IL-13 antibody molecule. In one embodiment, one or
more IL-13 binding agents, e.g., anti-IL-13 antibodies and
fragments thereof, may be coformulated with, and/or coadministered
with, one or more additional agents, such as other cytokine or
growth factor antagonists (e.g., soluble receptors, peptide
inhibitors, small molecules, adhesins), antibody molecules that
bind to other targets (e.g., antibodies that bind to other
cytokines or growth factors, their receptors, or other cell surface
molecules), and anti-inflammatory cytokines or agonists thereof.
Nonlimiting examples of the agents that can be used in combination
with IL-13 binding agents, e.g., anti-IL-13 antibodies and
fragments thereof, include, but are not limited to, inhaled
steroids; beta-agonists, e.g., short-acting or long-acting
beta-agonists; antagonists of leukotrienes or leukotriene
receptors; combination drugs such as ADVAIR.RTM.; IgE inhibitors,
e.g., anti-IgE antibodies (e.g., XOLAIR.RTM.); phosphodiesterase
inhibitors (e.g., PDE4 inhibitors); xanthines; anticholinergic
drugs; mast cell-stabilizing agents such as cromolyn; IL-4
inhibitors; IL-5 inhibitors; eotaxin/CCR3 inhibitors; and
antihistamines.
[0233] In other embodiments, one or more IL-13 binding agents,
e.g., anti-IL-13 antibody molecules, can be coformulated with,
and/or coadministered with, one or more anti-inflammatory drugs,
immunosuppressants, or metabolic or enzymatic inhibitors. Examples
of the drugs or inhibitors that can be used in combination with the
IL-13 binding agents, e.g., anti-IL-13 antibodies and fragments
thereof, include, but are not limited to, one or more of:
Additional examples of therapeutic agents that can be
coadministered and/or coformulated with one or more anti-IL-13
antibodies or fragments thereof include one or more of: TNF
antagonists (e.g., a soluble fragment of a TNF receptor, e.g., p55
or p75 human TNF receptor or derivatives thereof, e.g., 75 kd
TNFR-IgG (75 kD TNF receptor-IgG fusion protein, ENBREL.TM.)); TNF
enzyme antagonists, e.g., TNF.alpha. converting enzyme (TACE)
inhibitors; muscarinic receptor antagonists; TGF-.upsilon.
antagonists; interferon gamma; perfenidone; chemotherapeutic
agents, e.g., methotrexate, leflunomide, or a sirolimus (rapamycin)
or an analog thereof, e.g., CCI-779; COX2 and cPLA2 inhibitors;
NSAIDs; immunomodulators; p38 inhibitors, TPL-2, Mk-2 and NFPB
inhibitors, among others.
[0234] Vaccine Formulations
[0235] In another aspect, the invention features a method of
modifying an immune response associated with immunization. An IL-13
binding agent (e.g., an anti-IL-13 antibody molecule), can be used
to increase the efficacy of immunization by inhibiting IL-13
activity. IL-13 binding agents can be administered before, during,
or after delivery of an immunogen, e.g., administration of a
vaccine. In one embodiment, the immunity raised by the vaccination
is a cellular immunity, e.g., an immunity against cancer cells or
virus infected, e.g., retrovirus infected, e.g., HIV infected,
cells. In one embodiment, the vaccine formulation contains one or
more IL-13 binding agents and an antigen, e.g., an immunogen. In
another embodiment, the IL-13 binding agent and the immunogen are
administered separately, e.g., within one hour, three hours, one
day, or two days of each other. The IL-13 binding agent can be one
that neutralizes or inhibits one or more IL-13 activities.
[0236] Inhibition of IL-13 can improve the efficacy of, e.g.,
cellular vaccines, e.g., vaccines against diseases such as cancer
and viral infection, e.g., retroviral infection, e.g., HIV
infection. Induction of CD8.sup.+ cytotoxic T lymphocytes (CTL) by
vaccines is down modulated by CD4.sup.+ T cells, likely through the
cytokine IL-13. Inhibition of IL-13 has been shown to enhance
vaccine induction of CTL response (Ahlers et al. (2002) Proc. Natl.
Acad. Sci. USA 99:13020-10325). An IL-13 binding agent, e.g., an
anti-IL-13 antibody molecule, an antibody described herein, can be
used in conjunction with a vaccine to increase vaccine efficacy.
Cancer and viral infection (such as retroviral (e.g., HIV)
infection) are exemplary disorders against which a cellular vaccine
response can be effective. Vaccine efficacy is enhanced by blocking
IL-13 signaling at the time of vaccination (Ahlers et al. (2002)
Proc. Nat. Acad. Sci. USA 99:13020-25). A vaccine formulation may
be administered to a subject in the form of a pharmaceutical or
therapeutic composition.
[0237] Methods for Diagnosing, Prognosing, and Monitoring
Disorders
[0238] IL-13 binding agents can be used in vitro and in vivo as
diagnostic agents. One exemplary method includes: (i) administering
the IL-13 binding agent (e.g., an IL-13 antibody molecule) to a
subject; and (ii) detecting the IL-13 binding agent in the subject.
The detecting can include determining location of the IL-13 binding
agent in the subject. Another exemplary method includes contacting
an IL-13 binding agent to a sample, e.g., a sample from a subject.
The presence or absence of IL-13 or the level of IL-13 (either
qualitative or quantitative) in the sample can be determined.
[0239] In another aspect, the present invention provides a
diagnostic method for detecting the presence of a IL-13, in vitro
(e.g., a biological sample, such as tissue, biopsy) or in vivo
(e.g., in vivo imaging in a subject).
[0240] The method includes: (i) contacting a sample with IL-13
binding agent; and (ii) detecting formation of a complex between
the IL-13 binding agent and the sample. The method can also include
contacting a reference sample (e.g., a control sample) with the
binding agent, and determining the extent of formation of the
complex between the binding agent an the sample relative to the
same for the reference sample. A change, e.g., a statistically
significant change, in the formation of the complex in the sample
or subject relative to the control sample or subject can be
indicative of the presence of IL-13 in the sample.
[0241] Another method includes: (i) administering the IL-13 binding
agent to a subject; and (ii) detecting formation of a complex
between the IL-13 binding agent and the subject. The detecting can
include determining location or time of formation of the
complex.
[0242] The IL-13 binding agent can be directly or indirectly
labeled with a detectable substance to facilitate detection of the
bound or unbound protein. Suitable detectable substances include
various enzymes, prosthetic groups, fluorescent materials,
luminescent materials and radioactive materials.
[0243] Complex formation between the IL-13 binding agent and IL-13
can be detected by measuring or visualizing either the binding
agent bound to the IL-13 or unbound binding agent. Conventional
detection assays can be used, e.g., an enzyme-linked immunosorbent
assays (ELISA), a radioimmunoassay (RIA) or tissue
immunohistochemistry. Further to labeling the IL-13 binding agent,
the presence of IL-13 can be assayed in a sample by a competition
immunoassay utilizing standards labeled with a detectable substance
and an unlabeled IL-13 binding agent. In one example of this assay,
the biological sample, the labeled standards and the IL-13 binding
agent are combined and the amount of labeled standard bound to the
unlabeled binding agent is determined. The amount of IL-13 in the
sample is inversely proportional to the amount of labeled standard
bound to the IL-13 binding agent.
[0244] Methods for Diagnosing, Prognosing, and/or Monitoring
Asthma
[0245] The binding agents described herein can be used, e.g., in
methods for diagnosing, prognosing, and monitoring the progress of
asthma by measuring the level of IL-13 in a biological sample. In
addition, this discovery enables the identification of new
inhibitors of IL-13 signaling, which will also be useful in the
treatment of asthma.
[0246] Such methods for diagnosing allergic and nonallergic asthma
can include detecting an alteration (e.g., a decrease or increase)
of IL-13 in a biological sample, e.g., serum, plasma,
bronchoalveolar lavage fluid, sputum, etc. "Diagnostic" or
"diagnosing" means identifying the presence or absence of a
pathologic condition. Diagnostic methods involve detecting the
presence of IL-13 by determining a test amount of IL-13 polypeptide
in a biological sample, e.g., in bronchoalveolar lavage fluid, from
a subject (human or nonhuman mammal), and comparing the test amount
with a normal amount or range (i.e., an amount or range from an
individual(s) known not to suffer from asthma) for the IL-13
polypeptide. While a particular diagnostic method may not provide a
definitive diagnosis of asthma, it suffices if the method provides
a positive indication that aids in diagnosis.
[0247] Methods for prognosing asthma and/or atopic disorders can
include detecting upregulation of IL-13, at the mRNA or protein
level. "Prognostic" or "prognosing" means predicting the probable
development and/or severity of a pathologic condition. Prognostic
methods involve determining the test amount of IL-13 in a
biological sample from a subject, and comparing the test amount to
a prognostic amount or range (i.e., an amount or range from
individuals with varying severities of asthma) for IL-13. Various
amounts of the IL-13 in a test sample are consistent with certain
prognoses for asthma. The detection of an amount of IL-13 at a
particular prognostic level provides a prognosis for the
subject.
[0248] The present application also provides methods for monitoring
the course of asthma by detecting the upregulation of IL-13.
Monitoring methods involve determining the test amounts of IL-13 in
biological samples taken from a subject at a first and second time,
and comparing the amounts. A change in amount of IL-13 between the
first and second time can indicate a change in the course of asthma
and/or atopic disorder, with a decrease in amount indicating
remission of asthma, and an increase in amount indicating
progression of asthma and/or atopic disorder. Such monitoring
assays are also useful for evaluating the efficacy of a particular
therapeutic intervention (e.g., disease attenuation and/or
reversal) in patients being treated for an IL-13 associated
disorder.
[0249] Fluorophore- and chromophore-labeled binding agents can be
prepared. The fluorescent moieties can be selected to have
substantial absorption at wavelengths above 310 nm, and preferably
above 400 nm. A variety of suitable fluorescers and chromophores
are described by Stryer (1968) Science, 162:526 and Brand, L. et
al. (1972) Annual Review of Biochemistry, 41:843-868. The binding
agents can be labeled with fluorescent chromophore groups by
conventional procedures such as those disclosed in U.S. Pat. Nos.
3,940,475, 4,289,747, and 4,376,110. One group of fluorescers
having a number of the desirable properties described above is the
xanthene dyes, which include the fluoresceins and rhodamines.
Another group of fluorescent compounds are the naphthylamines. Once
labeled with a fluorophore or chromophore, the binding agent can be
used to detect the presence or localization of the IL-13 in a
sample, e.g., using fluorescent microscopy (such as confocal or
deconvolution microscopy).
[0250] Histological Analysis. Immunohistochemistry can be performed
using the binding agents described herein. For example, in the case
of an antibody, the antibody can synthesized with a label (such as
a purification or epitope tag), or can be detectably labeled, e.g.,
by conjugating a label or label-binding group. For example, a
chelator can be attached to the antibody. The antibody is then
contacted to a histological preparation, e.g., a fixed section of
tissue that is on a microscope slide. After an incubation for
binding, the preparation is washed to remove unbound antibody. The
preparation is then analyzed, e.g., using microscopy, to identify
if the antibody bound to the preparation. The antibody (or other
polypeptide or peptide) can be unlabeled at the time of binding.
After binding and washing, the antibody is labeled in order to
render it detectable.
[0251] Protein Arrays. An IL-13 binding agent (e.g., a protein that
is an IL-13 binding agent) can also be immobilized on a protein
array. The protein array can be used as a diagnostic tool, e.g., to
screen medical samples (such as isolated cells, blood, sera,
biopsies, and the like). The protein array can also include other
binding agents, e.g., ones that bind to IL-13 or to other target
molecules.
[0252] Methods of producing protein arrays are described, e.g., in
De Wildt et al. (2000) Nat. Biotechnol. 18:989-994; Lueking et al.
(1999) Anal. Biochem. 270:103-111; Ge (2000) Nucleic Acids Res. 28,
e3, I-VII; MacBeath and Schreiber (2000) Science 289:1760-1763; WO
01/40803 and WO 99/51773A1. Polypeptides for the array can be
spotted at high speed, e.g., using commercially available robotic
apparati, e.g., from Genetic MicroSystems or BioRobotics. The array
substrate can be, for example, nitrocellulose, plastic, glass,
e.g., surface-modified glass. The array can also include a porous
matrix, e.g., acrylamide, agarose, or another polymer. For example,
the array can be an array of antibodies, e.g., as described in De
Wildt, supra. Cells that produce the protein can be grown on a
filter in an arrayed format. proteins production is induced, and
the expressed protein are immobilized to the filter at the location
of the cell.
[0253] A protein array can be contacted with a sample to determine
the extent of IL-13 in the sample. If the sample is unlabeled, a
sandwich method can be used, e.g., using a labeled probe, to detect
binding of the IL-13. Information about the extent of binding at
each address of the array can be stored as a profile, e.g., in a
computer database. The protein array can be produced in replicates
and used to compare binding profiles, e.g., of different
samples.
[0254] Flow Cytometry. The IL-13 binding agent can be used to label
cells, e.g., cells in a sample (e.g., a patient sample). The
binding agent can be attached (or attachable) to a fluorescent
compound. The cells can then be analyzed by flow cytometry and/or
sorted using fluorescent activated cell sorted (e.g., using a
sorter available from Becton Dickinson Immunocytometry Systems, San
Jose Calif.; see also U.S. Pat. Nos. 5,627,037; 5,030,002; and
5,137,809). As cells pass through the sorter, a laser beam excites
the fluorescent compound while a detector counts cells that pass
through and determines whether a fluorescent compound is attached
to the cell by detecting fluorescence. The amount of label bound to
each cell can be quantified and analyzed to characterize the
sample. The sorter can also deflect the cell and separate cells
bound by the binding agent from those cells not bound by the
binding agent. The separated cells can be cultured and/or
characterized.
[0255] In vivo Imaging. In still another embodiment, the invention
provides a method for detecting the presence of a IL-13 within a
subject in vivo. The method includes (i) administering to a subject
(e.g., a patient having an IL-13 associated disorder) an anti-IL-13
antibody, conjugated to a detectable marker; (ii) exposing the
subject to a means for detecting the detectable marker. For
example, the subject is imaged, e.g., by
[0256] NMR or other tomographic means.
[0257] Examples of labels useful for diagnostic imaging include
radiolabels such as .sup.131I, .sup.111In, .sup.123I, .sup.99mTc,
.sup.32P, .sup.33P, .sup.125I, .sup.3H, .sup.14C, and .sup.188Rh,
fluorescent labels such as fluorescein and rhodamine, nuclear
magnetic resonance active labels, positron emitting isotopes
detectable by a positron emission tomography ("PET") scanner,
chemiluminescers such as luciferin, and enzymatic markers such as
peroxidase or phosphatase. Short-range radiation emitters, such as
isotopes detectable by short-range detector probes can also be
employed. The binding agent can be labeled with such reagents using
known techniques. For example, see Wensel and Meares (1983)
Radioimmunoimaging and Radioimmunotherapy, Elsevier, N.Y. for
techniques relating to the radiolabeling of antibodies and Colcher
et al. (1986) Meth. Enzymol. 121: 802-816. A radiolabeled binding
agent can also be used for in vitro diagnostic tests. The specific
activity of a isotopically-labeled binding agent depends upon the
half-life, the isotopic purity of the radioactive label, and how
the label is incorporated into the antibody. Procedures for
labeling polypeptides with the radioactive isotopes (such as
.sup.14C, .sup.3H, .sup.35S, .sup.125I, .sup.99mTc, .sup.32P,
.sup.33P, and .sup.131I) are generally known. See, e.g., U.S. Pat.
No. 4,302,438; Goding, J. W. (Monoclonal antibodies: principles and
practice: production and application of monoclonal antibodies in
cell biology, biochemistry, and immunology 2nd ed. London; Orlando:
Academic Press, 1986. pp 124-126) and the references cited therein;
and A. R. Bradwell et al., "Developments in Antibody Imaging",
Monoclonal Antibodies for Cancer Detection and Therapy, R. W.
Baldwin et al., (eds.), pp 65-85 (Academic Press 1985).
[0258] IL-13 binding agents described herein can be conjugated to
Magnetic Resonance Imaging (MRI) contrast agents. Some MRI
techniques are summarized in EP-A-0 502 814. Generally, the
differences in relaxation time constants T1 and T2 of water protons
in different environments is used to generate an image. However,
these differences can be insufficient to provide sharp high
resolution images. The differences in these relaxation time
constants can be enhanced by contrast agents. Examples of such
contrast agents include a number of magnetic agents paramagnetic
agents (which primarily alter T1) and ferromagnetic or
superparamagnetic (which primarily alter T2 response). Chelates
(e.g., EDTA, DTPA and NTA chelates) can be used to attach (and
reduce toxicity) of some paramagnetic substances (e.g., Fe.sup.3+,
Mn.sup.2+, Gd.sup.3+). Other agents can be in the form of
particles, e.g., less than 10 .mu.m to about 10 nm in diameter) and
having ferromagnetic, antiferromagnetic, or superparamagnetic
properties. The IL-13 binding agents can also be labeled with an
indicating group containing the NMR active .sup.19F atom, as
described by Pykett (1982) Scientific American, 246:78-88 to locate
and image IL-13 distribution.
[0259] Also within the scope described herein are kits comprising
an IL-13 binding agent and instructions for diagnostic use, e.g.,
the use of the IL-13 binding agent (e.g., an antibody molecule or
other polypeptide or peptide) to detect IL-13, in vitro, e.g., in a
sample, e.g., a biopsy or cells from a patient having an IL-13
associated disorder, or in vivo, e.g., by imaging a subject. The
kit can further contain a least one additional reagent, such as a
label or additional diagnostic agent. For in vivo use the binding
agent can be formulated as a pharmaceutical composition.
[0260] Kits
[0261] An IL-13 binding agent, e.g., an anti-IL-13 antibody
molecule, can be provided in a kit, e.g., as a component of a kit.
For example, the kit includes (a) an IL-13 binding agent, e.g., an
anti-IL-13 antibody molecule, and, optionally (b) informational
material. The informational material can be descriptive,
instructional, marketing or other material that relates to a
method, e.g., a method described herein. The informational material
of the kits is not limited in its form. In one embodiment, the
informational material can include information about production of
the compound, molecular weight of the compound, concentration, date
of expiration, batch or production site information, and so forth.
In one embodiment, the informational material relates to using the
IL-13 binding agent to treat, prevent, diagnose, prognose, or
monitor a disorder described herein.
[0262] In one embodiment, the informational material can include
instructions to administer an IL-13 binding agent, e.g., an
anti-IL-13 antibody molecule, in a suitable manner to perform the
methods described herein, e.g., in a suitable dose, dosage form, or
mode of administration (e.g., a dose, dosage form, or mode of
administration described herein). In another embodiment, the
informational material can include instructions to administer an
IL-13 binding agent, e.g., an anti-IL-13 antibody molecule, to a
suitable subject, e.g., a human, e.g., a human having, or at risk
for, allergic asthma, non-allergic asthma, or an IL-13 mediated
disorder, e.g., an allergic and/or inflammatory disorder, or HTLV-1
infection. IL-13 production has been correlated with HTLV-1
infection (Chung et al., (2003) Blood 102: 4130-36).
[0263] For example, the material can include instructions to
administer an IL-13 binding agent, e.g., an anti-IL-13 antibody
molecule, to a patient, a patient with or at risk for allergic
asthma, non-allergic asthma, or an IL-13 mediated disorder, e.g.,
an allergic and/or inflammatory disorder, or HTLV-1 infection.
[0264] The kit can include one or more containers for the
composition containing an IL-13 binding agent, e.g., an anti-IL-13
antibody molecule. In some embodiments, the kit contains separate
containers, dividers or compartments for the composition and
informational material. For example, the composition can be
contained in a bottle, vial, or syringe, and the informational
material can be contained in a plastic sleeve or packet. In other
embodiments, the separate elements of the kit are contained within
a single, undivided container. For example, the composition is
contained in a bottle, vial or syringe that has attached thereto
the informational material in the form of a label. In some
embodiments, the kit includes a plurality (e.g., a pack) of
individual containers, each containing one or more unit dosage
forms (e.g., a dosage form described herein) of an IL-13 binding
agent, e.g., anti-IL-13 antibody molecule. For example, the kit
includes a plurality of syringes, ampules, foil packets, atomizers
or inhalation devices, each containing a single unit dose of an
IL-13 binding agent, e.g., an anti-IL-13 antibody molecule, or
multiple unit doses.
[0265] The kit optionally includes a device suitable for
administration of the composition, e.g., a syringe, inhalant,
pipette, forceps, measured spoon, dropper (e.g., eye dropper), swab
(e.g., a cotton swab or wooden swab), or any such delivery device.
In a preferred embodiment, the device is an implantable device that
dispenses metered doses of the binding agent.
[0266] The Examples that follow are set forth to aid in the
understanding of the inventions but are not intended to, and should
not be construed to, limit its scope in any way.
EXAMPLES
Example 1
(a) Cloning of NHP-IL-13 and Homology to Human IL-13
[0267] The cynomolgus monkey IL-13 (NHP IL-13) was cloned using
hybridization probes. A comparison of the cynomolgus monkey IL-13
amino acid sequence to that of human IL-13 is shown in FIG. 1A.
There is 94% amino acid identity between the two sequences, due to
8 amino acid differences. One of these differences, R130Q,
represents a common human polymorphism preferentially expressed in
asthmatic subjects (Heinzmann et al. (2000) Hum. Mol. Genet.
9:549-559).
(b) Binding of NHP-IL-13 to Human IL13R.alpha.2
[0268] Human IL-13 binds with high affinity to the alpha2 form of
IL-13 receptor (IL13R.alpha.2). A soluble form of this receptor was
expressed with a human IgG1 Fc tail (sIL13R.alpha.2-Fc). By binding
to IL-13 and sequestering the cytokine from the cell surface
IL13R.alpha.1-IL4R signaling complex, sIL13R.alpha.2-Fc can act as
a potent inhibitor of human IL-13 bioactivity. sIL13R.alpha.2-Fc
was shown to bind to NHP-IL-13 produced by CHO cells or E.
coli.
(c) Bioactivity of NHP-IL-13 on Human Monocytes
[0269] (i) CD23 expression on human monocytes. cDNA encoding
cynomolgus monkey IL-13 was expressed in E. coli and refolded to
maintain bioactivity. Reactivity of human cells to cynomolgus IL-13
was demonstrated using a bioassay in which normal peripheral blood
mononuclear cells from healthy donors were treated with IL-13
overnight at 37.degree. C. This induced up-regulation of CD23
expression on the surface of monocytes. Results showed that
cynomolgus IL-13 had bioactivity on primary human monocytes.
[0270] (ii) STAT6 phosphorylation on HT-29 cells. The human HT-29
epithelial cell line responds to IL-13 by undergoing STAT6
phosphorylation, a consequence of signal transduction through the
IL-13 receptor. To assay the ability of recombinant NHP-IL-13 to
induce STAT6 phosphorylation, HT-29 cells were challenged with the
NHP-IL-13 for 30 minutes at 37.degree. C., then fixed,
permeabilized, and stained with fluorescent antibody to
phospho-STAT6. Results showed that cynomolgus IL-13 efficiently
induced STAT6 phosphorylation in this human cell line.
(d) Generation of Antibodies that Bind to NHP-IL-13
[0271] Mice or other appropriate animals may be immunized and
boosted with cynomolgus IL-13, e.g., using one or more of the
following methods. One method for immunization may be combined with
either the same or different method for boosting:
[0272] (i) Immunization with cynomolgus IL-13 protein expressed in
E. coli, purified from inclusion bodies, and refolded to preserve
biological activity. For immunization, the protein is emulsified
with complete Freund's adjuvant (CFA), and mice are immunized
according to standard protocols. For boosting, the same protein is
emulsified with incomplete Freund's adjuvant (IFA).
[0273] (ii) Immunization with peptides spanning the entire sequence
of mature cynomolgus IL-13. Each peptide contains at least one
amino acid that is unique to cynomolgus IL-13 and not present in
the human protein. See FIG. 1B. Where the peptide has a C-terminal
residue other than cysteine, a cysteine is added for conjugation to
a carrier protein. The peptides are conjugated to an immunogenic
carrier protein such as KLH, and used to immunize mice according to
standard protocols. For immunization, the protein is emulsified
with complete Freund's adjuvant (CFA), and mice are immunized
according to standard protocols. For boosting, the same protein is
emulsified with incomplete Freund's adjuvant (IFA).
[0274] (iii) Immunization with NHP-IL-13-encoding cDNA expressed.
The cDNA encoding NHP-IL-13, including leader sequence, is cloned
into an appropriate vector. This DNA is coated onto gold beads
which are injected intradermally by gene gun.
[0275] (iv) The protein or peptides can be used as a target for
screening a protein library, e.g., a phage or ribosome display
library. For example, the library can display varied immunoglobulin
molecules, e.g., Fab's, scFv's, or Fd's.
(e) Selection of Antibody Clones Cross-Reactive with NHP and
Optionally a Human IL-13, e.g., a Native Human IL-13
[0276] Primary Screen
[0277] The primary screen for antibodies was selection for binding
to recombinant NHP-IL-13 by ELISA. In this ELISA, wells are coated
with recombinant NHP IL-13. The immune serum was added in serial
dilutions and incubated for one hour at room temperature. Wells
were washed with PBS containing 0.05% TWEEN.RTM.-20 (PBS-Tween).
Bound antibody was detected using horseradish peroxidase
(HRP)-labeled anti-mouse IgG and tetramethylbenzidene (TMB)
substrate. Absorbance was read at 450 nm. Typically, all immunized
mice generated high titers of antibody to NHP-IL-13.
[0278] Secondary Screen
[0279] The secondary screen was selection for inhibition of binding
of recombinant NHP-IL-13 to sIL-13R.alpha.1-Fc by ELISA. Wells were
coated with soluble IL-13R.alpha.1-Fc, to which FLAG-tagged
NHP-IL-13 could bind. This binding was detected with anti-FLAG
antibody conjugated to HRP. Hydrolysis of TMB substrate was read as
absorbance at 450 nm. In the assay, the FLAG-tagged NHP-IL-13 was
added together with increasing concentrations of immune serum. If
the immune serum contained antibody that bound to NHP-IL-13 and
prevented its binding to the sIL13R.alpha.1-Fc coating the wells,
the ELISA signal was decreased. All immunized mice produced
antibody that competed with sIL13R.alpha.1-Fc binding to NHP-IL-13,
but the titers varied from mouse to mouse. Spleens were selected
for fusion from animals whose serum showed inhibited
sIL13R.alpha.1-Fc binding to NHP-IL-13 at the highest dilution.
[0280] Tertiary Screen
[0281] The tertiary screen tested for inhibition of NHP-IL-13
bioactivity. Several bioassays were available to be used, including
the TF-1 proliferation assay, the monocyte CD23 expression assay,
and the HT-29 cell STAT6 phosphorylation assay. Immune sera were
tested for inhibition of NHP-IL-13-mediated STAT6 phosphorylation.
The HT-29 human epithelial cell line was challenged for 30 minutes
at 37.degree. C. with recombinant NHP-IL-13 in the presence or
absence of the indicated concentration of mouse immune serum. Cells
were then fixed, permeabilized, and stained with ALEXA3 Fluor
488-conjugated mAb to phospho-STAT6 (Pharmingen). The percentage of
cells responding to IL-13 by undergoing STAT6 phosphorylation was
determined by flow cytometry. Spleens of mice with the most potent
neutralization activity, determined as the strongest inhibition of
NHP-IL-13 bioactivity at a high serum dilution, were selected for
generation of hybridomas.
[0282] Quaternary Screen
[0283] A crude preparation containing human IL-13 was generated
from human umbilical cord blood mononuclear cells
(BioWhittaker/Cambrex). The cells were cultured in a 37.degree. C.
incubator at 5% CO.sub.2, in RPMI media containing 10%
heat-inactivated FCS, 50 U/ml penicillin, 50 mg/ml streptomycin,
and 2 mM L-glutamine. Cells were stimulated for 3 days with the
mitogen PHA-P (Sigma), and skewed toward Th2 with recombinant human
IL-4 (R&D Systems) and anti-human IL-12. The Th2 cells were
expanded for one week with IL-2, then activated to produce cytokine
by treatment with phorbol 12-myristate 13-acetate (PMA) and
ionomycin for three days. The supernatant was collected and
dialyzed to remove PMA and ionomycin. To deplete GM-CSF and IL-4,
which could interfere with bioassays for IL-13, the supernatant was
treated with biotinylated antibodies to GM-CSF and IL-4 (R&D
Systems, Inc), then incubated with streptavidin-coated magnetic
beads (Dynal). The final concentration of IL-13 was determined by
ELISA (Biosource), and for total protein by Bradford assay
(Bio-Rad). The typical preparation contains <0.0005% IL-13 by
weight.
[0284] Selection of Hybridoma Clones
[0285] Using established methods, hybridomas were generated from
spleens of mice selected as above, fused to the P3X63_AG8.653
myeloma cell line (ATCC). Cells were plated at limiting dilution
and clones were selected according to the screening criteria
described above. Data was collected for the selection of clones
based on ability to compete for NHP-IL-13 binding to
sIL13R.alpha.1-Fc by ELISA. Clones were further tested for ability
to neutralize the bioactivity of NHP-IL-13. Supernatants of the
hybridomas were tested for competition of STAT-6 phosphorylation
induced by NHP-IL-13 in the HT-29 human epithelial cell line.
Example 2
MJ 2-7 Antibody
[0286] Total RNA was prepared from MJ 2-7 hybridoma cells using the
QIAGEN RNEASY3 Mini Kit (Qiagen). RNA was reverse transcribed to
cDNA using the SMART3 PCR Synthesis Kit (BD Biosciences Clontech).
The variable region of MJ 2-7 heavy chain was extrapolated by PCR
using SMART3 oligonucleotide as a forward primer and mIgG1 primer
annealing to DNA encoding the N-terminal part of CH1 domain of
mouse IgG1 constant region as a reverse primer. The DNA fragment
encoding MJ 2-7 light chain variable region was generated using
SMART3 and mouse kappa specific primers. The PCR reaction was
performed using DEEP VENT3 DNA polymerase (New England Biolabs) and
25 nM of dNTPs for 24 cycles (94.degree. C. for 1 minute,
60.degree. C. for 1 minute, 72.degree. C. for 1 minute). The PCR
products were subcloned into the pED6 vector, and the sequence of
the inserts was identified by DNA sequencing. N-terminal protein
sequencing of the purified mouse MJ 2-7 antibody was used to
confirm that the translated sequences corresponded to the observed
protein sequence.
[0287] Exemplary nucleotide and amino acid sequences of mouse
monoclonal antibody MJ 2-7 which interacts with NHP IL-13 and which
has characteristics which suggest that it may interact with human
IL-13 are as follows:
[0288] An exemplary nucleotide sequence encoding the heavy chain
variable domain includes:
TABLE-US-00010 (SEQ ID NO: 129) GAG GTTCAGCTGC AGCAGTCTGG
GGCAGAGCTT GTGAAGCCAG GGGCCTCAGT CAAGTTGTCC TGCACAGGTT CTGGCTTCAA
CATTAAAGAC ACCTATATAC ACTGGGTGAA GCAGAGGCCT GAACAGGGCC TGGAGTGGAT
TGGAAGGATT GATCCTGCGA ATGATAATAT TAAATATGAC CCGAAGTTCC AGGGCAAGGC
CACTATAACA GCAGACACAT CCTCCAACAC AGCCTACCTA CAGCTCAACA GCCTGACATC
TGAGGACACT GCCGTCTATT ACTGTGCTAG ATCTGAGGAA AATTGGTACG ACTTTTTTGA
CTACTGGGGC CAAGGCACCA CTCTCACAGT CTCCTCA
[0289] An exemplary amino acid sequence for the heavy chain
variable domain includes:
TABLE-US-00011 (SEQ ID NO: 130)
EVQLQQSGAELVKPGASVKLSCTGSGFNIKDTYIHWVKQRPEQGLEWI
GRIDPANDNIKYDPKFQGKATITADTSSNTAYLQLNSLTSEDTAVYYC
ARSEENWYDFFDYWGQGTTLTVSS
[0290] CDRs are underlined. The variable domain optionally is
preceded by a leader sequence. e.g., MKCSWVIFFLMAVVTGVNS (SEQ ID
NO:131). An exemplary nucleotide sequence encoding the light chain
variable domain includes:
TABLE-US-00012 (SEQ ID NO: 132) GAT GTTTTGATGA CCCAAACTCC
ACTCTCCCTG CCTGTCAGTC TTGGAGATCA AGCCTCCATC TCTTGCAGGT CTAGTCAGAG
CATTGTACAT AGTAATGGAA ACACCTATTT AGAATGGTAC CTGCAGAAAC CAGGCCAGTC
TCCAAAGCTC CTGATCTACA AAGTTTCCAA CCGATTTTCT GGGGTCCCAG ACAGGTTCAG
TGGCAGTGGA TCAGGGACAG ATTTCACACT CAAGATTAGC AGAGTGGAGG CTGAGGATCT
GGGAGTTTAT TACTGCTTTC AAGGTTCACA TATTCCGTAC ACGTTCGGAG GGGGGACCAA
GCTGGAAATA AAA
[0291] An exemplary amino acid sequence for the light chain
variable domain includes:
TABLE-US-00013 (SEQ ID NO: 133)
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSP
KLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSH
IPYTFGGGTKLEIK
[0292] CDRs are underlined. The amino acid sequence optionally is
preceded by a leader sequence, e.g., MKLPVRLLVLMFWIPASSS (SEQ ID
NO:134). The term "MJ 2-7" is used interchangeably with the term
"mAb7.1.1," herein.
Example 3
C65 Antibody
[0293] Exemplary nucleotide and amino acid sequences of mouse
monoclonal antibody C65, which interacts with NHP IL-13 and which
has characteristics that suggest that it may interact with human
IL-13 are as follows:
[0294] An exemplary nucleic acid sequence for the heavy chain
variable domain includes:
TABLE-US-00014 (SEQ ID NO: 135) 1 ATGGCTGTCC TGGCATTACT CTTCTGCCTG
GTAACATTCC CAAGCTGTAT 51 CCTTTCCCAG GTGCAGCTGA AGGAGTCAGG
ACCTGGCCTG GTGGCGCCCT 101 CACAGAGCCT GTCCATCACA TGCACCGTCT
CAGGGTTCTC ATTAACCGGC 151 TATGGTGTAA ACTGGGTTCG CCAGCCTCCA
GGAAAGGGTC TGGAGTGGCT 201 GGGAATAATT TGGGGTGATG GAAGCACAGA
CTATAATTCA GCTCTCAAAT 251 CCAGACTGAT CATCAACAAG GACAACTCCA
AGAGCCAAGT TTTCTTAAAA 301 ATGAACAGTC TGCAAACTGA TGACACAGCC
AGGTACTTCT GTGCCAGAGA 351 TAAGACTTTT TACTACGATG GTTTCTACAG
GGGCAGGATG GACTACTGGG 401 GTCAAGGAAC CTCAGTCACC GTCTCCTCA
[0295] An exemplary amino acid sequence for the heavy chain
variable domain includes:
TABLE-US-00015 (SEQ ID NO: 136) QVQLKESGPGL VAPSQSLSIT CTVSGFSLTG
YGVNWVRQPP GKGLEWLGII WGDGSTDYNS ALKSRLIINK DNSKSQVFLK MNSLQTDDTA
RYFCARDKTF YYDGFYRGRM DYWGQGTSVT VSS
CDRs are underlined. The amino acid sequence optionally is preceded
by a leader sequence, e.g., MAVLALLFCL VTFPSCILS (SEQ ID
NO:137).
[0296] An exemplary nucleotide sequence encoding the light chain
variable domain includes:
TABLE-US-00016 (SEQ ID NO: 138) 1 ATGAACACGA GGGCCCCTGC TGAGTTCCTT
GGGTTCCTGT TGCTCTGGTT 51 TTTAGGTGCC AGATGTGATG TCCAGATGAT
TCAGTCTCCA TCCTCCCTGT 101 CTGCATCTTT GGGAGACATT GTCACCATGA
CTTGCCAGGC AAGTCAGGGC 151 ACTAGCATTA ATTTAAACTG GTTTCAGCAA
AAACCAGGGA AAGCTCCTAA 201 GCTCCTGATC TTTGGTGCAA GCAACTTGGA
AGATGGGGTC CCATCAAGGT 251 TCAGTGGCAG TAGATATGGG ACAAATTTCA
CTCTCACCAT CAGCAGCCTG 301 GAGGATGAAG ATATGGCAAC TTATTTCTGT
CTACAGCATA GTTATCTCCC 351 GTGGACGTTC GGTGGCGGCA CCAAACTGGA
AATCAAA
[0297] An exemplary amino acid sequence for the light chain
variable domain includes:
TABLE-US-00017 (SEQ ID NO: 139) DVQMIQSP SSLSASLGDI VTMTCQASCQG
TSINLNWFQQ KPGKAPKLLI FGASNLEDGV PSRFSGSRYG TNFTLTISSL EDEDMATYFC
LQHSYLPWTF GGGTKLEIK
CDRs are underlined. The amino acid sequence optionally is preceded
by a leader sequence, e.g., MNTRAPAEFLGFLLLWFLGARC (SEQ ID
NO:140).
Example 4
Cynomolgus Monkey Model
[0298] The efficacy of an antibody to neutralize one or more
IL-13-associated activities in vivo can be tested using a model of
antigen-induced airway inflammation in cynomolgus monkeys naturally
allergic to Ascaris suum. In this model, challenge of an allergic
monkey with Ascaris suum antigen results in an influx of
inflammatory cells, especially eosinophils, into the airways. To
test the ability of an antibody to prevent this influx of cells,
the antibody can be administered 24 hours prior to challenge with
Ascaris suum antigen. On the day of challenge, a baseline
bronchoalveolar lavage (BAL) sample can be taken from the left
lung. The antigen can then be instilled intratracheally into the
right lung. Twenty-four hours later, the right lung is lavaged, and
the BAL fluid from animals treated intravenously with 10 mg/kg
recombinant antibody expressed from CHO cells are compared to BAL
fluid from untreated animals. If the antibody reduces airway
inflammation, an increase in percent BAL eosinophils may be
observed among the untreated group, but not for the
antibody-treated group. These assays can be used to confirm that
the antibody effectively prevents airway eosinophilia in allergic
animals challenged with an allergen.
Example 5
Fc Sequences
[0299] The Ser at position #1 of SEQ ID NO:128 represents amino
acid residue #119 in a first exemplary full length antibody
numbering scheme in which the Ser is preceded by residue #118 of a
heavy chain variable domain. In the first exemplary full length
antibody numbering scheme, mutated amino acids are at numbered 234
and 237, and correspond to positions 116 and 119 of SEQ ID NO:128.
Thus, the following sequence represents an Fc domain with two
mutations: L234A and G237A, according to the first exemplary full
length antibody numbering scheme.
Mus musculus (SEQ ID NO:128)
[0300] The following is another exemplary human Fc domain
sequence:
TABLE-US-00018 (SEQ ID NO: 141)
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKK
VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV
VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH
QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEM
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[0301] Other exemplary alterations that can be used to decrease
effector function include L234A;L235A), (L235A;G237A), and
N297A.
Example 6
IL-13 and IgE in Mice
[0302] IL-13 is involved in the production of IgE, an important
mediator of atopic disease. Mice deficient in IL-13 had partial
reductions in serum IgE and mast cell IgE responses, whereas mice
lacking the natural IL-13 binding agent, IL-13R.alpha.2-/-, had
enhanced levels of IgE and IgE effector function.
[0303] BALB/c female mice were obtained from Jackson Laboratories
(Bar Harbor, Me.). IL-13RI2-/- mice are described, e.g., in Wood et
al. (2003) J. Exp. Med. 197:703-9. Mice deficient in IL-13 are
described, e.g., in McKenzie et al. (1998) Immunity 9:423-32. All
mutant strains were on the BALB/c background.
[0304] Serum IgE levels were measured by ELISA. ELISA plates
(MaxiSorp; Nunc, Rochester, N.Y.) were coated overnight at
4.degree. C. with rat anti-mouse IgE (BD Biosciences, San Diego,
Calif.). Plates were blocked for 1 hour at room temperature with
0.5% gelatin in PBS, washed in PBS containing 0.05% TWEEN.RTM.-20
(PBS-Tween), and incubated for six hours at room temperature with
purified mouse IgE (BD Biosciences) as standards or with serum
dilutions. Binding was detected with biotinylated anti-mouse IgE
(BD Biosciences) using mouse IgG (Sigma-Aldrich, St. Louis, Mo.) as
a blocker. Binding was detected with peroxidase-linked streptavidin
(Southern Biotechnology Associates, Inc., Birmingham, Ala.) and
SURE BLUE3 substrate (KPL Inc., Gaithersburg, Md.).
[0305] In order to investigate the requirement for IL-13 to support
resting IgE levels in naive mice, serum was examined in the absence
of specific immunization from wild-type mice and from mice
genetically deficient in IL-13 and IL-13R.alpha.2. Mice deficient
in IL-13 had virtually undetectable levels of serum IgE. In
contrast, mice lacking the inhibitory receptor IL-13R.alpha.2
displayed elevated levels of serum IgE. These results demonstrate
that blocking IL-13 can be useful for treating or preventing atopic
disorders.
Example 7
IL-13 and Atopic Disorders
[0306] The ability of MJ2-7 to inhibit the bioactivity of native
human IL-13 (at 1 ng/ml) was evaluated in an assay for STATE
phosphorylation. MJ2-7 inhibited the activity of native human IL-13
with an IC50 of about 0.293 nM in this assay. An antibody with the
murine heavy chain of MJ2-7 and a humanized light chain inhibited
the activity of native human IL-13 with an IC50 of about 0.554 nM
in this assay.
[0307] The ability of MJ2-7 to inhibit non-human primate IL-13 (at
1 ng/ml) was evaluated in an assay for CD23 expression. The MJ2-7
inhibited the activity of non-human primate IL-13 with an IC50 of
about 0.242 nM in this assay. An antibody with the murine heavy
chain of MJ2-7 and a humanized light chain inhibited the activity
of non-human primate IL-13 with an IC50 of about 0.308 nM in this
assay.
Example 8
Nucleotide and Amino Acid Sequences of Mouse MJ 2-7 Antibody
[0308] The nucleotide sequence encoding the heavy chain variable
region (with an optional leader) is as follows:
TABLE-US-00019 (SEQ ID NO: 142) 1 ATGAAATGCA GCTGGGTTAT CTTCTTCCTG
ATGGCAGTGG TTACAGGGGT 51 CAATTCAGAG GTTCAGCTGC AGCAGTCTGG
GGCAGAGCTT GTGAAGCCAG 101 GGGCCTCAGT CAAGTTGTCC TGCACAGGTT
CTGGCTTCAA CATTAAAGAC 151 ACCTATATAC ACTGGGTGAA GCAGAGGCCT
GAACAGGGCC TGGAGTGGAT 201 TGGAAGGATT GATCCTGCGA ATGATAATAT
TAAATATGAC CCGAAGTTCC 251 AGGGCAAGGC CACTATAACA GCAGACACAT
CCTCCAACAC AGCCTACCTA 301 CAGCTCAACA GCCTGACATC TGAGGACACT
GCCGTCTATT ACTGTGCTAG 351 ATCTGAGGAA AATTGGTACG ACTTTTTTGA
CTACTGGGGC CAAGGCACCA 401 CTCTCACAGT CTCCTCA
[0309] The amino acid sequence of the heavy chain variable region
with an optional leader (underscored) is as follows:
TABLE-US-00020 (SEQ ID NO: 143) 1 MKCSWVIFFL MAVVTGVNSE VQLQQSGAEL
VKPGASVKLS CTGSGFNIKD 51 TYIHWVKQRP EQGLEWIGRI DPANDNIKYD
PKFQGKATIT ADTSSNTAYL 101 QLNSLTSEDT AVYYCARSEE NWYDFFDYWG
QGTTLTVSS
[0310] The nucleotide sequence encoding the light chain variable
region is as follows:
TABLE-US-00021 (SEQ ID NO: 144) 1 ATGAAGTTGC CTGTTAGGCT GTTGGTGCTG
ATGTTCTGGA TTCCTGCTTC 51 CAGCAGTGAT GTTTTGATGA CCCAAACTCC
ACTCTCCCTG CCTGTCAGTC 101 TTGGAGATCA AGCCTCCATC TCTTGCAGGT
CTAGTCAGAG CATTGTACAT 151 AGTAATGGAA ACACCTATTT AGAATGGTAC
CTGCAGAAAC CAGGCCAGTC 201 TCCAAAGCTC CTGATCTACA AAGTTTCCAA
CCGATTTTCT GGGGTCCCAG 251 ACAGGTTCAG TGGCAGTGGA TCAGGGACAG
ATTTCACACT CAAGATTAGC 301 AGAGTGGAGG CTGAGGATCT GGGAGTTTAT
TACTGCTTTC AAGGTTCACA 351 TATTCCGTAC ACGTTCGGAG GGGGGACCAA
GCTGGAAATA AAA
[0311] The amino acid sequence of the light chain variable region
with an optional leader (underscored) is as follows:
TABLE-US-00022 (SEQ ID NO: 145) 1 MKLPVRLLVL MFWIPASSSD VLMTQTPLSL
PVSLGDQASI SCRSSQSIVH 51 SNGNTYLEWY LQKPGQSPKL LIYKVSNRFS
GVPDRFSGSG SGTDFTLKIS 101 RVEAEDLGVY YCFQGSHIPY TFGGGTKLEI K
Example 9
Nucleotide and Amino Acid Sequences of Exemplary First Humanized
Variants of the MJ 2-7 Antibody
[0312] Humanized antibody Version 1 (V1) is based on the closest
human germline clones. The nucleotide sequence of hMJ 2-7 V1 heavy
chain variable region (hMJ 2-7 VH V1) (with a sequence encoding an
optional leader sequence) is as follows:
TABLE-US-00023 (SEQ ID NO: 146) 1 ATGGATTGGA CCTGGCGCAT CCTGTTCCTG
GTGGCCGCTG CCACCGGCGC 51 TCACTCTCAG GTGCAGCTGG TGCAGTCTGG
CGCCGAGGTG AAGAAGCCTG 101 GCGCTTCCGT GAAGGTGTCC TGTAAGGCCT
CCGGCTTCAA CATCAAGGAC 151 ACCTACATCC ACTGGGTGCG GCAGGCTCCC
GGCCAGCGGC TGGAGTGGAT 201 GGGCCGGATC GATCCTGCCA ACGACAACAT
CAAGTACGAC CCCAAGTTTC 251 AGGGCCGCGT GACCATCACC CGCGATACCT
CCGCTTCTAC CGCCTACATG 301 GAGCTGTCTA GCCTGCGGAG CGAGGATACC
GCCGTGTACT ACTGCGCCCG 351 CTCCGAGGAG AACTGGTACG ACTTCTTCGA
CTACTGGGGC CAGGGCACCC 401 TGGTGACCGT GTCCTCT
[0313] The amino acid sequence of the heavy chain variable region
(hMJ 2-7 V1) is based on a CDR grafted to DP-25, VH-I, 1-03. The
amino acid sequence with an optional leader (first underscored
region; CDRs based on AbM definition shown in subsequent
underscored regions) is as follows:
TABLE-US-00024 (SEQ ID NO: 147) 1 MDWTWRILFL VAAATGAHS-Q VQLVQSGAEV
KKPGASVKVS CKASGFNIKD 51 TYIHWVRQAP GQRLEWMGRI DPANDNIKYD
PKFQGRVTIT RDTSASTAYM 101 ELSSLRSEDT AVYYCARSEE NWYDFFDYWG
QGTLVTVSSG ESCR
[0314] The nucleotide sequence of the hMJ 2-7 V1 light chain
variable region (hMJ 2-7 VL V1) (with a sequence encoding an
optional leader sequence) is as follows:
TABLE-US-00025 (SEQ ID NO: 148) 1 ATGCGGCTGC CCGCTCAGCT GCTGGGCCTG
CTGATGCTGT GGGTGCCCGG 51 CTCTTCCGGC GACGTGGTGA TGACCCAGTC
CCCTCTGTCT CTGCCCGTGA 101 CCCTGGGCCA GCCCGCTTCT ATCTCTTGCC
GGTCCTCCCA GTCCATCGTG 151 CACTCCAACG GCAACACCTA CCTGGAGTGG
TTTCAGCAGA GACCCGGCCA 201 GTCTCCTCGG CGGCTGATCT ACAAGGTGTC
CAACCGCTTT TCCGGCGTGC 251 CCGATCGGTT CTCCGGCAGC GGCTCCGGCA
CCGATTTCAC CCTGAAGATC 301 AGCCGCGTGG AGGCCGAGGA TGTGGGCGTG
TACTACTGCT TCCAGGGCTC 351 CCACATCCCT TACACCTTTG GCGGCGGAAC
CAAGGTGGAG ATCAAG
[0315] This version is based on a CDR graft to DPK18, V kappaII.
The amino acid sequence of hMJ 2-7 V1 light chain variable region
(hMJ 2-7 VL V1) (with optional leader as first underscored region;
CDRs based on AbM definition in subsequent underscored regions) is
as follows:
TABLE-US-00026 (SEQ ID NO: 149) 1 MRLPAQLLGL LMLWVPGSSG-DVVMTQSPLS
LPVTLGQPAS ISCRSSQSIV 51 HSNGNTYLEW FQQRPGQSPR RLIYKVSNRF
SGVPDRFSGS GSGTDFTLKI 101 SRVEAEDVGV YYCFQGSHIP YTFGGGTKVE IK
Example 10
Nucleotide and Amino Acid Sequences of Exemplary Second Humanized
Variants of the MJ 2-7 Antibody
[0316] The following heavy chain variable region is based on a CDR
graft to DP-54, VH-3, 3-07. The nucleotide sequence of hMJ 2-7
Version 2 (V2) heavy chain variable region (hMJ 2-7 VH V2) (with a
sequence encoding an optional leader sequence) is as follows:
TABLE-US-00027 (SEQ ID NO: 150) 1 ATGGAGCTGG GCCTGTCTTG GGTGTTCCTG
GTGGCTATCC TGGAGGGCGT 51 GCAGTGCGAG GTGCAGCTGG TGGAGTCTGG
CGGCGGACTG GTGCAGCCTG 101 GCGGCTCTCT GCGGCTGTCT TGCGCCGCTT
CCGGCTTCAA CATCAAGGAC 151 ACCTACATCC ACTGGGTGCG GCAGGCTCCC
GGCAAGGGCC TGGAGTGGGT 201 GGCCCGGATC GATCCTGCCA ACGACAACAT
CAAGTACGAC CCCAAGTTCC 251 AGGGCCGGTT CACCATCTCT CGCGACAACG
CCAAGAACTC CCTGTACCTC 301 CAGATGAACT CTCTGCGCGC CGAGGATACC
GCCGTGTACT ACTGCGCCCG 351 GAGCGAGGAG AACTGGTACG ACTTCTTCGA
CTACTGGGGC CAGGGCACCC 401 TGGTGACCGT GTCCTCT
[0317] The amino acid sequence of hMJ 2-7 V2 heavy chain variable
region (hMJ 2-7 VH V2) with an optional leader (first underscored
region; CDRs based on AbM definition shown in subsequent
underscored regions) is as follows:
TABLE-US-00028 (SEQ ID NO: 151) 1 MELGLSWVFL VAILEGVQC- E
VQLVESGGGL VQPGGSLRLS CAASGFNIKD 51 TYIHWVRQAP GKGLEWVARI
DPANDNIKYD PKFQGRFTIS RDNAKNSLYL 101 QMNSLRAEDT AVYYCARSEE
NWYDFFDYWG QGTLVTVSS
[0318] The hMJ 2-7 V2 light chain variable region was based on a
CDR graft to DPK9, V kappaI, 02. The nucleotide sequence of hMJ 2-7
V2 light chain variable region (hMJ 2-7 VL V2) (with a sequence
encoding an optional leader sequence) is as follows:
TABLE-US-00029 (SEQ ID NO: 152) 1 ATGGATATGC GCGTGCCCGC TCAGCTGCTG
GGCCTGCTGC TGCTGTGGCT 51 GCGCGGAGCC CGCTGCGATA TCCAGATGAC
CCAGTCCCCT TCTTCTCTGT 101 CCGCCTCTGT GGGCGATCGC GTGACCATCA
CCTGTCGGTC CTCCCAGTCC 151 ATCGTGCACT CCAACGGCAA CACCTACCTG
GAGTGGTATC AGCAGAAGCC 201 CGGCAAGGCC CCTAAGCTGC TGATCTACAA
GGTGTCCAAC CGCTTTTCCG 251 GCGTGCCTTC TCGGTTCTCC GGCTCCGGCT
CCGGCACCGA TTTCACCCTG 301 ACCATCTCCT CCCTCCAGCC CGAGGATTTC
GCCACCTACT ACTGCTTCCA 351 GGGCTCCCAC ATCCCTTACA CCTTTGGCGG
CGGAACCAAG GTGGAGATCA 401 AGCGT
[0319] The amino acid sequence of the light chain variable region
of hMJ 2-7 V2 light chain variable region (hMJ 2-7 VL V2) (with
optional leader peptide underscored and CDRs based on AbM
definition shown in subsequent underscored regions) is as
follows:
TABLE-US-00030 (SEQ ID NO: 153) 1 MDMRVPAQLL GLLLLWLRGA RC
-DIQMTQSP SSLSASVGDR VTITCRSSQS 51 IVHSNGNTYL EWYQQKPGKA PKLLIYKVSN
RFSGVPSRFS GSGSGTDFTL 101 TISSLQPEDF ATYYCFQGSH IPYTFGGGTK
VEIKR
[0320] Additional humanized versions of MJ 2-7 V2 heavy chain
variable region were made. These versions included backmutations
that have murine amino acids at selected framework positions.
[0321] The nucleotide sequence encoding the heavy chain variable
region "Version 2.1" or V2.1 with the back mutations V48I,A29G is
as follows:
TABLE-US-00031 (SEQ ID NO: 154) 1 GAGGTGCAGC TGGTGGAGTC TGGCGGCGGA
CTGGTGCAGC CTGGCGGCTC 51 TCTGCGGCTG TCTTGCGCCG CTTCCGGCTT
CAACATCAAG GACACCTACA 101 TCCACTGGGT GCGGCAGGCT CCCGGCAAGG
GCCTGGAGTG GATCGGCCGG 151 ATCGATCCTG CCAACGACAA CATCAAGTAC
GACCCCAAGT TCCAGGGCCG 201 GTTCACCATC TCTCGCGACA ACGCCAAGAA
CTCCCTGTAC CTCCAGATGA 251 ACTCTCTGCG CGCCGAGGAT ACCGCCGTGT
ACTACTGCGC CCGGAGCGAG 301 GAGAACTGGT ACGACTTCTT CGACTACTGG
GGCCAGGGCA CCCTGGTGAC 351 CGTGTCCTCT
[0322] The amino acid sequence of the heavy chain variable region
of V2.1 (CDRs based on AbM definition shown in subsequent
underscored regions) is as follows:
TABLE-US-00032 (SEQ ID NO: 155) 1 EVQLVESGGG LVQPGGSLRL SCAASGFNIK
DTYIHWVRQA PGKGLEWIGR 51 IDPANDNIKY DPKFQGRFTI SRDNAKNSLY
LQMNSLRAED TAVYYCARSE 101 ENWYDFFDYW GQGTLVTVSS
[0323] The nucleotide sequence encoding the heavy chain variable
region V2.2 with the back mutations (R67K;F68A) is as follows:
TABLE-US-00033 (SEQ ID NO: 156) 1 GAGGTGCAGC TGGTGGAGTC TGGCGGCGGA
CTGGTGCAGC CTGGCGGCTC 51 TCTGCGGCTG TCTTGCGCCG CTTCCGGCTT
CAACATCAAG GACACCTACA 101 TCCACTGGGT GCGGCAGGCT CCCGGCAAGG
GCCTGGAGTG GGTGGCCCGG 151 ATCGATCCTG CCAACGACAA CATCAAGTAC
GACCCCAAGT TCCAGGGCAA 201 GGCCACCATC TCTCGCGACA ACGCCAAGAA
CTCCCTGTAC CTCCAGATGA 251 ACTCTCTGCG CGCCGAGGAT ACCGCCGTGT
ACTACTGCGC CCGGAGCGAG 301 GAGAACTGGT ACGACTTCTT CGACTACTGG
GGCCAGGGCA CCCTGGTGAC 351 CGTGTCCTCT
[0324] The amino acid sequence of the heavy chain variable region
of V2.2 (CDRs based on AbM definition shown in subsequent
underscored regions) is as follows:
TABLE-US-00034 (SEQ ID NO: 157) 1 EVQLVESGGG LVQPGGSLRL SCAASGFNIK
DTYIHWVRQA PGKGLEWVAR 51 IDPANDNIKY DPKFQGKATI SRDNAKNSLY
LQMNSLRAED TAVYYCARSE 102 ENWYDFFDYW GQGTLVTVSS
[0325] The nucleotide sequence encoding the heavy chain variable
region V2.3 with the back mutations (R72A):
TABLE-US-00035 (SEQ ID NO: 158) 1 GAGGTGCAGC TGGTGGAGTC TGGCGGCGGA
CTGGTGCAGC CTGGCGGCTC 51 TCTGCGGCTG TCTTGCGCCG CTTCCGGCTT
CAACATCAAG GACACCTACA 101 TCCACTGGGT GCGGCAGGCT CCCGGCAAGG
GCCTGGAGTG GGTGGCCCGG 151 ATCGATCCTG CCAACGACAA CATCAAGTAC
GACCCCAAGT TCCAGGGCCG 201 GTTCACCATC TCTGCCGACA ACGCCAAGAA
CTCCCTGTAC CTCCAGATGA 251 ACTCTCTGCG CGCCGAGGAT ACCGCCGTGT
ACTACTGCGC CCGGAGCGAG 301 GAGAACTGGT ACGACTTCTT CGACTACTGG
GGCCAGGGCA CCCTGGTGAC 351 CGTGTCCTCT
[0326] The amino acid sequence of the heavy chain variable region
of V2.3 (CDRs based on AbM definition shown in subsequent
underscored regions) is as follows:
TABLE-US-00036 (SEQ ID NO: 159) 1 EVQLVESGGG LVQPGGSLRL SCAASGFNIK
DTYIHWVRQA PGKGLEWVAR 51 IDPANDNIKY DPKFQGRFTI SADNAKNSLY
LQMNSLRAED TAVYYCARSE 103 ENWYDFFDYW GQGTLVTVSS
[0327] The nucleotide sequence encoding the heavy chain variable
region V2.4 with the back mutations (A49G) is as follows:
TABLE-US-00037 (SEQ ID NO: 160) 1 GAGGTGCAGC TGGTGGAGTC TGGCGGCGGA
CTGGTGCAGC CTGGCGGCTC 51 TCTGCGGCTG TCTTGCGCCG CTTCCGGCTT
CAACATCAAG GACACCTACA 101 TCCACTGGGT GCGGCAGGCT CCCGGCAAGG
GCCTGGAGTG GGTGGGCCGG 151 ATCGATCCTG CCAACGACAA CATCAAGTAC
GACCCCAAGT TCCAGGGCCG 201 GTTCACCATC TCTCGCGACA ACGCCAAGAA
CTCCCTGTAC CTCCAGATGA 251 ACTCTCTGCG CGCCGAGGAT ACCGCCGTGT
ACTACTGCGC CCGGAGCGAG 301 GAGAACTGGT ACGACTTCTT CGACTACTGG
GGCCAGGGCA CCCTGGTGAC 351 CGTGTCCTCT
[0328] The amino acid sequence of the heavy chain variable region
of V2.4 (CDRs based on AbM definition shown in subsequent
underscored regions) is as follows:
TABLE-US-00038 (SEQ ID NO: 161) 1 EVQLVESGGG LVQPGGSLRL SCAASGFNIK
DTYIHWVRQA PGKGLEWVGR 51 IDPANDNIKY DPKFQGRFTI SRDNAKNSLY
LQMNSLRAED TAVYYCARSE 104 ENWYDFFDYW GQGTLVTVSS
[0329] The nucleotide sequence encoding the heavy chain variable
region V2.5 with the back mutations (R67K;F68A;R72A) is as
follows:
TABLE-US-00039 (SEQ ID NO: 162) 1 GAGGTGCAGC TGGTGGAGTC TGGCGGCGGA
CTGGTGCAGC CTGGCGGCTC 51 TCTGCGGCTG TCTTGCGCCG CTTCCGGCTT
CAACATCAAG GACACCTACA 101 TCCACTGGGT GCGGCAGGCT CCCGGCAAGG
GCCTGGAGTG GGTGGCCCGG 151 ATCGATCCTG CCAACGACAA CATCAAGTAC
GACCCCAAGT TCCAGGGCAA 201 GGCCACCATC TCTGCCGACA ACGCCAAGAA
CTCCCTGTAC CTCCAGATGA 251 ACTCTCTGCG CGCCGAGGAT ACCGCCGTGT
ACTACTGCGC CCGGAGCGAG 301 GAGAACTGGT ACGACTTCTT CGACTACTGG
GGCCAGGGCA CCCTGGTGAC 352 CGTGTCCTCT
[0330] The amino acid sequence of the heavy chain variable region
of V2.5 (CDRs based on AbM definition shown in subsequent
underscored regions) is as follows:
TABLE-US-00040 (SEQ ID NO: 163) 1 EVQLVESGGG LVQPGGSLRL SCAASGFNIK
DTYIHWVRQA PGKGLEWVAR 51 IDPANDNIKY DPKFQGKATI SADNAKNSLY
LQMNSLRAED TAVYYCARSE 105 ENWYDFFDYW GQGTLVTVSS
[0331] The nucleotide sequence encoding the heavy chain variable
region V2.6 with the back mutations (V48I;A49G;R72A) is as
follows:
TABLE-US-00041 (SEQ ID NO: 164) 1 GAGGTGCAGC TGGTGGAGTC TGGCGGCGGA
CTGGTGCAGC CTGGCGGCTC 51 TCTGCGGCTG TCTTGCGCCG CTTCCGGCTT
CAACATCAAG GACACCTACA 101 TCCACTGGGT GCGGCAGGCT CCCGGCAAGG
GCCTGGAGTG GATCGGCCGG 151 ATCGATCCTG CCAACGACAA CATCAAGTAC
GACCCCAAGT TCCAGGGCCG 201 GTTCACCATC TCTGCCGACA ACGCCAAGAA
CTCCCTGTAC CTCCAGATGA 251 ACTCTCTGCG CGCCGAGGAT ACCGCCGTGT
ACTACTGCGC CCGGAGCGAG 301 GAGAACTGGT ACGACTTCTT CGACTACTGG
GGCCAGGGCA CCCTGGTGAC 351 CGTGTCCTCT
[0332] The amino acid sequence of the heavy chain variable region
of V2.6 (CDRs based on AbM definition shown in subsequent
underscored regions) is as follows:
TABLE-US-00042 (SEQ ID NO: 165) 1 EVQLVESGGG LVQPGGSLRL SCAASGFNIK
DTYIHWVRQA PGKGLEWIGR 51 IDPANDNIKY DPKFQGRFTI SADNAKNSLY
LQMNSLRAED TAVYYCARSE 106 ENWYDFFDYW GQGTLVTVSS
[0333] The nucleotide sequence encoding the heavy chain variable
region V2.7 with the back mutations (A49G;R72A) is as follows:
TABLE-US-00043 (SEQ ID NO: 166) 1 GAGGTGCAGC TGGTGGAGTC TGGCGGCGGA
CTGGTGCAGC CTGGCGGCTC 51 TCTGCGGCTG TCTTGCGCCG CTTCCGGCTT
CAACATCAAG GACACCTACA 101 TCCACTGGGT GCGGCAGGCT CCCGGCAAGG
GCCTGGAGTG GGTGGGCCGG 151 ATCGATCCTG CCAACGACAA CATCAAGTAC
GACCCCAAGT TCCAGGGCCG 201 GTTCACCATC TCTGCCGACA ACGCCAAGAA
CTCCCTGTAC CTCCAGATGA 251 ACTCTCTGCG CGCCGAGGAT ACCGCCGTGT
ACTACTGCGC CCGGAGCGAG 301 GAGAACTGGT ACGACTTCTT CGACTACTGG
GGCCAGGGCA CCCTGGTGAC 351 CGTGTCCTCT
[0334] The amino acid sequence of the heavy chain variable region
of V2.7 (CDRs based on AbM definition shown in subsequent
underscored regions) is as follows:
TABLE-US-00044 (SEQ ID NO: 167) 1 EVQLVESGGG LVQPGGSLRL SCAASGFNIK
DTYIHWVRQA PGKGLEWVGR 51 IDPANDNIKY DPKFQGRFTI SADNAKNSLY
LQMNSLRAED TAVYYCARSE 107 ENWYDFFDYW GQGTLVTVSS
[0335] The nucleotide sequence encoding the heavy chain variable
region V2.8 with the back mutations (L79A) is as follows:
TABLE-US-00045 (SEQ ID NO: 168) 1 GAGGTGCAGC TGGTGGAGTC TGGCGGCGGA
CTGGTGCAGC CTGGCGGCTC 51 TCTGCGGCTG TCTTGCGCCG CTTCCGGCTT
CAACATCAAG GACACCTACA 101 TCCACTGGGT GCGGCAGGCT CCCGGCAAGG
GCCTGGAGTG GGTGGCCCGG 151 ATCGATCCTG CCAACGACAA CATCAAGTAC
GACCCCAAGT TCCAGGGCCG 201 GTTCACCATC TCTCGCGACA ACGCCAAGAA
CTCCGCCTAC CTCCAGATGA 251 ACTCTCTGCG CGCCGAGGAT ACCGCCGTGT
ACTACTGCGC CCGGAGCGAG 301 GAGAACTGGT ACGACTTCTT CGACTACTGG
GGCCAGGGCA CCCTGGTGAC 351 CGTGTCCTCT
[0336] The amino acid sequence of the heavy chain variable region
of V2.8
[0337] (CDRs based on AbM definition shown in subsequent
underscored regions) is as follows:
TABLE-US-00046 (SEQ ID NO: 169) 1 EVQLVESGGG LVQPGGSLRL SCAASGFNIK
DTYIHWVRQA PGKGLEWVAR 51 IDPANDNIKY DPKFQGRFTI SRDNAKNSAY
LQMNSLRAED TAVYYCARSE 108 ENWYDFFDYW GQGTLVTVSS
[0338] The nucleotide sequence encoding the heavy chain variable
region V2.10 with the back mutations (A49G;R72A;L79A) is as
follows:
TABLE-US-00047 (SEQ ID NO: 170) 1 GAGGTGCAGC TGGTGGAGTC TGGCGGCGGA
CTGGTGCAGC CTGGCGGCTC 51 TCTGCGGCTG TCTTGCGCCG CTTCCGGCTT
CAACATCAAG GACACCTACA 101 TCCACTGGGT GCGGCAGGCT CCCGGCAAGG
GCCTGGAGTG GGTGGGCCGG 151 ATCGATCCTG CCAACGACAA CATCAAGTAC
GACCCCAAGT TCCAGGGCCG 201 GTTCACCATC TCTGCCGACA ACGCCAAGAA
CTCCGCCTAC CTCCAGATGA 251 ACTCTCTGCG CGCCGAGGAT ACCGCCGTGT
ACTACTGCGC CCGGAGCGAG 301 GAGAACTGGT ACGACTTCTT CGACTACTGG
GGCCAGGGCA CCCTGGTGAC 351 CGTGTCCTCT
[0339] The amino acid sequence of the heavy chain variable region
of V2.10 (CDRs based on AbM definition shown in subsequent
underscored regions) is as follows:
TABLE-US-00048 (SEQ ID NO: 171) 1 EVQLVESGGG LVQPGGSLRL SCAASGFNIK
DTYIHWVRQA PGKGLEWVGR 51 IDPANDNIKY DPKFQGRFTI SADNAKNSAY
LQMNSLRAED TAVYYCARSE 109 ENWYDFFDYW GQGTLVTVSS
[0340] The nucleotide sequence encoding the heavy chain variable
region V2.11 with the back mutations (V48I;A49G;R72A;L79A) is as
follows:
TABLE-US-00049 (SEQ ID NO: 172) 1 GAGGTGCAGC TGGTGGAGTC TGGCGGCGGA
CTGGTGCAGC CTGGCGGCTC 51 TCTGCGGCTG TCTTGCGCCG CTTCCGGCTT
CAACATCAAG GACACCTACA 101 TCCACTGGGT GCGGCAGGCT CCCGGCAAGG
GCCTGGAGTG GATCGGCCGG 151 ATCGATCCTG CCAACGACAA CATCAAGTAC
GACCCCAAGT TCCAGGGCCG 201 GTTCACCATC TCTGCCGACA ACGCCAAGAA
CTCCGCCTAC CTCCAGATGA 251 ACTCTCTGCG CGCCGAGGAT ACCGCCGTGT
ACTACTGCGC CCGGAGCGAG 301 GAGAACTGGT ACGACTTCTT CGACTACTGG
GGCCAGGGCA CCCTGGTGAC 351 CGTGTCCTCT
[0341] The amino acid sequence of the heavy chain variable region
of V2.11 (CDRs based on AbM definition shown in subsequent
underscored regions) is as follows:
TABLE-US-00050 (SEQ ID NO: 173) 1 EVQLVESGGG LVQPGGSLRL SCAASGFNIK
DTYIHWVRQA PGKGLEWIGR 51 IDPANDNIKY DPKFQGRFTI SADNAKNSAY
LQMNSLRAED TAVYYCARSE 110 ENWYDFFDYW GQGTLVTVSS
[0342] The nucleotide sequence encoding the heavy chain variable
region V2.16 with the back mutations (V48I;A49G;R72A) is as
follows:
TABLE-US-00051 (SEQ ID NO: 174) 1 GAGGTGCAGC TGGTGGAGTC TGGCGGCGGA
CTGGTGCAGC CTGGCGGCTC 51 TCTGCGGCTG TCTTGCACCG GCTCCGGCTT
CAACATCAAG GACACCTACA 101 TCCACTGGGT GCGGCAGGCT CCCGGCAAGG
GCCTGGAGTG GATCGGCCGG 151 ATCGATCCTG CCAACGACAA CATCAAGTAC
GACCCCAAGT TCCAGGGCCG 201 GTTCACCATC TCTGCCGACA ACGCCAAGAA
CTCCCTGTAC CTCCAGATGA 251 ACTCTCTGCG CGCCGAGGAT ACCGCCGTGT
ACTACTGCGC CCGGAGCGAG 301 GAGAACTGGT ACGACTTCTT CGACTACTGG
GGCCAGGGCA CCCTGGTGAC 351 CGTGTCCTCT
[0343] The amino acid sequence of the heavy chain variable region
of V2.16 (CDRs based on AbM definition shown in subsequent
underscored regions) is as follows:
TABLE-US-00052 (SEQ ID NO: 175) 1 EVQLVESGGG LVQPGGSLRL SCTGSGFNIK
DTYIHWVRQA PGKGLEWIGR 51 IDPANDNIKY DPKFQGRFTI SADNAKNSLY
LQMNSLRAED TAVYYCARSE 111 ENWYDFFDYW GQGTLVTVSS
[0344] The following is the amino acid sequence of a humanized MH
2-7 V2.11 IgG1 with a mutated CH2 domain:
TABLE-US-00053 (SEQ ID NO: 176)
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLE
WIGRIDPANDNIKYDPKFQGRFTISADNAKNSAYLQMNSLRAEDTA
VYYCARSEENWYDFFDYWGQGTLVTVSSASTKGPSVFPLAPSSKST
SGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS
LSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP
PCPAPEALGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV
KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY
KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL
TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT
VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[0345] The variable domain is at amino acids 1-120; CH1 at 121-218;
hinge at 219-233; CH2 at 234-343; and CH3 at 344-450. The light
chain includes the following sequence with variable domain at
1-133.
TABLE-US-00054 (SEQ ID NO: 177)
DIQMTQSPSSLSASVGDRVTITCRSSQSIVHSNGNTYLEWYQQKPG
KAPKLLIYKVSNRFSGVPSRFSGSGSGTDFTLTISSLQPEDFATYY
CFQGSHIPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVV
CLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Example 11
Functional Assays of Exemplary Variants of MJ2-7
[0346] We evaluated the ability of the MJ2-7 antibody and humanized
variants to inhibit human IL-13 in assays for IL-13 activity.
[0347] STAT6 Phosphorylation Assay.
[0348] HT-29 human colonic epithelial cells (ATCC) were grown as an
adherent monolayer in McCoy's 5A medium containing 10% FBS,
Pen-Strep, glutamine, and sodium bicarbonate. For assay, the cells
were dislodged from the flask using trypsin, washed into fresh
medium, and distributed into 12.times.75 mm polystyrene tubes.
Recombinant human IL-13 (R&D Systems, Inc.) was added at
concentrations ranging from 100-0.01 ng/ml. For assays testing the
ability of antibody to inhibit the IL-13 response, 1 ng/ml
recombinant human IL-13 was added along with dilutions of antibody
ranging from 500-0.4 ng/ml. Cells were incubated in a 37.degree. C.
water bath for 30-60 minutes, then washed into ice-cold PBS
containing 1% BSA. Cells were fixed by incubating in 1%
paraformaldehyde in PBS for 15 minutes at 37.degree. C., then
washed into PBS containing 1% BSA. To permeabilize the nucleus,
cells were incubated overnight at -20.degree. C. in absolute
methanol. They were washed into PBS containing 1% BSA, then stained
with ALEXA3 Fluor 488-labeled antibody to STATE (BD Biosciences).
Fluorescence was analyzed with a FACSCAN3 and CELLQUEST3 software
(BD Biosciences).
[0349] CD23 Induction on Human Monocytes
[0350] Mononuclear cells were isolated from human peripheral blood
by layering over HISTOPAQUE.RTM. (Sigma). Cells were washed into
RPMI containing 10% heat-inactivated FCS, 50 U/ml penicillin, 50
mg/ml streptomycin, 2 mM L-glutamine, and plated in a 48-well
tissue culture plate (Costar/Corning). Recombinant human IL-13
(R&D Systems, Inc.) was added at dilutions ranging from
100-0.01 ng/ml. For assays testing the ability of antibody to
inhibit the IL-13 response, 1 ng/ml recombinant human IL-13 was
added along with dilutions of antibody ranging from 500-0.4 ng/ml.
Cells were incubated overnight at 37.degree. C. in a 5% CO.sub.2
incubator. The next day, cells were harvested from wells using
non-enzymatic Cell Dissociation Solution (Sigma), then washed into
ice-cold PBS containing 1% BSA. Cells were incubated with
phycoerythrin (PE)-labeled antibody to human CD23 (BD Biosciences,
San Diego, Calif.), and Cy-Chrome-labeled antibody to human CD11b
(BD Biosciences). Monocytes were gated based on high forward and
side light scatter, and expression of CD11b. CD23 expression on
monocytes was determined by flow cytometry using a FACSCAN3 (BD
Biosciences), and the percentage of CD23.sup.+ cells was analyzed
with CELLQUEST3 software (BD Biosciences).
[0351] TF-1 Cell Proliferation
[0352] TF-1 cells are a factor-dependent human hemopoietic cell
line requiring interleukin 3 (IL-3) or granulocyte/macrophage
colony-stimulating factor (GM-CSF) for their long-term growth. TF-1
cells also respond to a variety of other cytokines, including
interleukin 13 (IL-13). TF-1 cells (ATCC) were maintained in RPMI
medium containing 10% heat-inactivated FCS, 50 U/ml penicillin, 50
mg/ml streptomycin, 2 mM L-glutamine, and 5 ng/ml recombinant human
GM-CSF (R&D Systems). Prior to assay, cells were starved of
GM-CSF overnight. For assay, TF-1 cells were plated in duplicate at
5000 cells/well in 96-well flat-bottom microtiter plates
(Costar/Corning), and challenged with human IL-13 (R&D
Systems), ranging from 100-0.01 ng/ml. After 72 hours in a
37.degree. C. incubator with 5% CO.sub.2, the cells were pulsed
with 1 TCi/well .sup.3H-thymidine (Perkin Elmer/New England
Nuclear). They were incubated an additional 4.5 hours, then cells
were harvested onto filter mats using a TOMTEK3 harvester.
.sup.3H-thymidine incorporation was assessed by liquid
scintillation counting.
[0353] Tenascin Production Assay
[0354] BEAS-2B human bronchial epithelial cells (ATCC) were
maintained BEGM media with supplements (Clonetics). Cells were
plated at 20,000 per well in a 96-well flat-bottom culture plate
overnight. Fresh media is added containing IL-13 in the presence or
absence of the indicated antibody. After overnight incubation, the
supernatants are harvested, and assayed for the presence of the
extracellular matrix component, tenascin C, by ELISA. ELISA plates
are coated overnight with 1 ug/ml of murine monoclonal antibody to
human tenascin (IgG1, k; Chemicon International) in PBS. Plates are
washed with PBS containing 0.05% TWEEN.RTM.-20 (PBS-Tween), and
blocked with PBS containing 1% BSA. Fresh blocking solution was
added every 6 minutes for a total of three changes. Plates were
washed 3.times. with PBS-Tween. Cell supernatants or human tenascin
standard (Chemicon International) were added and incubated for 60
minutes at 37.degree. C. Plates were washed 3.times. with
PBS-Tween. Tenascin was detected with murine monoclonal antibody to
tenascin (IgG2a, k; Biohit). Binding was detected with HRP-labeled
antibody to mouse IgG2a, followed by TMB substrate. The reaction
was stopped with 0.01 N sulfuric acid. Absorbance was read at 450
nm.
[0355] The HT 29 human epithelial cell line can be used to assay
STAT6 phosphorylation. HT 29 cells are incubated with 1 ng/ml
native human IL-13 crude preparation in the presence of increasing
concentrations of the test antibody for 30 minutes at 37.degree. C.
Western blot analysis of cell lysates with an antibody to
phosphorylated STAT6 can be used to detect dose-dependent IL
13-mediated phosphorylation of STAT6. Similarly, flow cytometric
analysis can detect phosphorylated STAT6 in HT 29 cells that were
treated with a saturating concentration of IL-13 for 30 minutes at
37.degree. C., fixed, permeabilized, and stained with an ALEXA.TM.
Fluor 488-labeled mAb to phospho-STAT6. An exemplary set of results
is set forth in the Table 1. The inhibitory activity of V2.11 was
comparable to that of sIL-13R.alpha.2-Fc.
TABLE-US-00055 TABLE 1 Expression Native hIL-13 Construct
Backmutations .mu.g/ml/ STAT6 assay VH VL VH COS; 48 h IC 50, nM
V2.0 V2 None, CDR grafted 8-10 >100 CDR graft V 2.1 V2 V48I;
A49G 9-14 2.8 V 2.2 V2 R67K; F68A 5-6 >100 V 2.3 V2 R72A 8-9
1.67-2.6 V 2.4 V2 A49G 10 17.5 V 2.5 V2 R67K; F68A; R72A 4-5 1.75 V
2.6 V2 V48I; A49G: R72A 11-12 1.074-3.37 V 2.7 V2 A49G; R72A 10-11
1.7 V 2.11 V2 V48I; A49G: 24 0.25-0.55 R72A: L79A
Example 12
Binding Interaction Site Between IL-13 and IL-13RI1
[0356] A complex of IL-13, the extracellular domain of IL-13RI1
(residues 27-342 of SEQ ID NO:125), and an antibody that binds
human IL-13 was studied by x-ray crystallography. See, e.g.,
16163-029001. Two points of substantial interaction were found
between IL-13 and IL-13R.alpha.1. The interaction between Ig domain
1 of IL-13R.alpha.1 and IL-13 results in the formation of an
extended beta sheet spanning the two molecules. Residues Thr88
[Thr107], Lys89 [Lys108], Ile90 [Ile109], and Glu91 [Glu110] of
IL-13 (SEQ ID NO:124, mature sequence [full-length sequence (SEQ ID
NO:178)]) form a beta strand that interacts with residues Lys76,
Lys77, Ile78 and A1a79 of the receptor (SEQ ID NO:125).
Additionally, the side chain of Met33 [Met52] of IL-13 (SEQ ID
NO:124 [SEQ ID NO:178]) extends into a hydrophobic pocket that is
created by the side chains of these adjoining strands.
[0357] The predominant feature of the interaction with Ig domain 3
is the insertion of a hydrophobic residue (Phe107 [Phe126]) of
IL-13 (SEQ ID NO:124 [SEQ ID NO:178]) into a hydrophobic pocket in
Ig domain 3 of the receptor IL-13R.alpha.1. The hydrophobic pocket
of IL-13R.alpha.1 is formed by the side chains of residues Leu319,
Cys257, Arg256, and Cys320 (SEQ ID NO:125). The interaction with
Phe107 [Phe126] of IL-13 (SEQ ID NO:124 [SEQ ID NO:178]) results in
an extensive set of van der Waals interactions between amino acid
residues Ile254, Ser255, Arg256, Lys318, Cys320, and Tyr321 of
IL-13R.alpha.1 (SEQ ID NO:125) and amino acid residues Arg11
[Arg30], Glu12 [Glu31], Leu13 [Leu32], Ile14 [Ile33], Glu15
[Ile34], Lys104 [Lys123], Lys105 [Lys124], Leu106 [Leu125], Phe107
[Phe126], and Arg108 [Arg 127] of IL-13 (SEQ ID NO:124 [SEQ ID
NO:178]). These results demonstrate that an IL-13 binding agent
that binds to the regions of IL-13 involved in interaction with
IL-13RI1 can be used to inhibit IL-13 signaling.
Example 13
Expression of Humanized MJ 2-7 Antibody in COS Cells
[0358] To evaluate the production of chimeric anti-NHP IL13
antibodies in the mammalian recombinant system, the variable
regions of mouse MJ 2-7 antibody were subcloned into a pED6
expression vector containing human kappa and IgG1mut constant
regions. Monkey kidney COS-1 cells were grown in DME media (Gibco)
containing 10% heat-inactivated fetal bovine serum, 1 mM glutamine
and 0.1 mg/ml Penicillin/Streptomycin. Transfection of COS cells
was performed using TRANSITIT3-LT1 Transfection reagent (Mirus)
according to the protocol suggested by the reagent supplier.
Transfected COS cells were incubated for 24 hours at 37.degree. C.
in the presence of 10% CO.sub.2, washed with sterile PBS, and then
grown in serum-free media R1CD1 (Gibco) for 48 hours to allow
antibody secretion and accumulation in the conditioned media. The
expression of chMJ 2-7 antibody was quantified by total human IgG
ELISA using purified human IgG1/kappa antibody as a standard.
[0359] The production of chimeric MJ 2-7 antibody in COS cells was
significantly lower then the control chimeric antibody (Table 2).
Therefore, optimization of Ab expression was included in the MJ 2-7
humanization process. The humanized MJ 2-7 V1 was constructed by
CDR grafting of mouse MJ 2-7 heavy chain CDRs onto the most
homologous human germline clone, DP 25, which is well expressed and
represented in typical human antibody response. The CDRs of light
chain were subcloned onto human germline clone DPK 18 in order to
generate huMJ 2-7 V1 VL. The humanized MJ 2-7 V2 was made by CDR
grafting of CDRs MJ 2-7 heavy chain variable region onto DP54 human
germline gene framework and CDRs of MJ 2-7 light chain variable
region onto DPK9 human germline gene framework. The DP 54 clone
belongs to human VH III germline subgroup and DPK9 is from the V
kappa I subgroup of human germline genes. Antibody molecules that
include VH III and V kappa I frameworks have high expression level
in E. coli system and possess high stability and solubility in
aqueous solutions (see, e.g., Stefan Ewert et al., J. Mol. Biol.
(2003), 325; 531-553, Adrian Auf et al., Methods (2004)
34:215-224). We have used the combination of DP54/DPK9 human
frameworks in the production of several recombinant antibodies and
have achieved a high expression of antibody (>20 Tg/ml) in the
transient COS transfection experiments.
TABLE-US-00056 TABLE 2 mAb Expression, Tg/ml 3D6 10.166 Ch MJ 2-7
pED6 (1) 2.44 Ch MJ 2-7 pED6 (2) 2.035 h12A11 V2 1.639
[0360] The CDR grafted MJ 2-7 V1 and V2 VH and VL genes were
subcloned into two mammalian expression vector systems
(pED6kappa/pED6 IgG1mut and pSMEN2kappa/pSMED2IgG1mut), and the
production of humanized MJ 2-7 antibodies was evaluated in
transient COS transfection experiments as described above. In the
first set of the experiments the effect of various combinations of
huMJ 2-7 VL and VH on the antibody expression was evaluated (Table
3). Changing of MJ 2-7 VL framework regions to DKP9 increased the
antibody production 8-10 fold, whereas VL V1 (CDR grafted onto DPK
18) showed only a moderate increase in antibody production. This
effect was observed when humanized VL was combined with chimeric MJ
2-7 VH and humanized MJ 2-7 V1 and V2. The CDR grafted MJ 2-7 V2
had a 3-fold higher expression level then CDR grafted MJ 2-7 V1 in
the same assay conditions.
TABLE-US-00057 TABLE 3 mAb Expression, Tg/ml ChMJ 2-7 1.83 hVH
V1/mVL 3.04 hVH V1/hVL V1 6.34 hVH V1/hVL V2 15.4 hVH-V2/mVL 0.2
mVH/hVL-V2 18.41 hVH-V2/hVL-V1 5.13 hVH-V2/hVL-V2 10.79
[0361] Similar experiments were performed with huMJ 2-7 V2
containing back mutations in the heavy chain variable regions
(Table 4). The highest expression level was detected for huMJ 2-7
V2.11 that retained the antigen binding and neutralization
properties of mouse MJ 2-7 antibody. Introduction of back mutations
at the positions 48 and 49 (V48I and A49G) increased the production
of huMJ 2-7 V2 antibody in COS cells, whereas the back mutations of
amino acids at the positions 23, 24, 67 and 68 (A23T; A24G; R67K
and F68A) had a negative impact on antibody expression.
TABLE-US-00058 TABLE 4 mAb Expression, Tg/ml V2 8.27 V2.1 12.1 V2.2
5.29 V2.3 9.60 V2.4 8.20 V2.5 6.05 V2.6 11.3 V2.10 9.84 V2.11 14.85
V2.16 1.765
Example 14
Evaluation of Antigen Binding Properties of Humanized MJ 2-7
Antibodies by NHP IL-13 FLAG ELISA
[0362] The ability of fully humanized MJ 2-7 mAb (V1, V2 v2) to
compete with biotinylated mouse MJ 2-7 Ab for binding to NHP
IL-13-FLAG was evaluated by ELISA. The microtiter plates (Costar)
were coated with 1 .mu.g/ml of anti-FLAG monoclonal antibody M2
(Sigma). The FLAG NHP IL-13 protein at concentration of 10 ng/ml
was mixed with 10 ng/ml of biotin labeled mouse MJ 2-7 antibody and
various concentrations of unlabeled mouse and humanized MJ 2-7
antibody. The mixture was incubated for 2 hours at room temperature
and then added to the anti-FLAG antibody-coated plate. Binding of
FLAG NHP-IL-13/bioMJ2-7 Ab complexes was detected with
streptavidin-HRP and 3,3',5,5'-tetramethylbenzidine (TMB). The
humanized MJ 2-7 V2 significantly lost activity whereas huMJ 2-7
V2.11 completely restored the antigen binding activity and was
capable of competing with biotinylated MJ 2-7 mAb for binding to
FLAG-NHP IL-13. BIACORE.TM. analysis also confirmed that NHP IL-13
had rapid binding to and slow dissociation to immobilized hluMJ 2-7
v2.11.
Example 15
Molecular Modeling of Humanized MJ2-7 V2VH
[0363] Structure templates for modeling humanized MJ2-7 heavy chain
version 2 (MJ2-7 V2VH) were selected based on BLAST homology
searches against Protein Data Bank (PDB). Besides the two
structures selected from the BLAST search output, an additional
template was selected from an in-house database of protein
structures. Model of MJ2-7 V2VH was built using the three template
structures 1JPS (co-crystal structure of human tissue factor in
complex with humanized Fab D3h44), 1N8Z (co-crystal structure of
human Her2 in complex with Herceptin Fab) and F13.2 (IL-13 in
complex with mouse antibody Fab fragment) as templates and the
Homology module of InsightII (Accelrys, San Diego). The
structurally conserved regions (SCRs) of 1JPS, 1N8Z and F13.2
(available from 16163-029001) were determined based on the C.alpha.
distance matrix for each molecule and the template structures were
superimposed based on minimum RMS deviation of corresponding atoms
in SCRs. The sequence of the target protein MJ2-7 V2VH was aligned
to the sequences of the superimposed templates proteins and
coordinates of the SCRs were assigned to the corresponding residues
of the target protein. Based on the degree of sequence similarity
between the target and the templates in each of the SCRs,
coordinates from different templates were used for different SCRs.
Coordinates for loops and variable regions not included in the SCRs
were generated by Search Loop or Generate Loop methods as
implemented in Homology module. Briefly, Search Loop method scans
protein structures that would fit properly between two SCRs by
comparing the Ca distance matrix of flanking SCR residues with a
pre-calculated matrix derived from protein structures that have the
same number of flanking residues and an intervening peptide segment
of a given length. Generate Loop method that generate atom
coordinates de novo was used in those cases where Search Loops did
not produce desired results. Conformation of amino acid side chains
was kept the same as that in the template if the amino acid residue
was identical in the template and the target. However, a
conformational search of rotamers was done and the energetically
most favorable conformation was retained for those residues that
are not identical in the template and target. This was followed by
Splice Repair that sets up a molecular mechanics simulation to
derive proper bond lengths and bond angles at junctions between two
SCRs or between SCR and a variable region. Finally the model was
subjected to energy minimization using Steepest Descents algorithm
until a maximum derivative of 5 kcal/(mol .ANG.) or 500 cycles and
Conjugate Gradients algorithm until a maximum derivative of 5
kcal/(mol .ANG.) or 2000 cycles. Quality of the model was evaluated
using ProStat/Struct_Check command.
[0364] Molecular model of mouse MJ2-7 VH was built by following the
procedure described for humanized MJ2-7 V2VH except the templates
used were 1QBL and 1QBM, crystal structures for horse
anti-cytochrome c antibody FabE8.
[0365] Potential differences in CDR-Framework H-bonds predicted by
the models
[0366] hMJ2-7 V2VH:G26-hMJ2-7 V2VH:A24
[0367] hMJ2-7 V2VH:Y109-hMJ2-7 V2VH:S25
[0368] mMJ2-7 VH:D61-mMJ2-7 VH:148
[0369] mMJ2-7 VH:K63-mMJ2-7 VH:E46
[0370] mMJ2-7 VH:Y109-mMJ2-7 VH:R98
These differences suggested the following optional back mutations:
A23T, A24G and V481.
[0371] Other optional back mutations suggested based on significant
RMS deviation of individual amino acids and differences in amino
acid residues adjacent to these are: G9A, L115T and R87T.
Example 16
IL-13 Neutralization Activity of MJ2-7 and C65
[0372] The IL-13 neutralization capacities of MJ2-7 and C65 were
tested in a series of bioassays. First, the ability of these
antibodies to neutralize the bioactivity of NHP IL-13 was tested in
a monocyte CD23 expression assay. Freshly isolated human PBMC were
incubated overnight with 3 ng/ml NHP IL-13 in the presence of
increasing concentrations of MJ2-7, C65, or sIL-13RI2-Fc. Cells
were harvested, stained with CYCHROME3-labeled antibody to the
monocyte-specific marker, CD11b, and with PE-labeled antibody to
CD23. In response to IL-13 treatment, CD23 expression is
up-regulated on the surface of monocytes, which were gated based on
expression of CD11b. MJ2-7, C65, and sIL13RI2-Fc all were able to
neutralize the acitivity of NHP IL-13 in this assay. The potencies
of MJ2-7 and sIL-13RI2-Fc were equivalent. C65 was approximately
20-fold less active (FIG. 2).
[0373] In a second bioassay, the neutralization capacities of MJ2-7
and C65 for native human IL-13 were tested in a STAT6
phosphorylation assay. The HT-29 epithelial cell line was incubated
with 0.3 ng/ml native human IL-13 in the presence of increasing
concentrations of MJ2-7, C65, or sIL-13RI2-Fc, for 30 minutes at
37.degree. C. Cells were fixed, permeabilized, and stained with
ALEXA3 Fluor 488-labeled antibody to phosphorylated STAT6. IL-13
treatment stimulated STAT6 phosphorylation. MJ2-7, C65, and
sIL13Ra2-Fc all were able to neutralize the acitivity of native
human IL-13 in this assay (FIG. 3). The IC50's for the murine MJ-27
antibody and the humanized form (V2.11) were 0.48 nM and 0.52 nM
respectively. The potencies of MJ2-7 and sIL-13RI2-Fc were
approximately equivalent. The IC50 for sIL-13Ra2-Fc was 0.33 nM
(FIG. 4). C65 was approximately 20-fold less active (FIG. 5).
[0374] In a third bioassay, the ability of MJ2-7 to neutralize
native human IL-13 was tested in a tenascin production assay. The
human BEAS-2B lung epithelial cell line was incubated overnight
with 3 ng/ml native human IL-13 in the presence of increasing
concentrations of MJ2-7. Supernatants were harvested and tested for
production of the extracellular matrix protein, tenascin C, by
ELISA (FIG. 6A). MJ2-7 inhibited this response with IC50 of
approximately 0.1 nM (FIG. 6B).
[0375] These results demonstrate that MJ2-7 is an effective
neutralizer of both NHP IL-13 and native human IL-13. The IL-13
neutralization capacity of MJ2-7 is equivalent to that of
sIL-13RI2-Fc. MJ1-65 also has IL-13 neutralization activity, but is
approximately 20-fold less potent than MJ2-7.
Example 17
Epitope Mapping of MJ2-7Antibody by SPR
[0376] sIL-13RI2-Fc was directly coated onto a CM5 chip by standard
amine coupling. NHP-IL-13 at 100 nM concentration was injected, and
its binding to the immobilized IL-13RI2-Fc was detected by
BIACORE3. An additional injection of 100 nM of anti IL-13
antibodies was added, and changes in binding were monitored. MJ2-7
antibody did not bind to NHP-IL-13 when it was in a complex with hu
IL-13RI2, whereas a positive control anti-IL-13 antibody did (FIG.
7). These results indicate that hu IL-13RI2 and MJ2-7 bind to the
same or overlapping epitopes of NHP IL-13.
Example 18
Measurement of Kinetic Rate Constants for the Interaction Between
NHP-IL-13 and Humanized MJ2-7 V2-11 Antibody
[0377] To prepare the biosensor surface, goat anti-human IgG Fc
specific antibody was immobilized onto a research-grade carboxy
methyl dextran chip (CM5) using amine coupling. The surface was
activated with a mixture of 0.1 M1-ethyl-3-(3-dimethylaminopropyl)
carbodiimide (EDC) and 0.05 M N-Hydroxysuccinimide (NHS). The
capturing antibody was injected at a concentration of 10 Tg/ml in
sodium acetate buffer (pH 5.5). Remaining activated groups were
blocked with 1.0 M ethanolamine (pH 8.0). As a control, the first
flow cell was used as a reference surface to correct for bulk
refractive index, matrix effects, and non-specific binding, the
second, third and fourth flow cells were coated with the capturing
molecule.
[0378] For kinetic analysis, the monoclonal antibody hMJ2-7 V2-11
was captured onto the anti IgG antibody surface by injecting 40 Tl
of a 1 Tg/ml solution. The net difference between the baseline and
the point approximately 30 seconds after completion of injection
was taken to represent the amount of target bound. Solutions of
NHP-IL-13 at 600, 200, 66.6, 22.2, 7.4, 2.5, 0.8, 0.27, 0.09 and 0
nM concentrations were injected in triplicate at a flow rate of 100
Tl per min for 2 minutes, and the amount of bound material as a
function of time was recorded (FIG. 8). The dissociation phase was
monitored in HBS/EP buffer (10 mM HEPES, pH 7.4, containing 150 mM
NaCl, 3 mM EDTA and 0.005% (v/v) Surfactant P20) for 5 minutes at
the same flow rate followed by two 5 Tl injections of glycine, pH
1.5, to regenerate a fully active capturing surface. All kinetic
experiments were done at 22.5.degree. C. in HBS/EP buffer. Blank
and buffer effects were subtracted for each sensorgram using double
referencing.
[0379] The kinetic data were analyzed using BIAEVALUATION3 software
3.0.2 applied to a 1:1 model. The apparent dissociation (kd) and
association (ka) rate constants were calculated from the
appropriate regions of the sensorgrams using a global analysis. The
affinity constant of the interaction between antibody and NHP IL-13
was calculated from the kinetic rate constants by the following
formula: Kd=kd/ka. These results indicate that huMJ2-7 V2-11 has on
and off-rates of 2.05.times.10.sup.7 M.sup.-1s.sup.-1 and
8.89.times.10.sup.-4 l/s, respectively, resulting in an antibody
with 43 .mu.M affinity for NHP-IL-13.
Example 19
Inhibitory Activity of MJ2-7 Humanization Intermediates in
Bioassays
[0380] The inhibitory activity of various intermediates in the
humanization process was tested by STATE phosphorylation and
tenascin production bioassays. A sub-maximal level of NHP IL-13 or
native human IL-13 crude preparation was used to elicit the
biological response, and the concentration of the humanized version
of MJ2-7 required for half-maximal inhibition of the response was
determined. Analysis hMJ2-7 V1, hMJ2-7 V2 and hMJ2-7 V3, expressed
with the human IgG1, and kappa constant regions, showed that
Version 2 retained neutralization activity against native human
IL-13. This concentration of the Version 2 humanized antibody
required for half-maximal inhibition of native human IL-13
bioactivity was approximately 110-fold greater than that of murine
MJ2-7 (FIG. 9). Analysis of a semi-humanized form, in which the V1
or V2 VL was combined with murine MJ2-7 VH, demonstrated that the
reduction of native human IL-13 neutralization activity was not due
to to the humanized VL, but rather to the VH sequence (FIG. 10).
Whereas the semi-humanized MJ2-7 antibody with VL V1 only partially
retained the neutralization activity the version with humanized VL
V2 was as active as parental mouse antibody. Therefore, a series of
back-mutations were introduced into the V1 VH sequence to improve
the native human IL-13 neutralization activity of murine MJ2-7.
Example 20
MJ2-7 Blocks IL-13 Interaction with IL-13RI1 and IL-13RI2
[0381] MJ2-7 is specific for the C-terminal 19-mer of NHP IL-13,
corresponding to amino acid residues 114-132 of the immature
protein (SEQ ID NO:24), and residues 95-113 of the mature protein
(SEQ ID NO:14). For human IL-13, this region, which forms part of
the D alpha-helix of the protein, has been reported to contain
residues important for binding to both IL-13RI1 and IL-13RI2.
Analysis of human IL-13 mutants identified the A, C, and D-helices
as containing important contacts site for the IL-13RI1/IL-4RI
signaling complex (Thompson and Debinski (1999) J. Biol. Chem. 274:
29944-50). Alanine scanning mutagenesis of the D-helix identified
residues K123, K124, and R127 (SEQ ID NO:24) as responsible for
interaction with IL-13RI2, and residues E110, E128, and L122 as
important contacts for IL-13RI1 (Madhankmuar et al. (2002) J. Biol.
Chem. 277: 43194-205). High resolution solution structures of human
IL-13 determined by NMR have predicted the IL-13 binding
interactions based on similarities to related ligand-receptor pairs
of known structure. These NMR studies have supported a key role for
the IL-13 A and D-helices in making important contacts with
IL-13RI1 (Eisenmesser et al. (2001) J. Mol. Biol. 310:231-241; Moy
et al. (2001) J. Mol. Biol. 310:219-230). Binding of MJ2-7 to this
epitope located in the C-terminal, D-helix of IL-13 was predicted
to disrupt interaction of IL-13 with IL-13RI1 and IL-13RI2.
[0382] The ability of MJ2-7 to inhibit binding of NHP IL-13 to
IL-13RI1 and IL-13RI2 was tested by ELISA. Recombinant soluble
forms of human IL-13RI1-Fc and IL-13RI2-Fc were coated onto ELISA
plates. FLAG-tagged NHP IL-13 was added in the presence of
increasing concentrations of MJ2-7. Results showed that MJ2-7
competed with both soluble receptor forms for binding to NHP IL-13
(FIGS. 11A and 11B). This provides a basis for the neutralization
of IL-13 bioactivity by MJ2-7.
Example 21
The MJ 2-7 Light Chain CDRs Contribute to Antigen Binding
[0383] To evaluate if all three light chain CDR regions are
required for the binding of MJ 2-7 antibody to NHP IL-13, two
additional humanized versions of MJ 2-7 VL were constructed by CDR
grafting. The VL version 3 was designed based on human germline
clone DPK18, contained CDR1 and CDR2 of the human germline clone
and CDR3 from mouse MJ2-7 antibody (FIG. 12). In the second
construct (hMJ 2-7 V4), only CDR1 and CDR2 of MJ 2-7 antibody were
grafted onto DPK 18 framework, and CDR3 was derived from irrelevant
mouse monoclonal antibody.
[0384] The humanized MJ 2-7 V3 and V4 were produced in COS cells by
combining hMJ 2-7 VH V1 with hMJ 2-7 VL V3 and V4. The antigen
binding properties of the antibodies were examined by direct NHP
IL-13 binding ELISA. The hMJ 2-7 V4 in which MJ 2-7 light chain
CDR3 was absent retained the ability to bind NHP IL-13, whereas V3
that contained human germline CDR1 and CDR2 in the light chain did
not bind to immobilized NHP IL-13. These results demonstrate that
CDR1 and CDR2 of MJ 2-7 antibody light chain are most likely
responsible for the antigen binding properties of this
antibody.
TABLE-US-00059 Nucleotide sequence of hMJ 2-7 VL V3 (SEQ ID NO:
189) 1 ATGCGGCTGC CCGCTCAGCT GCTGGGCCTG CTGATGCTGT GGGTGCCCGG 51
CTCTTCCGGC GACGTGGTGA TGACCCAGTC CCCTCTGTCT CTGCCCGTGA 101
CCCTGGGCCA GCCCGCTTCT ATCTCTTGCC GGTCCTCCCA GTCCCTGGTG 151
TACTCCGACG GCAACACCTA CCTGAACTGG TTCCAGCAGA GACCCGGCCA 201
GTCTCCTCGG CGGCTGATCT ACAAGGTGTC CAACCGCTTT TCCGGCGTGC 251
CCGATCGGTT CTCCGGCTCC GGCAGCGGCA CCGATTTCAC CCTGAAGATC 301
AGCCGCGTGG AGGCCGAGGA TGTGGGCGTG TACTACTGCT TCCAGGGCTC 351
CCACATCCCT TACACCTTTG GCGGCGGAAC CAAGGTGGAG ATCAAG Amino acid
sequence of hMJ 2-7 VL V3 (SEQ ID NO: 190)
MRLPAQLLGLLMLWVPGSSG-DVVMTQSPLSLPVTLGQPASISCRSSQ
SLVYSDGNTYLNWFQQRPGQSPRRLIYKVSNRFSGVPDRFSGSGSGTD
FTLKISRVEAEDVGVYYCFQGSHIPYTFGGGTKVEIK Nucleotide sequence of hMJ
2-7 VL V4 (SEQ ID NO: 191)
GATGTTGTGATGACCCAATCTCCACTCTCCCTGCCTGTCACTCCTGGA
GAGCCAGCCTCCATCTCTTGCAGATCTAGTCAGAGCATTGTGCATAGT
AATGGAAACACCTACCTGGAATGGTACCTGCAGAAACCAGGCCAGTCT
CCACAGCTCCTGATCTACAAAGTTTCCAACCGATTTTCTGGGGTCCCA
GACAGGTTCAGTGGCAGTGGATCAGGGACAGATTTCACACTCAAGATC
AGCAGAGTGGAGGCTGAGGATGTGGGAGTTTATTACTGCTTTCAAAGT
TCACATGTTCCTCTCACCTTCGGTCAGGGGACCAAGCTGGAGATCAAA Amino acid
sequence of hMJ 2-7 VL V4 (SEQ ID NO: 192) DVVMTQSPLS LPVTPGEPAS
ISCRSSQSIV HSNGNTYLEW YLQKPGQSPQ LLIYKVSNRF SGVPDRFSGS
GSGTDFTLKISRVEA EDVGV YYCFQSSHVP LTFGQGTKLE IK
[0385] Those skilled in the art will recognize, or be able to
ascertain using no more than routine experimentation, many
equivalents of the specific embodiments described herein described
herein. Other embodiments are within the following claims.
Sequence CWU 1
1
193119PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 1Phe Val Lys Asp Leu Leu Val His Leu Lys Lys Leu
Phe Arg Glu Gly1 5 10 15Gln Phe Asn219PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 2Phe
Val Lys Asp Leu Leu Val His Leu Lys Lys Leu Phe Arg Glu Gly1 5 10
15Arg Phe Asn319PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 3Phe Val Lys Asp Leu Leu Leu His Leu Lys
Lys Leu Phe Arg Glu Gly1 5 10 15Gln Phe Asn419PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 4Phe
Val Lys Asp Leu Leu Leu His Leu Lys Lys Leu Phe Arg Glu Gly1 5 10
15Arg Phe Asn516PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 5Phe Val Lys Asp Leu Leu Val His Leu Lys
Lys Leu Phe Arg Glu Gly1 5 10 15616PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 6Phe
Val Lys Asp Leu Leu Leu His Leu Lys Lys Leu Phe Arg Glu Gly1 5 10
15717PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 7Lys Asp Leu Leu Val His Leu Lys Lys Leu Phe Arg
Glu Gly Gln Phe1 5 10 15Asn817PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 8Lys Asp Leu Leu Val His Leu
Lys Lys Leu Phe Arg Glu Gly Arg Phe1 5 10 15Asn917PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 9Lys
Asp Leu Leu Leu His Leu Lys Lys Leu Phe Arg Glu Gly Gln Phe1 5 10
15Asn1017PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 10Lys Asp Leu Leu Leu His Leu Lys Lys Leu Phe Arg
Glu Gly Arg Phe1 5 10 15Asn1113PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 11Lys Asp Leu Leu Val His Leu
Lys Lys Leu Phe Arg Glu1 5 101213PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 12Lys Asp Leu Leu Leu His
Leu Lys Lys Leu Phe Arg Glu1 5 10138PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 13His
Leu Lys Lys Leu Phe Arg Glu1 514112PRTMacaca fascicularis 14Ser Pro
Val Pro Pro Ser Thr Ala Leu Lys Glu Leu Ile Glu Glu Leu1 5 10 15Val
Asn Ile Thr Gln Asn Gln Lys Ala Pro Leu Cys Asn Gly Ser Met 20 25
30Val Trp Ser Ile Asn Leu Thr Ala Gly Val Tyr Cys Ala Ala Leu Glu
35 40 45Ser Leu Ile Asn Val Ser Gly Cys Ser Ala Ile Glu Lys Thr Gln
Arg 50 55 60Met Leu Asn Gly Phe Cys Pro His Lys Val Ser Ala Gly Gln
Phe Ser65 70 75 80Ser Leu Arg Val Arg Asp Thr Lys Ile Glu Val Ala
Gln Phe Val Lys 85 90 95Asp Leu Leu Val His Leu Lys Lys Leu Phe Arg
Glu Gly Gln Phe Asn 100 105 1101510PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 15Gly
Phe Asn Ile Lys Asp Thr Tyr Ile His1 5 101617PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 16Arg
Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe Gln1 5 10
15Gly1711PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 17Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr1 5
101816PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 18Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn
Thr Tyr Leu Glu1 5 10 15197PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 19Lys Val Ser Asn Arg Phe
Ser1 5209PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 20Phe Gln Gly Ser His Ile Pro Tyr Thr1
52116PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 21Xaa Ser Ser Gln Ser Xaa Xaa His Ser Asn Gly Asn
Thr Tyr Leu Xaa1 5 10 15227PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 22Lys Xaa Ser Xaa Arg Phe
Ser1 5237PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 23Phe Gln Xaa Xaa Xaa Xaa Pro1 524132PRTMacaca
fascicularis 24Met Ala Leu Leu Leu Thr Met Val Ile Ala Leu Thr Cys
Leu Gly Gly1 5 10 15Phe Ala Ser Pro Ser Pro Val Pro Pro Ser Thr Ala
Leu Lys Glu Leu 20 25 30Ile Glu Glu Leu Val Asn Ile Thr Gln Asn Gln
Lys Ala Pro Leu Cys 35 40 45Asn Gly Ser Met Val Trp Ser Ile Asn Leu
Thr Ala Gly Val Tyr Cys 50 55 60Ala Ala Leu Glu Ser Leu Ile Asn Val
Ser Gly Cys Ser Ala Ile Glu65 70 75 80Lys Thr Gln Arg Met Leu Asn
Gly Phe Cys Pro His Lys Val Ser Ala 85 90 95Gly Gln Phe Ser Ser Leu
Arg Val Arg Asp Thr Lys Ile Glu Val Ala 100 105 110Gln Phe Val Lys
Asp Leu Leu Val His Leu Lys Lys Leu Phe Arg Glu 115 120 125Gly Gln
Phe Asn 1302516PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 25Xaa Ser Ser Gln Ser Xaa Xaa His Ser
Xaa Gly Asn Xaa Tyr Leu Xaa1 5 10 152616PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 26Xaa
Ser Ser Gln Ser Xaa Xaa His Ser Xaa Gly Asn Xaa Tyr Leu Glu1 5 10
15277PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 27Lys Xaa Ser Xaa Xaa Xaa Ser1 5286PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 28Gln
Xaa Xaa Xaa Ile Pro1 5299PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 29Phe Gln Xaa Xaa Xaa Xaa Pro
Tyr Thr1 530102PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 30Asp Ile Val Met Thr Gln Thr Pro
Leu Ser Leu Pro Val Thr Pro Gly1 5 10 15Glu Pro Ala Ser Ile Ser Cys
Arg Ser Ser Gln Ser Ile Val His Ser 20 25 30Asn Gly Asn Thr Tyr Leu
Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser 35 40 45Pro Gln Leu Leu Ile
Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60Asp Arg Phe Ser
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile65 70 75 80Ser Arg
Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Phe Gln Gly 85 90 95Ser
His Ile Pro Tyr Thr 10031102PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 31Asp Val Val Met Thr Gln
Ser Pro Leu Ser Leu Pro Val Thr Leu Gly1 5 10 15Gln Pro Ala Ser Ile
Ser Cys Arg Ser Ser Gln Ser Ile Val His Ser 20 25 30Asn Gly Asn Thr
Tyr Leu Glu Trp Phe Gln Gln Arg Pro Gly Gln Ser 35 40 45Pro Arg Arg
Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60Asp Arg
Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile65 70 75
80Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Phe Gln Gly
85 90 95Ser His Ile Pro Tyr Thr 10032102PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
32Asp Ile Val Met Thr Gln Thr Pro Leu Ser Leu Ser Val Thr Pro Gly1
5 10 15Gln Pro Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val His
Ser 20 25 30Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly
Gln Ser 35 40 45Pro Gln Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser
Gly Val Pro 50 55 60Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe
Thr Leu Lys Ile65 70 75 80Ser Arg Val Glu Ala Glu Asp Val Gly Val
Tyr Tyr Cys Phe Gln Gly 85 90 95Ser His Ile Pro Tyr Thr
10033102PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 33Asp Ile Val Met Thr Gln Thr Pro Leu Ser Leu
Ser Val Thr Pro Gly1 5 10 15Gln Pro Ala Ser Ile Ser Cys Arg Ser Ser
Gln Ser Ile Val His Ser 20 25 30Asn Gly Asn Thr Tyr Leu Glu Trp Tyr
Leu Gln Lys Pro Gly Gln Pro 35 40 45Pro Gln Leu Leu Ile Tyr Lys Val
Ser Asn Arg Phe Ser Gly Val Pro 50 55 60Asp Arg Phe Ser Gly Ser Gly
Ser Gly Thr Asp Phe Thr Leu Lys Ile65 70 75 80Ser Arg Val Glu Ala
Glu Asp Val Gly Val Tyr Tyr Cys Phe Gln Gly 85 90 95Ser His Ile Pro
Tyr Thr 10034102PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 34Asp Ile Val Met Thr Gln Ser Pro
Leu Ser Leu Pro Val Thr Pro Gly1 5 10 15Glu Pro Ala Ser Ile Ser Cys
Arg Ser Ser Gln Ser Ile Val His Ser 20 25 30Asn Gly Asn Thr Tyr Leu
Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser 35 40 45Pro Gln Leu Leu Ile
Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60Asp Arg Phe Ser
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile65 70 75 80Ser Arg
Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Phe Gln Gly 85 90 95Ser
His Ile Pro Tyr Thr 10035102PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 35Asp Ile Val Met Thr Gln
Thr Pro Leu Ser Ser Pro Val Thr Leu Gly1 5 10 15Gln Pro Ala Ser Ile
Ser Cys Arg Ser Ser Gln Ser Ile Val His Ser 20 25 30Asn Gly Asn Thr
Tyr Leu Glu Trp Leu Gln Gln Arg Pro Gly Gln Pro 35 40 45Pro Arg Leu
Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60Asp Arg
Phe Ser Gly Ser Gly Ala Gly Thr Asp Phe Thr Leu Lys Ile65 70 75
80Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Phe Gln Gly
85 90 95Ser His Ile Pro Tyr Thr 10036102PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
36Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1
5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ser Ser Gln Ser Ile Val His
Ser 20 25 30Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Gln Gln Lys Pro Gly
Lys Ala 35 40 45Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser
Gly Val Pro 50 55 60Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe
Thr Leu Thr Ile65 70 75 80Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr
Tyr Tyr Cys Phe Gln Gly 85 90 95Ser His Ile Pro Tyr Thr
10037102PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 37Asp Val Val Met Thr Gln Ser Pro Leu Ser Leu
Pro Val Thr Leu Gly1 5 10 15Gln Pro Ala Ser Ile Ser Cys Arg Ser Ser
Gln Ser Leu Val Tyr Ser 20 25 30Asp Gly Asn Thr Tyr Leu Asn Trp Phe
Gln Gln Arg Pro Gly Gln Ser 35 40 45Pro Arg Arg Leu Ile Tyr Lys Val
Ser Asn Arg Phe Ser Gly Val Pro 50 55 60Asp Arg Phe Ser Gly Ser Gly
Ser Gly Thr Asp Phe Thr Leu Lys Ile65 70 75 80Ser Arg Val Glu Ala
Glu Asp Val Gly Val Tyr Tyr Cys Phe Gln Gly 85 90 95Ser His Ile Pro
Tyr Thr 10038102PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 38Asp Val Leu Met Thr Gln Thr Pro
Leu Ser Leu Pro Val Ser Leu Gly1 5 10 15Asp Gln Ala Ser Ile Ser Cys
Arg Ser Ser Gln Ser Ile Val His Ser 20 25 30Asn Gly Asn Thr Tyr Leu
Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser 35 40 45Pro Lys Leu Leu Ile
Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60Asp Arg Phe Ser
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile65 70 75 80Ser Arg
Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln Gly 85 90 95Ser
His Ile Pro Tyr Thr 10039100PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 39Asp Ile Val Met Thr Gln
Thr Pro Leu Ser Leu Pro Val Thr Pro Gly1 5 10 15Glu Pro Ala Ser Ile
Ser Cys Xaa Ser Ser Gln Ser Xaa Xaa His Ser 20 25 30Xaa Gly Asn Xaa
Tyr Leu Xaa Trp Tyr Leu Gln Lys Pro Gly Gln Ser 35 40 45Pro Gln Leu
Leu Ile Tyr Lys Xaa Ser Xaa Xaa Xaa Ser Gly Val Pro 50 55 60Asp Arg
Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile65 70 75
80Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Phe Gln Xaa
85 90 95Xaa Xaa Xaa Pro 10040100PRTArtificial SequenceDescription
of Artificial Sequence Synthetic polypeptide 40Asp Val Val Met Thr
Gln Ser Pro Leu Ser Leu Pro Val Thr Leu Gly1 5 10 15Gln Pro Ala Ser
Ile Ser Cys Xaa Ser Ser Gln Ser Xaa Xaa His Ser 20 25 30Xaa Gly Asn
Xaa Tyr Leu Xaa Trp Phe Gln Gln Arg Pro Gly Gln Ser 35 40 45Pro Arg
Arg Leu Ile Tyr Lys Xaa Ser Xaa Xaa Xaa Ser Gly Val Pro 50 55 60Asp
Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile65 70 75
80Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Phe Gln Xaa
85 90 95Xaa Xaa Xaa Pro 10041100PRTArtificial SequenceDescription
of Artificial Sequence Synthetic polypeptide 41Asp Ile Val Met Thr
Gln Thr Pro Leu Ser Leu Ser Val Thr Pro Gly1 5 10 15Gln Pro Ala Ser
Ile Ser Cys Xaa Ser Ser Gln Ser Xaa Xaa His Ser 20 25 30Xaa Gly Asn
Xaa Tyr Leu Xaa Trp Tyr Leu Gln Lys Pro Gly Gln Ser 35 40 45Pro Gln
Leu Leu Ile Tyr Lys Xaa Ser Xaa Xaa Xaa Ser Gly Val Pro 50 55 60Asp
Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile65 70 75
80Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Phe Gln Xaa
85 90 95Xaa Xaa Xaa Pro 10042100PRTArtificial SequenceDescription
of Artificial Sequence Synthetic polypeptide 42Asp Ile Val Met Thr
Gln Thr Pro Leu Ser Leu Ser Val Thr Pro Gly1 5 10 15Gln Pro Ala Ser
Ile Ser Cys Xaa Ser Ser Gln Ser Xaa Xaa His Ser 20 25 30Xaa Gly Asn
Xaa Tyr Leu Xaa Trp Tyr Leu Gln Lys Pro Gly Gln Pro 35 40 45Pro Gln
Leu Leu Ile Tyr Lys Xaa Ser Xaa Xaa Xaa Ser Gly Val Pro 50 55 60Asp
Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile65 70 75
80Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Phe Gln Xaa
85 90 95Xaa Xaa Xaa Pro 10043100PRTArtificial SequenceDescription
of Artificial Sequence Synthetic polypeptide 43Asp Ile Val Met Thr
Gln Ser Pro Leu Ser Leu Pro Val Thr Pro Gly1 5 10 15Glu Pro Ala Ser
Ile Ser Cys Xaa Ser Ser Gln Ser Xaa Xaa His Ser 20 25 30Xaa Gly Asn
Xaa Tyr Leu Xaa Trp Tyr Leu Gln Lys Pro Gly Gln Ser 35 40 45Pro Gln
Leu Leu Ile Tyr Lys Xaa Ser Xaa Xaa Xaa Ser Gly Val
Pro 50 55 60Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
Lys Ile65 70 75 80Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr
Cys Phe Gln Xaa 85 90 95Xaa Xaa Xaa Pro 10044100PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
44Asp Ile Val Met Thr Gln Thr Pro Leu Ser Ser Pro Val Thr Leu Gly1
5 10 15Gln Pro Ala Ser Ile Ser Cys Xaa Ser Ser Gln Ser Xaa Xaa His
Ser 20 25 30Xaa Gly Asn Xaa Tyr Leu Xaa Trp Leu Gln Gln Arg Pro Gly
Gln Pro 35 40 45Pro Arg Leu Leu Ile Tyr Lys Xaa Ser Xaa Xaa Xaa Ser
Gly Val Pro 50 55 60Asp Arg Phe Ser Gly Ser Gly Ala Gly Thr Asp Phe
Thr Leu Lys Ile65 70 75 80Ser Arg Val Glu Ala Glu Asp Val Gly Val
Tyr Tyr Cys Phe Gln Xaa 85 90 95Xaa Xaa Xaa Pro
10045100PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 45Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu
Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Xaa Ser Ser
Gln Ser Xaa Xaa His Ser 20 25 30Xaa Gly Asn Xaa Tyr Leu Xaa Trp Tyr
Gln Gln Lys Pro Gly Lys Ala 35 40 45Pro Lys Leu Leu Ile Tyr Lys Xaa
Ser Xaa Xaa Xaa Ser Gly Val Pro 50 55 60Ser Arg Phe Ser Gly Ser Gly
Ser Gly Thr Asp Phe Thr Leu Thr Ile65 70 75 80Ser Ser Leu Gln Pro
Glu Asp Phe Ala Thr Tyr Tyr Cys Phe Gln Xaa 85 90 95Xaa Xaa Xaa Pro
10046100PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 46Asp Val Leu Met Thr Gln Thr Pro Leu Ser Leu
Pro Val Ser Leu Gly1 5 10 15Asp Gln Ala Ser Ile Ser Cys Xaa Ser Ser
Gln Ser Xaa Xaa His Ser 20 25 30Xaa Gly Asn Xaa Tyr Leu Xaa Trp Tyr
Leu Gln Lys Pro Gly Gln Ser 35 40 45Pro Lys Leu Leu Ile Tyr Lys Xaa
Ser Xaa Xaa Xaa Ser Gly Val Pro 50 55 60Asp Arg Phe Ser Gly Ser Gly
Ser Gly Thr Asp Phe Thr Leu Lys Ile65 70 75 80Ser Arg Val Glu Ala
Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln Xaa 85 90 95Xaa Xaa Xaa Pro
1004711PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 47Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg1 5
104810PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 48Gly Xaa Xaa Ile Lys Asp Thr Tyr Xaa His1 5
104917PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 49Xaa Ile Asp Pro Xaa Asn Asp Asn Ile Lys Tyr
Xaa Xaa Lys Phe Gln1 5 10 15Gly50109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
50Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1
5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Phe Asn Ile Lys Asp
Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu
Trp Met 35 40 45Gly Arg Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp
Pro Lys Phe 50 55 60Gln Gly Arg Val Thr Met Thr Arg Asp Thr Ser Ile
Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Arg Leu Arg Ser Asp Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp
Phe Phe Asp Tyr 100 10551109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 51Gln Val Gln Leu Val Gln
Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser
Cys Lys Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp
Val Arg Gln Ala Pro Gly Gln Arg Leu Glu Trp Met 35 40 45Gly Arg Ile
Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly
Arg Val Thr Ile Thr Arg Asp Thr Ser Ala Ser Thr Ala Tyr65 70 75
80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
10552109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 52Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val
Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly
Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Thr
Gly Gln Gly Leu Glu Trp Met 35 40 45Gly Arg Ile Asp Pro Ala Asn Asp
Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly Arg Val Thr Met Thr
Arg Asn Thr Ser Ile Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser
Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu
Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 10553109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
53Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1
5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Phe Asn Ile Lys Asp
Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu
Trp Met 35 40 45Gly Arg Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp
Pro Lys Phe 50 55 60Gln Gly Arg Val Thr Met Thr Thr Asp Thr Ser Thr
Ser Thr Ala Tyr65 70 75 80Met Glu Leu Arg Ser Leu Arg Ser Asp Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp
Phe Phe Asp Tyr 100 10554109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 54Gln Val Gln Leu Val Gln
Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser
Cys Lys Val Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Met 35 40 45Gly Arg Ile
Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly
Arg Val Thr Met Thr Glu Asp Thr Ser Thr Asp Thr Ala Tyr65 70 75
80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Thr Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
10555109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 55Gln Met Gln Leu Val Gln Ser Gly Ala Glu Val
Lys Lys Thr Gly Ser1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly
Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro
Gly Gln Ala Leu Glu Trp Met 35 40 45Gly Arg Ile Asp Pro Ala Asn Asp
Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly Arg Val Thr Ile Thr
Arg Asp Arg Ser Met Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser
Leu Arg Ser Glu Asp Thr Ala Met Tyr Tyr Cys 85 90 95Ala Arg Ser Glu
Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 10556109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
56Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1
5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Phe Asn Ile Lys Asp
Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu
Trp Met 35 40 45Gly Arg Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp
Pro Lys Phe 50 55 60Gln Gly Arg Val Thr Met Thr Arg Asp Thr Ser Thr
Ser Thr Val Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp
Phe Phe Asp Tyr 100 10557109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 57Gln Met Gln Leu Val Gln
Ser Gly Pro Glu Val Lys Lys Pro Gly Thr1 5 10 15Ser Val Lys Val Ser
Cys Lys Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp
Val Arg Gln Ala Arg Gly Gln Arg Leu Glu Trp Ile 35 40 45Gly Arg Ile
Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly
Arg Val Thr Ile Thr Arg Asp Met Ser Thr Ser Thr Ala Tyr65 70 75
80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Ala Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
10558109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 58Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Arg Ile Asp Pro Ala Asn Asp
Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu
Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 10559110PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
59Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Arg1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp
Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45Ser Arg Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp
Pro Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp
Thr Ala Leu Tyr Tyr Cys 85 90 95Ala Lys Asp Ser Glu Glu Asn Trp Tyr
Asp Phe Phe Asp Tyr 100 105 11060109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
60Gln Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp
Thr 20 25 30Tyr Ile His Trp Ile Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45Ser Arg Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp
Pro Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp
Phe Phe Asp Tyr 100 10561109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 61Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Gly Arg Ile
Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly
Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Asn Thr Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Thr Thr Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
10562109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 62Glu Val Gln Leu Val Glu Ser Gly Gly Gly Val
Val Arg Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Arg Ile Asp Pro Ala Asn Asp
Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Leu Tyr His Cys 85 90 95Ala Arg Ser Glu
Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 10563109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
63Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp
Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45Ser Arg Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp
Pro Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp
Phe Phe Asp Tyr 100 10564109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 64Glu Val Gln Leu Leu Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Arg Ile
Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Lys Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
10565109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 65Gln Val Gln Leu Val Glu Ser Gly Gly Gly Val
Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Arg Ile Asp Pro Ala Asn Asp
Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Ser Glu
Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 10566109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
66Gln Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp
Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45Ala Arg Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp
Pro Lys Phe 50 55 60Gln Gly Arg
Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu
Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90
95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
10567110PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 67Glu Val Gln Leu Val Glu Ser Gly Gly Val Val
Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Arg Ile Asp Pro Ala Asn Asp
Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ser Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Arg Thr Glu Asp Thr Ala Leu Tyr Tyr Cys 85 90 95Ala Lys Asp Ser
Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 105
11068109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 68Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Arg Ile Asp Pro Ala Asn Asp
Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Arg Asp Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu
Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 10569109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
69Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Arg1
5 10 15Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly Phe Asn Ile Lys Asp
Thr 20 25 30Tyr Ile His Trp Phe Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45Gly Arg Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp
Pro Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser Arg Asp Gly Ser Lys
Ser Ile Ala Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Thr Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Thr Arg Ser Glu Glu Asn Trp Tyr Asp
Phe Phe Asp Tyr 100 10570109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 70Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Tyr Val 35 40 45Ser Arg Ile
Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75
80Leu Gln Met Gly Ser Leu Arg Ala Glu Asp Met Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
10571109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 71Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Ile 35 40 45Gly Arg Ile Asp Pro Ala Asn Asp
Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu
Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 10572109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
72Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp
Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45Ala Arg Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp
Pro Lys Phe 50 55 60Gln Gly Lys Ala Thr Ile Ser Arg Asp Asn Ala Lys
Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp
Phe Phe Asp Tyr 100 10573109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 73Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Arg Ile
Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly
Arg Phe Thr Ile Ser Ala Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
10574109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 74Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45Gly Arg Ile Asp Pro Ala Asn Asp
Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu
Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 10575109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
75Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp
Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45Ala Arg Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp
Pro Lys Phe 50 55 60Gln Gly Lys Ala Thr Ile Ser Ala Asp Asn Ala Lys
Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp
Phe Phe Asp Tyr 100 10576109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 76Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45Gly Arg Ile
Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly
Arg Phe Thr Ile Ser Ala Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
10577109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 77Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45Gly Arg Ile Asp Pro Ala Asn Asp
Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser
Ala Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu
Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 10578109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
78Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp
Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45Ala Arg Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp
Pro Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Ser Ala Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp
Phe Phe Asp Tyr 100 10579109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 79Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Gly Arg Ile
Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly
Arg Phe Thr Ile Ser Ala Asp Asn Ala Lys Asn Ser Ala Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
10580109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 80Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Ile 35 40 45Gly Arg Ile Asp Pro Ala Asn Asp
Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser
Ala Asp Asn Ala Lys Asn Ser Ala Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu
Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 10581109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
81Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Thr Gly Ser Gly Phe Asn Ile Lys Asp
Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Ile 35 40 45Gly Arg Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp
Pro Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser Ala Asp Asn Ala Lys
Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp
Phe Phe Asp Tyr 100 10582109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 82Glu Val Gln Leu Gln Gln
Ser Gly Ala Glu Leu Val Lys Pro Gly Ala1 5 10 15Ser Val Lys Leu Ser
Cys Thr Gly Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp
Val Lys Gln Arg Pro Glu Gln Gly Leu Glu Trp Ile 35 40 45Gly Arg Ile
Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly
Lys Ala Thr Ile Thr Ala Asp Thr Ser Ser Asn Thr Ala Tyr65 70 75
80Leu Gln Leu Asn Ser Leu Thr Ser Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
10583109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 83Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val
Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly
Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala Pro
Gly Gln Gly Leu Glu Trp Met 35 40 45Gly Xaa Ile Asp Pro Xaa Asn Asp
Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln Gly Arg Val Thr Met Thr
Arg Asp Thr Ser Ile Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Arg
Leu Arg Ser Asp Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu
Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 10584109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
84Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1
5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Xaa Xaa Ile Lys Asp
Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala Pro Gly Gln Arg Leu Glu
Trp Met 35 40 45Gly Xaa Ile Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa
Xaa Lys Phe 50 55 60Gln Gly Arg Val Thr Ile Thr Arg Asp Thr Ser Ala
Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp
Phe Phe Asp Tyr 100 10585109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 85Gln Val Gln Leu Val Gln
Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser
Cys Lys Ala Ser Gly Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His Trp
Val Arg Gln Ala Thr Gly Gln Gly Leu Glu Trp Met 35 40 45Gly Xaa Ile
Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln Gly
Arg Val Thr Met Thr Arg Asn Thr Ser Ile Ser Thr Ala Tyr65 70 75
80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
10586109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 86Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val
Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly
Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala Pro
Gly Gln Gly Leu Glu Trp Met 35 40 45Gly Xaa Ile Asp Pro Xaa Asn Asp
Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln Gly Arg Val Thr Met Thr
Thr Asp Thr Ser Thr Ser Thr Ala Tyr65 70 75 80Met Glu Leu Arg Ser
Leu Arg Ser Asp Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu
Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 10587109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic
polypeptide
87Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1
5 10 15Ser Val Lys Val Ser Cys Lys Val Ser Gly Xaa Xaa Ile Lys Asp
Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Met 35 40 45Gly Xaa Ile Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa
Xaa Lys Phe 50 55 60Gln Gly Arg Val Thr Met Thr Glu Asp Thr Ser Thr
Asp Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Thr Ser Glu Glu Asn Trp Tyr Asp
Phe Phe Asp Tyr 100 10588109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 88Gln Met Gln Leu Val Gln
Ser Gly Ala Glu Val Lys Lys Thr Gly Ser1 5 10 15Ser Val Lys Val Ser
Cys Lys Ala Ser Gly Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His Trp
Val Arg Gln Ala Pro Gly Gln Ala Leu Glu Trp Met 35 40 45Gly Xaa Ile
Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln Gly
Arg Val Thr Ile Thr Arg Asp Arg Ser Met Ser Thr Ala Tyr65 70 75
80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Met Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
10589109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 89Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val
Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly
Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala Pro
Gly Gln Gly Leu Glu Trp Met 35 40 45Gly Xaa Ile Asp Pro Xaa Asn Asp
Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln Gly Arg Val Thr Met Thr
Arg Asp Thr Ser Thr Ser Thr Val Tyr65 70 75 80Met Glu Leu Ser Ser
Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu
Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 10590109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
90Gln Met Gln Leu Val Gln Ser Gly Pro Glu Val Lys Lys Pro Gly Thr1
5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Xaa Xaa Ile Lys Asp
Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala Arg Gly Gln Arg Leu Glu
Trp Ile 35 40 45Gly Xaa Ile Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa
Xaa Lys Phe 50 55 60Gln Gly Arg Val Thr Ile Thr Arg Asp Met Ser Thr
Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Ser Glu Glu Asn Trp Tyr Asp
Phe Phe Asp Tyr 100 10591109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 91Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Xaa Ile
Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
10592110PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 92Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Xaa Ile Asp Pro Xaa Asn Asp
Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Leu Tyr Tyr Cys 85 90 95Ala Lys Asp Ser
Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 105
11093109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 93Gln Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Lys Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His Trp Ile Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Xaa Ile Asp Pro Xaa Asn Asp
Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu
Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 10594109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
94Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Xaa Xaa Ile Lys Asp
Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45Gly Xaa Ile Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa
Xaa Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys
Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Thr Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Thr Thr Ser Glu Glu Asn Trp Tyr Asp
Phe Phe Asp Tyr 100 10595109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 95Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Val Val Arg Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Xaa Ile
Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Leu Tyr His Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
10596109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 96Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Lys Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Xaa Ile Asp Pro Xaa Asn Asp
Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu
Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 10597109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
97Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Xaa Xaa Ile Lys Asp
Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45Ser Xaa Ile Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa
Xaa Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys
Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Ser Glu Glu Asn Trp Tyr Asp
Phe Phe Asp Tyr 100 10598109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 98Gln Val Gln Leu Val Glu
Ser Gly Gly Gly Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Xaa Ile
Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Lys Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
10599109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 99Gln Val Gln Leu Val Glu Ser Gly Gly Gly Val
Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Xaa Ile Asp Pro Xaa Asn Asp
Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu
Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 105100110PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
100Glu Val Gln Leu Val Glu Ser Gly Gly Val Val Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Xaa Xaa Ile Lys Asp
Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45Ser Xaa Ile Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa
Xaa Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys
Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Thr Glu Asp
Thr Ala Leu Tyr Tyr Cys 85 90 95Ala Lys Asp Ser Glu Glu Asn Trp Tyr
Asp Phe Phe Asp Tyr 100 105 110101109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
101Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Xaa Xaa Ile Lys Asp
Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45Ser Xaa Ile Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa
Xaa Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Asp Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp
Phe Phe Asp Tyr 100 105102109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 102Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu
Ser Cys Thr Ala Ser Gly Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His
Trp Phe Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Gly Xaa
Ile Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln
Gly Arg Phe Thr Ile Ser Arg Asp Gly Ser Lys Ser Ile Ala Tyr65 70 75
80Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Thr Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
105103109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 103Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Tyr Val 35 40 45Ser Xaa Ile Asp Pro Xaa Asn
Asp Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Gly
Ser Leu Arg Ala Glu Asp Met Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser
Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 105104109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
104Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Xaa Xaa Ile Lys Asp
Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Ile 35 40 45Gly Xaa Ile Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa
Xaa Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp
Phe Phe Asp Tyr 100 105105109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 105Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Xaa
Ile Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln
Gly Lys Ala Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
105106109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 106Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Xaa Ile Asp Pro Xaa Asn
Asp Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile
Ser Ala Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser
Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 105107109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
107Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Xaa Xaa Ile Lys Asp
Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45Gly Xaa Ile Asp Pro Xaa Asn Asp Asn
Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser Arg
Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu
Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu Glu
Asn Trp Tyr Asp Phe Phe Asp Tyr 100 105108109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
108Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Xaa Xaa Ile Lys Asp
Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45Ala Xaa Ile Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa
Xaa Lys Phe 50 55 60Gln Gly Lys Ala Thr Ile Ser Ala Asp Asn Ala Lys
Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp
Phe Phe Asp Tyr 100 105109109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 109Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45Gly Xaa
Ile Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln
Gly Arg Phe Thr Ile Ser Ala Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
105110109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 110Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Gly Xaa Ile Asp Pro Xaa Asn
Asp Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile
Ser Ala Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser
Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 105111109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
111Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Xaa Xaa Ile Lys Asp
Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45Ala Xaa Ile Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa
Xaa Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Ser Ala Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp
Phe Phe Asp Tyr 100 105112109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 112Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Gly Xaa
Ile Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln
Gly Arg Phe Thr Ile Ser Ala Asp Asn Ala Lys Asn Ser Ala Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
105113109PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 113Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45Gly Xaa Ile Asp Pro Xaa Asn
Asp Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile
Ser Ala Asp Asn Ala Lys Asn Ser Ala Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser
Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100 105114109PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
114Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Thr Gly Ser Gly Xaa Xaa Ile Lys Asp
Thr 20 25 30Tyr Xaa His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Ile 35 40 45Gly Xaa Ile Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa
Xaa Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile Ser Ala Asp Asn Ala Lys
Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp
Phe Phe Asp Tyr 100 105115109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 115Glu Val Gln Leu Gln
Gln Ser Gly Ala Glu Leu Val Lys Pro Gly Ala1 5 10 15Ser Val Lys Leu
Ser Cys Thr Gly Ser Gly Xaa Xaa Ile Lys Asp Thr 20 25 30Tyr Xaa His
Trp Val Lys Gln Arg Pro Glu Gln Gly Leu Glu Trp Ile 35 40 45Gly Xaa
Ile Asp Pro Xaa Asn Asp Asn Ile Lys Tyr Xaa Xaa Lys Phe 50 55 60Gln
Gly Lys Ala Thr Ile Thr Ala Asp Thr Ser Ser Asn Thr Ala Tyr65 70 75
80Leu Gln Leu Asn Ser Leu Thr Ser Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 100
10511611PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 116Trp Gly Gln Gly Thr Thr Leu Thr Val Ser Ser1 5
1011711PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 117Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser1 5
1011811PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 118Gln Ala Ser Gln Gly Thr Ser Ile Asn Leu Asn1 5
101197PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 119Gly Ala Ser Asn Leu Glu Asp1
51209PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 120Leu Gln His Ser Tyr Leu Pro Trp Thr1
512110PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 121Gly Phe Ser Leu Thr Gly Tyr Gly Val Asn1 5
1012214PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 122Ile Ile Trp Gly Asp Gly Ser Thr Asp Tyr Asn
Ser Ala Leu1 5 1012316PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 123Asp Lys Thr Phe Tyr Tyr
Asp Gly Phe Tyr Arg Gly Arg Met Asp Tyr1 5 10 15124113PRTHomo
sapiens 124Pro Gly Pro Val Pro Pro Ser Thr Ala Leu Arg Glu Leu Ile
Glu Glu1 5 10 15Leu Val Asn Ile Thr Gln Asn Gln Lys Ala Pro Leu Cys
Asn Gly Ser 20 25 30Met Val Trp Ser Ile Asn Leu Thr Ala Gly Met Tyr
Cys Ala Ala Leu 35 40 45Glu Ser Leu Ile Asn Val Ser Gly Cys Ser Ala
Ile Glu Lys Thr Gln 50 55 60Arg Met Leu Ser Gly Phe Cys Pro His Lys
Val Ser Ala Gly Gln Phe65 70 75 80Ser Ser Leu His Val Arg Asp Thr
Lys Ile Glu Val Ala Gln Phe Val 85 90 95Lys Asp Leu Leu Leu His Leu
Lys Lys Leu Phe Arg Glu Gly Arg Phe 100 105 110Asn125427PRTHomo
sapiens 125Met Glu Trp Pro Ala Arg Leu Cys Gly Leu Trp Ala Leu Leu
Leu Cys1 5 10 15Ala Gly Gly Gly Gly Gly Gly Gly Gly Ala Ala Pro Thr
Glu Thr Gln 20 25 30Pro Pro Val Thr Asn Leu Ser Val Ser Val Glu Asn
Leu Cys Thr Val 35 40 45Ile Trp Thr Trp Asn Pro Pro Glu Gly Ala Ser
Ser Asn Cys Ser Leu 50 55 60Trp Tyr Phe Ser His Phe Gly Asp Lys Gln
Asp Lys Lys Ile Ala Pro65 70 75 80Glu Thr Arg Arg Ser Ile Glu Val
Pro Leu Asn Glu Arg Ile Cys Leu 85 90 95Gln Val Gly Ser Gln Cys Ser
Thr Asn Glu Ser Glu Lys Pro Ser Ile 100 105 110Leu Val Glu Lys Cys
Ile Ser Pro Pro Glu Gly Asp Pro Glu Ser Ala 115 120 125Val Thr Glu
Leu Gln Cys Ile Trp His Asn Leu Ser Tyr Met Lys Cys 130 135 140Ser
Trp Leu Pro Gly Arg Asn Thr Ser Pro Asp Thr Asn Tyr Thr Leu145 150
155 160Tyr Tyr Trp His Arg Ser Leu Glu Lys Ile His Gln Cys Glu Asn
Ile 165 170 175Phe Arg Glu Gly Gln Tyr Phe Gly Cys Ser Phe Asp Leu
Thr Lys Val 180 185 190Lys Asp Ser Ser Phe Glu Gln His Ser Val Gln
Ile Met Val Lys Asp 195 200 205Asn Ala Gly Lys Ile Lys Pro Ser Phe
Asn Ile Val Pro Leu Thr Ser 210 215 220Arg Val Lys Pro Asp Pro Pro
His Ile Lys Asn Leu Ser Phe His Asn225 230 235 240Asp Asp Leu Tyr
Val Gln Trp Glu Asn Pro Gln Asn Phe Ile Ser Arg 245 250 255Cys Leu
Phe Tyr Glu Val Glu Val Asn Asn Ser Gln Thr Glu Thr His 260 265
270Asn Val Phe Tyr Val Gln Glu Ala Lys Cys Glu Asn Pro Glu Phe Glu
275 280 285Arg Asn Val Glu Asn Thr Ser Cys Phe Met Val Pro Gly Val
Leu Pro 290 295 300Asp Thr Leu Asn Thr Val Arg Ile Arg Val Lys Thr
Asn Lys Leu Cys305 310 315 320Tyr Glu Asp Asp Lys Leu Trp Ser Asn
Trp Ser Gln Glu Met Ser Ile 325 330 335Gly Lys Lys Arg Asn Ser Thr
Leu Tyr Ile Thr Met Leu Leu Ile Val 340 345 350Pro Val Ile Val Ala
Gly Ala Ile Ile Val Leu Leu Leu Tyr Leu Lys 355 360 365Arg Leu Lys
Ile Ile Ile Phe Pro Pro Ile Pro Asp Pro Gly Lys Ile 370 375 380Phe
Lys Glu Met Phe Gly Asp Gln Asn Asp Asp Thr Leu His Trp Lys385 390
395 400Lys Tyr Asp Ile Tyr Glu Lys Gln Thr Lys Glu Glu Thr Asp Ser
Val 405 410 415Val Leu Ile Glu Asn Leu Lys Lys Ala Ser Gln 420
425126101PRTHomo sapiens 126Asp Val Val Met Thr Gln Ser Pro Leu Ser
Leu Pro Val Thr Leu Gly1 5 10 15Gln Pro Ala Ser Ile Ser Cys Arg Ser
Ser Gln Ser Leu Val Tyr Ser 20 25 30Asp Gly Asn Thr Tyr Leu Asn Trp
Phe Gln Gln Arg Pro Gly Gln Ser 35 40 45Pro Arg Arg Leu Ile Tyr Lys
Val Ser Asn Arg Asp Ser Gly Val Pro 50 55 60Asp Arg Phe Ser Gly Ser
Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile65 70 75 80Ser Arg Val Glu
Ala Glu Asp Val Gly Val Tyr Tyr Cys Met Gln Gly 85 90 95Thr His Trp
Pro Pro 10012720PRTMacaca fascicularis 127Met Ala Leu Leu Leu Thr
Met Val Ile Ala Leu Thr Cys Leu Gly Gly1 5 10 15Phe Ala Ser Pro
20128329PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 128Ser Thr Lys Gly Pro Ser Val Phe Pro Leu
Ala Pro Ser Ser Lys Ser1 5 10 15Thr Ser Gly Gly Thr Ala Ala Leu Gly
Cys Leu Val Lys Asp Tyr Phe 20 25 30Pro Glu Pro Val Thr Val Ser Trp
Asn Ser Gly Ala Leu Thr Ser Gly 35 40 45Val His Thr Phe Pro Ala Val
Leu Gln Ser Ser Gly Leu Tyr Ser Leu 50 55 60Ser Ser Val Val Thr Val
Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr65 70 75 80Ile Cys Asn Val
Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys 85 90 95Val Glu Pro
Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro 100 105 110Ala
Pro Glu Ala Leu Gly Ala Pro Ser Val Phe Leu Phe Pro Pro Lys 115 120
125Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val
130 135 140Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn
Trp Tyr145 150 155 160Val Asp Gly Val Glu Val His Asn Ala Lys Thr
Lys Pro Arg Glu Glu 165 170 175Gln Tyr Asn Ser Thr Tyr Arg Val Val
Ser Val Leu Thr Val Leu His 180 185 190Gln Asp Trp Leu Asn Gly Lys
Glu Tyr Lys Cys Lys Val Ser Asn Lys 195 200 205Ala Leu Pro Ala Pro
Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln 210 215 220Pro Arg Glu
Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met225 230 235
240Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro
245 250 255Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu
Asn Asn 260 265 270Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly
Ser Phe Phe Leu 275 280 285Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg
Trp Gln Gln Gly Asn Val 290 295 300Phe Ser Cys Ser Val Met His Glu
Ala Leu His Asn His Tyr Thr Gln305 310 315 320Lys Ser Leu Ser Leu
Ser Pro Gly Lys 325129360DNAMus musculus 129gaggttcagc tgcagcagtc
tggggcagag cttgtgaagc caggggcctc agtcaagttg 60tcctgcacag gttctggctt
caacattaaa gacacctata tacactgggt gaagcagagg 120cctgaacagg
gcctggagtg gattggaagg attgatcctg cgaatgataa tattaaatat
180gacccgaagt tccagggcaa ggccactata acagcagaca catcctccaa
cacagcctac 240ctacagctca acagcctgac atctgaggac actgccgtct
attactgtgc tagatctgag 300gaaaattggt acgacttttt tgactactgg
ggccaaggca ccactctcac agtctcctca 360130120PRTMus musculus 130Glu
Val Gln Leu Gln Gln Ser Gly Ala Glu Leu Val Lys Pro Gly Ala1 5 10
15Ser Val Lys Leu Ser Cys Thr Gly Ser Gly Phe Asn Ile Lys Asp Thr
20 25 30Tyr Ile His Trp Val Lys Gln Arg Pro Glu Gln Gly Leu Glu Trp
Ile 35 40 45Gly Arg Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro
Lys Phe 50 55 60Gln Gly Lys Ala Thr Ile Thr Ala Asp Thr Ser Ser Asn
Thr Ala Tyr65 70 75 80Leu Gln Leu Asn Ser Leu Thr Ser Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe
Phe Asp Tyr Trp Gly Gln 100 105 110Gly Thr Thr Leu Thr Val Ser Ser
115 12013119PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 131Met Lys Cys Ser Trp Val Ile Phe Phe
Leu Met Ala Val Val Thr Gly1 5 10 15Val Asn Ser132336DNAMus
musculus 132gatgttttga tgacccaaac tccactctcc ctgcctgtca gtcttggaga
tcaagcctcc 60atctcttgca ggtctagtca gagcattgta catagtaatg gaaacaccta
tttagaatgg 120tacctgcaga aaccaggcca gtctccaaag
ctcctgatct acaaagtttc caaccgattt 180tctggggtcc cagacaggtt
cagtggcagt ggatcaggga cagatttcac actcaagatt 240agcagagtgg
aggctgagga tctgggagtt tattactgct ttcaaggttc acatattccg
300tacacgttcg gaggggggac caagctggaa ataaaa 336133112PRTMus musculus
133Asp Val Leu Met Thr Gln Thr Pro Leu Ser Leu Pro Val Ser Leu Gly1
5 10 15Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val His
Ser 20 25 30Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly
Gln Ser 35 40 45Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser
Gly Val Pro 50 55 60Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe
Thr Leu Lys Ile65 70 75 80Ser Arg Val Glu Ala Glu Asp Leu Gly Val
Tyr Tyr Cys Phe Gln Gly 85 90 95Ser His Ile Pro Tyr Thr Phe Gly Gly
Gly Thr Lys Leu Glu Ile Lys 100 105 11013419PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 134Met
Lys Leu Pro Val Arg Leu Leu Val Leu Met Phe Trp Ile Pro Ala1 5 10
15Ser Ser Ser135429DNAMus musculus 135atggctgtcc tggcattact
cttctgcctg gtaacattcc caagctgtat cctttcccag 60gtgcagctga aggagtcagg
acctggcctg gtggcgccct cacagagcct gtccatcaca 120tgcaccgtct
cagggttctc attaaccggc tatggtgtaa actgggttcg ccagcctcca
180ggaaagggtc tggagtggct gggaataatt tggggtgatg gaagcacaga
ctataattca 240gctctcaaat ccagactgat catcaacaag gacaactcca
agagccaagt tttcttaaaa 300atgaacagtc tgcaaactga tgacacagcc
aggtacttct gtgccagaga taagactttt 360tactacgatg gtttctacag
gggcaggatg gactactggg gtcaaggaac ctcagtcacc 420gtctcctca
429136124PRTMus musculus 136Gln Val Gln Leu Lys Glu Ser Gly Pro Gly
Leu Val Ala Pro Ser Gln1 5 10 15Ser Leu Ser Ile Thr Cys Thr Val Ser
Gly Phe Ser Leu Thr Gly Tyr 20 25 30Gly Val Asn Trp Val Arg Gln Pro
Pro Gly Lys Gly Leu Glu Trp Leu 35 40 45Gly Ile Ile Trp Gly Asp Gly
Ser Thr Asp Tyr Asn Ser Ala Leu Lys 50 55 60Ser Arg Leu Ile Ile Asn
Lys Asp Asn Ser Lys Ser Gln Val Phe Leu65 70 75 80Lys Met Asn Ser
Leu Gln Thr Asp Asp Thr Ala Arg Tyr Phe Cys Ala 85 90 95Arg Asp Lys
Thr Phe Tyr Tyr Asp Gly Phe Tyr Arg Gly Arg Met Asp 100 105 110Tyr
Trp Gly Gln Gly Thr Ser Val Thr Val Ser Ser 115
12013719PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 137Met Ala Val Leu Ala Leu Leu Phe Cys Leu Val
Thr Phe Pro Ser Cys1 5 10 15Ile Leu Ser138387DNAMus musculus
138atgaacacga gggcccctgc tgagttcctt gggttcctgt tgctctggtt
tttaggtgcc 60agatgtgatg tccagatgat tcagtctcca tcctccctgt ctgcatcttt
gggagacatt 120gtcaccatga cttgccaggc aagtcagggc actagcatta
atttaaactg gtttcagcaa 180aaaccaggga aagctcctaa gctcctgatc
tttggtgcaa gcaacttgga agatggggtc 240ccatcaaggt tcagtggcag
tagatatggg acaaatttca ctctcaccat cagcagcctg 300gaggatgaag
atatggcaac ttatttctgt ctacagcata gttatctccc gtggacgttc
360ggtggcggca ccaaactgga aatcaaa 387139107PRTMus musculus 139Asp
Val Gln Met Ile Gln Ser Pro Ser Ser Leu Ser Ala Ser Leu Gly1 5 10
15Asp Ile Val Thr Met Thr Cys Gln Ala Ser Gln Gly Thr Ser Ile Asn
20 25 30Leu Asn Trp Phe Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu
Ile 35 40 45Phe Gly Ala Ser Asn Leu Glu Asp Gly Val Pro Ser Arg Phe
Ser Gly 50 55 60Ser Arg Tyr Gly Thr Asn Phe Thr Leu Thr Ile Ser Ser
Leu Glu Asp65 70 75 80Glu Asp Met Ala Thr Tyr Phe Cys Leu Gln His
Ser Tyr Leu Pro Trp 85 90 95Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile
Lys 100 10514022PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 140Met Asn Thr Arg Ala Pro Ala Glu Phe
Leu Gly Phe Leu Leu Leu Trp1 5 10 15Phe Leu Gly Ala Arg Cys
20141329PRTHomo sapiens 141Ser Thr Lys Gly Pro Ser Val Phe Pro Leu
Ala Pro Ser Ser Lys Ser1 5 10 15Thr Ser Gly Gly Thr Ala Ala Leu Gly
Cys Leu Val Lys Asp Tyr Phe 20 25 30Pro Glu Pro Val Thr Val Ser Trp
Asn Ser Gly Ala Leu Thr Ser Gly 35 40 45Val His Thr Phe Pro Ala Val
Leu Gln Ser Ser Gly Leu Tyr Ser Leu 50 55 60Ser Ser Val Val Thr Val
Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr65 70 75 80Ile Cys Asn Val
Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys 85 90 95Val Glu Pro
Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro 100 105 110Ala
Pro Glu Ala Leu Gly Ala Pro Ser Val Phe Leu Phe Pro Pro Lys 115 120
125Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val
130 135 140Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn
Trp Tyr145 150 155 160Val Asp Gly Val Glu Val His Asn Ala Lys Thr
Lys Pro Arg Glu Glu 165 170 175Gln Tyr Asn Ser Thr Tyr Arg Val Val
Ser Val Leu Thr Val Leu His 180 185 190Gln Asp Trp Leu Asn Gly Lys
Glu Tyr Lys Cys Lys Val Ser Asn Lys 195 200 205Ala Leu Pro Ala Pro
Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln 210 215 220Pro Arg Glu
Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met225 230 235
240Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro
245 250 255Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu
Asn Asn 260 265 270Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly
Ser Phe Phe Leu 275 280 285Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg
Trp Gln Gln Gly Asn Val 290 295 300Phe Ser Cys Ser Val Met His Glu
Ala Leu His Asn His Tyr Thr Gln305 310 315 320Lys Ser Leu Ser Leu
Ser Pro Gly Lys 325142417DNAMus musculus 142atgaaatgca gctgggttat
cttcttcctg atggcagtgg ttacaggggt caattcagag 60gttcagctgc agcagtctgg
ggcagagctt gtgaagccag gggcctcagt caagttgtcc 120tgcacaggtt
ctggcttcaa cattaaagac acctatatac actgggtgaa gcagaggcct
180gaacagggcc tggagtggat tggaaggatt gatcctgcga atgataatat
taaatatgac 240ccgaagttcc agggcaaggc cactataaca gcagacacat
cctccaacac agcctaccta 300cagctcaaca gcctgacatc tgaggacact
gccgtctatt actgtgctag atctgaggaa 360aattggtacg acttttttga
ctactggggc caaggcacca ctctcacagt ctcctca 417143139PRTMus musculus
143Met Lys Cys Ser Trp Val Ile Phe Phe Leu Met Ala Val Val Thr Gly1
5 10 15Val Asn Ser Glu Val Gln Leu Gln Gln Ser Gly Ala Glu Leu Val
Lys 20 25 30Pro Gly Ala Ser Val Lys Leu Ser Cys Thr Gly Ser Gly Phe
Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Lys Gln Arg Pro Glu
Gln Gly Leu 50 55 60Glu Trp Ile Gly Arg Ile Asp Pro Ala Asn Asp Asn
Ile Lys Tyr Asp65 70 75 80Pro Lys Phe Gln Gly Lys Ala Thr Ile Thr
Ala Asp Thr Ser Ser Asn 85 90 95Thr Ala Tyr Leu Gln Leu Asn Ser Leu
Thr Ser Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ala Arg Ser Glu
Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 115 120 125Trp Gly Gln Gly Thr
Thr Leu Thr Val Ser Ser 130 135144393DNAMus musculus 144atgaagttgc
ctgttaggct gttggtgctg atgttctgga ttcctgcttc cagcagtgat 60gttttgatga
cccaaactcc actctccctg cctgtcagtc ttggagatca agcctccatc
120tcttgcaggt ctagtcagag cattgtacat agtaatggaa acacctattt
agaatggtac 180ctgcagaaac caggccagtc tccaaagctc ctgatctaca
aagtttccaa ccgattttct 240ggggtcccag acaggttcag tggcagtgga
tcagggacag atttcacact caagattagc 300agagtggagg ctgaggatct
gggagtttat tactgctttc aaggttcaca tattccgtac 360acgttcggag
gggggaccaa gctggaaata aaa 393145131PRTMus musculus 145Met Lys Leu
Pro Val Arg Leu Leu Val Leu Met Phe Trp Ile Pro Ala1 5 10 15Ser Ser
Ser Asp Val Leu Met Thr Gln Thr Pro Leu Ser Leu Pro Val 20 25 30Ser
Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile 35 40
45Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro
50 55 60Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe
Ser65 70 75 80Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr
Asp Phe Thr 85 90 95Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly
Val Tyr Tyr Cys 100 105 110Phe Gln Gly Ser His Ile Pro Tyr Thr Phe
Gly Gly Gly Thr Lys Leu 115 120 125Glu Ile Lys
130146417DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 146atggattgga cctggcgcat cctgttcctg
gtggccgctg ccaccggcgc tcactctcag 60gtgcagctgg tgcagtctgg cgccgaggtg
aagaagcctg gcgcttccgt gaaggtgtcc 120tgtaaggcct ccggcttcaa
catcaaggac acctacatcc actgggtgcg gcaggctccc 180ggccagcggc
tggagtggat gggccggatc gatcctgcca acgacaacat caagtacgac
240cccaagtttc agggccgcgt gaccatcacc cgcgatacct ccgcttctac
cgcctacatg 300gagctgtcta gcctgcggag cgaggatacc gccgtgtact
actgcgcccg ctccgaggag 360aactggtacg acttcttcga ctactggggc
cagggcaccc tggtgaccgt gtcctct 417147144PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
147Met Asp Trp Thr Trp Arg Ile Leu Phe Leu Val Ala Ala Ala Thr Gly1
5 10 15Ala His Ser Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys
Lys 20 25 30Pro Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly Phe
Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly
Gln Arg Leu 50 55 60Glu Trp Met Gly Arg Ile Asp Pro Ala Asn Asp Asn
Ile Lys Tyr Asp65 70 75 80Pro Lys Phe Gln Gly Arg Val Thr Ile Thr
Arg Asp Thr Ser Ala Ser 85 90 95Thr Ala Tyr Met Glu Leu Ser Ser Leu
Arg Ser Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ala Arg Ser Glu
Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 115 120 125Trp Gly Gln Gly Thr
Leu Val Thr Val Ser Ser Gly Glu Ser Cys Arg 130 135
140148396DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 148atgcggctgc ccgctcagct gctgggcctg
ctgatgctgt gggtgcccgg ctcttccggc 60gacgtggtga tgacccagtc ccctctgtct
ctgcccgtga ccctgggcca gcccgcttct 120atctcttgcc ggtcctccca
gtccatcgtg cactccaacg gcaacaccta cctggagtgg 180tttcagcaga
gacccggcca gtctcctcgg cggctgatct acaaggtgtc caaccgcttt
240tccggcgtgc ccgatcggtt ctccggcagc ggctccggca ccgatttcac
cctgaagatc 300agccgcgtgg aggccgagga tgtgggcgtg tactactgct
tccagggctc ccacatccct 360tacacctttg gcggcggaac caaggtggag atcaag
396149132PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 149Met Arg Leu Pro Ala Gln Leu Leu Gly Leu
Leu Met Leu Trp Val Pro1 5 10 15Gly Ser Ser Gly Asp Val Val Met Thr
Gln Ser Pro Leu Ser Leu Pro 20 25 30Val Thr Leu Gly Gln Pro Ala Ser
Ile Ser Cys Arg Ser Ser Gln Ser 35 40 45Ile Val His Ser Asn Gly Asn
Thr Tyr Leu Glu Trp Phe Gln Gln Arg 50 55 60Pro Gly Gln Ser Pro Arg
Arg Leu Ile Tyr Lys Val Ser Asn Arg Phe65 70 75 80Ser Gly Val Pro
Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe 85 90 95Thr Leu Lys
Ile Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr 100 105 110Cys
Phe Gln Gly Ser His Ile Pro Tyr Thr Phe Gly Gly Gly Thr Lys 115 120
125Val Glu Ile Lys 130150417DNAArtificial SequenceDescription of
Artificial Sequence Synthetic polynucleotide 150atggagctgg
gcctgtcttg ggtgttcctg gtggctatcc tggagggcgt gcagtgcgag 60gtgcagctgg
tggagtctgg cggcggactg gtgcagcctg gcggctctct gcggctgtct
120tgcgccgctt ccggcttcaa catcaaggac acctacatcc actgggtgcg
gcaggctccc 180ggcaagggcc tggagtgggt ggcccggatc gatcctgcca
acgacaacat caagtacgac 240cccaagttcc agggccggtt caccatctct
cgcgacaacg ccaagaactc cctgtacctc 300cagatgaact ctctgcgcgc
cgaggatacc gccgtgtact actgcgcccg gagcgaggag 360aactggtacg
acttcttcga ctactggggc cagggcaccc tggtgaccgt gtcctct
417151139PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 151Met Glu Leu Gly Leu Ser Trp Val Phe Leu
Val Ala Ile Leu Glu Gly1 5 10 15Val Gln Cys Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Arg Ile
Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp65 70 75 80Pro Lys Phe Gln
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn 85 90 95Ser Leu Tyr
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr
Tyr Cys Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr 115 120
125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 130
135152405DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 152atggatatgc gcgtgcccgc tcagctgctg
ggcctgctgc tgctgtggct gcgcggagcc 60cgctgcgata tccagatgac ccagtcccct
tcttctctgt ccgcctctgt gggcgatcgc 120gtgaccatca cctgtcggtc
ctcccagtcc atcgtgcact ccaacggcaa cacctacctg 180gagtggtatc
agcagaagcc cggcaaggcc cctaagctgc tgatctacaa ggtgtccaac
240cgcttttccg gcgtgccttc tcggttctcc ggctccggct ccggcaccga
tttcaccctg 300accatctcct ccctccagcc cgaggatttc gccacctact
actgcttcca gggctcccac 360atcccttaca cctttggcgg cggaaccaag
gtggagatca agcgt 405153135PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 153Met Asp Met Arg Val
Pro Ala Gln Leu Leu Gly Leu Leu Leu Leu Trp1 5 10 15Leu Arg Gly Ala
Arg Cys Asp Ile Gln Met Thr Gln Ser Pro Ser Ser 20 25 30Leu Ser Ala
Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ser Ser 35 40 45Gln Ser
Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Gln 50 55 60Gln
Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn65 70 75
80Arg Phe Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr
85 90 95Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala
Thr 100 105 110Tyr Tyr Cys Phe Gln Gly Ser His Ile Pro Tyr Thr Phe
Gly Gly Gly 115 120 125Thr Lys Val Glu Ile Lys Arg 130
135154360DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 154gaggtgcagc tggtggagtc tggcggcgga
ctggtgcagc ctggcggctc tctgcggctg 60tcttgcgccg cttccggctt caacatcaag
gacacctaca tccactgggt gcggcaggct 120cccggcaagg gcctggagtg
gatcggccgg atcgatcctg ccaacgacaa catcaagtac 180gaccccaagt
tccagggccg gttcaccatc tctcgcgaca acgccaagaa ctccctgtac
240ctccagatga actctctgcg cgccgaggat accgccgtgt actactgcgc
ccggagcgag 300gagaactggt acgacttctt cgactactgg ggccagggca
ccctggtgac cgtgtcctct 360155120PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 155Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45Gly Arg
Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65
70
75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr Trp
Gly Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser 115
120156360DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 156gaggtgcagc tggtggagtc tggcggcgga
ctggtgcagc ctggcggctc tctgcggctg 60tcttgcgccg cttccggctt caacatcaag
gacacctaca tccactgggt gcggcaggct 120cccggcaagg gcctggagtg
ggtggcccgg atcgatcctg ccaacgacaa catcaagtac 180gaccccaagt
tccagggcaa ggccaccatc tctcgcgaca acgccaagaa ctccctgtac
240ctccagatga actctctgcg cgccgaggat accgccgtgt actactgcgc
ccggagcgag 300gagaactggt acgacttctt cgactactgg ggccagggca
ccctggtgac cgtgtcctct 360157120PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 157Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Arg
Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln
Gly Lys Ala Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr Trp Gly
Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser 115
120158360DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 158gaggtgcagc tggtggagtc tggcggcgga
ctggtgcagc ctggcggctc tctgcggctg 60tcttgcgccg cttccggctt caacatcaag
gacacctaca tccactgggt gcggcaggct 120cccggcaagg gcctggagtg
ggtggcccgg atcgatcctg ccaacgacaa catcaagtac 180gaccccaagt
tccagggccg gttcaccatc tctgccgaca acgccaagaa ctccctgtac
240ctccagatga actctctgcg cgccgaggat accgccgtgt actactgcgc
ccggagcgag 300gagaactggt acgacttctt cgactactgg ggccagggca
ccctggtgac cgtgtcctct 360159120PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 159Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Arg
Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln
Gly Arg Phe Thr Ile Ser Ala Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr Trp Gly
Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser 115
120160360DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 160gaggtgcagc tggtggagtc tggcggcgga
ctggtgcagc ctggcggctc tctgcggctg 60tcttgcgccg cttccggctt caacatcaag
gacacctaca tccactgggt gcggcaggct 120cccggcaagg gcctggagtg
ggtgggccgg atcgatcctg ccaacgacaa catcaagtac 180gaccccaagt
tccagggccg gttcaccatc tctcgcgaca acgccaagaa ctccctgtac
240ctccagatga actctctgcg cgccgaggat accgccgtgt actactgcgc
ccggagcgag 300gagaactggt acgacttctt cgactactgg ggccagggca
ccctggtgac cgtgtcctct 360161120PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 161Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Gly Arg
Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr Trp Gly
Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser 115
120162360DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 162gaggtgcagc tggtggagtc tggcggcgga
ctggtgcagc ctggcggctc tctgcggctg 60tcttgcgccg cttccggctt caacatcaag
gacacctaca tccactgggt gcggcaggct 120cccggcaagg gcctggagtg
ggtggcccgg atcgatcctg ccaacgacaa catcaagtac 180gaccccaagt
tccagggcaa ggccaccatc tctgccgaca acgccaagaa ctccctgtac
240ctccagatga actctctgcg cgccgaggat accgccgtgt actactgcgc
ccggagcgag 300gagaactggt acgacttctt cgactactgg ggccagggca
ccctggtgac cgtgtcctct 360163120PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 163Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Arg
Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln
Gly Lys Ala Thr Ile Ser Ala Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr Trp Gly
Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser 115
120164360DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 164gaggtgcagc tggtggagtc tggcggcgga
ctggtgcagc ctggcggctc tctgcggctg 60tcttgcgccg cttccggctt caacatcaag
gacacctaca tccactgggt gcggcaggct 120cccggcaagg gcctggagtg
gatcggccgg atcgatcctg ccaacgacaa catcaagtac 180gaccccaagt
tccagggccg gttcaccatc tctgccgaca acgccaagaa ctccctgtac
240ctccagatga actctctgcg cgccgaggat accgccgtgt actactgcgc
ccggagcgag 300gagaactggt acgacttctt cgactactgg ggccagggca
ccctggtgac cgtgtcctct 360165120PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 165Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45Gly Arg
Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln
Gly Arg Phe Thr Ile Ser Ala Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr Trp Gly
Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser 115
120166360DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 166gaggtgcagc tggtggagtc tggcggcgga
ctggtgcagc ctggcggctc tctgcggctg 60tcttgcgccg cttccggctt caacatcaag
gacacctaca tccactgggt gcggcaggct 120cccggcaagg gcctggagtg
ggtgggccgg atcgatcctg ccaacgacaa catcaagtac 180gaccccaagt
tccagggccg gttcaccatc tctgccgaca acgccaagaa ctccctgtac
240ctccagatga actctctgcg cgccgaggat accgccgtgt actactgcgc
ccggagcgag 300gagaactggt acgacttctt cgactactgg ggccagggca
ccctggtgac cgtgtcctct 360167120PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 167Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Gly Arg
Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln
Gly Arg Phe Thr Ile Ser Ala Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr Trp Gly
Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser 115
120168360DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 168gaggtgcagc tggtggagtc tggcggcgga
ctggtgcagc ctggcggctc tctgcggctg 60tcttgcgccg cttccggctt caacatcaag
gacacctaca tccactgggt gcggcaggct 120cccggcaagg gcctggagtg
ggtggcccgg atcgatcctg ccaacgacaa catcaagtac 180gaccccaagt
tccagggccg gttcaccatc tctcgcgaca acgccaagaa ctccgcctac
240ctccagatga actctctgcg cgccgaggat accgccgtgt actactgcgc
ccggagcgag 300gagaactggt acgacttctt cgactactgg ggccagggca
ccctggtgac cgtgtcctct 360169120PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 169Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Arg
Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Ala Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr Trp Gly
Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser 115
120170360DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 170gaggtgcagc tggtggagtc tggcggcgga
ctggtgcagc ctggcggctc tctgcggctg 60tcttgcgccg cttccggctt caacatcaag
gacacctaca tccactgggt gcggcaggct 120cccggcaagg gcctggagtg
ggtgggccgg atcgatcctg ccaacgacaa catcaagtac 180gaccccaagt
tccagggccg gttcaccatc tctgccgaca acgccaagaa ctccgcctac
240ctccagatga actctctgcg cgccgaggat accgccgtgt actactgcgc
ccggagcgag 300gagaactggt acgacttctt cgactactgg ggccagggca
ccctggtgac cgtgtcctct 360171120PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 171Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Gly Arg
Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln
Gly Arg Phe Thr Ile Ser Ala Asp Asn Ala Lys Asn Ser Ala Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr Trp Gly
Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser 115
120172360DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 172gaggtgcagc tggtggagtc tggcggcgga
ctggtgcagc ctggcggctc tctgcggctg 60tcttgcgccg cttccggctt caacatcaag
gacacctaca tccactgggt gcggcaggct 120cccggcaagg gcctggagtg
gatcggccgg atcgatcctg ccaacgacaa catcaagtac 180gaccccaagt
tccagggccg gttcaccatc tctgccgaca acgccaagaa ctccgcctac
240ctccagatga actctctgcg cgccgaggat accgccgtgt actactgcgc
ccggagcgag 300gagaactggt acgacttctt cgactactgg ggccagggca
ccctggtgac cgtgtcctct 360173120PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 173Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45Gly Arg
Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln
Gly Arg Phe Thr Ile Ser Ala Asp Asn Ala Lys Asn Ser Ala Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr Trp Gly
Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser 115
120174360DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 174gaggtgcagc tggtggagtc tggcggcgga
ctggtgcagc ctggcggctc tctgcggctg 60tcttgcaccg gctccggctt caacatcaag
gacacctaca tccactgggt gcggcaggct 120cccggcaagg gcctggagtg
gatcggccgg atcgatcctg ccaacgacaa catcaagtac 180gaccccaagt
tccagggccg gttcaccatc tctgccgaca acgccaagaa ctccctgtac
240ctccagatga actctctgcg cgccgaggat accgccgtgt actactgcgc
ccggagcgag 300gagaactggt acgacttctt cgactactgg ggccagggca
ccctggtgac cgtgtcctct 360175120PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 175Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu
Ser Cys Thr Gly Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45Gly Arg
Ile Asp Pro Ala Asn Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln
Gly Arg Phe Thr Ile Ser Ala Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Ser Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr Trp Gly
Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser 115
120176450PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 176Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45Gly Arg Ile Asp Pro Ala Asn
Asp Asn Ile Lys Tyr Asp Pro Lys Phe 50 55 60Gln Gly Arg Phe Thr Ile
Ser Ala Asp Asn Ala Lys Asn Ser Ala Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser
Glu Glu Asn Trp Tyr Asp Phe Phe Asp Tyr Trp Gly Gln 100 105 110Gly
Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val 115 120
125Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala
130 135 140Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr
Val Ser145 150 155 160Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His
Thr Phe Pro Ala Val 165 170 175Leu Gln Ser Ser Gly Leu Tyr Ser Leu
Ser Ser Val Val Thr Val Pro 180 185 190Ser Ser Ser Leu Gly Thr Gln
Thr Tyr Ile Cys Asn Val Asn His Lys 195 200 205Pro Ser Asn Thr Lys
Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp 210 215 220Lys Thr His
Thr Cys Pro Pro Cys Pro Ala Pro Glu Ala Leu Gly Ala225 230 235
240Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile
245 250 255Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser
His Glu 260 265 270Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly
Val Glu Val His 275 280 285Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln
Tyr Asn Ser Thr Tyr Arg 290 295 300Val Val Ser Val Leu Thr Val Leu
His Gln Asp Trp Leu Asn Gly Lys305 310 315 320Glu Tyr Lys Cys Lys
Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu 325 330 335Lys Thr Ile
Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr
340 345 350Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val
Ser Leu 355 360 365Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile
Ala Val Glu Trp 370 375 380Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
Lys Thr Thr Pro Pro Val385 390 395 400Leu Asp Ser Asp Gly Ser Phe
Phe Leu Tyr Ser Lys Leu Thr Val Asp 405 410 415Lys Ser Arg Trp Gln
Gln Gly Asn Val Phe Ser Cys Ser Val Met His 420 425 430Glu Ala Leu
His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro 435 440 445Gly
Lys 450177219PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 177Asp Ile Gln Met Thr Gln Ser Pro
Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys
Arg Ser Ser Gln Ser Ile Val His Ser 20 25 30Asn Gly Asn Thr Tyr Leu
Glu Trp Tyr Gln Gln Lys Pro Gly Lys Ala 35 40 45Pro Lys Leu Leu Ile
Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60Ser Arg Phe Ser
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile65 70 75 80Ser Ser
Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Phe Gln Gly 85 90 95Ser
His Ile Pro Tyr Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys 100 105
110Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu
115 120 125Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn
Asn Phe 130 135 140Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp
Asn Ala Leu Gln145 150 155 160Ser Gly Asn Ser Gln Glu Ser Val Thr
Glu Gln Asp Ser Lys Asp Ser 165 170 175Thr Tyr Ser Leu Ser Ser Thr
Leu Thr Leu Ser Lys Ala Asp Tyr Glu 180 185 190Lys His Lys Val Tyr
Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser 195 200 205Pro Val Thr
Lys Ser Phe Asn Arg Gly Glu Cys 210 215178132PRTHomo sapiens 178Met
Ala Leu Leu Leu Thr Thr Val Ile Ala Leu Thr Cys Leu Gly Gly1 5 10
15Phe Ala Ser Pro Gly Pro Val Pro Pro Ser Thr Ala Leu Arg Glu Leu
20 25 30Ile Glu Glu Leu Val Asn Ile Thr Gln Asn Gln Lys Ala Pro Leu
Cys 35 40 45Asn Gly Ser Met Val Trp Ser Ile Asn Leu Thr Ala Gly Met
Tyr Cys 50 55 60Ala Ala Leu Glu Ser Leu Ile Asn Val Ser Gly Cys Ser
Ala Ile Glu65 70 75 80Lys Thr Gln Arg Met Leu Ser Gly Phe Cys Pro
His Lys Val Ser Ala 85 90 95Gly Gln Phe Ser Ser Leu His Val Arg Asp
Thr Lys Ile Glu Val Ala 100 105 110Gln Phe Val Lys Asp Leu Leu Leu
His Leu Lys Lys Leu Phe Arg Glu 115 120 125Gly Arg Phe Asn
13017913PRTMacaca fascicularis 179Met Ala Leu Leu Leu Thr Met Val
Ile Ala Leu Thr Cys1 5 1018012PRTMacaca fascicularis 180Leu Gly Gly
Phe Ala Ser Pro Ser Pro Val Pro Pro1 5 1018117PRTMacaca
fascicularis 181Ser Pro Ser Pro Val Pro Pro Ser Thr Ala Leu Lys Glu
Leu Ile Glu1 5 10 15Glu18219PRTMacaca fascicularis 182Thr Ala Leu
Lys Glu Leu Ile Glu Glu Leu Val Asn Ile Thr Gln Asn1 5 10 15Gln Lys
Ala18322PRTMacaca fascicularis 183Asn Gln Lys Ala Pro Leu Cys Asn
Gly Ser Met Val Trp Ser Ile Asn1 5 10 15Leu Thr Ala Gly Val Tyr
2018421PRTMacaca fascicularis 184Ile Asn Leu Thr Ala Gly Val Tyr
Cys Ala Ala Leu Glu Ser Leu Ile1 5 10 15Asn Val Ser Gly Cys
2018521PRTMacaca fascicularis 185Ser Leu Ile Asn Val Ser Gly Cys
Ser Ala Ile Glu Lys Thr Gln Arg1 5 10 15Met Leu Asn Gly Phe
2018618PRTMacaca fascicularis 186Gly Phe Cys Pro His Lys Val Ser
Ala Gly Gln Phe Ser Ser Leu Arg1 5 10 15Val Arg18720PRTMacaca
fascicularis 187Val Arg Asp Thr Lys Ile Glu Val Ala Gln Phe Val Lys
Asp Leu Leu1 5 10 15Val His Leu Lys2018819PRTMacaca fascicularis
188Phe Val Lys Asp Leu Leu Val His Leu Lys Lys Leu Phe Arg Glu Gly1
5 10 15Gln Phe Asn189396DNAArtificial SequenceDescription of
Artificial Sequence Synthetic polynucleotide 189atgcggctgc
ccgctcagct gctgggcctg ctgatgctgt gggtgcccgg ctcttccggc 60gacgtggtga
tgacccagtc ccctctgtct ctgcccgtga ccctgggcca gcccgcttct
120atctcttgcc ggtcctccca gtccctggtg tactccgacg gcaacaccta
cctgaactgg 180ttccagcaga gacccggcca gtctcctcgg cggctgatct
acaaggtgtc caaccgcttt 240tccggcgtgc ccgatcggtt ctccggctcc
ggcagcggca ccgatttcac cctgaagatc 300agccgcgtgg aggccgagga
tgtgggcgtg tactactgct tccagggctc ccacatccct 360tacacctttg
gcggcggaac caaggtggag atcaag 396190132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
190Met Arg Leu Pro Ala Gln Leu Leu Gly Leu Leu Met Leu Trp Val Pro1
5 10 15Gly Ser Ser Gly Asp Val Val Met Thr Gln Ser Pro Leu Ser Leu
Pro 20 25 30Val Thr Leu Gly Gln Pro Ala Ser Ile Ser Cys Arg Ser Ser
Gln Ser 35 40 45Leu Val Tyr Ser Asp Gly Asn Thr Tyr Leu Asn Trp Phe
Gln Gln Arg 50 55 60Pro Gly Gln Ser Pro Arg Arg Leu Ile Tyr Lys Val
Ser Asn Arg Phe65 70 75 80Ser Gly Val Pro Asp Arg Phe Ser Gly Ser
Gly Ser Gly Thr Asp Phe 85 90 95Thr Leu Lys Ile Ser Arg Val Glu Ala
Glu Asp Val Gly Val Tyr Tyr 100 105 110Cys Phe Gln Gly Ser His Ile
Pro Tyr Thr Phe Gly Gly Gly Thr Lys 115 120 125Val Glu Ile Lys
130191336DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 191gatgttgtga tgacccaatc tccactctcc
ctgcctgtca ctcctggaga gccagcctcc 60atctcttgca gatctagtca gagcattgtg
catagtaatg gaaacaccta cctggaatgg 120tacctgcaga aaccaggcca
gtctccacag ctcctgatct acaaagtttc caaccgattt 180tctggggtcc
cagacaggtt cagtggcagt ggatcaggga cagatttcac actcaagatc
240agcagagtgg aggctgagga tgtgggagtt tattactgct ttcaaagttc
acatgttcct 300ctcaccttcg gtcaggggac caagctggag atcaaa
336192112PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 192Asp Val Val Met Thr Gln Ser Pro Leu Ser
Leu Pro Val Thr Pro Gly1 5 10 15Glu Pro Ala Ser Ile Ser Cys Arg Ser
Ser Gln Ser Ile Val His Ser 20 25 30Asn Gly Asn Thr Tyr Leu Glu Trp
Tyr Leu Gln Lys Pro Gly Gln Ser 35 40 45Pro Gln Leu Leu Ile Tyr Lys
Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60Asp Arg Phe Ser Gly Ser
Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile65 70 75 80Ser Arg Val Glu
Ala Glu Asp Val Gly Val Tyr Tyr Cys Phe Gln Ser 85 90 95Ser His Val
Pro Leu Thr Phe Gly Gln Gly Thr Lys Leu Glu Ile Lys 100 105
1101938PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 193Gln Xaa Xaa Xaa Ile Pro Tyr Thr1 5
* * * * *