U.S. patent application number 13/030557 was filed with the patent office on 2011-06-16 for roles for dual endothelin-1/angiotensin ii receptor (dear) in hypertension and angiogenesis.
This patent application is currently assigned to TRUSTEES OF BOSTON UNIVERSITY. Invention is credited to Victoria L.M. HERRERA, Nelson RUIZ-OPAZO.
Application Number | 20110142821 13/030557 |
Document ID | / |
Family ID | 36407731 |
Filed Date | 2011-06-16 |
United States Patent
Application |
20110142821 |
Kind Code |
A1 |
HERRERA; Victoria L.M. ; et
al. |
June 16, 2011 |
ROLES FOR DUAL ENDOTHELIN-1/ANGIOTENSIN II RECEPTOR (DEAR) IN
HYPERTENSION AND ANGIOGENESIS
Abstract
The present application is directed to the identification of
mutations and/or polymorphisms in the Dual Endothelin-1/Angiotensin
II Receptor (Dear) that indicate susceptibility to, or show current
affliction with, hypertension. Additionally, the present invention
discloses methods for the modulation of angiogenesis via the
regulation of Dear.
Inventors: |
HERRERA; Victoria L.M.;
(Westwood, MA) ; RUIZ-OPAZO; Nelson; (Westwood,
MA) |
Assignee: |
TRUSTEES OF BOSTON
UNIVERSITY
Boston
MA
|
Family ID: |
36407731 |
Appl. No.: |
13/030557 |
Filed: |
February 18, 2011 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
11667713 |
May 14, 2007 |
7919093 |
|
|
PCT/US05/41594 |
Nov 15, 2005 |
|
|
|
13030557 |
|
|
|
|
60628447 |
Nov 16, 2004 |
|
|
|
60694268 |
Jun 27, 2005 |
|
|
|
Current U.S.
Class: |
424/130.1 ;
435/6.1; 435/6.11 |
Current CPC
Class: |
A61P 17/02 20180101;
C12Q 1/6883 20130101; A61P 1/04 20180101; A61P 13/10 20180101; C07K
16/28 20130101; A61P 17/06 20180101; C07K 16/2869 20130101; C12Q
1/6886 20130101; A61P 9/00 20180101; A61P 35/00 20180101; A61P
15/00 20180101; A61P 35/04 20180101; A61P 13/02 20180101; A61P
19/10 20180101; C07K 2317/34 20130101; C07K 2317/76 20130101; C12Q
2600/172 20130101; A61P 27/06 20180101; A61P 29/00 20180101; A61K
2039/505 20130101; A61P 9/10 20180101; C12Q 2600/156 20130101; A61K
39/00 20130101; A61P 27/02 20180101; A61P 3/10 20180101; A61P 1/18
20180101; A61P 19/02 20180101; A61P 13/12 20180101 |
Class at
Publication: |
424/130.1 ;
435/6.1; 435/6.11 |
International
Class: |
A61K 39/395 20060101
A61K039/395; A61P 29/00 20060101 A61P029/00; A61P 17/06 20060101
A61P017/06; A61P 3/10 20060101 A61P003/10; A61P 27/02 20060101
A61P027/02; A61P 19/10 20060101 A61P019/10; A61P 35/00 20060101
A61P035/00; C12Q 1/68 20060101 C12Q001/68 |
Goverment Interests
GOVERNMENT SUPPORT
[0002] This invention was made with Government Support under
Contract No. HL69937 awarded by the National Institutes of Health.
The Government has certain rights in the invention.
Claims
1. A method for determining an individual's susceptibility to
hypertension comprising: (a) obtaining a biological sample from a
patient; and (b) detecting the presence or absence of at least one
mutation or polymorphism in the Dual Endothelin-1/Angiotensin II
Receptor (Dear) in said tissue sample as compared to a control
sample, (c) determining whether the mutation or polymorphism
increases the expression of Dual Endothelin-1/Angiotensin II
Receptor (Dear), enhances the affinity of ET-1 binding to Dual
Endothelin-1/Angiotensin II Receptor (Dear), enhances the affinity
of VEGF-signal peptide (VEGFsp) binding to Dual
Endothelin-1/Angiotensin II Receptor (Dear), or increases
Dear-activation when Dear is stimulated with a ligand, wherein the
presence of at least one of the mutations or polymorphisms
indicates that the individual is susceptible to hypertension.
2. A method for diagnosing hypertension comprising: (a) obtaining a
biological sample from a patient; and (b) detecting the presence or
absence of at least one mutation or polymorphism in the Dual
Endothelin-1/Angiotensin II Receptor (Dear) in said tissue sample
as compared to a control sample; (c) determining whether the
mutation or polymorphism increases the expression of Dual
Endothelin-1/Angiotensin II Receptor (Dear), enhances the affinity
of ET-1 binding to Dual Endothelin-1/Angiotensin II Receptor
(Dear), enhances the affinity of VEGF-signal peptide (VEGFsp)
binding to Dual Endothelin-1/Angiotensin II Receptor (Dear), or
increases Dear-activation when Dear is stimulated with a ligand,
wherein the presence of at least one of the mutations or
polymorphisms indicates that the individual has hypertension.
3. The method of claim 1 further comprising performing a polymerase
chain reaction (PCR) to amplify the DEAR coding sequence.
4. The method of claim 2, wherein the DEAR coding sequence is a
human DEAR coding sequence and has at least 75% homology or
identity to SEQ ID NO. 1.
5. The method of claim 1 further comprising: (a) isolating nucleic
acid from the biological sample; and (b) contacting the nucleic
acid with at least one nucleic acid probe under selective
hybridization conditions, wherein said probe preferentially
hybridizes with a nucleic acid sequence comprising a Dear mutation
or polymorphism, wherein the binding of the probe to the isolated
nucleic acid indicates that the individual is susceptible to or
currently has hypertension.
6. A method for enhancing angiogenesis at a clinically relevant
site in an individual comprising administering to said patient an
effective amount of a Dual Endothelin-1/Angiotensin II Receptor
(Dear) activator.
7. The method of claim 7, wherein said clinically relevant site is
selected from the group consisting of a wound, ulcer, diabetic
ulcer, and a heart with coronary artery disease.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a divisional application of U.S. Utility
application Ser. No. 11/667,713, which is a 371 National Phase
Entry Application of International Application PCT/US2005/041594,
filed Nov. 15, 2005, which designated the U.S. and which claims
benefit under 35 USC 119(e) of the U.S. provisional application No.
60/628,447 filed on Nov. 16, 2004 and U.S. provisional application
No. 60/694,268 filed on Jun. 27, 2005, the content of which is
incorporated herein by reference in its entirety.
FIELD OF THE INVENTION
[0003] The present application is directed to the identification of
mutations and/or polymorphisms in the Dual Endothelin-1/Angiotensin
II Receptor (Dear) that indicate susceptibility to, or show current
affliction with, hypertension. Additionally, the present invention
discloses methods for the modulation of angiogenesis via the
regulation of Dear.
BACKGROUND OF THE INVENTION
[0004] The Dual Endothelin-1/Angiotensin II Receptor (Dear) was
originally isolated from an adult rat brain cDNA library using an
AngII antisense oligonucleotide probe and also, independently, with
an ET-1 oligonucleotide, see Molecular Medicine 4: 96-108, 1998.
Structural analysis of the receptor revealed putative single
predicted transmembrane domain and distinct ET-1 and AngII putative
binding domains. Functional analysis has shown that both ET-1 and
AngII bind to Dear and induce coupling to a Ca2+ mobilizing
transduction system.
[0005] ET-1 is a potent vasoconstrictor peptide involved in diverse
physiological functions such as blood pressure regulation,
mitogenesis and apoptosis (Lariviere, R. et al. Can J Physiol
Pharmacol. 81, 607-621 (2003), and angiogenesis (Salani, D. et al.
Am. J. Pathol. 157, 1537-1547 (2000); Sullivan, D. C. &
Bicknell, R. British Journal of Cancer 89, 228-231 (2003)), and has
been implicated in several pathophysiological conditions such as
hypertension, cardiac failure (Lariviere, R. et al. Can J Physiol
Pharmacol. 81, 607-621 (2003); Ikeda, T. et al. Hypertension 34,
514-519 (1999); Touyz, R. M. & Schiffrin, E. L. Can J Physiol
Pharmacol. 81, 533-541 (2003)), and more recently tumor
angiogenesis, invasion and metastases (Bagnato, A. & Spinella,
F. Trends in Endocrinology and Metabolism 14, 44-50 (2002); Grant,
K., Loizidou, M. & Taylor, I. British Journal of Cancer 88,
163-166 (2003)).
[0006] AngII exhibits similar physiological responses to ET-1, such
as blood pressure regulation, proliferation, apoptosis and
angiogenesis (Watanabe, T. et al. Hypertension 45, 163-169 (2005),
and has also been implicated in tumor angiogenesis (Escobar, E. et
al. Curr Vasc Pharmacol 2, 385-399 (2004)). Separate receptors have
been identified for binding by either ET-1 or AngII which are
believed to be responsible for the physiological responses
observed.
[0007] Accordingly, despite known roles for ET-1 and AngII, the
role of Dear is currently unknown. It is believed that Dear
regulates pathways distinct from those triggered by either ET-1 or
AngII binding to ET.sub.A, ET.sub.B or AT1 and AT2 receptors
respectively. However, due to its ability to bind to both ET-1 and
AngII, and the important role these molecules play in angiogenesis,
hypertension and tumor progression, a better understanding of
Dear's role is needed. The present invention discloses newly
discovered roles for Dear and presents methods to screen for,
diagnose, prognose and treat various diseases and disorders such as
hypertension, pathological angiogenesis and tumor
growth/metastasis.
[0008] The genomes of all organisms undergo spontaneous mutation in
the course of their continuing evolution, generating variant forms
of progenitor genetic sequences (Gusella, Ann. Rev. Biochem. 55,
831-854 (1986)). A variant form may confer an evolutionary
advantage or disadvantage relative to a progenitor form or may be
neutral. In some instances, a variant form confers an evolutionary
advantage to the species and is eventually incorporated into the
DNA of many or most members of the species and effectively becomes
the progenitor form. However, often times the variant form confers
a disadvantage that may make an individual susceptible to certain
diseases or disorders. An understanding of these variants may
provide for better diagnosis of existing diseases or disorders,
prognosis of the risk of obtaining certain diseases or disorders,
and improved, more targeted treatments.
[0009] The knowledge of specific mutations and/or polymorphisms
that are disease or disorder associated help identify patients most
suited to therapy with particular pharmaceutical agents (this is
often termed "pharmacogenetics"). Pharmacogenetics can also be used
in pharmaceutical research to assist the drug selection process.
Polymorphisms are used in mapping the human genome and to elucidate
the genetic component of diseases. The following references show
background details on pharmacogenetics and other uses of
polymorphism detection: Linder et al. (1997), Clinical Chemistry,
43, 254; Marshall (1997), Nature Biotechnology, 15, 1249;
International Patent Application WO 97/40462, Spectra Biomedical;
and Schafer et al. (1998), Nature Biotechnology, 16, 33.
[0010] I. Hypertension
[0011] Hypertension, or high blood pressure, is the most common
chronic illness in America. The American Heart Association
estimates that more than 62 million Americans over the age of six
suffer from high blood pressure, and that only a minority of these
people have their blood pressure under control. Left untreated,
hypertension can lead to stroke, heart attack, kidney damage,
congestive heart failure, and death. Uncontrolled mild-to-moderate
hypertension will reduce the life expectancy of a typical
35-year-old person by 16 years. Even the mildest form of high blood
pressure, "borderline hypertension," can cut one's life span by a
few years and impact negatively on the quality of life.
[0012] The existence of a genetic component to hypertension is
known from twin studies, which have revealed a greater concordance
of blood pressure in monozygotic twins than in dizygotic twins.
Similarly, biological siblings show greater concordance of blood
pressure than adoptive siblings raised in the same household. Such
studies have suggested that up to about 40% of the variations in
blood pressure in the population are genetically determined.
However, to date, a reliable genetic marker for hypertension has
not been identified. Although significant gains have been made with
respect to treatment, hypertension prevails as a major risk factor
for heart and kidney disease, and stroke prompting the lowering of
the BP level at which to start treatment.
[0013] Thus, a genetic marker for predicting one's susceptibility
to hypertension is needed, as well as, a reliable method to
diagnose hypertension is needed. Additionally, treatment strategies
targeting the normalization of mutant genes contributing to genetic
hypertension (hypertension genes) are needed.
[0014] II. Angiogenesis
[0015] Angiogenesis is a process of tissue vascularization that
involves both the growth of new developing blood vessels into a
tissue (neo-vascularization) and co-opting of existing blood
vessels to a target site. Blood vessels are the means by which
oxygen and nutrients are supplied to living tissues and waste
products are removed from living tissue. Angiogenesis can be a
critical biological process. For example, angiogenesis is essential
in reproduction, development and wound repair. Conversely,
inappropriate angiogenesis can have severe negative consequences.
For example, it is only after solid tumors are vascularized as a
result of angiogenesis that the tumors have a sufficient supply of
oxygen and nutrients that permit it to grow rapidly and
metastasize.
[0016] Angiogenesis-dependent diseases and disorders are those
diseases and disorders affected by vascular growth. Such diseases
represent a significant portion of diseases for which medical
treatment is sought, and include inflammatory disorders such as
immune and non-immune inflammation, chronic articular rheumatism
and psoriasis, disorders associated with inappropriate or
inopportune invasion of vessels such as diabetic retinopathy,
macular degeneration, neovascular glaucoma, restenosis, capillary
proliferation in atherosclerotic plaques and osteoporosis, and
cancer associated disorders, such as solid tumors, solid tumor
metastases, angiofibromas, retrolental fibroplasia, hemangiomas,
Kaposi sarcoma, cancers which require neovascularization to support
tumor growth, etc.
[0017] While methods to inhibit unwanted angiogenesis are known,
few have proven clinically useful. For example, a number of
therapeutic strategies exist for inhibiting aberrant angiogenesis,
which attempt to reduce the production or effect of VEGF. For
example, anti-VEGF or VEGF receptor antibodies (Kim E S et al.
(2002), PNAS USA 99: 11399-11404), and soluble VEGF "traps" which
compete with endothelial cell receptors for VEGF binding (Holash J
et al. (2002), PNAS USA 99: 11393-11398) have been developed.
Classical VEGF "antisense" or aptamer therapies directed against
VEGF gene expression have also been proposed (U.S. published
application 2001/0021772 of Uhlmann et al.). The anti-angiogenic
agents used in these and similar non-VEGF targeted therapies have
typically been unsuccessful. The results achieved with available
anti-angiogenic therapies have therefore been generally
unsatisfactory.
[0018] Thus, methods to reduce or eliminate unwanted angiogenesis
are needed.
[0019] Conversely, in situations where angiogenesis is desired,
such as, for example, reproduction, development, wound repair and
areas of ischemia or infarction, the stimulation of angiogenesis is
useful. Current methods to initiate or up-regulate angiogenesis
have also typically been clinically unsuccessful and are thus
needed.
[0020] Furthermore, because ET-1 is also associated with breast
cancer growth and pro-malignant potential, inhibition of Dear will
also be useful in decreasing tumor growth and potential to
metastasize, independent of its effects on angiogenesis.
SUMMARY OF THE INVENTION
[0021] The inventors of the present invention have discovered that
mutations and/or polymorphisms in Dear that enhances the expression
and/or the affinity of ET-1 binding to Dear can accurately predict
susceptibility to hypertension. Mutations and/or polymorphisms in
Dear and human homologues thereof are encompassed in the present
invention. Thus, in one embodiment of the present invention, it is
possible to predict susceptibility to hypertension, to diagnose
current hypertension and/or provide prognosis of the hypertension
by analyzing Dear gene and/or protein. The presence of a mutation
and/or polymorphism that (1) enhances Dear expression and/or (2)
enhances the affinity of ET-1 binding to Dear, compared to a wild
type control, is indicative of one's susceptibility to and/or
current affliction with hypertension.
[0022] In addition, Dear plays a role in angiogenesis, tumor growth
and pro-malignant potential. In particular, the inventors have
shown that inhibitors of Dear, such as anti-Dear antibodies,
decreased tumor progression and pro-malignant potential in both a
rat and mouse model of cancer. Thus, in another embodiment of the
present invention, methods to inhibit angiogenesis and/or tumor
growth and/or pro-malignant potential are disclosed. In this
embodiment, an individual is administered a compound that inhibits
Dear activation, such as for example, a small molecule inhibitor,
competitive inhibitor, antibody, antibody fragment, sirna, aptamer,
etc. Preferably, these are used in conjunction with inhibitors to
other angiogenesis-associated agents such as VEGF, placental growth
factors etc.
[0023] Non-limiting examples of pathological angiogenesis or
disorders treated by the methods of the present invention include,
inflammatory disorders such as immune and non-immune inflammation,
chronic articular rheumatism and psoriasis, disorders associated
with inappropriate or inopportune invasion of vessels such as
diabetic retinopathy, macular degeneration, neovascular glaucoma,
restenosis, capillary proliferation in atherosclerotic plaques and
osteoporosis, and cancer associated disorders, such as solid
tumors, solid tumor metastases, angiofibromas, retrolental
fibroplasia, hemangiomas, Kaposi sarcoma and the like cancers which
require neovascularization to support tumor growth. In a preferred
embodiment of the present invention, the methods are directed to
inhibiting tumor angiogenesis and/or pro-malignant potential in a
mammal with cancer, such as, for example, breast cancer.
[0024] In a related embodiment, the present invention discloses
methods to stimulate angiogenesis in tissues in need thereof. In
this embodiment, activators of Dear are administered to an
individual, such as, for example, small molecules, antibodies,
antibody fragments, or other activators known to those of skill in
the art.
[0025] As an example, stimulation of angiogenesis may be beneficial
in diabetes-induced ischemia, poor circulation, myocardial
infarction, aortic aneurysm, arterial disease of the lower
extremities, cerebrovascular disease, etc.
BRIEF DESCRIPTION OF THE DRAWINGS
[0026] FIGS. 1A-1C. Molecular characterization of Dahl S and Dahl R
Dear variants. (FIG. 1A) Comparative nucleotide sequence of Dahl S
and Dahl R cDNAs spanning the T.sup.2814 (Dahl S)/C.sup.2814 (Dahl
R) and T.sup.2901 (Dahl S)/C.sup.2901 (Dahl R) nucleotide
transitions. Amino acid substitutions resulting from the
corresponding nucleotide transitions detected S44 substitution in
Dahl R Dear for P44 and M74 substitution in Dahl R Dear for T74
(amino acid numbering as per Ruiz-Opazo et al. 1998) FIG. 1A
discloses SEQ ID NOS: 17-22, respectively, in order of appearance.
FIG. 1B shows schematic structure of the Dahl R Dear (SEQ ID NO:
23. The following functional domains are highlighted: putative
AngII binding site, AngII (aa 41-48); ET-1 binding site, ET-1 (aa
60-67); amino acid S44 and M74 substituted in the Dahl S Dear by
P44 and T74 respectively; potential cAMP-dependent protein kinase
phosphorylation sites (S91, T108 in green); a potential
internalization recognition sequence (IRS) (FIG. 1C) Western blot
analysis detects equivalent levels of Dahl S(S) and Dahl R(R) Dear
variants in Dahl S and Dahl R rat kidney membranes isolated from
male and female rats. MW, 14.4 kDa molecular weight marker.
[0027] FIGS. 2A-2C. Functional characterization of Dahl S and Dahl
R Dear variants. Saturation binding curves of ligand binding
studies of Dahl S (.smallcircle.) and Dahl R (.cndot.) Dear
expressed in Cos1 cells with radiolabeled .sup.125I-AngII (FIG. 2A)
and .sup.125I-ET-1 (FIG. 2B). Values are presented as
Mean.+-.standard deviation from five independent experiments. (FIG.
2C) Detection of the 14 kDa Dear protein () by western blot
analysis (ab) of Dahl R (Kid-R) and Dahl S (Kid-S) kidney (Kid)
membranes; control non-transfected Cost cell membranes (Cos1-c),
Cost cell membranes expressing the Dahl R S44P/M74T variant
(Cos1-R) and Cost cell membranes expressing the Dahl S S44/M74
variant (Cos1-S). .sup.125I-AngII west-western blot analysis
(*AngII) detects binding only to Dahl S kidney membranes (Kid-S)
and Cos1 cell membranes expressing the Dahl S S44/M74 variant
(Cos1-S) while .sup.125I-ET-1 west-western blot analysis (*ET-1)
reveals binding to both Dahl R (Kid-R) and Dahl S (Kid-S) kidney
membranes as well as to Cos1 cell membranes expressing the Dahl R
S44P/M74T (Cos1-R) and Dahl S S44/M74 (Cos1-S) molecular
variants.
[0028] FIGS. 3A-3D. Scatchard plots of saturation data for Dahl S
and Dahl R Dear variants. Scatchard plots of .sup.125I-AngII (FIG.
3A) and .sup.125I-ET-1 (FIG. 3B, FIG. 3C) saturation binding data
of Dahl S (.smallcircle.) and Dahl R (.cndot.) Dear expressed in
Cos1 cells. FIG. 3D: Saturation binding curves of ligand binding
studies of mouse Dear expressed in Cos-1 cells. .largecircle.,
mean.+-.sem .sup.125I-ET-1 binding; , mean.+-.sem .sup.125I-AngII
binding.
[0029] FIGS. 4A-4C. Detection and genetic analysis of Dear
variants. (FIG. 4A) Detection of the Dear gene variants by single
strand conformation polymorphism (SSCP) analysis in different rat
strains. A 137 bp PCR product spanning the S44P substitution
reveals the S44P/M74T variant in Dahl R(R) and LEW strains while
the S44/M74 variant is detected in Dahl S(S), BN, WKY and SHR
genomic DNAs. F1 denotes F1 [RxS] subjects. Interval mapping with
bootstrap-analysis for chromosome-2 in male (FIG. 4B) and female
(FIG. 4C) cohorts using Map Manager QTXb17 program. Horizontal
lines (--) mark LRS values for significance of linkage. For (FIG.
4B) from top to bottom: LRS=18.4 (LOD=4.00) for highly significant,
LRS=10.6 (LOD=2.30) for significant, LRS=4.1 (LOD=0.89) for
suggestive; for (FIG. 4C) from top to bottom: LRS=16.6 (LOD=3.61)
for highly significant, LRS=9.9 (LOD=2.15) for significant, LRS=3.9
(LOD=0.85) for suggestive. -- Likelihood ratio statistic; --
regression coefficient for additive effect; -- regression
coefficient for dominance effect. Histograms represent the
bootstrap-based confidence intervals for the detected QTLs.
[0030] FIG. 5 shows Dear expression and schematic representation of
the targeting vector. FIG. 5A shows a restriction map of wild type
129SVJ mouse Dear (WT allele), the Dear targeting vector for
homologous recombination (KO construct), and the mutant allele. (1)
is a probe for Southern-blot analysis, which is a 1.5 kb S-B
restriction fragment which detects a 5.2 kb SphI restriction digest
fragment in targeted allele (2) and a 8.0 kb fragment in the wild
type allele (3); P1 (4) is a forward primer flanking integration
site; P2 (5) is a reverse pGKNeo-specific primer; successful
targeting event yields expected 5.5 kb P1-P2 PCR product. S, SacI;
B, BamHI; N, NsiI restriction enzymes.
[0031] FIG. 5B shows a Northern blot analysis which detects mouse
Dear mRNA in all tissues tested with higher levels in kidney and
aorta. The three different-sized Dear mRNAs most likely represent
different polyadenylation signals. 28S and 18S ribosomal markers
are noted to the left. H, heart, B, brain, K, kidney, Li, liver,
Sp, spleen, Lu, lung, Ao, aorta, Te, testis, Ut, uterus.
[0032] FIG. 5C shows a Southern blot analysis for detection of
Dear-inactivation in mice by homologous recombination. Evidence of
inactivation is characterized by predicted 5.2 kb SphI restriction
digest fragment of genomic DNA detected as a lower hybridizing band
in heterozygous (+/-) DNA samples compared with absence in wild
type (+/+) samples.
[0033] FIG. 5D shows PCR genotyping of E11.5 mouse embryos. Results
(lower panel) show a 153 bp allele in wild type, Dear.sup.+/+ (+/+)
and heterozygous Dear.sup.+/- (+/-), but not in Dear.sup.-/- (-/-)
embryos. The upper panel shows inactivated (5.5 kb) allele in
Dear.sup.+/- and Dear.sup.-/- but not in Dear.sup.+/+ embryos.
[0034] FIG. 5E shows deduced amino acid sequence for mouse Dear
cDNA (bottom sequence; SEQ ID NO: 24) compared with rat Dear
sequence (SEQ ID NO: 2); Ab, peptide sequence used for anti-Dear
antibody; AngII, angiotensin II binding site.sup.1, ET-1,
endothelin-1 binding site.sup.1, TM-1, predicted transmembrane
domain; IRS, internalization recognition sequence; (-), identical
sequence; (*), adjusted gap for better alignment; bold lettering
denotes non-conservative amino acid differences.
[0035] FIG. 5F shows a Western blot analysis of Dear.sup.+/+ (+/+)
and Dear.sup.+/- (+/-) deficient mouse kidney membranes using the
anti-mouse Dear specific anti-peptide antibody (upper panel);
presence of a non-specific cross-reacting high molecular weight
protein demonstrates equal amounts of protein analyzed (lower
panel).
[0036] FIGS. 5G-5I show analysis of blood pressure (FIG. 5G), heart
rate (FIG. 5H) and body weight (FIG. 5I) in heterozygous
Dear.sup.+/- adult mice. Systolic blood pressure (SBP, mmHg) and
mean heart rate (bpm, in beats per minute) in Dear.sup.+/+
(.quadrature.) and Dear.sup.+/- (.box-solid.) deficient male (M)
and female (F) mice. Body weight in grams (g) comparing male
Dear.sup.+/+ (.diamond.) and Dear.sup.+/- (.diamond-solid.) mice,
and female Dear.sup.+/+ (.largecircle.) and Dear.sup.-/- ( ) mice
from 4-6 months (m) of age. *, P<0.05; **, P<0.01.
[0037] FIGS. 6A-I show comparative anatomical analysis of
Dear.sup.+/+ (left side) and Dear.sup.-/- (right side) mouse
embryos. FIG. 6A shows adjacent E12.5 embryos revealing prominent
yolk-sac collecting vessels in Dear.sup.+/+ (left side) but absent
in the smaller Dear.sup.-/- embryo (right side); both embryos still
attached to placentas respectively.
[0038] FIG. 6B shows adjacent E11.5 mouse embryos revealing
well-developed yolk-sac collecting vessels in Dear.sup.+/+ while
absent in Dear.sup.-/- embryo.
[0039] FIG. 6C shows that compared to E10.5 Dear.sup.+/+, E10.5
Dear.sup.-/- mouse embryo exhibits a lack of yolk-sac collecting
vessels; embryo translucency allows detection of incomplete
vascular network, blood filled heart and some cranial region
vascularization.
[0040] FIG. 6D shows adjacent E12.5 mouse embryos distinguishing
normal Dear.sup.+/+ from darkened, resorbed Dear.sup.-/-
embryo.
[0041] FIG. 6E shows E11.5 Dear.sup.-/- mouse embryo exhibiting a
hypoplastic phenotype compared with age-matched, larger dysmorphic
null phenotype in FIG. 6B.
[0042] FIG. 6F shows E10.5 Dear.sup.-/- mouse embryo exhibiting a
hypoplastic phenotype compared with a slightly larger E10.5
dysmorphic null phenotype in FIG. 6C.
[0043] FIG. 6G shows high magnification of E9.5 Dear.sup.+/+ (left
panel) mouse embryo showing vascular network development from
cranial to caudal region with prominent blood-filled dorsal aortae
(.gradient.) and heart (.fwdarw.), in contrast to E10.5
Dear.sup.-/- embryo (right panel) with rudimentary and abnormal
vascular plexus in cranial region, an isolated blood filled heart
(4), and non-detection blood-filled dorsal aortae.
[0044] FIG. 6H shows an analysis of mouse embryos revealing
distinct blood-filled cardiac ventricles and vascular network
throughout the body in the larger Dear.sup.+/+ embryo, in contrast
to Dear.sup.-/- embryo with an enlarged single-chamber blood-filled
heart, minimal peripheral vascular network, absent eye
pigmentation, and abnormal brain region development.
[0045] FIG. 6I shows cleared, fixed E11.5 mouse embryos shown in
FIG. 6B, revealing marked developmental delay in Dear.sup.-/-
embryo particularly in brain region development and heart chamber
formation.
[0046] FIGS. 7A-7L shows histologic analysis of Masson-trichrome
stained mouse embryos. FIG. 7A: E10.5 Dear.sup.-/- yolk sac
revealing sparse blood islands in primary vascular plexus with a
dilated vessel (.fwdarw.), but absent collecting vessels. FIG. 7B:
E10.5 Dear.sup.+/+ embryo yolk-sac revealing large blood
island-filled collecting vessels (.fwdarw.) and primary vascular
plexus. FIG. 7C: Analysis of E12.5 Dear.sup.-/- embryos reveals
abnormal hyper-convoluted neuroepithelium with disorderly
demarcation of major brain regions. Central ventral section is
devoid of organogenesis with no recognizable liver and gut
differentiation. FIG. 7D: Analysis of littermate E12.5 Dear.sup.+/+
embryo contrasts the dysmorphic phenotype in the Dear.sup.-/-
mutant. Note prominent organogenesis: gut, liver, heart, brain and
dorsal aorta. FIG. 7E: High magnification of Dear-/-
neuroepithelial segment (proximal * in FIG. 7C) revealing
thin-walled perineural vessels (.fwdarw.) and a hyper-cellular
neuroepithelium. FIG. 7F: In contrast, high magnification of
Dear+/+ neuroepithelial segment (proximal * in FIG. 7C) revealing
perineural vessels (.fwdarw.) filled with blood islands and
exhibiting relatively thicker walls. FIG. 7G: Higher magnification
of Dear-/- neuroepithelium segment (distal * in FIG. 7C) showing
marked cellularity with poor differential layering, absent
penetrating capillaries, although a few nucleated rbcs are detected
within the neuroepithelium. FIG. 7H: Higher magnification of
Dear.sup.+/+ neuroepithelium (distal * in FIG. 7D) revealing
differential layering and numerous penetrating capillaries
(.fwdarw.) with nucleated rbcs. FIGS. 7I-J: Analysis of
fetal-placental connections (f-pl con/xn) (bar=160 .mu.m) and FIGS.
7K-L: fetal-placental junctions (f-pl jxn) in E11.5 embryos shows
abnormal vascular development and decreased embryonic blood cells
in Dear.sup.-/-, (bar=20 .mu.m).
[0047] FIGS. 8A-F show histological analysis of Dear.sup.+/+ (+/+)
(FIGS. 8A, 8C and 8E) and Dear.sup.-/- (-/-) mouse embryos (FIGS.
8B, 8D and 8F). Masson-trichrome stained E11.5 embryos showing
deficient development of dorsal aorta (da), vasculature (vasc) and
yolk sac, as well as heart and brain in Dear.sup.-/- (bar=160
.mu.m).
[0048] FIGS. 9A-F show smooth muscle cell a-actin immunostaining of
E12.5 mouse embryos (embryo (FIG. 9A-B); bar=160 .mu.m) demarcating
angiogenesis (angiog; FIG. 9C-D) in perineural region and formation
of vascular network (vasc net; FIG. 9E-F) in the caudal region
detects deficient vascular development in Dear.sup.-/- embryos;
bar=20 .mu.m.
[0049] FIGS. 10A and 10B show analysis of mouse dear expression
pattern in wild type (+/+) E9.5 and E12.5 embryos detects Dear
expression in the heart, extra-embryonic and embryonic vasculature,
and neural tube. sc, spinal cord, ao, aorta, bi, blood islands;
neuroepith, neuroepithelium; bar=20 .mu.m.
[0050] FIGS. 11A-11E show analysis of Dear-inhibition on tumor
growth. In Dear.sup.+/- mice (.box-solid.), decreased tumor mass
(mg) (FIG. 11A) and tumor volume (mm.sup.3) (FIG. 11B) of melanoma
cell-induced subcutaneous tumors were observed in females but not
in males compared with age-matched Dear.sup.+/+ control mice
(.quadrature.). FIG. 11C: Anti-rat Dear anti-peptide specific
antibody treatment (.largecircle.) results in decreased tumor
volume in radiation-induced rat mammary tumors. FIG. 11D: Anti-rat
Dear DNA vaccine treatment (.diamond.) also results in decreased
tumor volume in radiation-induced rat mammary tumors. FIG. 11E:
Representative histological analysis of Masson-trichrome stained
tumor sections comparing mock-treated (mock-Rx) vector controls,
anti-Dear anti-peptide specific antibody treatment (ab-Rx) and
anti-rat Dear DNA-vaccine (DNA-vac) shows changes in tumor pattern,
microvascular invasion and nuclear grade in anti-Dear treated
tumors; bar=20 .mu.m. Values are presented as mean.+-.sem. *,
P<0.05; **, P<0.01;***, P, <0.001
DETAILED DESCRIPTION OF THE INVENTION
I. Hypertension
[0051] In one embodiment of the present invention, a method for
determining an individual's susceptibility to hypertension is
disclosed, as well as a diagnostic and/or prognostic method to
determine the condition of the hypertension. An individual is
screened for mutations and/or polymorphisms in Dear that correlate
to an increase expression of Dear and/or enhancement of
Dear-activation or Dear-signaling by AngII, ET-1, VEGF-signal
peptide (VEGFsp) or other Dear-ligand as compared to a control. The
presence of such a mutation and/or polymorphism in the test sample,
as compared to the normal control, is indicative of an individual's
susceptibility to hypertension. The presence of such a mutation
and/or polymorphism in the test sample, as compared to the normal
control, can also be indicative of a current state of
hypertension.
[0052] As used herein, the term Dear encompasses Dear and human
homologues thereof. In one embodiment, the term "human homologue to
Dear" refers to a DNA sequence that has at least about 50% homology
to SEQ ID NO:1 and more preferably at least about 60% homology or
identity, including all intervals up (i.e. 55%, 60%, 65%, 70%, 75%,
80%, 85%, 90%, 95%, etc.). In one embodiment, the term "human
homologue to Dear protein" refers to an amino acid sequence that
has 50% homology to SEQ ID NO: 2, more preferably at least about
60% homology, still more preferably, at least about 70% homology,
even more preferably, at least about 75% homology, yet more
preferably, at least about 80% homology, even more preferably at
least about 85% homology, still more preferably, at least about 90%
homology, and more preferably, at least about 95% homology,
intervals of the same are also encompassed (i.e., 55%, 60%, 70%,
75%, 80%, 85%, 90%, 95%, 98%, etc.).
[0053] "Homology" or "identity" or "similarity" refers to sequence
similarity between two peptides or between two nucleic acid
molecules. Homology and identity can each be determined by
comparing a position in each sequence which may be aligned for
purposes of comparison. When an equivalent position in the compared
sequences is occupied by the same base or amino acid, then the
molecules are identical at that position; when the equivalent site
occupied by the same or a similar amino acid residue (e.g., similar
in steric and/or electronic nature), then the molecules can be
referred to as homologous (similar) at that position. Expression as
a percentage of homology/similarity or identity refers to a
function of the number of identical or similar amino acids at
positions shared by the compared sequences. A sequence which is
"unrelated" or "non-homologous" shares less than 40% identity,
though preferably less than 25% identity with a sequence of the
present application.
[0054] In comparing two sequences, the absence of residues (amino
acids or nucleic acids) or presence of extra residues also
decreases the identity and homology/similarity. The term "homology"
describes a mathematically based comparison of sequence
similarities which is used to identify genes or proteins with
similar functions or motifs. The nucleic acid and protein sequences
of the present application may be used as a "query sequence" to
perform a search against public databases to, for example, identify
other family members, related sequences or homologs. Such searches
can be performed using the NBLAST and XBLAST programs (version 2.0)
of Altschul, et al. (1990) J. Mol. Biol. 215:403-10. BLAST
nucleotide searches can be performed with the NBLAST program,
score=100, wordlength=12 to obtain nucleotide sequences homologous
to nucleic acid molecules of the application. BLAST protein
searches can be performed with the XBLAST program, score=50,
wordlength=3 to obtain amino acid sequences homologous to protein
molecules of the application. To obtain gapped alignments for
comparison purposes, Gapped BLAST can be utilized as described in
Altschul et al., (1997) Nucleic Acids Res. 25(17):3389-3402. When
utilizing BLAST and Gapped BLAST programs, the default parameters
of the respective programs (e.g., XBLAST and BLAST) can be used.
See ncbi web site at nih.gov.
[0055] As used herein, "identity" means the percentage of identical
nucleotide or amino acid residues at corresponding positions in two
or more sequences when the sequences are aligned to maximize
sequence matching, i.e., taking into account gaps and insertions.
Identity can be readily calculated by known methods, including but
not limited to those described in (Computational Molecular Biology,
Lesk, A. M., ea., Oxford University Press, New York, 1988;
Biocomputing: Informatics and--14 Genome Projects, Smith, D. W.,
ea., Academic Press, New York, 1993; Computer Analysis of Sequence
Data, Part I, Griffin, A. M., and Griffin, H. G., eds., Humana
Press, New Jersey, 1994; Sequence Analysis in Molecular Biology,
von Heinje, G., Academic Press, 1987; and Sequence Analysis Primer,
Gribskov, M. and Devereux, J., eds., M Stockton Press, New York,
1991; and Carillo, H., and Lipman, D., SIAM J. Applied Math., 48:
1073 (1988)). Methods to determine identity are designed to give
the largest match between the sequences tested. Moreover, methods
to determine identity are codified in publicly available computer
programs. Computer program methods to determine identity between
two sequences include, but are not limited to, the GCG program
package (Devereux, J., et al., Nucleic Acids Research 112(1): 387
(1984)), BLASTP, BLASTN, and FASTA (Altschul, S. F. et al., J. I
Molec. Biol. 215: 403-410 (1990) and Altschul et al. Nuc. Acids
Res. 25: 3389-3402 (1997)). The BLAST X program is publicly
available from NCBI and other sources (BLAST Manual, Altschul, S.,
et al., NCBI NLM NIH Bethesda, Md. 20894; Altschul, S., et al., J.
Mol. Biol. 215: 403-410 (1990)). The well known Smith Waterman
algorithm may also be used to determine identity.
[0056] Once an individual is known to be susceptible to
hypertension, currently available methods to reduce or prevent a
rise in blood pressure may be used. Examples of currently available
methods to reduce and/or prevent hypertension include, for example,
diet, exercise, multidrug regimens including combinations of
antihypertensive drugs such as beta blockers, diuretics, calcium
antagonists, angiotensin II active agents, heart rate-reducing
nondihydropyridine calcium antagonists, and angiotensin-converting
enzyme (ACE) inhibitors. Alternatively, compounds that modulate
Dear function may be administered. Where the individual already has
hypertension knowing the basis for that hypertension can be used to
determine treatment regime.
[0057] Methods to detect the presence or absence of mutations
and/or polymorphisms in genes such as Dear are known to those of
skill in the art and certain embodiments are as follows:
Preparation of Samples
[0058] Mutations and/or polymorphisms are detected in a target
nucleic acid from an individual being analyzed. For example, for
assay of genomic DNA, virtually any biological sample (other than
pure red blood cells) is suitable. For example, convenient tissue
samples include whole blood, semen, saliva, tears, urine, fecal
material, sweat, buccal, skin and hair. For assay of cDNA or mRNA,
the tissue sample must be obtained from an organ in which the
target nucleic acid is expressed, see for example, FIG. 5B, which
shows Dear expression in heart, brain, kidney, liver, spleen, lung,
aorta, testis, and uterus.
[0059] Many of the methods described below require amplification of
DNA from target samples. This can be accomplished by e.g., PCR. See
generally PCR Technology: Principles and Applications for DNA
Amplification (ed. H. A. Erlich, Freeman Press, NY, N.Y., 1992);
PCR Protocols: A Guide to Methods and Applications (eds. Innis, et
al., Academic Press, San Diego, Calif., 1990); Mattila et al.,
Nucleic Acids Res. 19, 4967 (1991); Eckert et al., PCR Methods and
Applications 1, 17 (1991); PCR (eds. McPherson et al., IRL Press,
Oxford); and U.S. Pat. No. 4,683,202 (each of which is incorporated
by reference for all purposes).
[0060] Other suitable amplification methods include the ligase
chain reaction (LCR) (see Wu and Wallace, Genomics 4, 560 (1989),
Landegren et al., Science 241, 1077 (1988), transcription
amplification (Kwoh et al., Proc. Natl. Acad. Sci. USA 86, 1173
(1989)), and self-sustained sequence replication (Guatelli et al.,
Proc. Nat. Acad. Sci. USA, 87, 1874 (1990)) and nucleic acid based
sequence amplification (NASBA). The latter two amplification
methods involve isothermal reactions based on isothermal
transcription, which produce both single stranded RNA (ssRNA) and
double stranded DNA (dsDNA) as the amplification products in a
ratio of about 30 or 100 to 1, respectively.
Detection of Mutations and/or Polymorphisms in Target DNA
[0061] The identity of bases occupying mutated or polymorphic sites
can be determined in an individual (e.g., a patient being analyzed)
by several methods, which are described in turn.
Allele-Specific Probes
[0062] The design and use of allele-specific probes for analyzing
mutations and/or polymorphisms is described by e.g., Saiki et al.,
Nature 324, 163-166 (1986); Dattagupta, EP 235,726, Saiki, WO
89/11548. Allele-specific probes can be designed that hybridize to
a segment of target DNA from one individual but do not hybridize to
the corresponding segment from another individual due to the
presence of different mutated or polymorphic forms in the
respective segments from the two individuals. Hybridization
conditions should be sufficiently stringent that there is a
significant difference in hybridization intensity between alleles,
and preferably an essentially binary response, whereby a probe
hybridizes to only one of the alleles. Some probes are designed to
hybridize to a segment of target DNA such that the polymorphic site
aligns with a central position (e.g., in a 15 mer at the 7
position; in a 16 mer, at either the 8 or 9 position) of the probe.
This design of probe achieves good discrimination in hybridization
between different allelic forms.
[0063] Allele-specific probes are often used in pairs, one member
of a pair showing a perfect match to a reference form of a target
sequence and the other member showing a perfect match to a variant
form. Several pairs of probes can then be immobilized on the same
support for simultaneous analysis of multiple mutations and/or
polymorphisms within the same target sequence.
Tiling Arrays
[0064] The mutations and/or polymorphisms can also be identified by
hybridization to nucleic acid arrays, some example of which are
described by WO 95/11995 (incorporated by reference in its entirety
for all purposes). The same array or a different array can be used
for analysis of characterized mutations and/or polymorphisms. WO
95/11995 also describes subarrays that are optimized for detection
of a variant form of a precharacterized mutation and/or
polymorphism. Such a subarray contains probes designed to be
complementary to a second reference sequence, which is an allelic
variant of the first reference sequence. The second group of probes
is designed by the same principles as described above except that
the probes exhibit complementarily to the second reference
sequence. The inclusion of a second group (or further groups) can
be particularly useful for analyzing short subsequences of the
primary reference sequence in which multiple mutations are expected
to occur within a short distance commensurate with the length of
the probes (i.e., two or more mutations within 9 to 21 bases).
Allele-Specific Primers
[0065] An allele-specific primer hybridizes to a site on target DNA
overlapping a mutation and/or polymorphism and only primes
amplification of an allelic form to which the primer exhibits
perfect complementarily. See Gibbs, Nucleic Acid Res. 17, 2427-2448
(1989). This primer is used in conjunction with a second primer
which hybridizes at a distal site. Amplification proceeds from the
two primers leading to a detectable product signifying the
particular allelic form is present. A control is usually performed
with a second pair of primers, one of which shows a single base
mismatch at the polymorphic site and the other of which exhibits
perfect complementarily to a distal site. The single-base mismatch
prevents amplification and no detectable product is formed. The
method works best when the mismatch is included in the 3'-most
position of the oligonucleotide aligned with the mutation and/or
polymorphism because this position is most destabilizing to
elongation from the primer. See, e.g., WO 93/22456.
Direct-Sequencing
[0066] The direct analysis of the sequence of mutation and/or
polymorphisms of the present invention can be accomplished using
either the dideoxy-chain termination method or the Maxam-Gilbert
method (see Sambrook et al., Molecular Cloning, A Laboratory Manual
(2nd Ed., CSHP, New York 1989); Zyskind et al., Recombinant DNA
Laboratory Manual, (Acad. Press, 1988)).
Denaturing Gradient Gel Electrophoresis
[0067] Amplification products generated using the polymerase chain
reaction can be analyzed by the use of denaturing gradient gel
electrophoresis. Different alleles can be identified based on the
different sequence-dependent melting properties and electrophoretic
migration of DNA in solution. Erlich, ed., PCR Technology,
Principles and Applications for DNA Amplification, (W. H. Freeman
and Co, New York, 1992), Chapter 7.
Single-Strand Conformation Mutation and/or Polymorphism
Analysis
[0068] Alleles of target sequences can be differentiated using
single-strand conformation mutation and/or polymorphism analysis,
which identifies base differences by alteration in electrophoretic
migration of single stranded PCR products, as described in Orita et
al., Proc. Nat. Acad. Sci. 86, 2766-2770 (1989). Amplified PCR
products can be generated as described above, and heated or
otherwise denatured, to form single stranded amplification
products. Single-stranded nucleic acids may refold or form
secondary structures which are partially dependent on the base
sequence. The different electrophoretic mobilities of
single-stranded amplification products can be related to
base-sequence difference between alleles of target sequences.
Antibody Detection Methods
[0069] According to another aspect of the present invention an
antibody specific for an allelic variant (mutation and/or
polymorphism) of human Dear polypeptide is used to detect the
presence or absence of Dear mutations and/or polymorphisms.
[0070] Antibodies can be prepared using any suitable method. For
example, purified polypeptide may be utilized to prepare specific
antibodies. The term "antibodies" is meant to include polyclonal
antibodies, monoclonal antibodies, and the various types of
antibody constructs such as for example F(ab')2, Fab and single
chain Fv. Antibodies are defined to be specifically binding if they
bind the allelic variant of Dear with a Ka of greater than or equal
to about 10.sup.7 M-1. Affinity of binding can be determined using
conventional techniques, for example those described by Scatchard
et al., Ann. N.Y. Acad. Sci., 51:660 (1949).
[0071] Polyclonal antibodies can be readily generated from a
variety of sources, for example, horses, cows, goats, sheep, dogs,
chickens, rabbits, mice or rats, using procedures that are
well-known in the art. In general, antigen is administered to the
host animal typically through parenteral injection. The
immunogenicity of antigen may be enhanced through the use of an
adjuvant, for example, Freund's complete or incomplete adjuvant.
Following booster immunizations, small samples of serum are
collected and tested for reactivity to antigen. Examples of various
assays useful for such determination include those described in:
Antibodies: A Laboratory Manual, Harlow and Lane (eds.), Cold
Spring Harbor Laboratory Press, 1988; as well as procedures such as
countercurrent immuno-electrophoresis (CIEP), radioimmunoassay,
radioimmunoprecipitation, enzyme-linked immuno-sorbent assays
(ELISA), dot blot assays, and sandwich assays, see U.S. Pat. Nos.
4,376,110 and 4,486,530.
[0072] Monoclonal antibodies may be readily prepared using
well-known procedures, see for example, the procedures described in
U.S. Pat. Nos. 4,902,614, 4,543,439 and 4,411,993; Monoclonal
Antibodies, Hybridomas: A New Dimension in Biological Analyses,
Plenum Press, Kennett, McKearn, and Bechtol (eds.), (1980).
[0073] Monoclonal antibodies to variant forms of Dear can be
produced using alternative techniques, such as those described by
Alting-Mees et al., "Monoclonal Antibody Expression Libraries: A
Rapid Alternative to Hybridomas", Strategies in Molecular Biology
3: 1-9 (1990) which is incorporated herein by reference. Similarly,
binding partners can be constructed using recombinant DNA
techniques to incorporate the variable regions of a gene that
encodes a specific binding antibody. Such a technique is described
in Larrick et al., Biotechnology, 7: 394 (1989).
[0074] Once isolated and purified, the antibodies may be used to
detect the presence of variant Dear in a sample using established
assay protocols, see for example "A Practical Guide to ELISA" by D.
M. Kemeny, Pergamon Press, Oxford, England. As is known to those of
skill in the art, a suitable control sample (i.e. a sample with
wild type or non-mutated and/or polymorphic Dear) is used as a
control.
[0075] Also encompassed are methods for the determination of
expression levels. For example, the overexpression of Dear is an
indication that an individual is susceptible to or is currently
afflicted with hypertension. Methods for analyzing expression
levels are known to those of skill in the art. In one aspect of the
invention, Dear levels present in a test biological sample are
measured by analyzing the level of Dear mRNA in a test sample and
comparing this level to the level of Dear in a control sample. In
another embodiment, Dear levels present in a test biological sample
are measured by contacting the test sample, or preparation thereof,
with an endogenous control 18S rRNA. A preferred embodiment of the
present invention is the use of laser capture microdissection and
RT-PCR for the analysis of Dear mRNA from tissue samples. Laser
capture microdissection is known to those of skill in the art and
described, for example, in Simon et al. (1998) Trends in Genetics
14:272 and Emmert-Buck et al. (1996) Science 274:998-1001.
[0076] In another aspect of the invention, Dear levels present in a
test biological sample are measured by contacting the test sample,
or preparation thereof, with an antibody-based binding moiety that
specifically binds to Dear protein, or to a portion thereof. The
antibody-based binding moiety forms a complex with Dear that can be
detected, thereby allowing the levels of Dear to be measured.
[0077] Any means known to those skilled in art can be used to asses
Dear levels. For example, in some embodiments Dear expression
levels are assayed by measuring levels of Dear via mass
spectrometry, ELISA, MR, CT, PET targeted at Dear or
immunohistochemistry.
[0078] In a further embodiment, the invention provides for kits
that comprise means for measuring Dear in a biological sample.
DEFINITIONS
[0079] "Dear", "DEAR", or "Dear" as used herein and throughout is
the Dual Endothelin-1/Angiotensin II Receptor.
[0080] Polymorphism refers to the occurrence of two or more
genetically determined alternative sequences or alleles in a
population. A polymorphic marker or site is the locus at which
divergence occurs. Preferred markers have at least two alleles,
each occurring at frequency of greater than 1%, and more preferably
greater than 10% or 20% of a selected population. A polymorphic
locus may be as small as one base pair. Polymorphic markers include
restriction fragment length polymorphisms, variable number of
tandem repeats (VNTR's), hypervariable regions, minisatellites,
dinucleotide repeats, trinucleotide repeats, tetranucleotide
repeats, simple sequence repeats, and insertion elements such as
Alu. The first identified allelic form is arbitrarily designated as
the reference form and other allelic forms are designated as
alternative or variant alleles.
[0081] The allelic form occurring most frequently in a selected
population is sometimes referred to as the wild type form. Diploid
organisms may be homozygous or heterozygous for allelic forms. A
dialletic polymorphism has two forms. A triallelic polymorphism has
three forms.
[0082] A single nucleotide polymorphism occurs at a polymorphic
site occupied by a single nucleotide, which is the site of
variation between allelic sequences. The site is usually preceded
by and followed by highly conserved sequences of the allele (e.g.,
sequences that vary in less than 1/100 or 1/1000 members of the
populations).
[0083] A single nucleotide polymorphism usually arises due to
substitution of one nucleotide for another at the polymorphic site.
A transition is the replacement of one purine by another purine or
one pyrimidine by another pyrimidine. A transversion is the
replacement of a purine by a pyrimidine or vice versa. Single
nucleotide polymorphisms can also arise from a deletion of a
nucleotide or an insertion of a nucleotide relative to a reference
allele.
II. Angiogenesis
A. Inhibiting Angiogenesis
[0084] In another embodiment of the present invention, a method of
inhibiting angiogenesis in a tissue of an individual having a
disease or disorder dependent or modulated by angiogenesis, wherein
the disease or disorder can be treated by the inhibition of
angiogenesis is disclosed. Generally, the method comprises
administering to the tissue a composition comprising an
angiogenesis-inhibiting amount of Dear inhibitor.
[0085] In a related embodiment, the methods of the present
invention provide for a method of inhibiting angiogenesis in a
tissue of an individual at risk for developing an angiogenic
disease or disorder.
[0086] Where the growth of new blood vessels is the cause of, or
contributes to, the pathology associated with a disease, inhibition
of angiogenesis will reduce the deleterious effects of the disease.
Examples include tumors, rheumatoid arthritis, diabetic
retinopathy, inflammatory diseases, restenosis, and the like. Where
the growth of new blood vessels is required to support growth of a
deleterious tissue, inhibition of angiogenesis will reduce the
blood supply to the tissue and thereby contribute to reduction in
tissue mass based on blood supply requirements. Examples include
growth of tumors where neovascularization is a continual
requirement in order that the tumor growth beyond a few millimeters
in thickness, and for the establishment of solid tumor metastases.
Another example is coronary plaque enlargement.
[0087] The invention provides for a method for the inhibition of
angiogenesis in a tissue, and thereby inhibiting events in the
tissue which depend upon angiogenesis.
[0088] The treatment will involve the administration of a Dear
inhibitor. The treatment may involve a combination of treatments,
including, but not limited to a Dear inhibitor in combination with
other angiogenic inhibitors, chemotherapy, radiation, surgery, or
other treatments known to those of skill in the art to inhibit
angiogenesis. Examples of angiogenic inhibitors that may be used in
combination with the Dear inhibitor of the present invention are:
direct angiogenesis inhibitors, Angiostatin, Bevacizumab (Avastin),
Arresten, Canstatin, Combretastatin, Endostatin, NM-3,
Thrombospondin, Tumstatin, 2-methoxyestradiol, and Vitaxin; and
indirect angiogenesis inhibitors: ZD1839 (Iressa), ZD6474, OS1774
(Tarceva), CI1033, PKI1666, IMC225 (Erbitux), PTK787, SU6668,
SU11248, Herceptin, and IFN-.alpha., CELEBREX.RTM. (Celecoxib),
THALOMID.RTM. (Thalidomide), and IFN-.alpha..
[0089] Thus, in connection with the administration of a Dear
inhibitor, a compound which inhibits angiogenesis indicates that
administration in a clinically appropriate manner results in a
beneficial effect for at least a statistically significant fraction
of patients, such as improvement of symptoms, a cure, a reduction
in disease load, reduction in tumor mass or cell numbers, extension
of life, improvement in quality of life, or other effect generally
recognized as positive by medical doctors familiar with treating
the particular type of disease or condition.
[0090] Examples of Dear inhibitors include, but are not limited to,
molecules which block the binding of AngII, ET-1 and/or other ET-1
or AngII-like ligands to Dear, compounds which interfere with
downstream signaling events of Dear, or other compounds or agents
that inhibit activation of the receptor. Such compounds include
antibodies that bind to Dear and prevent binding of AngII, ET-1 or
other mimetic ligands. Preferably, the antibody is a humanized
antibody. Preferably, the antibody is a single chain antibody or
F(ab).sup.2 fragment. Other inhibitors including small molecules
that bind to the Dear domain that binds to ET-1, soluble Dear
receptors, peptides containing the Dear ET-1 and/or AngII binding
domains, etc.
[0091] There are a variety of diseases or disorders in which
angiogenesis is believed to lead to negative consequences, referred
to as pathological angiogenesis, including but not limited to,
inflammatory disorders such as immune and non-immune inflammation,
chronic articular rheumatism and psoriasis, disorders associated
with inappropriate or inopportune invasion of vessels such as
diabetic retinopathy, neovascular glaucoma, restenosis, capillary
proliferation in atherosclerotic plaques and osteoporosis, and
cancer associated disorders, such as solid tumors, solid tumor
metastases, angiofibromas, retrolental fibroplasia, hemangiomas,
Kaposi sarcoma and the like cancers which require
neovascularization to support tumor growth. In a preferred
embodiment of the present invention, the methods are directed to
inhibiting angiogenesis in a mammal with cancer.
[0092] As described herein, any of a variety of tissues, or organs
comprised of organized tissues, can support angiogenesis in disease
conditions including skin, muscle, gut, connective tissue, joints,
bones and the like tissue in which blood vessels can invade upon
angiogenic stimuli.
[0093] The individual treated in the present invention in its many
embodiments is desirably a human patient, although it is to be
understood that the principles of the invention indicate that the
invention is effective with respect to all mammals, which are
intended to be included in the term "patient". In this context, a
mammal is understood to include any mammalian species in which
treatment of diseases associated with angiogenesis is desirable,
particularly agricultural and domestic mammalian species.
[0094] In a preferred embodiment, the present invention is directed
to methods of inhibiting angiogenesis in a tissue of a mammal
having pathological angiogenesis as in cancer, and in particular
breast cancer and the administration of the Dear inhibitor
eliminates or reduces the presence of the cancer.
B. Enhancing Angiogenesis
[0095] In an alternative embodiment of the present invention, Dear
activators are used to stimulate angiogenesis in tissues or organs
in need of neovascularization or additional blood supply. In these
instances, delivery of a Dear activator alone or in combination
with other angiogenesis stimulators may be beneficial.
[0096] Any condition that would benefit from increased blood flow
are encompassed such as, for example, gangrene, diabetes, poor
circulation, arteriosclerosis, atherosclerosis, coronary artery
disease, myocardial ischemia, myocardial infarction, aortic
aneurysm, arterial disease of the lower extremities,
cerebrovascular disease, etc. In this manner, the methods of the
invention may be used to treat peripheral vascular diseases by
administering Dear activators to promote vascularization. Likewise,
the Dear activators are useful to treat a diseased or hypoxic
heart, particularly where vessels to the heart are partially or
completely obstructed. Other organs with arterial sclerosis may
benefit from Dear activation Likewise, organs whose function may be
enhanced by higher vascularization may be improved by an activation
of Dear. This includes kidneys or other organs which need an
improvement in function. In the same manner, other disorders which
could benefit from increased blood flow include ischemic bowel
disease, cerebro vascular disease, impotence of a vascular basis,
and the like. Additionally, formation of new blood vessels in the
heart is critically important in protecting the myocardium from the
consequences of coronary obstruction. Administration of a Dear
activator into ischemic myocardium can enhance the development of
collaterals, accelerate the healing of necrotic tissue and prevent
infarct expansion and cardiac failure.
[0097] Additionally, Dear activators are useful to prepare a
transplant site for tissues or organs of interest by increasing
vascularization. Such organ transplants include, but are not
limited to, pancreas, kidney, heart, lung, liver, etc. Dear
activators may also be used in combination with other implants as a
surgical adhesion barrier.
[0098] Following in vitro fertilization, the embryo is implanted in
a female for gestation. The methods of the invention can be used to
prepare the uterine vascularized bed for embryo implantation. In
this embodiment, Dear activators are introduced prior to
implantation so as to promote blood vessel formation in the uterine
wall prior to implantation of the embryo, thus promoting
fetal-maternal vascular plexus. Likewise, Dear activators can also
enhance fetal-maternal vascular plexus formation, and/or robust
placental vasculature for successful pregnancy/gestation of both
natural and in vitro fertilized embryos.
[0099] Skilled artisans are able to determine when therapy is
beneficial and where therapy is contraindicated. In general,
patients with known tumors or pathological angiogenesis should not
be given the Dear activators of the present invention.
III. Tumor Pro-Malignant Potential
Decreasing Pro-Malignant Potential of Tumors
[0100] In another embodiment of the present invention, a method of
decreasing the pro-malignant potential of a tumor is disclosed.
Generally, the method consists of administering to the tumor,
systemically or locally, a composition comprising a Dear inhibitor
at a dose which decreases pro-malignant parameters such as, but not
all inclusive, nuclear pleomorphism, nuclear hyperchromasia,
vascular invasion, mosaic tumor vessels, chaotic tumor vessels,
tumor metastasis, etc.
Formulations
[0101] The Dear activators and inhibitors of the present invention
may be administered to an individual via intravenous (I.V.),
intramuscular (I.M.), subcutaneous (S.C.), intradermal (I.D.),
intraperitoneal (I.P.), intrathecal (I.T.), intrapleural,
intrauterine, rectal, vaginal, topical, intratumor and the like.
The Dear modulators (either activators or inhibitors) can be
administered parenterally by injection or by gradual infusion over
time and can be delivered by peristaltic means.
[0102] Administration may be by transmucosal or transdermal means.
For transmucosal or transdermal administration, penetrants
appropriate to the barrier to be permeated are used in the
formulation. Such penetrants are generally known in the art, and
include, for example, for transmucosal administration bile salts
and fusidic acid derivatives. In addition, detergents may be used
to facilitate permeation. Transmucosal administration may be
through nasal sprays, for example, or using suppositories. For oral
administration, the compounds of the invention are formulated into
conventional oral administration forms such as capsules, tablets
and tonics.
[0103] For topical administration, the pharmaceutical composition
(inhibitor or activator of Dear activity) is formulated into
ointments, salves, gels, or creams, as is generally known in the
art.
[0104] The activators and inhibitors of Dear are conventionally
administered intravenously, as by injection of a unit dose, for
example. The term "unit dose" when used in reference to a
therapeutic composition refers to physically discrete units
suitable as unitary dosage for the subject, each unit containing a
predetermined quantity of active material calculated to produce the
desired therapeutic effect in association with the required
diluent; i.e., carrier, or vehicle.
[0105] The compositions are administered in a manner compatible
with the dosage formulation, and in a therapeutically effective
amount. The quantity to be administered and timing depends on the
subject to be treated, capacity of the subject's system to utilize
the active ingredient, and degree of therapeutic effect desired.
Precise amounts of active ingredient required to be administered
depend on the judgment of the practitioner and are peculiar to each
individual.
[0106] The Dear activators and inhibitors useful for practicing the
methods of the present invention are of any formulation or drug
delivery system containing the active ingredients, which is
suitable for the intended use, as are generally known to those of
skill in the art. Suitable pharmaceutically acceptable carriers for
oral, rectal, topical or parenteral (including inhaled,
subcutaneous, intraperitoneal, intramuscular and intravenous)
administration are known to those of skill in the art. The carrier
must be pharmaceutically acceptable in the sense of being
compatible with the other ingredients of the formulation and not
deleterious to the recipient thereof.
[0107] As used herein, the terms "pharmaceutically acceptable",
"physiologically tolerable" and grammatical variations thereof, as
they refer to compositions, carriers, diluents and reagents, are
used interchangeably and represent that the materials are capable
of administration to or upon a mammal without the production of
undesirable physiological effects.
[0108] Formulations suitable for parenteral administration
conveniently include sterile aqueous preparation of the active
compound which is preferably isotonic with the blood of the
recipient. Thus, such formulations may conveniently contain
distilled water, 5% dextrose in distilled water or saline. Useful
formulations also include concentrated solutions or solids
containing the compound which upon dilution with an appropriate
solvent give a solution suitable for parental administration
above.
[0109] For enteral administration, a compound can be incorporated
into an inert carrier in discrete units such as capsules, cachets,
tablets or lozenges, each containing a predetermined amount of the
active compound; as a powder or granules; or a suspension or
solution in an aqueous liquid or non-aqueous liquid, e.g., a syrup,
an elixir, an emulsion or a draught. Suitable carriers may be
starches or sugars and include lubricants, flavorings, binders, and
other materials of the same nature.
[0110] A tablet may be made by compression or molding, optionally
with one or more accessory ingredients. Compressed tablets may be
prepared by compressing in a suitable machine the active compound
in a free-flowing form, e.g., a powder or granules, optionally
mixed with accessory ingredients, e.g., binders, lubricants, inert
diluents, surface active or dispersing agents. Molded tablets may
be made by molding in a suitable machine, a mixture of the powdered
active compound with any suitable carrier.
[0111] A syrup or suspension may be made by adding the active
compound to a concentrated, aqueous solution of a sugar, e.g.,
sucrose, to which may also be added any accessory ingredients. Such
accessory ingredients may include flavoring, an agent to retard
crystallization of the sugar or an agent to increase the solubility
of any other ingredient, e.g., as a polyhydric alcohol, for
example, glycerol or sorbitol.
[0112] Formulations for rectal administration may be presented as a
suppository with a conventional carrier, e.g., cocoa butter or
Witepsol S55 (trademark of Dynamite Nobel Chemical, Germany), for a
suppository base.
[0113] Formulations for oral administration may be presented with
an enhancer. Orally-acceptable absorption enhancers include
surfactants such as sodium lauryl sulfate, palmitoyl carnitine,
Laureth-9, phosphatidylcholine, cyclodextrin and derivatives
thereof; bile salts such as sodium deoxycholate, sodium
taurocholate, sodium glycochlate, and sodium fusidate; chelating
agents including EDTA, citric acid and salicylates; and fatty acids
(e.g., oleic acid, lauric acid, acylcarnitines, mono- and
diglycerides). Other oral absorption enhancers include benzalkonium
chloride, benzethonium chloride, CHAPS
(3-(3-cholamidopropyl)-dimethylammonio-1-propanesulfonate),
Big-CHAPS(N,N-bis(3-D-gluconamidopropyl)-cholamide), chlorobutanol,
octoxynol-9, benzyl alcohol, phenols, cresols, and alkyl alcohols.
An especially preferred oral absorption enhancer for the present
invention is sodium lauryl sulfate.
[0114] Alternatively, the compound may be administered in liposomes
or microspheres (or microparticles). Methods for preparing
liposomes and microspheres for administration to a patient are well
known to those of skill in the art. U.S. Pat. No. 4,789,734, the
contents of which are hereby incorporated by reference, describes
methods for encapsulating biological materials in liposomes.
Essentially, the material is dissolved in an aqueous solution, the
appropriate phospholipids and lipids added, along with surfactants
if required, and the material dialyzed or sonicated, as necessary.
A review of known methods is provided by G. Gregoriadis, Chapter
14, "Liposomes," Drug Carriers in Biology and Medicine, pp. 287-341
(Academic Press, 1979).
[0115] Microspheres formed of polymers or proteins are well known
to those skilled in the art, and can be tailored for passage
through the gastrointestinal tract directly into the blood stream.
Alternatively, the compound can be incorporated and the
microspheres, or composite of microspheres, implanted for slow
release over a period of time ranging from days to months. See, for
example, U.S. Pat. Nos. 4,906,474, 4,925,673 and 3,625,214, and
Jein, TIPS19:155-157 (1998), the contents of which are hereby
incorporated by reference.
[0116] In one embodiment, the Dear activator or inhibitor of the
present invention can be formulated into a liposome, microparticle,
nanoparticle, etc. which is suitably sized to lodge in capillary
beds following intravenous administration. When the liposome,
microparticle or nanoparticle is lodged in the capillary beds
surrounding ischemic tissue, the agents can be administered locally
to the site at which they can be most effective. Suitable liposomes
for targeting ischemic tissue are generally less than about 200
nanometers and are also typically unilamellar vesicles, as
disclosed, for example, in U.S. Pat. No. 5,593,688 to
Baldeschweiler, entitled "Liposomal targeting of ischemic tissue,"
the contents of which are hereby incorporated by reference.
[0117] Preferred particles are those prepared from biodegradable
polymers, such as polyglycolide, polylactide and copolymers
thereof. Those of skill in the art can readily determine an
appropriate carrier system depending on various factors, including
the desired rate of drug release and the desired dosage.
[0118] In one embodiment, the formulations are administered via
catheter directly to the inside of blood vessels. The
administration can occur, for example, through holes in the
catheter. In those embodiments wherein the active compounds have a
relatively long half life (on the order of 1 day to a week or
more), the formulations can be included in biodegradable polymeric
hydrogels, such as those disclosed in U.S. Pat. No. 5,410,016 to
Hubbell et al. These polymeric hydrogels can be delivered to the
inside of a tissue lumen and the active compounds released over
time as the polymer degrades. If desirable, the polymeric hydrogels
can have microparticles or liposomes which include the active
compound dispersed therein, providing another mechanism for the
controlled release of the active compounds.
[0119] The formulations may conveniently be presented in unit
dosage form and may be prepared by any of the methods well known in
the art of pharmacy. All methods include the step of bringing the
active compound into association with a carrier which constitutes
one or more accessory ingredients. In general, the formulations are
prepared by uniformly and intimately bringing the active compound
into association with a liquid carrier or a finely divided solid
carrier and then, if necessary, shaping the product into desired
unit dosage form.
[0120] The formulations may further include one or more optional
accessory ingredient(s) utilized in the art of pharmaceutical
formulations, e.g., diluents, buffers, flavoring agents, binders,
surface active agents, thickeners, lubricants, suspending agents,
preservatives (including antioxidants) and the like.
[0121] Compounds of the present methods may be presented for
administration to the respiratory tract as a snuff or an aerosol or
solution for a nebulizer, or as a microfine powder for
insufflation, alone or in combination with an inert carrier such as
lactose. In such a case the particles of active compound suitably
have diameters of less than 50 microns, preferably less than 10
microns, more preferably between 2 and 5 microns.
[0122] Generally for nasal administration a mildly acid pH will be
preferred. Preferably the compositions of the invention have a pH
of from about 3 to 5, more preferably from about 3.5 to about 3.9
and most preferably 3.7. Adjustment of the pH is achieved by
addition of an appropriate acid, such as hydrochloric acid.
[0123] The preparation of a pharmacological composition that
contains active ingredients dissolved or dispersed therein is well
understood in the art and need not be limited based on formulation.
Typically such compositions are prepared as injectables either as
liquid solutions or suspensions, however, solid forms suitable for
solution, or suspensions, in liquid prior to use can also be
prepared. The preparation can also be emulsified.
[0124] The following is the sequence for rat Dear:
[0125] Rattus norvegicus dual endothelin 1, angiotensin II receptor
(Dear), mRNA:
TABLE-US-00001 GeneID: 446170 Locus tag: RGD:1303105 (SEQ. ID. NO.
1) 1 tttctaaatg attacttttc tagatacctg tttacaaaac agaagatcct
ccctttgaaa 61 ccaaactaaa ctacacttga agaatataaa gtgcacaaag
gaagaccacg atgaatcagt 121 accacccatc ttcccagcat tcaagaatgt
tcagcgcaca ggaggtgcac agtaagtgtt 181 cctgagagga gtggatacaa
cactcaatta tctgggcatg taatgctgat ctgcggtttc 241 ctttacatca
gccggcctcc ttcccggttg ggatcaagga agtgaacaga tgcagactca 301
ctctggcagg caccactgag ccagccattt actctcactg catagcaaag ttattttgtc
361 aacttgtttc caggatcctc tgcttccaca gagcagaaac acctcgtcta
ggggattctg 421 atccttaccc tcttctttac atttctctct ccagagaagg
ttatcctcag ccaaaatcct 481 ccagtatcga cacgtctgag ccgcttgcag
caggtctttg ggttccagga atgaaagtac 541 atagagtgcc agctatggaa
aaggaaataa gggaggcaca ctcagacaca tcacagaaga 601 aaggttactc
tacgaagggt gagcattgag ctgggactgc tggatttcag tgggctgaac 661
gaatcaagag aagcagcatt ttaagagcaa agaaaatgct catcattctc acattaggaa
721 tctgaggctt tactctgggt aacctgtgat tctattggta tttccttaca
aagtgagaac 781 aatgccactt atcacaagtt tcttgtgtga gcccagtgct
caagctctta gataatccaa 841 ataaatgttg ataaagagac tttatattgt
tcataccaat tatcaaaaaa tacaagtaca 901 tttcatgtca gtgtggtaat
aatgttttaa ataacacact tccctacagg gttaagtcta 961 tgccattatt
cttccacgca gacataaagc acttcccaaa tgaagaacac cccagtagtc 1021
agaaacaaaa accatagctg atatgctaag acagggctct ctcctttgta acttcttttt
1081 tcctcaggaa gtctttgaaa gaacacagaa gccaagagaa tcttttgggg
ttttaccttt 1141 tattaatcat ctgtgcttac ttcttaaaat tctaaaacac
tttcaaattt gggggactgg 1201 tgatggctca gtcagtaagg tttcatgaag
atgagggctc ggatcctggc agtcttggaa 1261 agtcaggcat ggcagttcta
gctatagtca ctgctcactg gacagccagc caccgtagct 1321 aaaggcgtaa
gctccagact cagtgaaaga cgacatggca aaaacaacat ggatcagctg 1381
agggatacac ctctggcctc cacgggcaca tacgtgcagg agcatctgaa tgtacttatg
1441 tatacccaca cgaatacata cacatcctac acacatacac actctacagg
aggtatcggg 1501 catgtaagat aatccagacg aatattcact tcacgccctg
atggcagcaa agggatctcg 1561 tgttactttc ataagtttag tcaaagagtt
ctgatgtaga aaaagctcac aagagcaaac 1621 acttttcttc tgggacactg
tcacctttaa aaagtactca aaagggggga aagtgccagg 1681 aaaaagatga
tttatcaatt tgctttcccc cagaattata ttttaattca tcaattttac 1741
tcaaatctaa tgccagattc taactaggac tatatttaat gccactagga ctttagagtg
1801 atcatctaag aaaggagaaa gcaagactct tcctgttcaa atgaggtttc
gggatcatct 1861 gtatgaagga tgtggtagtt ttttgatgct gtctttttaa
ctgctattta taacatgtgt 1921 atagtaattt gagaaaatat ggactatggg
gcattatcta atatcacatt atttcttcct 1981 tttgataaaa attaagctat
gaagtctaat gtcaatatgt gcattatatt taaaccatca 2041 gccacacatg
gctgtatgac taagtgccta agaatccaat ttttttgtgg tatctctctc 2101
tctccctctc tccgtatgtg tgtgtctttc tctgtctctg tctctctctc tctttctctc
2161 tgacgaagga tgataagtag aaatgccata aaaacatata gataaatttt
atatattggg 2221 ggctggagag atggctcagt ggttgagaac actgactgtt
cttcagaggt cctgagttaa 2281 attcccagca accacatggt agctcacaac
catctatatt gcatctgatg ccctcttctg 2341 gtgtgtctaa agacagctac
cggtatactt acatataata aataaatctt taaaaaaatt 2401 ttttatatat
taaaaaaaaa tcacataatg taataaccag gagaaatacg aacaatcgat 2461
aaaattactg gtcttgaagg ggcattaaat aattagcaaa ataaaaacaa aattaatatt
2521 gttgcttagt gaatccagaa ttttgaaaac atccactata tataataaac
ataccaacta 2581 actaaagtca gcctttagat aacccaggga aaactgaaga
gactcggcga cttcacatga 2641 agccttactt tatccaagcg gaagaaagca
gcaccttggt atgagcacac tttatgtaac 2701 agctgtacca aaaagccaca
gcagtttgcc aaagtgtcaa gccatgatga gcaggacact 2761 gcttacaggc
atggctatgt atctggacag cagccatgcg ggtgctgcat ccatgcaggt 2821
gagctggccg cccttactca cctctttggg gagcaaggag atgaagtctc gctggaactg
2881 gggctcgatc acttgcatca tgtgcttcac ttgtgtgggt tcacagctat
cgatgagctc 2941 atctaaggcc agcaacttct ctggtccact ccagctctac
caaagaggaa ttggacacat 3001 tacaaatcca tacagaagac caccagcacc
tgcatggcca tgttcgagca gtggaactac 3061 atgaaagggg accgtggaca
gagaccttgt ctccagaagc caccagagcg atagcagttt 3121 ttagtttcag
caagtttact cagtaccttt cccgcaaagc attaaaagtc atgactggca 3181
gaaaaataag tctgcattta tttttaatta taagacttat gctaacacca agacactggg
3241 agacacacaa tatccatctg ggttattgac tag (SEQ. ID. NO. 2)
Translation = "MSTLYVTAVPKSHSSLPKCQAMMSRTLLTGMAMY
LDSSHAGAASMQVSWPPLLTSLGSKEMKSRWNWGSITCIMCFTCVGSQL
SMSSSKASNFSGPLQLYQRGIGHITNPYRRPPAPAWPCSSSGTT"
Example 1
[0126] The inbred Dahl/JR rat model is an established model of
human essential hypertension comprised of a salt-sensitive,
hypertensive strain (Dahl S) with its cognate salt-resistant,
normotensive control strain (Dahl R) (52). To investigate the
involvement of Dear in hypertension pathogenesis we obtained cDNAs
spanning the entire amino acid coding region for both Dahl S and
Dahl R receptors. Two nucleotide differences were detected
resulting in two non-conservative amino acid substitutions:
T.sup.2814 (Dahl S)/C.sup.2814 (Dahl R) nucleotide transition
resulting in S44P substitution and T.sup.2901 (Dahl S)/C.sup.2901
(Dahl R) nucleotide transition resulting in M74T substitution (FIG.
1A, 1B). The S44P substitution is located in the putative AngII
binding site in the extracellular domain; while the M74T
substitution is located in the putative transmembrane domain (FIG.
1B). The Dahl S cDNA nucleotide sequence is identical to the
previously reported Sprague Dawley rat brain Dear cDNA (1). We note
that both the Dahl S and Dahl R rat strains were derived from the
Sprague Dawley strain (52).
[0127] The S44P substitution spans the predicted AngII binding
domain within the Dahl R Dear variant (1) (FIG. 1B) suggesting the
hypothesis that AngII-binding will most likely be different between
Dahl S and Dahl R receptors. In order to examine this hypothesis,
we first determined that there is no significant difference in Dear
expression levels between Dahl S and Dahl R rats at 12 weeks of age
in both male and female rats as detected by western blot analysis
comparing Dahl S and Dahl R kidney membranes (FIG. 1C). To examine
hormone binding, both Dahl S and Dahl R receptors were transiently
expressed in Cos1 cells respectively and tested for both AngII and
ET-1 binding. Dahl R Dear do not exhibit AngII binding, but exhibit
normal ET-1 binding as shown by direct radioligand binding (FIG. 2
and Table 1), and by west-western blot analysis (i.e., labeled
ligand [west] binding to receptor polypeptide on western blot) of
Dahl S and Dahl R rat kidney membranes and Dahl S and Dahl R Dear
Cost-transfectant cell membranes (FIG. 2C). These data demonstrate
that the Dahl S Dear variant is a dual receptor binding both ET-1
and AngII similar to the brain-derived clone first characterized
(1), but that the Dahl R Dear variant responds solely to ET-1
stimulation. Two affinity binding sites for ET-1 are detected in
Dahl S and Dahl R receptors (FIG. 3, Table 1) and two affinity
binding sites for AngII in Dahl S receptors (FIG. 3, Table 1)
consistent with previous characterization (1). Furthermore, when
compared to the Dahl R Dear S44P/M74S variant, the Dahl S Dear
S44/M74 variant exhibits 3-fold increased affinity for ET-1 (Dahl
R: S44P/M74T K.sub.H ET-1=12.0.+-.1.12 pM; Dahl S: S44/M74 K.sub.H
ET-1=4.42.+-.0.89 pM, P<0.001, Table 1)--suggesting an enhanced
response of the Dahl S receptor to ET-1 stimulation compared to the
Dahl R receptor.
[0128] Based on its localization to the predicted AngII-binding
site, it is likely that the S44P substitution accounts for the
observed absent AngII binding in Dahl R Dear. Interestingly, this
S44P substitution and resultant differential AngII binding
elucidates for the first time a natural occurring mutation within a
peptide-ligand binding domain predicted by the molecular
recognition theory (1).
[0129] Having found functionally significant variants between Dahl
S and Dahl R Dear genes, we then investigated the potential genetic
contribution to hypertension susceptibility by performing
independent QTL analysis on both male (n=106) and female (n=102) F2
[RxS]-intercross rats phenotyped for blood pressure by
radiotelemetry after 8 and 12 weeks of high salt (8% NaCl)
challenge respectively (Table 2). The high-salt diet challenge was
extended 4 weeks longer for the F2 [RxS]-intercross female rats
since female BP phenotype was much lower than in male F2
[RxS]-intercross rats (average F2 [RxS]-intercross male SBP after
eight weeks of high salt diet=157.2.+-.14.2 mmHg; average F2
[RxS]-intercross female SBP after twelve weeks of high salt
diet=145.0.+-.11.4 mmHg, Table 2). Using an SSCP-based Dear
gene-specific marker (FIG. 4A), we mapped the rat Dear to
chromosome 2 (physical position in the current assembly of the rat
genome: 2q34, 176.687 Mb), 4.5 cM centromeric to the
.alpha.1-Na,K-ATPase locus, ATP1A1. A total chromosome-2 scan was
then done with 11 informative markers that distinguish Dahl R and
Dahl S strains. Marker regression and interval mapping analyses
detect a single chromosomal region with suggestive linkage to mean,
systolic and diastolic BP, peaking at ATP1A1+2 cM (LOD=1.70) in the
F2 [R.times.S] male cohort (FIG. 4B, Table 2). In contrast,
chromosome-2 scan analysis of F2 [R.times.S]-intercross females
revealed two QTLs on chromosome 2, one centered at D2Rat143
(LOD=2.43, significant linkage) and the other centered at Dear-5 cM
(LOD=3.61, highly significant linkage) (FIG. 4C, Table 2). To
assess pathophysiological relevance, analysis of Dear
allele-specific contribution (Table 3) reveals that the Dahl S
S44/M74 variant increases susceptibility to hypertension regardless
of BP parameter--systolic, diastolic or mean arterial pressure with
greatest changes in mean arterial pressure (ANOVA P<10.sup.-3 to
10.sup.-4). Concordance of results in different blood pressure
parameters provide evidence delineating the Dear locus as a gene
for hypertension susceptibility in F2 [RxS]-intercross female
rats.
[0130] To date, only Dear (shown here) and ATP1A1 (38, 43) genes
exhibit functionally significant variants between Dahl S and Dahl R
rats with demonstrated pathogenic relevance to hypertension. These
data forward said two loci as candidate genes for the Dear-5 cM QTL
region on chromosome 2 affecting BP in female F2
[R.times.S]-intercross rats based on a 4-parameter analysis
framework for hypertension genes (37, 54). The causal role of
ATP1A1 in hypertension has been shown by transgenesis in both male
and female Dahl S rats (38). While putative gene interactions need
to be investigated for Dear, ATP1A1-Na,K,2Cl-cotransporter (NKCC2)
gene-interaction has been detected to increase susceptibility to
high blood pressure in cosegregation analysis of F2 [R.times.S]
intercross rats (39). This epistatic nature of the ATP1A1 effect on
BP could account for the reduced statistical significance of
linkage to BP detected at ATP1A1 when analyzed as a single locus as
done in this chromosome 2 scan and in previous F2-intercross and
congenic studies (34, 53).
[0131] To further analyze the Dear locus in the context of previous
genetic rat model studies which report chromosome 2 QTLs for BP
which span the Dear locus (31, 34, 41, 51, 59), we assessed Dear
variants on WKY, SHR, BN and LEW rat strains used in said studies
by SSCP analysis. As shown in FIG. 4A, the Dahl R Dear S44P/M74T
variant is detected in Dahl R and LEW strains, while the Dahl S
Dear S44/M74 variant is detected in SHR, WKY and BN strains.
Detection of variant-specific alleles in the different strains was
corroborated by direct nucleotide sequencing of two independent
Dear cDNA clones spanning the entire amino acid coding region (data
not shown). Since SHR, WKY and BN rat strains have the S44/M74 Dahl
S Dear allele, the Dear locus is a priori eliminated as a candidate
gene for the chromosome 2 QTL for BP in F2-intercross studies
derived from these strains (31, 41, 51, 59). The Dear locus is also
eliminated as candidate gene for the reported chromosome 2 BP QTL
in F2 [Dahl S.times.LEW]-intercross study which investigated males
only (34), since the Dear S-variant cosegregates with high blood
pressure in females.
[0132] Thus, observations from genetic, molecular and
pathophysiological analyses suggest that modification in the
balance of AngII and ET-1 receptor systems through variant Dear
contributes to hypertension susceptibility in female F2
[RxS]-intercross rats. The data reiterate the importance of
gender-specific factors in hypertension susceptibility and the role
of Dear in AngII-ET-1 response-balance.
Materials and Methods
[0133] Characterization of Dahl S and Dahl R Dear cDNAs
[0134] Dahl S and Dahl R Dear cDNAs were RT-PCR from Dahl S/JRHsd
and Dahl R/JRHsd rat kidney PolyA.sup.+ RNAs respectively (Forward
primer: 5'-AAG-AAA-GCA-GCA-CCT-TGG-T-3' (SEQ. ID. NO. 3); Reverse
primer: 5'-CGT-GGA-CAG-AGA-CCT-TGT-CT-3' (SEQ. ID. NO. 4)) and
subsequently subcloned into the PT-vector system (Clontech, Palo
Alto, Calif.). Primer sequences were obtained from the previously
reported Sprague Dawley Dear cDNA (GenBank accession number
AY664492). The cDNAs (432 bp) encompassing the entire Dear amino
acid coding region was then sequenced on both strands. Six Dahl S
and six Dahl R rats were sequenced showing no intra-strain sequence
heterogeneity.
Detection of the Dear Gene S44P/M74T Variant by Single Strand
Conformation Polymorphism (SSCP) Analysis
[0135] Dahl S/jrHsd, Dahl R/jrHsd, LEW/SsNHsd, WKY/NHsd, SHR/NHsd
and BN/Hsd rats were purchased from Harlan Inc. (Indianapolis,
Ind.). SSCP analysis was performed on genomic DNA isolated from the
different rat strains essentially as described (60). The SSCP
marker was based on a PCR product encompassing nucleotides
2774-2911 (spanning the S44P substitution) within the amino acid
encoding region of the Dear cDNA (forward primer:
5'-GCT-ATG-TAT-CTG-GAC-AGC-AGC-3' (SEQ. ID. NO. 5); reverse primer:
5'-AGT-GAA-GCA-CAT-GAT-GCA-AGT-3'(SEQ. ID. NO. 6); product: 137 bp)
(1). The SSCP marker was detected by 6% non-denaturing
polyacrylamide gel electrophoresis.
Receptor Expression and Membrane Preparation
[0136] The Dahl S and Dahl R Dear cDNAs were subcloned
directionally (5' to 3') into the pcDNA (+) expression vector
(Invitrogen, Carlsbad, Calif.) and transiently expressed in Cost
cells (ATCC). Cos1 cells were transfected with the expression
vectors via lipofectin-mediated gene transfer and cell membranes
were isolated 72 hr post-transfection for hormone binding. Rat
kidney membranes were prepared essentially as described (42). COS-1
cell membranes were isolated as described (36). Briefly, cells were
washed twice in phosphate-buffered saline and homogenized in
10-fold ice-cold buffer (0.25 M sucrose, 1 mM EDTA, 50 .mu.g/ml
aprotinin, 10 .mu.g/ml leupeptin, 100 .mu.M phenylmethylsulfonyl
fluoride, 25 mM Imidazol/HCl, pH 7.4). The homogenate was
centrifuged at 5,000 g for 15 min and the pellet was discarded. The
supernatant was then centrifuged at 27,500 g for 30 min and the
resulting pellet was washed twice in ice-cold suspension buffer (5
mM MgCl.sub.2, 0.2 mM EDTA, 50 mM Hepes, pH 7.4). The final pellet
was resuspended into the appropriate assay buffer and quickly
frozen in liquid nitrogen. The membrane preparations were store at
-80.degree. C. until use. Protein concentrations of the membranes
were determined by BCA protein assay kit (PIERCE).
Radioligand Binding Assays
[0137] Binding of [.sup.125I]Tyr.sup.4-angiotensin II and
[.sup.125I]Tyr.sup.13-endothelin-1 to COS-1 membranes was performed
by a rapid filtration method (32, 50). Briefly,
[.sup.125I]Tyr.sup.4-angiotensin II (0.25.about.6.5 nM) or
[.sup.125I]Tyr.sup.13-endothelin-1 (0.045.about.1.46 nM) was
incubated with membranes (100 .mu.g) for 20 min at 37.degree. C. in
1000 buffer A (5 mM MgCl.sub.2, 0.2 mM EDTA, 10 mg/ml BSA, 10 mM
Hepes, pH7.4). Binding reactions were terminated by the addition of
1 ml ice-cold buffer A and immediately filtered through a Whatman
GF/C filter (presoaked overnight at 4.degree. C. in 10 mg/ml BSA)
and subsequently washed with 15 ml ice-cold buffer A. Specific
binding was determined as the difference between the total
radioactivity bound to membranes and the radioactivity bound to
blanks containing 1 .mu.M AngII or 1 .mu.M ET-1. The dissociation
constant (K.sub.d) and maximum ligand-binding sites (B.sub.max)
were determined using Hill plot analysis (55). Hill coefficient
values (h) were calculated from the relationship ln
[B/(B.sub.max-B)]=h ln [free Radioligand]-ln K.sub.d. An F test
(P<0.05) was used to determine whether the saturation binding
curves best fitted one or two independent binding sites. The data
were best fit by two affinity states determined by Scatchard plot
analysis; K.sub.H and K.sub.L designate the K.sub.d for high- and
low-affinity states of the receptor, respectively (44). Most
results are expressed as the mean.+-.SE (standard error) from three
to five independent experiments.
Western and West-Western Blotting Analysis
[0138] A polyclonal rabbit antipeptide antibody raised against the
synthetic peptide P.sub.51LLTSLGSKE.sub.60 (SEQ. ID. NO. 7) was
utilized for western blot analysis (1). Plasma membranes (40 .mu.g
protein/lane) were subjected to 12.5% SDS-PAGE and the separated
proteins electro-transferred onto PVDF membranes which were
incubated with blocking buffer (0.3% Tween-20, 5% non-fat milk, 137
mM NaCl, 2.7 mM KCl, 8.1 mM Na.sub.2HPO.sub.4, and 1.5 mM
KH.sub.2PO.sub.4, pH7.4) for 2 hr at room temperature, and then
incubated with primary antibody (1:500) for 16 hr at 4.degree. C.
The PVDF membranes were then sequentially incubated with
biotinylated goat anti-rabbit IgG followed by immunostaining with
horseradish peroxidase-linked streptavidin. To confirm the
interaction between Dear and ligands, we performed west-western
blot analysis (62). Briefly, protein blots of kidney and COS-1 cell
membranes were incubated with radioligands (0.5 .mu.Ci in 10 ml) in
buffer A at 37.degree. C. for 16 hr. PVDF membranes were then
washed three times for 15 min with buffer A at 37.degree. C. and
exposed to X-ray film at -80.degree. C. for 1-3 days.
Genetic Crosses
[0139] Dahl S/jrHsd and Dahl R/jrHsd rat strains (Harlan,
Indianapolis, Ind.) were used to develop the F2 cohort. The F2
cohort was derived from brother-to-sister mating of F1 (R
female.times.S male) hybrids to produce the F2 male (n=106,
carrying exclusively Y chromosomes from the Dahl S genetic
background) and F2 female (n=102) segregating populations.
Phenotypic Characterization of F2 Cohorts
[0140] All animal procedures were performed in accordance with
institutional guidelines. Animals were maintained on a LabDiet 5001
rodent chow (Harlan Teklad, Madison Wis.) containing 0.4% NaCl from
weaning until the high salt diet begun at 12 weeks of age. The food
pellets and water were made available ad lib. Blood pressure (BP)
was measured essentially as described (38) using intra-aortic
abdominal radiotelemetric implants (DATASCIENCE) obtaining
non-stressed blood pressure measurements taking the average over
ten-seconds every 5 minutes for 24 hours (38). Systolic (SBP),
diastolic (DBP) and mean arterial pressures (MAP) were obtained
along with heart rate and activity. The protocol for the F2 rats
was as follows: implant surgery at 10 weeks of age; only rats with
no post-operative complications were used; after 12 days, baseline
BP levels were obtained. High salt (8% NaCl) challenge was begun at
12 weeks of age and maintained for eight weeks for male and twelve
weeks for female F2-intercross rats; a longer high-salt challenge
was necessary for females to attain a similar F2-mean BP since BP
in females is lower. BP values used for phenotype are the averages
obtained in the final week of the salt loading from a 24-hour
recording during a no-entry day ascertaining non-stress BP. We note
that baseline BP means for SBP, DBP and MAP were equivalent, .+-.1
mmHg range for all three BP parameters among the different Dear
genotypes (P>0.5).
Intercross Linkage Analysis
[0141] Genotyping was done with 10 chromosome-2 microsatellite
markers informative for our Dahl [R.times.S] intercross and one
SSCP-based Dear marker (described above). Marker regression and QTL
analyses was performed with the Map Manager QTXb17 (MMQTXb17)
program (46) using MAP as quantitative trait. MMQTXb17 generates a
likelihood ratio statistic (LRS) as a measure of the significance
of a possible QTL. Genetic distances were calculated using Kosambi
mapping function (genetic distances are expressed in cM). Critical
significance values (LRS values) for linkage were determined by a
permutation test (2000 permutations at 10 cM interval) on our male
and female progenies using Kosambi mapping function and a free
regression model. Thus, the minimum LRS values for the F2 male
cohort were for Suggestive linkage=4.1 (LOD=0.89); for Significant
linkage=10.6 (LOD=2.30); for Highly Significant linkage=18.4
(LOD=4.00) and for the F2 female cohort were for Suggestive
linkage=3.9 (LOD=0.85); for Significant linkage=9.9 (LOD=2.15); for
Highly Significant linkage=16.6 (LOD=3.61). LRS 4.6 delineates LOD
1-support interval. Confidence interval for a QTL location was
estimated by bootstrap resampling method wherein histogram single
peak delineates the QTL and peak widths define confidence interval
for the QTL. Histograms which show more than one peak warn that the
position for the QTL is not well defined or that there may be
multiple linked QTLs (QTX Map Manager) (46).
Example 2
[0142] We isolated the mouse Dear gene from a 129 SVJ mouse genomic
library. Molecular characterization detects a one-exon
transcription unit (FIG. 5A). The mouse receptor polypeptide
contains 127 amino acids showing 78 percent homology with the rat
receptor and binds solely ET-1 (data not shown) resembling the
recently characterized Dahl R Dear S44P/M74T rat variant (2), and
suggesting that observations in Dear.sup.-/- mice are most likely
not AngII-mediated. The mouse Dear mRNA is detected in all tissues
tested with the highest level of expression in kidney and aorta
(FIG. 5B).
[0143] Targeted inactivation of Dear.sup.-/- in ES cells was done
by replacement of the genomic region spanning amino acids 81-127 of
Dear with a PGK-neomycin cassette (FIG. 5A) resulting in the
deletion of the last 47 amino acids of the Dear polypeptide,
including the putative G-protein interacting domain (1). Screening
for homologous recombination was done on 196 G418-resistant
colonies by Southern blot analysis (FIG. 5C). Targeting events were
confirmed by polymerase chain reaction (PCR) amplification using a
neomycin-specific primer and a primer flanking the integration
site. Production of the expected size fragment (5.5 Kb) was
indicative of a targeting event (FIG. 5D). Five ES cell clones
carrying the targeted Dear mutation were injected into 129SVJ
blastocysts and implanted into pseudopregnant foster mothers. We
obtained 14 chimeric mice (representative of 2 independent targeted
ES cell clones). Chimeras were bred to C57BL/6J mice and shown to
germ line transmit, producing F1 progeny.
[0144] Heterozygous Dear-deficient (Dear.sup.+/-) male and female
mice (backcross-10 inbred C57BL/6 mouse strain) exhibit 50% less
Dear protein in mouse kidney protein blot analysis as detected
using an anti-mouse Dear anti-peptide specific antibody (FIG. 5F;
P<0.05, t-test), less body weight at 5 and 6 months of age
(males: P=0.007; females: P=0.0006) (FIG. 5I) and decreased blood
pressure in female (Dear.sup.+/+: 134.+-.4.0 mmHg vs Dear.sup.+/-:
112.3.+-.6.1; P<0.01) but not in male mice while heart rate
remains equivalent (FIG. 5G-H). Gender-specific blood pressure
effects are concordant with observations in a recent study of rat
genetic hypertension wherein Dear variants cosegregated with
hypertension in female but not in male F2-intercross rats (2).
[0145] To assess potential embryonic lethality of the
gene-targeting event, we analyzed progeny from F1-Dear.sup.+/- male
and female cross which were genotyped for the presence/absence of
the targeted Dear allele. Sixty-eight pups were produced from 17
liters showing the following genotype distribution: 29 wild type
(+/+), 39 heterozygous (+/-), 0 null (-/-). The absence of null
genotypes in the F2 progeny demonstrates that Dear null mutation is
embryonic lethal.
[0146] In order to investigate embryonic lethality in Dear.sup.-/-
embryos, we analyzed embryos from timed-pregnancies derived from
Dear.sup.+/- mice at different stages of development to determine
the exact developmental stage in which lethality occurs. We
produced 129 embryos (from E9.5 to E12.5) detecting 33 (-/-), 67
(+/-) and 29 wildtype (+/+) genotypes (FIG. 5D). This conforms to
the expected segregation ratio 1 (+/+):2 (+/-):1 (-/-) for a
standard (+/-).times.(+/-) intercross. Analysis of the embryos
revealed that lethality occurs around E12.5.
[0147] Anatomic analysis of E9.5-E12.5 embryos reveals absent
yolk-sac collecting vessels associated with homozygous
Dear.sup.-/--deficiency (FIG. 6A-F); heterozygous Dear.sup.+/-
deficient embryos exhibit normal yolk sac vascularization (data not
shown). All embryos with absent yolk-sac collecting vessels are
Dear.sup.-/- by genotype; heterozygous Dear.sup.+/- deficient
embryos are not distinguishable from Dear embryos (data not shown).
Hemorrhagic, resorbed embryos were detected as early as E10.5 but
mostly at E12.5 (FIG. 6D). Although smaller and strikingly paler
than Dear.sup.+/+ and Dear.sup.+/- embryos, Dear.sup.-/- embryos
exhibit two size phenotypes: a dysmorphic phenotype detected at
E10.5-E12.5 (FIG. 6A-C) that is relatively larger than a second,
hypoplastic phenotype (FIG. 6E-F). In order to determine whether
genetic variation influences the null phenotype, speed congenics
were done onto C57BL/6j genetic background and backcross-10 null
mice were generated and analyzed confirming embryonic range of
lethality, absent yolk-sac collecting vessels and both embryo
morphology phenotypes in Dear.sup.-/- embryos (FIG. 6A-F).
[0148] At E10.5 and E11.5, blood-filled pumping hearts were
detected in larger dysmorphic Dear.sup.-/- mice (FIG. 6B, 6C), but
not apparent in hypoplastic Dear.sup.-/- mice (FIG. 6E, F).
Dear.sup.-/- E10.5 embryos lack the vascular network formation
marked by prominent blood-filled dorsal aortae (FIG. 6G) and blood
vessels in the cranial region which are normal features
characteristic of E9.5 Dear.sup.+/+ embryo (FIG. 6G left panel).
Furthermore, E10.5 Dear.sup.-/- embryos exhibit disorganized,
blood-filled pools in the cranial region without apparent
connection to a blood-filled heart (FIG. 6G) observed to pump (data
not shown) despite lack of vascular networking. In contrast to
E11.5 Dear.sup.+/+ embryo, E11.5 dysmorphic-type Dear.sup.-/-
embryo exhibits minimal and altered vascular networks in both
cranial and caudal regions, dilated heart albeit blood-filled, and
altered brain development (FIG. 6H). Furthermore, while both
Dear.sup.-/- and Dear.sup.+/+ E11.5 hearts pump, observation of
cardiac pumping reveals single chamber filling and contraction in
Dear.sup.-/- embryos, in contrast to distinct filling and pumping
of ventricles in E11.5 Dear.sup.+/+ embryo (data not shown). In
E10.5 and E11.5 hypoplastic Dear.sup.-/- embryos, minimal
cardiovascular development is detected (FIG. 6E-F). Altered brain
and cardiac development is confirmed in the analysis of cleared,
fixed E11.5 embryos revealing poor delineation of brain regions
particularly the telencephalon and cardiac chamber formation (FIG.
6I).
[0149] In summary, analysis of dysmorphic Dear.sup.-/- embryos at
E10.5 and E11.5 detects blood-filled hearts (FIG. 6G-H) which
contracted, despite aberrant vascular formation typified by
disorganized, blood-filled pools in the cranial region without
apparent connection to a blood-filled heart (FIG. 6G), or minimal
vascular networks in both cranial and caudal regions, and a dilated
blood-filled heart (FIG. 6H). This contrasts the prominent vascular
network marked by blood-filled dorsal aorta and blood vessels in
the cranial region which are characteristic features of E9.5
Dear.sup.+/+ embryo (FIG. 6G). Furthermore, analysis of fixed E11.5
embryos reveals abnormal brain and cardiac development in
Dear.sup.-/- embryos (FIG. 6I).
[0150] Histological analysis of Masson-trichrome stained
E10.5-E11.5 embryo sections confirm minimal to absent collecting
vessels in the yolk sac in Dear.sup.-/- embryos (FIG. 7A) compared
with Dear.sup.+/+ (FIG. 7B) at E10.5. The yolk-sac plexus of
smaller vessels are present, with fewer nucleated red blood cells
(FIG. 7A). A few are enlarged (FIG. 7A). Blood islands are present
but the number of nucleated red blood cells is decreased in
Dear.sup.-/- embryos (FIG. 7A) compared with Dear.sup.+/+ embryos
(FIG. 7B). At E12.5, comparative histological analysis reveals
amorphous cellular areas with a lack of apparent organogenesis in
dysmorphic-type Dear.sup.-/- embryos (FIG. 7C) compared with
Dear.sup.+/+ (FIG. 7D). High magnification reveals large areas of
nucleated red blood cells in the ventral midportion that are not
contained in blood vessels or in recognizable liver tissue (FIG.
7C). The heart is thin-walled, enlarged and with poor delineation
of chambers in Dear.sup.-/- embryos (data not shown) corroborating
anatomical observations (FIG. 6). Blood vessels with few nucleated
red blood cells are rudimentary, thin-walled and sparse in
Dear.sup.-/- (FIG. 7C) compared with Dear.sup.+/+ (FIG. 7D) embryos
most evident in the cranial region. Rudimentary, thin-walled blood
vessels are detected in the perineural regions with sparse
nucleated rbcs in Dear.sup.-/- (FIG. 7E), in contrast to
Dear.sup.+/+ embryos which exhibit perineural blood vessels filled
with nucleated rbcs and with perivascular sheaths (FIG. 7D, F),
thus corroborating the observed vascular network deficiency evident
in anatomical analyses (FIG. 6). Concordant with sparse perineural
vessels, only a few penetrating capillaries are evident in
Dear.sup.-/- embryo neuroepithelium (FIG. 7G) in contrast to
Dear.sup.+/+ embryo (FIG. 7H). Scattered nucleated rbcs are
detected in the neuroepithelium (FIG. 7G) suggesting possible
vascular leakiness and/or failure of vasculogenesis.
Immunohistochemical analyses comparing E12.5 Dear.sup.+/+ and
Dear.sup.-/- embryos do not detect upregulation of VEGF,
VEGF-receptor 2 flk-1, or angiopoietin-1 and -2 expression (data
not shown).
[0151] To further analyze vascular deficits, immunohistochemical
staining for smooth muscle cell (smc) .alpha.-actin reveals
scattered expression in E12.5 Dear.sup.-/- embryos and intense
staining in the embryo-placenta vascular connection (FIG. 9A-F).
Perineural blood vessels exhibit a-actin immunostaining in
Dear.sup.-/- embryos but have minimal angiogenic-branching in
contrast to Dear.sup.+/+ embryos wherein angiogenic sprouting is
evident (FIG. 9A-F). Closer histological analysis reveals sporadic
blood islands incompletely circumscribed by .alpha.-actin stained
single-cell vascular wall in Dear.sup.-/- embryos (FIG. 9A-F).
[0152] To investigate mouse Dear temporal and spatial expression
patterns, we analyzed Dear expression in E9.5-E12.5 wild type
embryos using an anti-mouse Dear specific anti-peptide antibody
validated to detect Dear polypeptide (FIG. 10). At E9.5 days, we
detect Dear expression predominantly in the heart, yolk sac
mesodermal layer and endothelium, fetal vascular endothelium in the
placenta, dorsal aorta, and ependymal layer of the neural tube
(FIG. 10A). These expression patterns persist at E12.5 days,
wherein we detect increased expression in some hemangioblasts in
yolk sac blood islands (FIG. 10B), as well as more prominent
expression in the ependymal layer of the neuroepithelium and in
perineural blood vessel walls (FIG. 10B). Observed temporal and
spatial expression patterns are concordant with vascular, cardiac
and neuroepithelial phenotypes observed in Dear.sup.-/- deficient
mice.
[0153] In contrast to minimal blood islands in the yolk sac, we
detect scattered blood islands in Dear.sup.-/- embryos but markedly
underdeveloped dorsal aorta and peripheral vasculature, suggesting
deficiencies in primary vascularization despite the presence of
blood islands (FIG. 8A-F). Analysis of cardiac development in
adjacent littermates reveals that Dear.sup.-/- hearts have poor
cardiac chamber formation and endocardial cushion formation (FIG.
8A-F), consistent with incomplete cardiac looping observed on
analysis of whole embryos (FIG. 6).
[0154] The Dear.sup.-/- mutant vascular and cardiac phenotypes in
the C57BL/6J genetic background (BC10) is similar to that observed
in VEGF.sup.+/- deficient embryos (18, 19), but quite distinct from
that observed in previously reported ET-1, ET.sub.A and ET.sub.B
receptor null embryos (10-12, 24), as well as AngII, AT1a, AT1b,
and AT2 receptor null mutants (14-17). The similarity to
VEGF.sup.+/- deficient mouse vascular phenotype (18, 19) suggests
that both VEGF and Dear-mediated signaling are necessary for
angiogenesis and vascular network development, as well as modulate
blood island formation. The fact that both VEGF and Dear null
mutations are embryonic lethal, along with other similar
vascular-phenotype null mutants such as transforming growth
factor-.beta.1 (25), suggest that multiple pathways are involved in
vascular network formation--all necessary but none sufficient. The
slightly later but overlapping range of embryonic lethality
indicates that Dear-mediated pathways are downstream to
VEGF-mediated pathways. The association of vascular network
deficiency and arrest of cardiac development in both VEGF.sup.+/-
and Dear.sup.-/- deficiency suggests that vascular-derived
signaling plays a role in the progression of the complex
development of the heart into a multi-chambered pump. The finding
that Dear.sup.-/- deficiency results in embryonic lethal vascular
network abnormalities, while ET-1.sup.-/- inactivation does not
interfere with vascular networking (10) implies the existence of an
alternative ET-1 source that is produced independently of the well
known Pre-pro-ET-1 pathway (26) or alternatively, the existence of
an [ET-1]-like ligand that activates Dear and underlies
Dear-mediated angiogenic roles.
Methods
[0155] Northern Blot Analysis
[0156] Total RNA was extracted with TRIzol (Invitrogen, Life
Technologies Inc.,) from the different tissues analyzed.
PolyA.sup.+ RNA was subsequently isolated from total RNA using the
Dynabeads mRNA purification kit (Dynal Biotech) as per
manufacturer's specifications. PolyA.sup.+ RNA (3 .mu.g) was run on
a 1% formaldehyde-denaturing agarose gel, transferred to Zeta-Probe
blotting membrane (Bio-Rad) and UV cross-linked prior to
hybridization. Hybridization was done in a buffer containing
5.times.SSC, 20 mM Na.sub.2HPO.sub.4, 7% SDS, 1.times.Denhardt's,
100 ug/ml denatured Calf thymus DNA at 50.degree. C. for 24 h. A
.gamma.-.sup.32P-end labeled anti-sense mouse Dear oligonucleotide
(5'-AGT-GAT-AGA-GCC-CCA-GTT-CCA-GCG-AGA-CTT-CAT-CTC-CTT-GC-3' (SEQ.
ID. NO. 8)) was used as probe. Membranes were washed sequentially
with 3.times.SSC, 5% SDS at 50.degree. C. two times for 30 minutes
each, and once with 1.times.SSC, 1% SDS at 50.degree. C. for 30
min. Autoradiography was carried out at -80.degree. C. with
intensifying screen.
[0157] Characterization of 129SVJ Mouse Dear Gene
[0158] One million independent recombinants from a .lamda.FIXII
129SVJ mouse genomic library were screened with the full-length
3274 bp rat Dear cDNA.sup.1 as probe. Six independent genomic
clones were identified and plaque-purified after a fourth round of
screening. One of them, .lamda.191, was characterized further by
restriction digestion and subsequent southern blot analysis. A
single 8 kb BamHI/BamHI restriction fragment (that hybridized to
the 3274 bp rat Dear cDNA probe) was subcloned into psp73 plasmid
vector and sequenced.
[0159] Targeted Disruption of Dear in Mice and Production of
Chimeric Mice
[0160] All animal procedures were performed in accordance with
institutional guidelines. A targeting vector was constructed by
replacing a 300-bp piece containing the 3'-end of Dear with the
PGKNeo-cassette (FIG. 5) effectively deleting amino acids 81-127 of
Dear. The targeting vector was electroporated into 129SVJ ES cells
and G418 resistant cell clones were isolated. Genomic DNA was
obtained from each ES cell clone, restricted with SphI and
subjected to Southern blot analysis. A 1.5 Kb fragment of Dear was
used as probe (FIG. 5). The presence of an 8 Kb endogenous band and
a 5.2 Kb band was indicative of homologous recombination (FIG. 5).
Homologous recombination was further verified by PCR analysis using
an upstream primer (P1: 5'-TGTGAGGCTAGAAGGCTGC-3' (SEQ. ID. NO. 9))
located 171 bp upstream from the 5'-end of the targeting vector and
a reverse primer (P2: 5'-GAGCAAGGTGAGATGACAGG-3' (SEQ. ID. NO. 10))
located in the PGKNeo cassette (FIG. 5). Amplification of a 5.5 Kb
fragment that hybridized to the same probe used in the Southern
blot analysis (FIG. 5) was indicative of homologous recombination.
Five positive ES cell clones were then microinjected into 129SVJ
blastocysts generating 14 chimeric mice that were used to establish
the Dear knockout line. Speed-congenic backcross breeding to
inbreed onto C57BL/6 genetic background was done for more than ten
generations, .gtoreq.BC10, providing all Dear.sup.+/- and
Dear.sup.-/- mice for analyses (>99.95% congenic line in C57BL/6
background).
[0161] Characterization of Mouse Dear cDNA and Expression
Studies
[0162] Mouse Dear cDNA was obtained by RT-PCR from C57BL/6 mouse
kidney PolyA.sup.+ RNA (forward primer,
5'-CACACAAAGCCTTACTTTATCC-3' (SEQ. ID. NO. 13); reverse primer,
5'-AAAGCCAGCCTTTAGATAACC-3'(SEQ. ID. NO. 14)), subcloned into the
PT-vector system (Clontech, Palo Alto, Calif.) and then sequenced
(GenBank accession no. DQ009865). RNA blot analysis was done as
described (1) using PolyA.sup.+ RNA (3 .mu.g), .gamma.-.sup.32P-end
labeled anti-sense mouse Dear oligonucleotide
(5'-AGTGATAGAGCCCCAGTTCCAGCGAGACTTCATCTCCTTGC-3'(SEQ. ID. NO. 15))
as probe. Receptor expression studies, .sup.125I-ET-1-1 and
.sup.125I-AngII binding to membranes were done as described
(2).
[0163] Genotyping of Mouse Embryos
[0164] Genotyping was done by PCR analysis of genomic DNA isolated
from extraembryonic membranes. Primers flanking the Sad site
localized within the amino acid coding region of Dear (upstream
primer: 5'-AACTTCTCTGGTCCGCTCC-3' (SEQ. ID. NO. 11); downstream
primer: 5'-ACTTGCTGAAACTAAAACCTGC-3' (SEQ. ID. NO. 12)) were used
to detect the wild type allele (PCR product=153 bp indicative of
the presence of the wild type allele) and primers P1 and P2
(described above) to detect the mutated allele (PCR product=5.5 Kb
indicative of the presence of the mutated allele).
[0165] Analysis of Heterozygous Dear.sup.+/- Phenotype
[0166] We analyzed backcross BC10[C57BL/6] Dear.sup.+/- mice for
Dear protein levels by Western blot analysis using equal amounts of
protein (40 .mu.g) from mouse kidney membranes and rabbit IgG
anti-mouse Dear anti-peptide specific antibody (1:500 dilution)
developed against mouse Dear specific synthetic peptide:
L.sub.16SKCNHNEQDTA.sub.27 (SEQ. ID. NO. 16) to detect
Dear-specific polypeptide. We measured blood pressure in 6 month
old mice by tail-cuff sphygmomanometer (Visitech BP 2000, Visitech
CA) under light anesthesia ascertaining equivalent physiologic
state by limiting BP measurements to periods with heart rate
ranging from 300-500 beats per minute. We obtained three sets of 10
consecutive readings per mouse and took the average of at least 20
readings within the prescribed normal heart rate range.
[0167] Histology
[0168] Embryos were collected at embryonic E9.5-E12.5 days from
timed-pregnant mice (counting noon of the day a vaginal plug is
detected as E0.5); genotypes were determined by PCR analysis of
extraembryonic membrane tissue DNA. Embryos were analyzed and
photographed within their yolk sacs, then fixed in 4% freshly
prepared PBS-buffered paraformaldehyde. Histology processing and
Masson-trichrome staining were done following established
procedures. Digital stereophotomicroscopy and bright-field
photomicroscopy were done using a Nikon stereomicroscope and Zeis
Axioskop microscope respectively. Immunohistochemistry was done
essentially as described (27).
Example 3
Blood Pressure Measurements
[0169] Male and female cohorts of Dear KO and wild type (N10
backcross generation) were used to measured BP. Twelve (+/-) and 11
(+/+) female mice and 14 (+/-) and 14 (+/+) male mice were studied.
Testing was done at 6 months of age.
[0170] Mice were maintained on regular rodent chow and on a 12-hour
light/dark cycle. Mice were transported and allowed to settle in
the procedure room 1 hour before measurements were taken. Systolic
BP along with heart rate was measured by a programmable tail-cuff
sphygmomanometer (Visitech BP 2000, Visitech, NC). Mice were
lightly anesthetized with intraperitoneal ketamine (80 mg/kg) and
xylazine (18 mg/kg) and placed on the heated platform after a 2
minute interval. Three sets of 10 consecutive readings each were
taken per mouse. Data is presented as average of at least 20
readings per mouse spanning the heart rate range of 300-500
bpm.
[0171] Results
[0172] As shown in FIG. 10A, SBP did not differ between WT and KO
male mice (WT, 137.2.+-.5.1; KO, 138.6.+-.3.7; t=0.05, P>0.8) at
6 months of age. In contrast, SBP is significantly lower in KO
female mice when compared with WT female mice (WT, 134.9.+-.4.0;
KO, 112.3.+-.6.1; t=3.03, P<0.01). Mean heart rates did not
differ between contrasting groups (FIG. 10B) affirming the SBP
differences observed between WT and KO female mice. Thus,
heterozygosis at the Dear locus shows gender-specific effects on BP
affecting only females. This result is consistent with recent data
suggesting a female-specific effect of Dear variants in
salt-sensitive hypertension in the Dahl rat model (2).
Example 4
[0173] We next investigated the role of Dear-inhibition in two
established rodent tumor models. First, comparing heterozygous
Dear.sup.+/- deficient mice and wild type Dear.sup.+/+ littermates,
we detect significant reduction in tumor mass (FIG. 11A-B) and
tumor volume (FIG. 11C-D) in B16-F10 melanoma cell-induced tumor
model (74) in heterozygous Dear.sup.+/- deficient-female (t-test,
P<0.02) mice but not in male mice. Secondly, because effects
were seen only in female Dear.sup.+/- mice, we next tested whether
Dear-inhibition would reduce tumor growth in .sup.137Cs-radiation
induced breast cancer model (70) in female rats with tumor latency
less than 3 months. Using two independent inhibition methods,
anti-rat Dear anti-peptide specific antibody begun 4 weeks after
irradiation (FIG. 11C) and anti-rat Dear DNA vaccine begun two
weeks after irradiation (FIG. 11D), we detect significant
reductions in tumor growth during a 6-week observation period. In
contrast to respective control groups, both anti-Dear treatments
prevented tumor growth with significant reductions in %-change in
tumor volume detected from 4-6 weeks after tumor appearance (ab-Rx:
P<0.05-0.01; DNA-v: P<0.02-0.001). Furthermore, we detect
significant tumor regression with 68% reduction in tumor volume in
anti-Dear DNA-vaccinated rats (FIG. 11D, P<0.01). Inhibition of
tumor growth is associated with decrease in malignancy-potential
based on tumor pattern, nuclear grade and vascular invasion in both
anti-Dear antibody and DNA vaccine treated rats compared with
age-matched, non-treated control rats (FIG. 11E). Furthermore,
decrease in the number of chaotic and mosaic vessels was also
detected as a result of anti-Dear treatment.
Methods
[0174] Tumor Studies and Dear-Specific Inhibition
[0175] We developed B16-F10 (ATCC) melanoma cell-induced
subcutaneous tumor model essentially as described (74) in 10-week
old Dear.sup.+/- and littermate Dear.sup.+/+ male and female mice
(n=5 per group). Thirteen days after tumor induction, we excised
tumors and measured tumor weight and volume. We induced rat mammary
gland tumors in 48 Sprague Dawley rats (n=12 per group) essentially
as described (70) at 40 days of age via .sup.127Cs-radiation. Only
rats with tumor latency less than 3 months were used for study (n=4
for anti-Dear anti-peptide antibody; n=3 for control antibody; n=3
for anti-Dear DNA-vaccine; n=3 for control pcDNA). We began
antibody treatments 6 weeks after irradiation at 12 weeks of age.
We used affinity-purified rabbit IgG anti-Dear anti-peptide
antibody raised against the synthetic peptide
P.sub.51LLTSLGSKE.sub.60 (1) (SEQ. ID. NO. 7). As control, we used
rabbit IgG (sc-2027, Santa Cruz Biologicals, Santa Cruz Calif.).
Test and control antibodies were injected thrice weekly
intraperitoneally (6 .mu.g/injection) until the end of the study at
6 weeks post tumor appearance. In parallel, we injected test and
mock-DNA vaccines--using anti-Dear (pcDNA-Dear) DNA-vaccine and
control expression vector (pcDNA, Invitrogen, Carlsbad, Calif.)
mock-vaccine--two weeks after irradiation at 8 weeks of age, and
thereafter bi-weekly until 6 weeks from tumor appearance (500 .mu.g
per dose, intramuscularly). Tumor volume was measured using the
formula (4/3.pi.r.sub.1.sup.2.times.r.sub.2) where r.sub.1 is the
smaller, and r.sub.2 the larger radius as described (71). We used
t-test, two-way repeated measures ANOVA and Tukey's post test for
multiple pairwise comparisons for statistical analysis as
appropriate.
REFERENCES
[0176] 1. Ruiz-Opazo, N., Hirayama, K., Akimoto, K. & Herrera,
V. L. M. Molecular characterization of a dual
endothelin-1/angiotensin II receptor. Molecular Medicine 4, 96-108
(1998). [0177] 2. Kaneko, Y., Herrera, V. L. M., Didishvili, T.
& Ruiz-Opazo, N. Sex-specific effects of dual ET-1/AngII
receptor (Dear) variants in Dahl salt-sensitive/resistant
hypertension rat model. Physiol Genomics 20, 157-164 (2005). [0178]
3. Lariviere, R. & Lebel, M. Endothelin-1 in chronic renal
failure and hypertension. Can J Physiol Pharmacol. 81, 607-621
(2003). [0179] 4. Salani, D. et al. Role of endothelin-1 in
neovascularization of ovarian carcinoma. Am. J. Pathol. 157,
1537-1547 (2000). [0180] 5. Sullivan, D. C. & Bicknell, R. New
molecular pathways in angiogenesis. British Journal of Cancer 89,
228-231 (2003). [0181] 6. Bagnato, A. & Spinella, F. Emerging
role of endothelin-1 in tumor angiogenesis. Trends in Endocrinology
and Metabolism 14, 44-50 (2002). [0182] 7. Grant, K., Loizidou, M.
& Taylor, I. Endothelin-1: a multifunctional molecule in
cancer. British Journal of Cancer 88, 163-166 (2003). [0183] 8.
Watanabe, T., Barker, T. A. & Berk B. C. Angiotensin II and the
Endothelium: Diverse signals and effects. Hypertension 45, 163-169
(2005). [0184] 9. Escobar, E., Rodriguez-Reyna, T. S., Arrieta, O.
& Sotelo, J. Angiotensin II, cell proliferation and
angiogenesis regulator: biologic and therapeutic implications in
cancer. Curr Vasc Pharmacol 2, 385-399 (2004). [0185] 10. Kurihara,
Y. et al. Elevated blood pressure and craniofacial abnormalities in
mice deficient in endothelin-1. Nature 368, 703-710 (1994). [0186]
11. Clouthier, D. E. et al. Cranial and cardiac neural crest
defects in endothelin-A receptor-deficient mice. Development 125,
813-824 (1998). [0187] 12. Hosoda, K. et al. Targeted and natural
(piebald-lethal) mutations of endothelin-B receptor gene produce
megacolon associated with spotted coat color in mice. Cell 79,
1267-1276 (1994). [0188] 13. Tanimoto, K. et al.
Angiotensinogen-deficient mice with hypotension. J Biol Chem 269,
31334-31337 (1994). [0189] 14. Nimura, F. et al. Gene targeting in
mice reveals a requirement for angiotensin in the development and
maintenance of kidney morphology and growth factor regulation. J
Clin Invest. 96, 2947-2954 (1995). [0190] 15. Ito, M. et al.
Regulation of blood pressure by the type 1A angiotensin II receptor
gene. Proc Natl Acad Sci 92, 3521-3525 (1995). [0191] 16. Chen, X.
et al. Targeting deletion of angiotensin type 1B receptor gene in
the mouse. Am J Physiol 272, F299-F304 (1997). [0192] 17. Hein, L.,
Barsh, G. S., Pratt, R. E., Dzau, V. J. & Kobilka, B. K. 1996.
Behavioral and cardiovascular effects of disrupting the angiotensin
II type 2 receptor in mice. Nature 377, 744-777 (1996). [0193] 18.
Carmeliet, P. et al. Abnormal blood vessel development and
lethality in embryos lacking a single VEGF allele. Nature 380,
435-439 (1996). [0194] 19. Ferrara, N. et al. Heterozygous
embryonic lethality induced by targeted inactivation of the VEGF
gene. Nature 380, 439-442 (1996). [0195] 20. Raab, S. et al.
Impaired brain angiogenesis and neuronal apoptosis induced by
conditional homozygous inactivation of vascular endothelial growth
factor. Thromb Haemost 91, 595-605 (2004). [0196] 21. Ikeda, T. et
al. Pathophysiological roles of endothelin-1 in Dahl salt-sensitive
hypertension. Hypertension 34, 514-519 (1999). [0197] 22. Touyz, R.
M. & Schiffrin, E. L. Role of endothelin in human hypertension.
Can J Physiol Pharmacol. 81, 533-541 (2003). [0198] 23. Fujita, M.
et al. Angiotensin type 1a receptor signaling-dependent induction
of vascular endothelial growth factor in stroma is relevant to
tumor-associated angiogenesis and tumor growth. Carcinogenesis 26,
271-279 (2005). [0199] 24. Griswold, D. E. et al. Targeted
disruption of the endothelin-B-receptor gene attenuates
inflammatory nociception and cutaneous inflammation in mice. J
Cardiovasc Pharmacol 36, S78-S81 (2000). [0200] 25. Dickson, M. C.
et al. Defective haematopoiesis and vasculogenesis in transforming
growth factor-.beta.1 knockout mice. Development 121, 1845-1854
(1995). [0201] 26. D'Orleans-Juste, P., Plante, M., Honore, J. C.,
Carrier, E. & Labonte, J. Synthesis and degradation of
endothelin-1. Can J Physiol Pharmacol. 81, 503-510 (2003). [0202]
27. Herrera, V. L. M. et al. Spontaneous combined hyperlipidemia,
coronary heart disease and decreased survival in Dahl
salt-sensitive hypertensive rats transgenic for human cholesteryl
ester transfer protein. Nature Med 12, 1383-1389 (1999). [0203] 28.
Agapitov A V and Haynes W G. Role of endothelin in cardiovascular
disease. J. Renin Angiotensin Aldosterone Syst. 3: 1-15, 2002.
[0204] 29. Antoniucci D, Miller V M, Sieck G C, and Fitzpatrick L
A. Gender-related differences in proliferative responses of
vascular smooth muscle cells to endothelin-1. Endothelium 8:
137-145, 2001. [0205] 30. Blalock J E. Genetic origins of protein
shape and interaction rules. Nature Medicine 1: 876-878, 1995.
[0206] 31. Clark J S, Jeffs B, Davidson A O, Lee W K, Anderson N H,
Bihoreau M T, Brosnan M J, Devlin A M, Kelman A W, Lindpaintner K,
and Dominiczak A F. Quantitative trait loci in genetically
hypertensive rats, possible sex specificity. Hypertension 28:
898-906, 1996. [0207] 32. Doi T, Hiroaki Y, Arimoto I, Fujiyoshi Y,
Okamoto T, Satoh M, and Furuichi Y. Characterization of human
endothelin B receptor and mutant receptors expressed in insect
cells. Eur. J. Biochem. 248: 139-148, 1997. [0208] 33. Elijovich F
and Laffer C L. Participation of renal and circulating endothelin
in salt-sensitive essential hypertension. J. Hum. Hypertens. 16:
459-467, 2002. [0209] 34. Garrett M R, Dene H, Walder R, Zhang Q Y,
Cicila G T, Assadnia S, Deng A Y, and Rapp J P. Genome scan and
congenic strains for blood pressure QTL using Dahl Salt sensitive
rats. Genome Res. 8: 711-723, 1998. [0210] 35. Hallberg P, Karlsson
J, Lind L, Michaelsson K, Kurland L, Kahan T, Malmqvist K, Ohman K
P, Nystrom F, Liljedahl U, Syvanen A C, and Melhus H.
Gender-specific association between preproendothelin-1 genotype and
reduction of systolic blood pressure during antihypertensive
treatment-results from the Swedish Irbersartan Left Ventricular
Hypertrophy Investigation versus Atenolol (SILVHIA). Clin Cardiol.
27: 287-290, 2004. [0211] 36. Hausdorff W P, Hnatowich M, O'Dowd B
F, Caron M G, and Lefkowitz R J. A mutation of b.sub.2-adrenergic
receptor impairs agonist activation of adenylyl cyclase without
affecting high affinity agonist binding. Distinct molecular
determinants of the receptor are involved in physical coupling to
and functional activation of G.sub.S. J. Biol. Chem. 265:
1388-1393, 1990. [0212] 37. Herrera V L M and Ruiz-Opazo N.
Genetics of hypertension: A multidisciplinary challenge. Trends in
Cardiovascular Medicine 1: 185-189, 1991. [0213] 38. Herrera V L M,
Xiang X H, Lopez L V, Schork N J, and Ruiz-Opazo N. The .alpha.1
Na,K-ATPase gene is a susceptibility hypertension gene in the Dahl
salt-sensitive rat. J. Clin. Invest. 102: 1102-1111, 1998. [0214]
39. Herrera V L M, Lopez L V, and Ruiz-Opazo N. .alpha.1
Na,K-ATPase and Na,K,2Cl-cotransporter/D3Mit3 loci interact to
increase susceptibility to salt-sensitive hypertension in Dahl
S.sup.HSD rats. Molecular Medicine 7: 125-134, 2001. [0215] 40.
Iwanaga Y, Kihara Y, Inagaki K, Onozawa Y, Yoneda T, Kataoka K, and
Sasayama S. Differential effects of angiotensin II versus
endothelin-1 inhibitions in hypertrophic left ventricular
myocardium during transition to heart failure. Circulation 104:
606-612, 2001. [0216] 41. Jeffs B, Negrin C D, Graham D, Clark J S,
Anderson N H, Gauguier D, and Dominiczak A F. Applicability of a
"speed" congenic strategy to dissect blood pressure quantitative
trait loci on rat chromosome 2. Hypertension 35: 179-187, 2000.
[0217] 42. Jorgensen P L. Purification (Na.sup.+ plus
K.sup.+)-ATPase: active site determinations and criteria of purity.
Ann. N.Y. Acad. Sci. 242: 36-52, 1974. [0218] 43. Kaneko Y, Cloix J
F, Herrera V L M, and Ruiz-Opazo N. Corroboration of Dahl S Q276L
alpha1-Na,K-ATPase protein sequence: impact on affinities for
ligands and on E1 conformation. J Hypertension 23: 745-752, 2005.
[0219] 44. Kent R S, De Lean A, and Lefkowitz R J. A quantitative
analysis of beta-adrenergic receptor interactions: resolution of
high and low affinity states of the receptor by computer modeling
of ligand binding data. Mol. Pharmacol. 17: 14-23, 1980. [0220] 45.
Lavalle M, Takamura M, Parent R, and Thorin E. Crosstalk between
endothelin and nitric oxide in the control of vascular tone. Heart
Fail. Rev. 6: 265-276, 2001. [0221] 46. Manly K F, Cudmore Jr, R H,
and Meer J M. Map Manager QTX, cross-platform software for genetic
mapping. Mammalian Genome 12: 930-932, 2001. [0222] 47. Mukoyama M,
Nakajima M, Horiuchi M, Sasamura H, Pratt R E, and Dzau V J.
Expression cloning of type 2 angiotensin II receptor reveals a
unique class of seven transmembrane receptors. J. Biol. Chem. 268:
24539-24542, 1993. [0223] 48. Murphy T J, Alexander R W, Griendling
K K, Runge M S, and Bernstein K E. Isolation of a cDNA encoding the
vascular type-1 angiotensin II receptor. Nature 351: 233-236, 1991.
[0224] 49. Nuedling S, van Eickels M, Allera A, Doevendans P, Meyer
R, Vetter H, and Grohe C. 17 Beta-estradiol regulates the
expression of endothelin receptor type B in the heart. Br J
Pharmacol. 140: 195-201, 2003. [0225] 50. Phalipou S, Seyer R,
Cotte N, Breton C, Barberis C, Hibert M, and Mouillac B. Docking of
linear peptide antagonists into the human V.sub.1a vasopressin
receptor. J. Biol. Chem. 274: 23316-23327, 1999. [0226] 51.
Pravenec M, Gauguier D, Schott J J, Buard J, Kren V, Bila V,
Szpirer C, Szpirer J, Wang J M, Huanng H, St. Lezin E, Spence M A,
Flodman P, Printz M, Lathrop G M, Vergnaud G, and Kurtz T W.
Mapping of quantitative trait loci for blood pressure and cardiac
mass in the rat by genome scanning of recombinant inbred strains.
J. Clin. Invest. 96: 1973-1978, 1995. [0227] 52. Rapp J P and Dene
H. Development and characteristics of inbred strains of Dahl
salt-sensitive and salt-resistant rats. Hypertension 7: 340-349,
1985. [0228] 53. Rapp J P and Dene H. Failure of alleles at the
Na+,K+-ATPase .alpha.1 locus to cosegregate with blood pressure in
Dahl rats. J Hypertension 8: 457-462, 1990. [0229] 54. Rapp J P.
Genetic analysis of inherited hypertension in the rat.
Physiological Reviews 80: 135-172, 2000. [0230] 55. Rodbard D.
Mathematics of hormone-receptor interaction. Adv. Exp. Medicine 36:
289-326, 1972. [0231] 56. Romero J C and Reckelhoff J F. Role of
angiotensin and oxidative stress in essential hypertension.
Hypertension 34: 943-949, 1999. [0232] 57. Ruiz-Opazo N, Akimoto K,
and Herrera V L M. Identification of a novel dual
AngiotensinII/Vasopressin receptor on the basis of molecular
recognition theory. Nature Medicine 1: 1074-1081, 1995. [0233] 58.
Ruiz-Opazo N, Lopez L V, and Herrera V L M. The dual AngII/AVP
receptor gene N119S/C163R variant exhibits sodium-induced
dysfunction and cosegregates with salt-sensitive hypertension in
the Dahl salt-sensitive hypertensive rat model. Molecular Medicine
8: 24-32, 2002. [0234] 59. Samani N J, Gauguier D, Vincent M,
Kaiser M A, Bihoreau M T, Lodwick D, Wallis R, Parent V, Kimber P,
Rattray F, Thompson J R, Sassard J, and Lathrop M. Analysis of
quantitative trait loci for blood pressure on rat chromosomes 2 and
13. Age-related differences in effect. Hypertension 28: 1118-1122,
1996. [0235] 60. Song Y, Herrera V L M, Filigheddu F, Troffa C,
Lopez L V, Glorioso N, and Ruiz-Opazo N. Non-association of the
thiazide-sensitive Na,Cl-cotransporter gene with polygenic
hypertension in both rats and humans. J. Hypertension 19:
1547-1551, 2001. [0236] 61. Tatchum-Talom R, Martel C, Labrie C,
Labrie F, and Marette A. Gender differences in hemodynamic
responses to endothelin-1. J Cardiovasc Pharmacol. 36: S102-S104,
2000. [0237] 62. Tsukamoto T, Shibagaki Y, Imajoh-Ohmi S, Murakoshi
T, Suzuki M, Nakamura A, Gotoh H, and Mizumoto K. Isolation and
characterization of the yeast mRNA capping enzyme b subunit gene
encoding RNA 5'-triphosphatase, which is essential for cell
viability. Biochem. Biophy. Res. Commun. 239: 116-122, 1997. [0238]
63. Wong C, Mahapatra N R, Chitbangonsyn S, Mahboubi P, Mahata M,
Mahata SK, and O'Connor D T. The angiotensin II receptor (Agtr1a):
functional regulatory polymorphisms in a locus genetically linked
to blood pressure variation in the mouse. Physiol Genomics 14:
83-93, 2003. [0239] 64. Wright J W and Harding J W. Regulatory role
of brain angiotensins in the control of physiological and
behavioral responses. Brain Research Reviews 17: 227-262, 1992.
[0240] 65. Zicha J, Negrin C D, Dobesova Z, Carr F, Vokurkova M,
McBride M W, Kunes J, Dominiczak A F. Altered Na+-K+pump activity
and plasma lipids in salt-hypertensive Dahl rats: relationship to
Atp1a1 gene. Physiol Genomics 6: 99-104, 2001. [0241] 66. Morris R
G M, Garrud P, Rawlins J N P, O'Keefe J. Place navigation impaired
in rats with hippocampal lesions. Nature 297: 681-683 (1982).
[0242] 67. Richardson J C, Kendal C E, Anderson R, et al.
Ultrastructural and behavioural changes precede amyloid deposition
in a transgenic model of Alzheimer's disease. Neuroscience 122:
213-228 (2003). [0243] 68. Galef B G Jr. Socially-induced diet
preference can partially reverse a LiCl-induced diet aversion. Anim
Learn Behav 13: 415-418 (1985). [0244] 69. Kaneko Y, Herrera V L,
Didishvili T, Ruiz-Opazo, N. Gender-specific effects of dual
ET-1/AngII receptor (Dear) variants in Dahl
salt-sensitive/resistant hypertension rat model. Physiol Genomics
Nov 23; [Epub ahead of print], (2004). [0245] 70. Cronkite E P,
Shellabarger C J, Bond V P, Lippincott S W. Studies on
radiation-induced mammary gland neoplasia in the rat I. The role of
the ovary in the neoplastic response of the breast tissue to total-
or partial-body X-irradiation. Radiation Research 12: 81-93 (1960).
[0246] 71. Long B J, Jelovac D, Handratta V, Thiantanawat A,
MacPherson N, Ragaz J, Goloubeva O G, Brodie A M. Therapeutic
strategies using the aromatase inhibitor letrozole and tamoxifen in
a breast cancer model. J Natl Cancer Inst 96: 456-465 (2004).
[0247] 72. Storkebaum E, et al. 2004. Treatment of motoneuron
degeneration by intracerebroventricular delivery of VEGF in a rat
model of ALS. Nature Neuroscience 8:85-92. [0248] 73. Rissanen et
al. 2004. Gene transfer for therapeutic vascular growth in
myocardial and peripheral ischemia. Adv Genet. 52:117-164. [0249]
74. Woodman, S. E. et al. Caveolin-1 knockout mice show an impaired
angiogenic response to exogenous stimuli. Am J Pathol 162:2059-2068
(2003).
[0250] All references described herein are incorporated herein by
reference in their entirety.
TABLE-US-00002 TABLE 1 Ligand affinities for Dear S44P/M74T and
S44/M74 variants B.sub.max, Variant pmol/mg K.sub.H, nM K.sub.L, nM
h .sup.125I-[Tyr.sup.4]Angiotensin II S44P/ no binding M74T S44/M74
23.6 .+-. 0.92 0.23 .+-. 0.08 2.65 .+-. 0.11 2.63 .+-. 0.25
.sup.125I-[Tyr.sup.13]Endothelin-1 S44P/ 20.21 .+-. 1.59 12.0 .+-.
1.12 836 .+-. 38.1 1.45 .+-. 0.09 M74T S44/M74 26.25 .+-. 1.29 4.42
.+-. 0.89* 450 .+-. 12.4* 1.41 .+-. 0.12 Values are means .+-. SE,
B.sub.max, maximum ligand binding sites in pmol/mg membrane
protein; K.sub.H, dissociation constant for high affinity binding
site; K.sub.L, dissociation constant for low affinity binding site;
h, Hill coefficient. *P < 0.01 (t-test).
TABLE-US-00003 TABLE 2 Chromosome 2 analysis of F2(R .times. S)
male and female cohorts F2(R .times. S) Males Females LRS TTV, % P
LRS TTV, % P MAP Locus Marker, cM (males/females) 134.3 (1 3.1)
122.6 (10.4) D2Rat124 0.0/0.0 1.8 2 0.40800 1.2 1 0.55024 D2Rat196
9.1/7.2 0.7 1 0.71099 1.1 1 0.57694 D2Rat19 14.1/13.5 0.9 1 0.62681
2.5 2 0.29225 D2Rat21 8.4/6.1 1.3 1 0.52159 3.4 3 0.17980 D2Rat143
12.3/14.9 1.6 1 0.45032 11.4 11 0.00332 D2Rat161 25.2/10.8 0.2 0
0.91259 8.8 8 0.01247 D2Rat34 25.8/12.4 4.3 4 0.11848 11.2 10
0.00376 Dear 14.8/14.6 6.1 6 0.04816 15.2 14 0.00050 D2Mgh11/
2.9/6.1 7.7 7 0.02155 9.6 9 0.00840 ATP1A1 D2Rat169 7.8/4.5 6.2 6
0.04520 5.4 5 0.06632 D2Rat59 10.1/8.8 2.7 3 0.26394 1.8 2 0.41202
SBP 157.2 (14.2) 145.0 (11.4)
TABLE-US-00004 TABLE 3 Table 3. Analysis of S allele effects on
blood pressure of Dear locus in F2(R .times. S) intercross rats BP,
mmHg (.+-.sd) Tukey Test P SS SR RR ANOVA P SS vs. RR SS vs. SR SR
vs. RR S Allele Effect Females MAP 130 (13.1) 122 (9.1) 119 (8.3)
6.2 .times. 10.sup.-4 4.8 .times. 10.sup.-4 0.01 NS ? SBP 152
(14.2) 145 (10.0) 141 (9.7) 1.7 .times. 10.sup.-3 1.0 .times.
10.sup.-3 0.02 NS ? DBP 109 (12.0) 102 (8.7) 99 (7.6) 7.3 .times.
10.sup.4 5.5 .times. 10.sup.4 0.01 NS ? Males MAP 139 (13.6) 133
(13.4) 131 (10.0) 0.052 NA NA NA SBP 162 (14.4) 156 (14.7) 152
(10.9) 0.034 0.04 NS NS ? DBP 117 (12.6) 113 (12.0) 110 (9.2) 0.085
NA NA NA Values are means, with SD in parentheses. ANOVA, analysis
of variance; Tukey test, all pairwise multiple comparison
procedure; NS, not significant; NA, not applicable.
Sequence CWU 1
1
2413273DNARattus norvegicus 1tttctaaatg attacttttc tagatacctg
tttacaaaac agaagatcct ccctttgaaa 60ccaaactaaa ctacacttga agaatataaa
gtgcacaaag gaagaccacg atgaatcagt 120accacccatc ttcccagcat
tcaagaatgt tcagcgcaca ggaggtgcac agtaagtgtt 180cctgagagga
gtggatacaa cactcaatta tctgggcatg taatgctgat ctgcggtttc
240ctttacatca gccggcctcc ttcccggttg ggatcaagga agtgaacaga
tgcagactca 300ctctggcagg caccactgag ccagccattt actctcactg
catagcaaag ttattttgtc 360aacttgtttc caggatcctc tgcttccaca
gagcagaaac acctcgtcta ggggattctg 420atccttaccc tcttctttac
atttctctct ccagagaagg ttatcctcag ccaaaatcct 480ccagtatcga
cacgtctgag ccgcttgcag caggtctttg ggttccagga atgaaagtac
540atagagtgcc agctatggaa aaggaaataa gggaggcaca ctcagacaca
tcacagaaga 600aaggttactc tacgaagggt gagcattgag ctgggactgc
tggatttcag tgggctgaac 660gaatcaagag aagcagcatt ttaagagcaa
agaaaatgct catcattctc acattaggaa 720tctgaggctt tactctgggt
aacctgtgat tctattggta tttccttaca aagtgagaac 780aatgccactt
atcacaagtt tcttgtgtga gcccagtgct caagctctta gataatccaa
840ataaatgttg ataaagagac tttatattgt tcataccaat tatcaaaaaa
tacaagtaca 900tttcatgtca gtgtggtaat aatgttttaa ataacacact
tccctacagg gttaagtcta 960tgccattatt cttccacgca gacataaagc
acttcccaaa tgaagaacac cccagtagtc 1020agaaacaaaa accatagctg
atatgctaag acagggctct ctcctttgta acttcttttt 1080tcctcaggaa
gtctttgaaa gaacacagaa gccaagagaa tcttttgggg ttttaccttt
1140tattaatcat ctgtgcttac ttcttaaaat tctaaaacac tttcaaattt
gggggactgg 1200tgatggctca gtcagtaagg tttcatgaag atgagggctc
ggatcctggc agtcttggaa 1260agtcaggcat ggcagttcta gctatagtca
ctgctcactg gacagccagc caccgtagct 1320aaaggcgtaa gctccagact
cagtgaaaga cgacatggca aaaacaacat ggatcagctg 1380agggatacac
ctctggcctc cacgggcaca tacgtgcagg agcatctgaa tgtacttatg
1440tatacccaca cgaatacata cacatcctac acacatacac actctacagg
aggtatcggg 1500catgtaagat aatccagacg aatattcact tcacgccctg
atggcagcaa agggatctcg 1560tgttactttc ataagtttag tcaaagagtt
ctgatgtaga aaaagctcac aagagcaaac 1620acttttcttc tgggacactg
tcacctttaa aaagtactca aaagggggga aagtgccagg 1680aaaaagatga
tttatcaatt tgctttcccc cagaattata ttttaattca tcaattttac
1740tcaaatctaa tgccagattc taactaggac tatatttaat gccactagga
ctttagagtg 1800atcatctaag aaaggagaaa gcaagactct tcctgttcaa
atgaggtttc gggatcatct 1860gtatgaagga tgtggtagtt ttttgatgct
gtctttttaa ctgctattta taacatgtgt 1920atagtaattt gagaaaatat
ggactatggg gcattatcta atatcacatt atttcttcct 1980tttgataaaa
attaagctat gaagtctaat gtcaatatgt gcattatatt taaaccatca
2040gccacacatg gctgtatgac taagtgccta agaatccaat ttttttgtgg
tatctctctc 2100tctccctctc tccgtatgtg tgtgtctttc tctgtctctg
tctctctctc tctttctctc 2160tgacgaagga tgataagtag aaatgccata
aaaacatata gataaatttt atatattggg 2220ggctggagag atggctcagt
ggttgagaac actgactgtt cttcagaggt cctgagttaa 2280attcccagca
accacatggt agctcacaac catctatatt gcatctgatg ccctcttctg
2340gtgtgtctaa agacagctac cggtatactt acatataata aataaatctt
taaaaaaatt 2400ttttatatat taaaaaaaaa tcacataatg taataaccag
gagaaatacg aacaatcgat 2460aaaattactg gtcttgaagg ggcattaaat
aattagcaaa ataaaaacaa aattaatatt 2520gttgcttagt gaatccagaa
ttttgaaaac atccactata tataataaac ataccaacta 2580actaaagtca
gcctttagat aacccaggga aaactgaaga gactcggcga cttcacatga
2640agccttactt tatccaagcg gaagaaagca gcaccttggt atgagcacac
tttatgtaac 2700agctgtacca aaaagccaca gcagtttgcc aaagtgtcaa
gccatgatga gcaggacact 2760gcttacaggc atggctatgt atctggacag
cagccatgcg ggtgctgcat ccatgcaggt 2820gagctggccg cccttactca
cctctttggg gagcaaggag atgaagtctc gctggaactg 2880gggctcgatc
acttgcatca tgtgcttcac ttgtgtgggt tcacagctat cgatgagctc
2940atctaaggcc agcaacttct ctggtccact ccagctctac caaagaggaa
ttggacacat 3000tacaaatcca tacagaagac caccagcacc tgcatggcca
tgttcgagca gtggaactac 3060atgaaagggg accgtggaca gagaccttgt
ctccagaagc caccagagcg atagcagttt 3120ttagtttcag caagtttact
cagtaccttt cccgcaaagc attaaaagtc atgactggca 3180gaaaaataag
tctgcattta tttttaatta taagacttat gctaacacca agacactggg
3240agacacacaa tatccatctg ggttattgac tag 32732127PRTRattus
norvegicus 2Met Ser Thr Leu Tyr Val Thr Ala Val Pro Lys Ser His Ser
Ser Leu1 5 10 15Pro Lys Cys Gln Ala Met Met Ser Arg Thr Leu Leu Thr
Gly Met Ala 20 25 30Met Tyr Leu Asp Ser Ser His Ala Gly Ala Ala Ser
Met Gln Val Ser 35 40 45Trp Pro Pro Leu Leu Thr Ser Leu Gly Ser Lys
Glu Met Lys Ser Arg 50 55 60Trp Asn Trp Gly Ser Ile Thr Cys Ile Met
Cys Phe Thr Cys Val Gly65 70 75 80Ser Gln Leu Ser Met Ser Ser Ser
Lys Ala Ser Asn Phe Ser Gly Pro 85 90 95Leu Gln Leu Tyr Gln Arg Gly
Ile Gly His Ile Thr Asn Pro Tyr Arg 100 105 110Arg Pro Pro Ala Pro
Ala Trp Pro Cys Ser Ser Ser Gly Thr Thr 115 120 125319DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
3aagaaagcag caccttggt 19420DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 4cgtggacaga gaccttgtct
20521DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 5gctatgtatc tggacagcag c 21621DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
6agtgaagcac atgatgcaag t 21710PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 7Pro Leu Leu Thr Ser Leu Gly
Ser Lys Glu1 5 10841DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 8agtgatagag ccccagttcc
agcgagactt catctccttg c 41919DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 9tgtgaggcta gaaggctgc
191020DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 10gagcaaggtg agatgacagg 201119DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
11aacttctctg gtccgctcc 191222DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 12acttgctgaa actaaaacct gc
221322DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 13cacacaaagc cttactttat cc 221421DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
14aaagccagcc tttagataac c 211541DNAArtificial SequenceDescription
of Artificial Sequence Synthetic oligonucleotide 15agtgatagag
ccccagttcc agcgagactt catctccttg c 411612PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 16Leu
Ser Lys Cys Asn His Asn Glu Gln Asp Thr Ala1 5 101715DNARattus
norvegicusCDS(1)..(15) 17gct gca tcc atg cag 15Ala Ala Ser Met Gln1
5185PRTRattus norvegicus 18Ala Ala Ser Met Gln1 51915DNARattus
norvegicusCDS(1)..(15) 19tgc atc atg tgc ttc 15Cys Ile Met Cys Phe1
5205PRTRattus norvegicus 20Cys Ile Met Cys Phe1 52115DNARattus
norvegicus 21gctgcaccca tccag 152215DNARattus norvegicus
22tgcatcagct gcttc 1523127PRTRattus norvegicus 23Met Ser Thr Leu
Tyr Val Thr Ala Val Pro Lys Ser His Ser Ser Leu1 5 10 15Pro Lys Cys
Gln Ala Met Met Ser Arg Thr Leu Leu Thr Gly Met Ala 20 25 30Met Tyr
Leu Asp Ser Ser His Ala Gly Ala Ala Pro Met Gln Val Ser 35 40 45Trp
Pro Pro Leu Leu Thr Ser Leu Gly Ser Lys Glu Met Lys Ser Arg 50 55
60Trp Asn Trp Gly Ser Ile Thr Cys Ile Thr Cys Phe Thr Cys Val Gly65
70 75 80Ser Gln Leu Ser Met Ser Ser Ser Lys Ala Ser Asn Phe Ser Gly
Pro 85 90 95Leu Gln Leu Tyr Gln Arg Gly Ile Gly His Ile Thr Asn Pro
Tyr Arg 100 105 110Arg Pro Pro Ala Pro Ala Trp Pro Cys Ser Ser Ser
Gly Thr Thr 115 120 12524127PRTMus musculus 24Met Asn Ala Leu Tyr
Val Thr Thr Val Pro Lys Gly Tyr Ser Ser Leu1 5 10 15Ser Lys Cys Asn
His Asn Glu Gln Asp Thr Ala Tyr Arg Leu Trp Leu 20 25 30Cys Thr His
Asn His Trp Thr Ala Pro Ser Gly Met Arg Leu Gln Pro 35 40 45Leu Thr
Ser Leu Gly Ser Lys Glu Met Lys Ser Arg Trp Asn Trp Gly 50 55 60Ser
Ile Thr Cys Ile Ile Cys Phe Thr Cys Val Gly Ser Gln Leu Ser65 70 75
80Met Ser Ser Ser Lys Ala Ser Asn Phe Ser Gly Pro Leu Gln Leu Tyr
85 90 95Gln Arg Gly Ile Gly His Ile Thr Asn Ser Tyr Lys Arg Pro Gln
Ala 100 105 110Pro Ala Trp Pro Cys Leu Ser Ser Gly Thr Met Gly Arg
Ser His 115 120 125
* * * * *