U.S. patent application number 12/935413 was filed with the patent office on 2011-04-28 for contrast agents, methods for preparing contrast agents, and methods of imaging.
Invention is credited to Jie Jiang, Shunyi Li, Zhiren Liu, Jinjuan Qiao, Lixia Wei, Shenghui Xue, Jenny Jie Yang, Yubin Zhou.
Application Number | 20110097742 12/935413 |
Document ID | / |
Family ID | 41377862 |
Filed Date | 2011-04-28 |
United States Patent
Application |
20110097742 |
Kind Code |
A1 |
Yang; Jenny Jie ; et
al. |
April 28, 2011 |
CONTRAST AGENTS, METHODS FOR PREPARING CONTRAST AGENTS, AND METHODS
OF IMAGING
Abstract
Embodiments of the present disclosure provide for contrast
agents, methods of making contrast agents, and methods of using
contrast agents, and the like.
Inventors: |
Yang; Jenny Jie; (Atlanta,
GA) ; Liu; Zhiren; (Atlanta, GA) ; Li;
Shunyi; (Atlanta, GA) ; Zhou; Yubin; (San
Diego, CA) ; Jiang; Jie; (Atlanta, GA) ; Xue;
Shenghui; (Atlanta, GA) ; Qiao; Jinjuan;
(Atlanta, GA) ; Wei; Lixia; (Atlanta, GA) |
Family ID: |
41377862 |
Appl. No.: |
12/935413 |
Filed: |
April 2, 2009 |
PCT Filed: |
April 2, 2009 |
PCT NO: |
PCT/US09/39276 |
371 Date: |
December 22, 2010 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
61041693 |
Apr 2, 2008 |
|
|
|
Current U.S.
Class: |
435/7.21 ;
530/387.3; 530/400 |
Current CPC
Class: |
A61K 49/143 20130101;
A61P 35/00 20180101; A61K 49/126 20130101; A61K 49/14 20130101 |
Class at
Publication: |
435/7.21 ;
530/400; 530/387.3 |
International
Class: |
G01N 33/53 20060101
G01N033/53; C07K 14/00 20060101 C07K014/00; C07K 16/18 20060101
C07K016/18 |
Claims
1. A contrast agent comprising: a) a scaffold protein, and b) at
least one metal ion chelating site, wherein the scaffold protein
includes at least one metal ion chelating site that is already
present or is integrated into the scaffold protein, wherein the
scaffold protein includes a metal ion bound to a metal ion
chelating site, wherein the contrast agent is stable in a
physiological environment.
2. The contrast agent of claim 1, wherein the metal is Gd(III).
3. The contrast agent of claim 2, wherein the scaffold protein
includes at least one polyethylene glycol (PEG) group attached to
the scaffold protein.
4. The contrast agent of claim 3, further comprising a targeting
agent attached to the scaffold protein.
5. The contrast agent of claim 4, wherein the targeting agent is
selected from the group consisting of: a biomarker probe, a
precancerous targeting agent, a cancer targeting agent, a tumor
targeting agent, and a probe or agent that targets at least two of
a biomarker, a precancerous cell, a cancer cell, and a tumor.
6. The contrast agent of claim 3, wherein one or more metal ion
chelating sites are integrated into the scaffold protein, and
wherein each of the metal ion chelating sites include one Gd(III)
bound to each of the metal ion chelating sites.
7. The contrast agent of claim 6, further comprising a targeting
agent attached to the scaffold protein.
8. The contrast agent of claim 6, wherein a Near-IR functional
group for Near-IR detection is covalently bound to the scaffold
protein.
9. The contrast agent of claim 7, wherein the targeting agent is
selected from the group consisting of: a biomarker probe, a
precancerous targeting agent, a cancer targeting agent, a tumor
targeting agent, and a probe or agent that targets at least two of
a biomarker, a precancerous cell, a cancer cell, and a tumor.
10. The contrast agent of claim 1, wherein the scaffold protein
includes at least one modification to the protein sequence, wherein
the modification of the metal binding site alters the metal
selectivity of the binding site, optimizes binding affinity for the
metal, or improves serum stability of the contrast agent.
11. The contrast agent of claim 1, wherein the scaffold protein
includes at least one polyethylene glycol (PEG) group attached to
the scaffold protein.
12. The contrast agent of claim 11, wherein the PEGylation of the
contrast agent increased the solubility of protein by more than 100
fold without reducing the metal binding affinity and selectivity
relative to a contrast agent that does not include the PEG.
13. The contrast agent of claim 11, wherein the serum stability of
the contrast agent is improved relative to a contrast agent that
does not include the PEG.
14. The contrast agent of claim 11, wherein PEGylation of the
contrast agent increases the in vitro R1 and R2 relaxivities of the
contrast agents by at least 2-fold relative to a contrast agent
that does not include the PEG.
15. The contrast agent of claim 11, wherein the contrast agent
exhibits a significantly-increased blood circulation time relative
to a contrast agent not including the PEG.
16. The contrast agent of claim 11, wherein the immunogenicity of
the contrast agent is significantly decreased relative to a
contrast agent not including the PEG.
17. The contrast agent of claim 11, wherein the PEG has a molecular
weight of about 1 to 100 kDa.
18. The contrast agent of claim 11, wherein the PEG has a molecular
weight of about 1 to 20 kDa.
19. The contrast agent of claim 11, wherein the PEG is attached to
the scaffold protein via an amino acid selected from: lysine,
glutamic acid, aspartic acid, cysteine, carboxyl/amino terminals,
and combinations thereof.
20. The contrast agent of claim 11, wherein the PEG is attached to
the scaffold protein via lysine.
21. The contrast agent of claim 1, wherein at least one metal ion
chelating site is embedded within the scaffold protein.
22. The contrast agent of claim 1, wherein at least one metal ion
chelating site is substantially embedded within the scaffold
protein.
23. The contrast agent of claim 22, wherein the relaxivity of the
contrast agent is greater than that of the scaffold protein
relative to a contrast agent not including the PEG.
24. The contrast agent of claim 1, wherein the metal is a
paramagnetic metal ion selected from the group consisting of:
Gd(III), Mn(II), Fe(II), Fe(III), Co(II), Co(III), Ni(III), Mo(V),
and V(IV).
25. The contrast agent of claim 1, wherein the metal is an ion of a
metal selected from the group consisting of Lanthanide Series
metals.
26. The contrast agent of claim 1, wherein the scaffold protein is
selected from immunoglobulin proteins.
27. The contrast agent of claim 1, wherein the scaffold protein is
selected from proteins derived from a fluorescent protein having a
chromophore.
28. The contrast agent of claim 1, further comprising a targeting
agent attached to the scaffold protein.
29. The contrast agent of claim 28, wherein the targeting agent is
selected from the group consisting of: a biomarker probe, a
precancerous targeting agent, a cancer targeting agent, a tumor
targeting agent, and a probe or agent that targets of a biomarker,
a precancerous cell, a cancer cell, and a tumor.
30. The contrast agent of claim 28, wherein the targeting agent is
selected from the group consisting of: a gastrin release peptide
(GRP) and a RGD (Arg-Gly-Asp) peptide.
31. The contrast agent of claim 1, wherein the scaffold protein is
a natural metal binding site protein, wherein the natural metal
binding site protein includes a natural metal binding site, and
wherein the metal ion binding site is derived from a natural metal
binding site.
32. The contrast agent of claim 31, wherein the natural metal
binding protein is selected from a group consisting of: calmodulin,
calbindin D9K, troponin C, and parvalbumin.
33. The contrast agent of claim 1, wherein binding the metal ion
causes no changes to the protein conformation or to the binding
affinity under clinical conditions that would cause premature
release of the metal ion, and that the contrast agent will function
as a contrast agent.
34. The contrast agent of claim 1, wherein the tailored metal ion
binding site is present in an unmodified protein of a scaffold
protein.
35. The contrast agent of claim 1, wherein the tailored metal ion
binding site is integrated into the scaffold protein.
36. The contrast agent of claim 1, wherein the scaffold protein
includes a fragment or domain of a natural metal binding
protein.
37. The contrast agent of claim 1, wherein the scaffold protein
functions independently or in a complex with another cofactor,
ligand or other biomolecule.
38. A method of imaging a sample comprising: administering at least
one of the contrast agent of claims 1-37 to the sample; introducing
the sample to an imaging system; and imaging the sample.
39. The method as claimed in claimed 38, wherein the imaging system
is selected from the group consisting of: a nuclear magnetic
resonance system, a Near-IR system, a PET system, and a combination
thereof.
40. The method as claimed in claimed 38, wherein the imaging system
is an optical imaging system.
41. A method for preparing a contrast agent comprising the steps
of: a) selecting a scaffold protein; b) constructing at least one
metal ion chelating site; c) operatively embedding the metal ion
binding site into the protein, wherein the metal ion has contrast
agent properties, and d) attaching at least one polyethylene glycol
(PEG) to the scaffold protein.
42. The method of claim 41, wherein attaching includes: attaching
the PEG to the scaffold protein via an amino acid selected from the
group consisting of: lysine, glutamic acid, aspartic acid,
cysteine, carboxyl/amino terminals, and a combination thereof.
43. The method of claim 41, wherein attaching includes: attaching
the PEG to the scaffold protein via lysine.
44. The method of claim 41, wherein the PEGs are attached to amino
acid residues so that the PEGs do not substantially interfere with
or interfere with the metal ion binding site ability to interact
with the metal ion of interest or the conformation of the
polymer.
45. The method of claim 41, wherein constructing at least one metal
ion chelating site includes constructing at least two metal ion
chelating sites.
46. The method of claim 41, further comprising: attaching at least
one targeting agent to the scaffold protein.
Description
CROSS-REFERENCE TO RELATED APPLICATION
[0001] This application claims priority to copending U.S.
provisional application entitled, "CONTRAST AGENTS, METHODS FOR
PREPARING CONTRAST AGENTS, AND METHODS OF IMAGING," having Ser. No.
61/041,693, filed Apr. 2, 2008, which is entirely incorporated
herein by reference.
BACKGROUND
[0002] Magnetic resonance imaging (MRI) is a non-invasive technique
providing high resolution, three-dimensional images of
morphological features as well as functional and physiological
information about tissues in vivo. It is capable of detecting
abnormalities in deep tissues and allows for whole body imaging. It
has emerged as a primary diagnostic imaging technique for human
diseases.
[0003] Exogenous MRI contrast agents are often used to enhance the
contrast between pathological and normal tissues by altering the
longitudinal and transverse (i.e., T.sub.1 and T.sub.2) relaxation
times of water protons. The relaxivity (unit capability of the
agent to change the relaxation time) of a contrast agent is
dependent on several factors including the number of water
molecules in the coordination shell, the exchange rate of the
coordinated water with the bulk water, and the rotational
correlation time .tau..sub.R of the contrast agent. The MRI
contrast agent can have: 1) high relaxivity for high
contrast-to-noise ratio (CNR) and dose efficiency, 2) thermodynamic
stability, especially metal selectivity for the target ions over
excess physiological metal ions, to minimize the release of toxic
paramagnetic metal ions, 3) adequate vascular, tissue retention
time to allow imaging, and 4) proper excretion from the body. There
is a need in the art to meet some or all of these properties.
SUMMARY
[0004] Embodiments of the present disclosure provide for contrast
agents, methods of making contrast agents, and methods of using
contrast agents, and the like. One exemplary contrast agent, among
others, includes: a) a scaffold protein, and b) at least one metal
ion chelating site, wherein the scaffold protein includes at least
one metal ion chelating site that is already present or is
integrated into the scaffold protein, wherein the scaffold protein
includes a metal ion bound to a metal ion chelating site, wherein
the contrast agent is stable in a physiological environment.
[0005] One exemplary method of imaging a sample, among others,
includes: administering at least one of the contrast agent
described herein to the sample; introducing the sample to an
imaging system; and imaging the sample.
[0006] One exemplary method for preparing a contrast agent, among
others, includes: a) selecting a scaffold protein; b) constructing
at least one metal ion chelating site; c) operatively embedding the
metal ion binding site into the protein, wherein the metal ion has
contrast agent properties, and d) attaching at least one
polyethylene glycol (PEG) to the scaffold protein.
BRIEF DESCRIPTION OF THE DRAWINGS
[0007] Many aspects of the disclosure can be better understood with
reference to the following drawings. The components in the drawings
are not necessarily to scale, emphasis instead being placed upon
clearly illustrating the principles of the present disclosure.
Moreover, in the drawings, like reference numerals designate
corresponding parts throughout the several views.
[0008] FIG. 1.1: Schematic descriptions of different classes of MRI
contrast agents and simulation of T.sub.1 relaxivity. FIG. 1.1(a):
Different constructs of MRI contrast agents. (i) Small chelator
DPTA with a fast .tau..sub.R (.tau..sub.Rf) at .about.100 ps level;
(ii) Small contrast agents after being covalently conjugated to
macromolecules with a slow .tau..sub.R (.tau..sub.Rs) still possess
a fast .tau..sub.R due to its internal mobility; (iii) Schematic
description of the design of reported MRI contrast agents by
directly coordinating Gd.sup.3+ ions to ligand residues on a rigid
protein frame to eliminate the high internal mobility. The
rotational correlation time of the Gd.sup.3+ binding site is the
same as that of the whole protein (.tau..sub.Rs). FIG. 1.1(b):
Simulated T.sub.1 relaxivity at the given rotational correlation
time .tau..sub.R (100 ps, below, or 10 ns, above), water dwelling
time .tau..sub.m, correlation time of splitting .tau..sub.v (1 and
10 ps, solid and dashed lines, respectively), and mean square zero
field splitting energy .DELTA..sup.2 (10.sup.18 s.sup.-2). The
.tau..sub.m valves are 10.sup.-10 (.largecircle.), 10.sup.-9
(.quadrature.), and 10.sup.-8 s (.DELTA.) for 100 ps .tau..sub.R
and 10.sup.-9 ( ), 10.sup.-8 (.box-solid.), and 10.sup.-7 s
(.tangle-solidup.) for 10 ns .tau..sub.R according to the theory
developed by Blombergen, Solomon (refs 6 and 7 in Example 1). The
water coordination number, q, is assumed to be 1 and the agent
concentration is 0.001 M. See on-line supporting materials for r1
and r2 simulations. FIG. 1.1(c): Modeled structure of designed
Gd.sup.3+-CA1.CD2 based on the designed NMR structure 1T6W (ref 31
in Example 1). Ligand residues E15, E56, D58, D62 and D64 at the B,
E, and D .beta.-strands of the host protein CD2 are shown in
red.
[0009] FIG. 1.2: Comparison of in vitro relaxivity between DTPA and
designed contrast agents. FIG. 1.2(a): MR images produced using
Spin-echo sequence, TR 6000 ms, TI 960 ms, TE 7.6 ms at 3T. Samples
are 1) dH.sub.2O, 2) 10 mM Tris-HCl pH 7.4, 3) 0.10 mM Gd-DTPA in
H.sub.2O, 4) 0.10 mM Gd-DTPA in 10 mM Tris-HCl pH 7.4, 5) 0.10 mM
Gd.sup.3+ and CD2, 6) 0.077 mM Gd-CA4.CD2, 7) 0.050 mM Gd-CA2.CD2,
8) 0.10 mM Gd-CA9.CD2, 9) 0.020 mM Gd-CA1.CD2, and 10) 0.050 mM
Gd-CA1.CD2. FIG. 1.2(b): Proton relaxivity values of Gd-CA1.CD2
(r.sub.1, solid black; r.sub.2, cross) and Gd-DPTA (r.sub.1,
shield; r.sub.2, open) at indicated field strength were measured.
FIG. 1.2(c): In vitro relaxivity of contrast agents Gd-DPTA (DTPA),
Gd-CA1.CD2 (CA1) and Gd-CA2.CD2 (CA2) in the absence of Ca.sup.2+
(black and grey), presence of 1 mM Ca.sup.2+ (left strip and open)
and 10 mM Ca.sup.2+ (right strip and cross) at 3T. T.sub.1 (black,
left & right strips) and T.sub.2 (grey, open and cross) were
determined using a Siemens whole-body MR system.
[0010] FIG. 1.3: Dynamic properties and hydration water number of
designed contrast agents. FIG. 1.3(a): S.sup.2 order values of the
engineered metal binding protein. The positions of ligand residues
are shown in vertical bars. Order factors of CA2-CD2 with
discontinuous ligand residues have the same dynamic properties as
the scaffold protein. Arrows indicate the position of ligand
residues. FIG. 1.3(b): Measurement of coordination water number by
monitoring Tb.sup.3+ life time. Luminescence decay lifetime was
obtained by fitting the acquired data in both H.sub.2O and D.sub.2O
with a mono-exponential decay function. A standard curve
correlating the .DELTA.k.sub.obs with water number was established
by using well-characterized chelators, such as EDTA (q=3), DTPA
(q=1), NTA (q=5), and Aquo Tb.sup.3+ (q=9) solution with
R.sup.2=0.997..sup.26,27 Water numbers coordinated to
Tb.sup.3+-protein complexes were then obtained by fitting the
acquired .DELTA.k.sub.obs value to the standard curve.
[0011] FIG. 1.4: In vivo MR images and biodistribution of designed
contrast agents. FIG. 1.4(a): MR images of mouse (26 g) pre (left)
and 40 minutes post (right) the injection of 50 .mu.L, of 1.2 mM
Gd-CA1.CD2 through the tail vein. The MRI was performed using a
spin echo sequence with TE/TR/Angle=15 ms/500 ms/90.degree. using a
3T scanner. The arrows indicate the contrast enhancements at
different organ sites. FIG. 1.4(b): The MRI signal intensity
changes at kidney ( ), liver (.tangle-solidup.), and muscle
(.diamond.) as a function of time. The 0 refers to the
pre-injection. FIG. 1.4(c): Tissue distributions 1 hour post
intravenous injection of Gd-CA1.CD2 (3.0 .mu.mole/kg, solid black),
Gd-DTPA (150 .mu.mole/kg, grey), and GdCl.sub.3 (100 .mu.mole/kg,
open) The Gd.sup.3+ in tissues was measured by ICP-MS and was
calculated and expressed as percent of the injected dose..sup.45
The Gd.sup.3+ in carcass is the average of randomly picked 10
different sites from rest of whole body after removing indicated
organs. Error bars in FIGS. 1.4(a), (b), and (c) are standard
deviations of four measurements or four animals (n=4).
[0012] FIG. 1.5: The ESI-TOF MS spectrum of Gd-CA1.CD2. The CA1.CD2
(10 .mu.M) in 1 mM ammonium acetate (pH 7.0) was mixed with 20
.mu.M of gadolinium chloride (GdCl.sub.3). The ESI-TOF MS spectra
of the complex were recorded by Q-TOF Micro Mass Spectrometer
(Micromass).
[0013] FIG. 1.6: Measurement of metal binding constants. Gd.sup.3+
binding affinity (FIG. 1.6a) and Zn.sup.2+ binding affinity (FIG.
1.6b) of CA1.CD2 measured by dye competition assays. CA1.CD2 stock
solution was gradually added into the 1:1 dye-metal complex to
compete for the dye-bound metal ions. The insets show the titration
curve for the dye indicators fluo 5N (FIG. 1.6a) and FluoZin (FIG.
1.6b), respectively. (FIG. 1.6c) La.sup.3+ binding affinity
obtained by Aromatic residue sensitized Tb.sup.3+ luminescence
energy transfer. The Tb.sup.3+ fluorescence of a protein-Tb.sup.3+
mixture decreases with the addition of La.sup.3+. The La.sup.3+
concentrations are 0, 0.30, 0.76, 5.95, 11.03, and 28.95 .mu.M from
top to bottom. The Tb.sup.3+ fluorescence decrease competition was
fitted (line) by a normal competition plus a nonspecific quenching
effect (inset).
[0014] FIG. 1.7: MRI imaging of CA1.CD2 at 9.4 T. FIG. 1.7(a): MR
images of CD-1 mouse (26 g) (four mice were imaged) at 9.4T field
using Gd-CA1.CD2 as a T.sub.2-weighted contrast agent. The images
were recorded pre-(i) and 2 hours post-(ii & iii) injection of
50 .mu.l of 1.2 mM Gd-CA1.CD2 agent through the tail vein. MR
images were recorded using a multi-echo Carr-Purcell-Meiboom-Gill
(CPMG) sequence. The in-plane resolution is 0.2.times.0.3.times.1.0
mm. FIG. 1.7(b): The T.sub.2 MRI relative intensity changes at
kidney cortex (cross bars), kidney medulla (bars), kidney center
(bars), liver (bars), and muscle (bars) as a function of time
(indicated). The MRI intensity in muscle at 10 minutes post
contrast administration was defined as 1. MRI intensities at other
tissue sites were normalized to the muscle intensity.
[0015] FIG. 1.8: Detection of CA1.CD2 in serum and cytotoxicity of
CA1.CD2. FIG. 1.8(a): Sandwich ELISA detection of CA1.CD2 in mouse
blood using OX45 and PabCD2. PabCD2 was used as the capture
antibody and OX45 was used as the detection antibody in the
sandwich-ELISA experiments. Serum samples were obtained from test
mice at 0, 0.5, 1.0, 2, and 3 hours post injection (tail vein) of
Gd-CA1.CD2 (.about.1.0 .mu.mole/kg). The amounts of CA1.CD2 are
expressed as percentages of the injected dose. Calculations are
based on the assumption that the total blood volume is 8% of each
individual mouse body weight. FIG. 1.8(b): The cytotoxicity of
designed protein Gd-CA1.CD2. The SW480 cells were grown under
standard conditions (1.times.10.sup.4 cells in 100 .mu.l medium).
The cells were treated by addition of wild type CD2 (stripe bars),
CA1.CD2 (grey bars), Gd-CA1.CD2 (black bars), and Gd-DTPA (cross
bars) with concentrations of 30 .mu.M (left panel) or 50 .mu.M
(right panel). The open bars are controls where cells were treated
with PBS buffer. The cells were incubated with the treatments for
48 hours. The cells were then subjected for MTT assay. The results
were presented as percentages of viable cells using the cells that
were treated with buffer alone (filled bars) as a reference (100%).
The cell lines SW620 and HEK293 were similarly examined. The error
bars in FIGS. 1.8(a) and (b) are standard deviations of four
measurements or four animals (n=4).
[0016] FIG. 2.1(a): Illustrates the model structure of the designed
contrast agent CA1.CD2 with eight Lys residues highlighted. The
solvent accessibility calculated by Getarea is also listed. FIG.
2.1 (b): Examples of PEGylation reagents used with different chain
lengths and molecular weights and related chemical reactions.
[0017] FIG. 2.2: (top) illustrates a FPLC profile for the
separation of pegylated protein CA1.CD2 with P12K and reaction
mixture by gel filtration column. (bottom) The SDS gel of FPLC
fractions (peaks 123) of CA1.CD2 pegylated with P40 stained by
idiol (left) and commassie blue (right).
[0018] FIG. 2.3: The SDS gel stained by commassie blue (middle) for
protein and iodine (top) for PEG moiety with 5:1 PEG:protein using
the preactivated PEG reagents. 1. Marker; 2. CA1.CD2; 3. PEG4; 4.
PEG12; 5. PEG40; 6. PEG5K; 7. PEG12K; 8. PEG20K. CA1.CD2 was
Pegylated mainly with 3, 4, 5 PEG. (bottom) MALD-Mass analyses of
mixture after PEGylation with PEG40.
[0019] FIG. 2.4: Illustrates the conformational analysis of
PEGylaed CA1.CD2. (left) Trp emission fluorescence spectrum of
CA1.CD2 is similar to that PEGylated CA1.CD2-PEG12 and
CA1.CD2-PEG40 excited at 280 nm. (right) The Terbium-sensitized
energy transfer was used to monitor the binding of metal ions in
the designed binding pocket. The Tb3+ emission is gradually
increased upon addition of terbium excited at 280 nm.
[0020] FIG. 2.5: Pegylated CA1.CD2-P40 remains intact after
incubate with human serum for 24 hours at 37.degree. C. monitored
by SDS Page.
[0021] FIG. 2.6: R1 (left) and R2 (right) relaxivity values of
CA1.CD2 alone, pegylated with P12, and P40 compared with DTPA at
different field strengths (0.47, 3.0, 9.4, and 11.4T).
[0022] FIG. 2.7: Illustrates ELISA (left) or western blot (right)
analyses of antibody produced in rabbit serum after i.p. injection
of 3 ng/kg of protein CA1.CD2 or PEGylated CA1.CD2 (PEGCA1.CD2). In
(left), Pre is the serum from pre-bleeding before antigen
injection. CA1.CD2 was mixed with adjuvant (CA1.CD2+Ad) or with
buffer saline (CA1.CD2+Sal) before injection. PabCD2 is the
anti-serum from rabbits produced by a commercial source use CD2 as
antigen. The open bars are the first bleed after first injection.
The gray bars are the second bleed after second injection. The
rabbit blood was taken 3 weeks after each injection. The error bars
are standard deviations of four measurements. In (right), Western
blots were performed with anti-serum (1st bleed) from rabbits that
were injected; CA1.CD2 mixed with buffered saline (left panel,
CA1.CD2+Sal), CA1.CD2 mixed with adjuvant (middle panel,
CA1.CD2+Ad), and the PEGylated CA1.CD2 (right panel, PEG-CA1.CD2).
The Western blots experiments were carried out with 0.5 mg of
PEGylated CA1.CD2 (PEG-CA1.CD2) or unmodified CA1.CD2 (CA1.CD2).
Arrow indicates the position of the detected protein bands 19 hours
post injection.
[0023] FIG. 2.8: Table 2.1 is a summary of water number in CA1.CD2
and its variants.
[0024] FIG. 3.1: Illustrates the development of MRI contrast agents
by modifying natural calcium binding proteins such as calmodulin
with four metal binding sites.
[0025] FIG. 3.2: Illustrates the determination of Gd.sup.3+
stability constant of CaM variants. CaM titration (FIG. 3.2A) and
its curve fitting (FIG. 3.2B) with Fura-2 fluorescence spectra. The
measurement was performed at 20 mM Gd.sup.3+ and 20 mM Fura-2 with
10 mM Tris and pH 7.4. The arrows show fluorescence intensity
changes at 340 nm and 380 nm excitation wavelengths with the
increase of CaM concentration, respectively. lem=510 nm. FIG.
3.2(c): The meal selectivity of CBPP (left) and CBPP56 (right). The
addition of 1.5 .mu.M protein to free Tb.sup.3+ (40 .mu.M) solution
resulted in an increase of fluorescence intensity at 545 nm by over
20-fold due to the binding of Tb.sup.3+ to the protein and the
resultant FRET. 10 mM Mg.sup.2+, 2 mM Ca.sup.2+, 1 .mu.M Ca.sup.2+,
0.1 mM Zn.sup.2+, and 10 .mu.M La.sup.3+ and 10 .mu.M Gd.sup.3+
were subsequently added to individually prepared solutions
containing 40 .mu.M Tb.sup.3+, 100 mM Kcl and 1.5 .mu.M CBPP or
CBPP56.
[0026] FIG. 3.3: Illustrates the SDS gel of PEGylation of CaM
variants with P12 (lanes 1-6), P40 (lanes 7-10), P5K (Lanes 11-14),
and P40 (lanes 15-17) at different reaction time with PEG:protein
5:1 ratio stained by Idiol (top A) and commossie blue (bottom
B).
[0027] FIG. 3.4: Illustrates the separation of PEGylation of CaM
variants-P12 with mono-Q column (left) and UV absorption spectrum
of purified protein (right).
[0028] FIG. 3.5: Illustrates Tyr emission spectra of CAM variant
without and with PEGYlation by P12K excited at 280 nm (FIG. 3.5A)
Emission spectra of Tb fluorescence of CAM variant (FIG. 3.5B) and
its PEGylated one in the presence of 0 (bottom), 5 uM (middle), and
20 uM of protein (top) excited at 280 nm (FIG. 3.5C).
[0029] FIG. 3.6: Shows the SDS PAGE results of serum stability for
new designed protein based MRI Contrast Agents at different time
points incubating with serum at 37.degree. C. (FIG. 3.6A). CBP1;
(FIG. 3.6B).CBPP.
[0030] FIG. 3.7: Illustrates MRI images of Mice at 4.7T with tail
vein injection of 6 mM CBP1 at 0, 10, and 30 mins post injection
(top). Relative MRI intensity at different organs (bottom).
[0031] FIG. 3.8: Illustrates relaxivity of CBP1 at 0.47 T. Both R1
and R2 values are 5-8 fold higher than DTPA.
[0032] FIG. 3.9: Illustrates MRI images of Mice at 4.7T with tail
vein injection of 6 mM CBP1-P40 at 0, and 13 mins post injection at
slice 3 (top) and slice 4 (bottom). (right) These graphs illustrate
the relative MRI intensity at different organs.
[0033] FIG. 3.10: Illustrates Table 3.1, which shows the
dissociation constant of C.sup.2+, Tb.sup.3+ and Gd.sup.3+ to CBPP
were measured by Fluorescence spectroscopy. To determine the
Ca.sup.2+ and Gd.sup.3+ dissociation constant, the intrinsic
tryptophan fluorescence change were used to monitor the binding
process between CBP1/CBPP and metal. The free metal concentration
were controlled by the metal-EGTA buffer system and calculated by
[Metal].sub.free=Kd*[EGTA-metal]/[EGTA].sub.free. The aromatic
residue-sensitized Tb.sup.3+ fluorescence at 545 nm were applied to
monitor the process of Tb.sup.3+ binding to CBP1/CBPP and the
variants.
[0034] FIG. 4.1: The affibody that can specifically bind to Her2
biomarker on the cancer cells was fused to the C-terminal of the
protein contrast agent CA1.CD2 with a designed Gd.sup.3+ binding
site (denoted as CA1-Affi). This contrast agent was surface
modified with PEG40 to reduce immunogenesity and increase
solubility and serum stability (PEG-CA1-Affi). The affibody was
further conjugated with near infra-red dye Cy5.5 via a Cys at the
C-terminal to generate a dual labeled contrast agent
PEG-CA1-Affi-Cy5.5.
[0035] FIG. 4.2: Contrast agent with PeGylation (PEG-CA1-affi) and
without PeGylation (CA1-Aff) is able to bind to the positive cell
line AU565 with membrane staining at 4 C (top right) and both
membrane and cytosol staining at 37 C (top left). This developed
contrast agent does not bind to negative cell line EMT-6 at either
4 or 37 C. (Bottom right) Near IR labeled contrast agent
PEG-CA1-affi-Cy5.5 is able to bind to positive cell lines AU565 and
AKOV-3 with NIR fluorescence signal. These data suggest that our
contrast agent fused with the affibody can target to HER2 positive
tumor cell lines specifically. PEGylation does not change the
target capability to the cancer cell. At 37.degree. C., the
contrast agent is endocytosized.
[0036] FIG. 4.3: Specific targeting to the positive cancer cell
line (AU565) and negative cell line (EMT6) monitored by .sup.153Gd
(FIG. 4.3A) and ELISA (FIG. 4.3B). Similar radioactivity (CPM) of
the contrast agents without PEGylation (CA1-Affi) and with
PEGylation (PEG-CA1-Affi) at 75, 150, 375 nM were observed for
AU565 cell line. Under identical conditions, negative cell line EMT
has a small radioactivity after incubating with .sup.153Gd labeled
contrast agent.
[0037] FIG. 4.4: Breast cancer biomarker HER2 positive tumor and
negative tumor were implanted on the left and right back in nude
mice. 5 mM contrast agent CA1.Affi-P40 (100 fold lower than clinic
used DTPA) was injected via tail vein. MRI images at 4.7 T using
fast spin echo were acquired before injection, and at 5 min, 30
min, 3 hr, 24 hr and 52 hr post injection. Positive tumor shows a
strong contrast after 30 mins and peaked at 24 hour with about 35%
enhancement. Contrast capability was decreased after 52 hours,
suggesting that the contrast agent was secreted out of the animal.
This mouse was alive and looks normal after 52 hours MRI
scanning.
[0038] FIG. 4.5: Nude mice were inoculated with negative cell line
MDA-MB-231 and positive cell line SKOV-3 (top). The cell number for
each spot was about 5.times.10.sup.6. The specific binding of
positive tumor on the right upon injection of the dual labeled
contrast PeG-CA1-Affi-Cy5.5 can be visualized using Kodak NIR in
vivo FX-pro animal imaging system 21 hours poster injection.
(middle) Traverse MR images of tumor mice at 4.7T with fast spin
echo obtained at 3 min., 35 min., and 21 hours following
administration of the contrast agent. (bottom right) The intensity
enhancement at the positive tumor by our contrast agent analyzed by
Image J.
[0039] FIG. 4.6: Western Blot with PAbPEGCA1 (top) and NIR imaging
(bottom) of different tissues of the tumor nice after MRI
imaging.
[0040] FIG. 4.7: Immunohistochemistry (IHC) staining using the
antibody PAbPGCA1 with tissue slides made from the tissue samples
from the imaged mice, including HER2 tumors. Strongest staining was
observed with liver and HER2 positive tumor tissue slides. The
kidney slides also gave strong immunostaining. Interestingly, the
areas near proximal tubes showed the strongest staining in the
slides made from the kidney, indicating that the protein contrast
agent was ready to be filtered through the kidney.
[0041] FIG. 4.8: The binding of CAM-Affi with HER2 positive cells
was measured by western blot.
[0042] FIG. 4.9: Immune staining of CaM-Affi treated breast cancer
cells for skov-3 (Left, Her 2 positive) and MDA-MB-231 (right, Her2
negative).
[0043] FIG. 4.10: Immunostaining CA-Bom, CA-52I-Bom, CA at
different time points for PC-3 and DU145 (GRPR high expression),
and H441 (GRPR low expression).
[0044] FIG. 4.11: Near IR imaging of nude mice xenografted with
DU-145 tumor (high expression of GRPR, left) and H441 tumor (low
expression of GRPR, control, right) post injection of
CA1.CD2-52Ibom-cy5.5-P40 26 hours via tail vein.
[0045] FIG. 4.12: NIR imaging (top) and NIR intensity (bottom) of
CA1.CD2-52I-Bom-Cy5.5-P40 at different organs of the mice.
DETAILED DESCRIPTION
[0046] Before the present disclosure is described in greater
detail, it is to be understood that this disclosure is not limited
to particular embodiments described, and the embodiment of the
invention as such may, of course, vary. It is also to be understood
that the terminology used herein is for the purpose of describing
particular embodiments only, and is not intended to be limiting,
since the scope of the present disclosure will be limited only by
the appended claims.
[0047] Unless defined otherwise, all technical and scientific terms
used herein have the same meaning as commonly understood by one of
ordinary skill in the art to which this disclosure belongs.
[0048] All publications and patents cited in this specification are
herein incorporated by reference as if each individual publication
or patent were specifically and individually indicated to be
incorporated by reference and are incorporated herein by reference
to disclose and describe the methods and/or materials in connection
with which the publications are cited.
[0049] As will be apparent to those of skill in the art upon
reading this disclosure, each of the individual embodiments
described and illustrated herein has discrete components and
features which may be readily separated from or combined with the
features of any of the other several embodiments without departing
from the scope or spirit of the present disclosure. Any recited
method can be carried out in the order of events recited or in any
other order that is logically possible.
[0050] Embodiments of the present disclosure will employ, unless
otherwise indicated, techniques of imaging, synthetic organic
chemistry, biochemistry, biology, molecular biology, recombinant
DNA techniques, pharmacology, and the like, which are within the
skill of the art. Such techniques are explained fully in the
literature.
[0051] The examples herein are put forth so as to provide those of
ordinary skill in the art with an illustrative disclosure and
description of how to perform the methods and use the compounds
disclosed and claimed herein. Unless indicated otherwise, parts are
parts by weight, temperature is in .degree. C., and pressure is at
or near atmospheric. Standard temperature and pressure are defined
as 20.degree. C. and 1 atmosphere.
[0052] Before the embodiments of the present disclosure are
described in detail, it is to be understood that, unless otherwise
indicated, the present disclosure is not limited to particular
materials, reagents, reaction materials, manufacturing processes,
or the like, as such can vary. It is also to be understood that the
terminology used herein is for purposes of describing particular
embodiments only, and is not intended to be limiting. It is also
possible in the present disclosure that steps can be executed in
different sequence where this is logically possible.
[0053] It must be noted that, as used in the specification and the
appended claims, the singular forms "a," "an," and "the" include
plural referents unless the context clearly dictates otherwise.
Thus, for example, reference to "a compound" includes a plurality
of compounds. In this specification and in the claims that follow,
reference will be made to a number of terms that shall be defined
to have the following meanings unless a contrary intention is
apparent.
DEFINITIONS
[0054] In describing and claiming the disclosed subject matter, the
following terminology will be used in accordance with the
definitions set forth below.
[0055] As used herein, a "contrast agent" is intended to include
any agent that is physiologically tolerable and capable of
providing enhanced contrast for magnetic resonance imaging. A
suitable contrast agent is preferably biocompatible, e.g.,
non-toxic, chemically stable, not absorbed by the body or reactive
with a tissue, and eliminated from the body within a short
time.
[0056] The term "polymer" means any compound that is made up of two
or more monomeric units covalently bonded to each other, where the
monomeric units may be the same or different, such that the polymer
may be a homopolymer or a heteropolymer. Representative polymers
include peptides, polysaccharides, nucleic acids and the like,
where the polymers may be naturally occurring or synthetic.
[0057] The term "polypeptides" includes proteins and fragments
thereof. Polypeptides are disclosed herein as amino acid residue
sequences. Those sequences are written left to right in the
direction from the amino to the carboxy terminus. In accordance
with standard nomenclature, amino acid residue sequences are
denominated by either a three letter or a single letter code as
indicated as follows: Alanine (Ala, A), Arginine (Arg, R),
Asparagine (Asn, N), Aspartic Acid (Asp, D), Cysteine (Cys, C),
Glutamine (Gln, Q), Glutamic Acid (Glu, E), Glycine (Gly, G),
Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine
(Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline
(Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W),
Tyrosine (Tyr, Y), and Valine (Val, V). In addition, the protein
can include non-standard and/or non-naturally occurring amino
acids, as well as other amino acids that may be found in
phosphorylated proteins in organisms such as, but not limited to,
animals, plants, insects, protists, fungi, bacteria, algae,
single-cell organisms, and the like. The non-standard amino acids
include, but are not limited to, selenocysteine, pyrrolysine,
gamma-aminobutyric acid, carnitine, ornithine, citrulline,
homocysteine, hydroxyproline, hydroxylysine, sarcosine, and the
like. The non-naturally occurring amino acids include, but are not
limited to, trans-3-methylproline, 2,4-methanoproline,
cis-4-hydroxyproline, trans-4-hydroxyproline, N-methyl-glycine,
allo-threonine, methylthreonine, hydroxy-ethylcysteine,
hydroxyethylhomocysteine, nitro-glutamine, homoglutamine, pipecolic
acid, thiazolidine carboxylic acid, dehydroproline, 3- and
4-methylproline, 3,3-dimethylproline, tert-leucine, norvaline,
2-azaphenylalanine, 3-azaphenylalanine, 4-azaphenylalanine, and
4-fluorophenylalanine.
[0058] "Variant" refers to a polypeptide or polynucleotide or
polymer that differs from a reference polypeptide or polynucleotide
or polymer, but retains essential properties. A typical variant of
a polypeptide differs in amino acid sequence from another,
reference polypeptide. Generally, differences are limited so that
the sequences of the reference polypeptide and the variant are
closely similar overall and, in many regions, identical. A variant
and reference polypeptide may differ in amino acid sequence by one
or more modifications (e.g., substitutions, additions, and/or
deletions). A variant of a polypeptide includes conservatively
modified variants. A substituted or inserted amino acid residue may
or may not be one encoded by the genetic code. A variant of a
polypeptide may be naturally occurring, such as an allelic variant,
or it may be a variant that is not known to occur naturally.
[0059] A variant of a polypeptide may contain different
modifications such as with PEGylation groups or the same type of
groups with different sizes or lengths of the modifications.
[0060] "Variant" generated such as by modifying metal binding sites
may have different metal binding properties and relaxivities and
vivo peroperties.
[0061] Modifications and changes can be made in the structure of
the polypeptides of this disclosure and still obtain a molecule
having similar characteristics as the polypeptide (e.g., a
conservative amino acid substitution). For example, certain amino
acids can be substituted for other amino acids in a sequence
without appreciable loss of activity. Because it is the interactive
capacity and nature of a polypeptide that defines that
polypeptide's biological functional activity, certain amino acid
sequence substitutions can be made in a polypeptide sequence and
nevertheless obtain a polypeptide with like properties.
[0062] In making such changes, the hydropathic index of amino acids
can be considered. The importance of the hydropathic amino acid
index in conferring interactive biologic function on a polypeptide
is generally understood in the art. It is known that certain amino
acids can be substituted for other amino acids having a similar
hydropathic index or score and still result in a polypeptide with
similar biological activity. Each amino acid has been assigned a
hydropathic index on the basis of its hydrophobicity and charge
characteristics. Those indices are: isoleucine (+4.5); valine
(+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cysteine
(+2.5); methionine (+1.9); alanine (+1.8); glycine (-0.4);
threonine (-0.7); serine (-0.8); tryptophan (-0.9); tyrosine
(-1.3); proline (-1.6); histidine (-3.2); glutamate (-3.5);
glutamine (-3.5); aspartate (-3.5); asparagine (-3.5); lysine
(-3.9); and arginine (-4.5).
[0063] It is believed that the relative hydropathic character of
the amino acid determines the secondary structure of the resultant
polypeptide, which in turn defines the interaction of the
polypeptide with other molecules, such as enzymes, substrates,
receptors, antibodies, antigens, and the like. It is known in the
art that an amino acid can be substituted by another amino acid
having a similar hydropathic index and still obtain a functionally
equivalent polypeptide. In such changes, the substitution of amino
acids whose hydropathic indices are within .+-.2 is preferred,
those within .+-.1 are particularly preferred, and those within
.+-.0.5 are even more particularly preferred.
[0064] Substitution of like amino acids can also be made on the
basis of hydrophilicity, particularly, where the biological
functional equivalent polypeptide or peptide thereby created is
intended for use in immunological embodiments. The following
hydrophilicity values have been assigned to amino acid residues:
arginine (+3.0); lysine (+3.0); aspartate (+3.0.+-.1); glutamate
(+3.0.+-.1); serine (+0.3); asparagine (+0.2); glutamine (+0.2);
glycine (0); proline (-0.5.+-.1); threonine (-0.4); alanine (-0.5);
histidine (-0.5); cysteine (-1.0); methionine (-1.3); valine
(-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3);
phenylalanine (-2.5); tryptophan (-3.4). It is understood that an
amino acid can be substituted for another having a similar
hydrophilicity value and still obtain a biologically equivalent,
and in particular, an immunologically equivalent polypeptide. In
such changes, the substitution of amino acids whose hydrophilicity
values are within .+-.2 is preferred, those within .+-.1 are
particularly preferred, and those within .+-.0.5 are even more
particularly preferred.
[0065] As outlined above, amino acid substitutions are generally
based on the relative similarity of the amino acid side-chain
substituents, for example, their hydrophobicity, hydrophilicity,
charge, size, and the like. Exemplary substitutions that take
various of the foregoing characteristics into consideration are
well known to those of skill in the art and include (original
residue: exemplary substitution): (Ala: Gly, Ser), (Arg: Lys),
(Asn: Gln, His), (Asp: Glu, Cys, Ser), (Gln: Asn), (Glu: Asp),
(Gly: Ala), (His: Asn, Gln), (Ile: Leu, Val), (Leu: Ile, Val),
(Lys: Arg), (Met: Leu, Tyr), (Ser: Thr), (Thr: Ser), (Tip: Tyr),
(Tyr: Trp, Phe), and (Val: Ile, Leu). Embodiments of this
disclosure thus contemplate functional or biological equivalents of
a polypeptide as set forth above. In particular, embodiments of the
polypeptides can include variants having about 50%, 60%, 70%, 80%,
90%, and 95% sequence identity to the polypeptide of interest.
[0066] "Identity," as known in the art, is a relationship between
two or more polypeptide sequences, as determined by comparing the
sequences. In the art, "identity" also means the degree of sequence
relatedness between polypeptides as determined by the match between
strings of such sequences. "Identity" and "similarity" can be
readily calculated by known methods, including, but not limited to,
those described in (Computational Molecular Biology, Lesk, A. M.,
Ed., Oxford University Press, New York, 1988; Biocomputing:
Informatics and Genome Projects, Smith, D. W., Ed., Academic Press,
New York, 1993; Computer Analysis of Sequence Data, Part I,
Griffin, A. M., and Griffin, H. G., Eds., Humana Press, New Jersey,
1994; Sequence Analysis in Molecular Biology, von Heinje, G.,
Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M.
and Devereux, J., Eds., M Stockton Press, New York, 1991; and
Carillo, H., and Lipman, D., SIAM J Applied Math., 48: 1073
(1988).
[0067] Preferred methods to determine identity are designed to give
the largest match between the sequences tested. Methods to
determine identity and similarity are codified in publicly
available computer programs. The percent identity between two
sequences can be determined by using analysis software (e.g.,
Sequence Analysis Software Package of the Genetics Computer Group,
Madison Wis.) that incorporates the Needelman and Wunsch, (J. Mol.
Biol., 48: 443-453, 1970) algorithm (e.g., NBLAST and XBLAST). The
default parameters are used to determine the identity of the
polypeptides of the present disclosure.
[0068] By way of example, a polypeptide sequence may be identical
to the reference sequence, that is 100% identical, or it may
include up to a certain integer number of amino acid alterations as
compared to the reference sequence such that the % identity is less
than 100%. Such alterations are selected from: at least one amino
acid deletion, substitution, including conservative and
non-conservative substitution, or insertion, and wherein said
alterations may occur at the amino- or carboxy-terminal positions
of the reference polypeptide sequence or anywhere between those
terminal positions, interspersed either individually among the
amino acids in the reference sequence or in one or more contiguous
groups within the reference sequence. The number of amino acid
alterations for a given % identity is determined by multiplying the
total number of amino acids in the reference polypeptide by the
numerical percent of the respective percent identity (divided by
100) and then subtracting that product from said total number of
amino acids in the reference polypeptide.
[0069] Conservative amino acid variants can also comprise
non-naturally occurring amino acid residues. Non-naturally
occurring amino acids include, without limitation,
trans-3-methylproline, 2,4-methanoproline, cis-4-hydroxyproline,
trans-4-hydroxyproline, N-methyl-glycine, allo-threonine,
methylthreonine, hydroxy-ethylcysteine, hydroxyethylhomocysteine,
nitro-glutamine, homoglutamine, pipecolic acid, thiazolidine
carboxylic acid, dehydroproline, 3- and 4-methylproline,
3,3-dimethylproline, tert-leucine, norvaline, 2-azaphenyl-alanine,
3-azaphenylalanine, 4-azaphenylalanine, and 4-fluorophenylalanine.
Several methods are known in the art for incorporating
non-naturally occurring amino acid residues into proteins. For
example, an in vitro system can be employed wherein nonsense
mutations are suppressed using chemically aminoacylated suppressor
tRNAs. Methods for synthesizing amino acids and aminoacylating tRNA
are known in the art. Transcription and translation of plasmids
containing nonsense mutations is carried out in a cell-free system
comprising an E. coli S30 extract and commercially available
enzymes and other reagents. Proteins are purified by
chromatography. (Robertson, et al., J. Am. Chem. Soc., 113: 2722,
1991; Ellman, et al., Methods Enzymol., 202: 301, 1991; Chung, et
al., Science, 259: 806-9, 1993; and Chung, et al., Proc. Natl.
Acad. Sci. USA, 90: 10145-9, 1993). In a second method, translation
is carried out in Xenopus oocytes by microinjection of mutated mRNA
and chemically aminoacylated suppressor tRNAs (Turcatti, et al., J.
Biol. Chem., 271: 19991-8, 1996). Within a third method, E. coli
cells are cultured in the absence of a natural amino acid that is
to be replaced (e.g., phenylalanine) and in the presence of the
desired non-naturally occurring amino acid(s) (e.g.,
2-azaphenylalanine, 3-azaphenylalanine, 4-azaphenylalanine, or
4-fluorophenylalanine). The non-naturally occurring amino acid is
incorporated into the protein in place of its natural counterpart.
(Koide, et al., Biochem., 33: 7470-6, 1994). Naturally occurring
amino acid residues can be converted to non-naturally occurring
species by in vitro chemical modification. Chemical modification
can be combined with site-directed mutagenesis to further expand
the range of substitutions (Wynn, et al., Protein Sci., 2: 395-403,
1993).
[0070] As used herein, the term "polynucleotide" generally refers
to any polyribonucleotide or polydeoxyribonucleotide, which may be
unmodified RNA or DNA or modified RNA or DNA. Thus, for instance,
polynucleotides as used herein refers to, among others, single- and
double-stranded DNA, DNA that is a mixture of single- and
double-stranded regions, single- and double-stranded RNA, and RNA
that is mixture of single- and double-stranded regions, hybrid
molecules comprising DNA and RNA that may be single-stranded or,
more typically, double-stranded or a mixture of single- and
double-stranded regions. Polynucleotide encompasses the terms
"nucleic acid," "nucleic acid sequence," or "oligonucleotide" as
defined above.
[0071] In addition, polynucleotide as used herein refers to
triple-stranded regions comprising RNA or DNA or both RNA and DNA.
The strands in such regions may be from the same molecule or from
different molecules. The regions may include all of one or more of
the molecules, but more typically involve only a region of some of
the molecules. One of the molecules of a triple-helical region
often is an oligonucleotide.
[0072] As used herein, the term polynucleotide includes DNAs or
RNAs as described above that contain one or more modified bases.
Thus, DNAs or RNAs with backbones modified for stability or for
other reasons are "polynucleotides" as that term is intended
herein. Moreover, DNAs or RNAs comprising unusual bases, such as
inosine, or modified bases, such as tritylated bases, to name just
two examples, are polynucleotides as the term is used herein.
[0073] It will be appreciated that a great variety of modifications
have been made to DNA and RNA that serve many useful purposes known
to those of skill in the art. The term polynucleotide as it is
employed herein embraces such chemically, enzymatically or
metabolically modified forms of polynucleotides, as well as the
chemical forms of DNA and RNA characteristic of viruses and cells,
including simple and complex cells, inter alias.
[0074] By way of example, a polynucleotide sequence of the present
disclosure may be identical to the reference sequence, that is be
100% identical, or it may include up to a certain integer number of
nucleotide alterations as compared to the reference sequence. Such
alterations are selected from the group including at least one
nucleotide deletion, substitution, including transition and
transversion, or insertion, and wherein said alterations may occur
at the 5' or 3' terminal positions of the reference nucleotide
sequence or anywhere between those terminal positions, interspersed
either individually among the nucleotides in the reference sequence
or in one or more contiguous groups within the reference sequence.
The number of nucleotide alterations is determined by multiplying
the total number of nucleotides in the reference nucleotide by the
numerical percent of the respective percent identity (divided by
100) and subtracting that product from said total number of
nucleotides in the reference nucleotide. Alterations of a
polynucleotide sequence encoding the polypeptide may alter the
polypeptide encoded by the polynucleotide following such
alterations.
[0075] The term "codon" means a specific triplet of mononucleotides
in the DNA chain. Codons correspond to specific amino acids (as
defined by the transfer RNAs) or to start and stop of translation
by the ribosome.
[0076] The term "degenerate nucleotide sequence" denotes a sequence
of nucleotides that includes one or more degenerate codons (as
compared to a reference polynucleotide molecule that encodes a
polypeptide). Degenerate codons contain different triplets of
nucleotides, but encode the same amino acid residue (e.g., GAU and
GAC triplets each encode Asp).
[0077] The term "antibody" is used to refer both to a homogenous
molecular entity, or a mixture such as a serum product made up of a
plurality of different molecular entities. Monoclonal or polyclonal
antibodies, which specifically react with the virosomes of the
present disclosure, may be made by methods known in the art. (e.g.,
Harlow and Lane (1988) Antibodies: A Laboratory Manual, Cold Spring
Harbor Laboratories; Goding (1986) Monoclonal Antibodies:
Principles and Practice, 2d ed., Academic Press, New York; and
Ausubel et al. (1987)). Also, recombinant immunoglobulin may be
produced by methods known in the art, including but not limited to,
the methods described in U.S. Pat. No. 4,816,567, which is hereby
incorporated by reference herein.
[0078] Affibody.RTM. ligands (U.S. Pat. No. 5,831,012, which is
incorporated herein by reference) are highly specific affinity
proteins that may be designed and used like aptamers. Affibodies
may be produced or purchased from commercial sources (Affibody AB,
Bromma, Sweden). Aptamers and affibodies may be used in combination
with antibodies to increase the functional avidity of translucent
or non-translucent solid matrices for probe molecule binding.
Increased binding in turn results in an increased signal strength,
greater signal-to-noise ratio, more reproducible target molecule
detection and greater sensitivity of detection.
[0079] Aptamers must also be differentiated from the naturally
occurring nucleic acid sequences that bind to certain proteins.
These latter sequences generally are naturally occurring sequences
embedded within the genome of the organism that bind to a
specialized sub-group of proteins or polypeptides, or their
derivatives, that are involved in the transcription, translation,
and transportation of naturally occurring nucleic acids, i.e.,
protein-binding nucleic acids. Aptamers on the other hand are
short, isolated, non-naturally occurring nucleic acid molecules.
While aptamers can be identified that bind nucleic acid-binding
proteins, in most cases such aptamers have little or no sequence
identity to the sequences recognized by the nucleic acid-binding
proteins in nature. More importantly, aptamers can be selected to
bind virtually any protein (not just nucleic acid-binding proteins)
as well as almost any target of interest including small molecules,
carbohydrates, peptides, etc. For most targets, even proteins, a
naturally occurring nucleic acid sequence to which it binds does
not exist. For those targets that do have such a sequence, i.e.,
nucleic acid-binding proteins, such sequences will differ from
aptamers as a result of the relatively low binding affinity used in
nature as compared to tightly binding aptamers. Aptamers are
capable of specifically binding to selected targets and modulating
the target's activity or binding interactions, e.g., through
binding, aptamers may block their target's ability to function. The
functional property of specific binding to a target is an inherent
property of an aptamer.
[0080] A typical aptamer is 6-35 kDa in size (20-100 nucleotides),
binds its target with micromolar to sub-nanomolar affinity, and may
discriminate against closely related targets (e.g., aptamers may
selectively bind related proteins from the same gene family).
Aptamers are capable of using intermolecular interactions such as
hydrogen bonding, electrostatic complementarities, hydrophobic
contacts, and steric exclusion to bind with a specific target. In
the present disclosure, aptamers also employ boronic acid-Lewis
base/nucleophile (such as hydroxyl groups, diols, and amino groups)
interactions for binding. Aptamers have a number of desirable
characteristics for use as therapeutics and diagnostics including
high specificity and affinity, low immunogenicity, biological
efficacy, and excellent pharmacokinetic properties.
[0081] As used herein, the term "PEGylation" means and refers to
modifying a polymer (e.g., a protein) by covalently attaching
polyethylene glycol (PEG) to the polymer, with "PEGylated"
referring to a polymer having a PEG attached. For further general
information on PEGylation methods see, for example, the Nektar
Advanced PEGylation Catalogs 2004 and 2005-2006, as well as the
references cited therein. PEGYlation can be achieved by
non-specific interaction with functional group of polypeptide chain
such as via amino group or specific interaction at certain location
of the macromolecules such as amino terminal or at the Cys
residues.
[0082] The terms "biomarker" or "biomarker probe" are used to refer
to a substance used as an indicator of a biologic state. It is a
characteristic that is objectively measured and evaluated as an
indicator of normal biologic processes, pathogenic processes,
and/or pharmacologic responses to a therapeutic intervention.
[0083] The term "disease marker" is used to refer to substances,
such as proteins, bio-chemicals, nucleic acids, carbohydrates, or
enzymes, produced by disease cells or by the body in response to
disease cells during disease development and progression. These
substances are indicative of a particular disease process.
[0084] By "administration" is meant introducing a compound into a
subject. The preferred route of administration of the compounds is
intravenous. However, any route of administration, such as oral,
topical, subcutaneous, peritoneal, intraarterial, inhalation,
vaginal, rectal, nasal, introduction into the cerebrospinal fluid,
or instillation into body compartments can be used.
[0085] As used herein, the terms "treatment", "treating", and
"treat" are defined as acting upon a disease, disorder, or
condition with an agent to reduce or ameliorate the pharmacologic
and/or physiologic effects of the disease, disorder, or condition
and/or its symptoms. "Treatment," as used herein, covers any
treatment of a disease in a host (e.g., a mammal, typically a human
or non-human animal of veterinary interest), and includes: (a)
reducing the risk of occurrence of the disease in a subject
determined to be predisposed to the disease but not yet diagnosed
as infected with the disease (b) impeding the development of the
disease, and (c) relieving the disease, i.e., causing regression of
the disease and/or relieving one or more disease symptoms.
"Treatment" is also meant to encompass delivery of a contrast agent
including a compound to provide a pharmacologic effect, even in the
absence of a disease or condition. For example, "treatment"
encompasses delivery of a disease or pathogen compound via the
contrast agent that provides for enhanced or desirable effects in
the subject (e.g., reduction of pathogen load, reduction of disease
symptoms, etc.).
[0086] As used herein, the terms "prophylactically treat" or
"prophylactically treating" refers to completely or partially
preventing a disease or symptom thereof and/or may be therapeutic
in terms of a partial or complete cure for a disease and/or adverse
effect attributable to the disease.
[0087] The term "unit dosage form," as used herein, refers to
physically discrete units suitable as unitary dosages for human
and/or animal subjects, each unit containing a predetermined
quantity of a contrast agent calculated in an amount sufficient to
produce the desired effect in association with a pharmaceutically
acceptable diluent, carrier or vehicle. The specifications for unit
dosage forms depend on the particular compound employed, the route
and frequency of administration, the effect to be achieved, and the
pharmacodynamics associated with each compound in the host.
[0088] A "pharmaceutically acceptable excipient," "pharmaceutically
acceptable diluent," "pharmaceutically acceptable carrier," or
"pharmaceutically acceptable adjuvant" means an excipient, diluent,
carrier, and/or adjuvant that are useful in preparing a
pharmaceutical composition that are generally safe, non-toxic and
neither biologically nor otherwise undesirable, and include an
excipient, diluent, carrier, and adjuvant that are acceptable for
veterinary use and/or human pharmaceutical use. "A pharmaceutically
acceptable excipient, diluent, carrier and/or adjuvant" as used in
the specification and claims includes one or more such excipients,
diluents, carriers, and adjuvants.
[0089] As used herein, a "pharmaceutical composition" is meant to
encompass a contrast agent suitable for administration to a
subject, such as a mammal, especially a human. In general a
"pharmaceutical composition" is sterile, and preferably free of
contaminants that are capable of eliciting an undesirable response
within the subject (e.g., the compound(s) in the pharmaceutical
composition is pharmaceutical grade). Pharmaceutical compositions
can be designed for administration to subjects or patients in need
thereof via a number of different routes of administration
including oral, intravenous, buccal, rectal, parenteral,
intraperitoneal, intradermal, intracheal, intramuscular,
subcutaneous, inhalational and the like.
[0090] The terms "therapeutically effective amount" and "an
effective amount" are used interchangeably herein and refer to that
amount of a contrast agent being administered that is sufficient to
effect the intended application. In an embodiment, the effective
amount of the contrast agent includes enough so that the disease,
for example, in the host can be imaged, studied, diagnosed, or the
like. For example, an effective amount of a contrast agent
including a compound will relieve to some extent one or more of the
symptoms of the disease being treated, and/or that amount that will
prevent, to some extent, one or more of the symptoms of the disease
that the host being treated has or is at risk of developing. The
therapeutically effective amount may vary depending upon the
intended application (in vitro or in vivo), or the subject and
disease condition being treated, e.g., the weight and age of the
subject, the severity of the disease condition, the manner of
administration and the like, which can readily be determined by one
of ordinary skill in the art. The term also applies to a dose that
will induce a particular response in target cells. The specific
dose will vary depending on the particular compounds chosen, the
dosing regimen to be followed, whether it is administered in
combination with other compounds, timing of administration, the
tissue to which it is administered, and the physical delivery
system in which it is carried.
[0091] As used herein, the term "host," "subject," "patient," or
"organism" includes humans and mammals (e.g., mice, rats, pigs,
cats, dogs, and horses). Typical hosts to which compounds of the
present disclosure may be administered will be mammals,
particularly primates, especially humans. For veterinary
applications, a wide variety of subjects will be suitable, e.g.,
livestock such as cattle, sheep, goats, cows, swine, and the like;
poultry such as chickens, ducks, geese, turkeys, and the like; and
domesticated animals particularly pets such as dogs and cats. For
diagnostic or research applications, a wide variety of mammals will
be suitable subjects, including rodents (e.g., mice, rats,
hamsters), rabbits, primates, and swine such as inbred pigs and the
like. The term "living host" refers to a host noted above or
another organism that is alive. The term "living host" refers to
the entire host or organism and not just a part excised (e.g., a
liver or other organ) from the living host.
[0092] "Cancer", as used herein, shall be given its ordinary
meaning, as a general term for diseases in which abnormal cells
divide without control. In particular, cancer refers to
angiogenesis related cancer. Cancer cells can invade nearby tissues
and can spread through the bloodstream and lymphatic system to
other parts of the body.
[0093] There are several main types of cancer, for example,
carcinoma is cancer that begins in the skin or in tissues that line
or cover internal organs. Sarcoma is cancer that begins in bone,
cartilage, fat, muscle, blood vessels, or other connective or
supportive tissue. Leukemia is cancer that starts in blood-forming
tissue such as the bone marrow, and causes large numbers of
abnormal blood cells to be produced and enter the bloodstream.
Lymphoma is cancer that begins in the cells of the immune
system.
[0094] When normal cells lose their ability to behave as a
specified, controlled and coordinated unit, a tumor is formed.
Generally, a solid tumor is an abnormal mass of tissue that usually
does not contain cysts or liquid areas (some brain tumors do have
cysts and central necrotic areas filled with liquid). A single
tumor may even have different populations of cells within it, with
differing processes that have gone awry. Solid tumors may be benign
(not cancerous), or malignant (cancerous). Different types of solid
tumors are named for the type of cells that form them. Examples of
solid tumors are sarcomas, carcinomas, and lymphomas. Leukemias
(cancers of the blood) generally do not form solid tumors.
[0095] Representative cancers include, but are not limited to,
bladder cancer, breast cancer, colorectal cancer, endometrial
cancer, head and neck cancer, lung cancer, lymphoma, melanoma,
non-small-cell lung cancer, ovarian cancer, prostate cancer,
testicular cancer, uterine cancer, cervical cancer, thyroid cancer,
gastric cancer, brain stem glioma, cerebellar astrocytoma, cerebral
astrocytoma, glioblastoma, ependymoma, Ewing's sarcoma family of
tumors, germ cell tumor, extracranial cancer, Hodgkin's disease,
leukemia, acute lymphoblastic leukemia, acute myeloid leukemia,
liver cancer, medulloblastoma, neuroblastoma, brain tumors
generally, non-Hodgkin's lymphoma, osteosarcoma, malignant fibrous
histiocytoma of bone, retinoblastoma, rhabdomyosarcoma, soft tissue
sarcomas generally, supratentorial primitive neuroectodermal and
pineal tumors, visual pathway and hypothalamic glioma, Wilms'
tumor, acute lymphocytic leukemia, adult acute myeloid leukemia,
adult non-Hodgkin's lymphoma, chronic lymphocytic leukemia, chronic
myeloid leukemia, esophageal cancer, hairy cell leukemia, kidney
cancer, multiple myeloma, oral cancer, pancreatic cancer, primary
central nervous system lymphoma, skin cancer, small-cell lung
cancer, among others.
[0096] A tumor can be classified as malignant or benign. In both
cases, there is an abnormal aggregation and proliferation of cells.
In the case of a malignant tumor, these cells behave more
aggressively, acquiring properties of increased invasiveness.
Ultimately, the tumor cells may even gain the ability to break away
from the microscopic environment in which they originated, spread
to another area of the body (with a very different environment, not
normally conducive to their growth), and continue their rapid
growth and division in this new location. This is called
metastasis. Once malignant cells have metastasized, achieving a
cure is more difficult.
[0097] Benign tumors have less of a tendency to invade and are less
likely to metastasize. Brain tumors spread extensively within the
brain but do not usually metastasize outside the brain. Gliomas are
very invasive inside the brain, even crossing hemispheres. They do
divide in an uncontrolled manner, though. Depending on their
location, they can be just as life threatening as malignant
lesions. An example of this would be a benign tumor in the brain,
which can grow and occupy space within the skull, leading to
increased pressure on the brain.
[0098] It should be noted that precancerous cells, cancer cells,
cancer, and tumors may be used interchangeably in the
disclosure.
[0099] The terms "including", "such as", "for example", and the
like are intended to refer to exemplary embodiments and not to
limit the scope of the present disclosure.
Discussion
[0100] In accordance with the purpose(s) of the present disclosure,
as embodied and broadly described herein, embodiments of the
present disclosure, in one aspect, relate to contrast agents,
compositions including contrast agents, methods of making contrast
agents, methods of imaging, methods of diagnosing, methods of
studying, and the like. More particularly, embodiments of the
contrast agents include magnetic resonance imaging contrast agents
that accumulate in tissue and can be used to determine the presence
and/or location of a target. In addition, contrast agents of the
present disclosure can include targeting agents to target cells or
tissue (e.g., cancer). Embodiments of the present disclosure can be
tuned to have properties for diagnostic imaging.
[0101] In general, embodiments of the present disclosure include
contrasts agents that include a scaffold polymer (e.g., protein or
peptide) that includes (e.g., integrated into the scaffold protein)
at least one tailored metal ion binding site (e.g., 1, 2, 3, 4, 5,
or more biding sites) (also referred to as "metal ion binding
site") capable of chelating paramagnetic and heavy metal ions. In
an embodiment, the contrast agent can include a targeting agent. In
an embodiment, the contrast agent can include a Near-IR moiety
(e.g., functional group). In an embodiment, the modification of the
metal binding site, either by residue mutation or insertion, is
intended to alter the metal selectivity of the binding site. In an
embodiment, the contrast agent includes a metal ion interacting
(e.g., bonding with or chelating with) with the metal ion binding
site. In an embodiment, a contrast agent can include two metal ions
interacting (e.g., bonding with or chelating with) with two metal
ion binding sites. In an embodiment, the metal ion binding site may
be developed by a design approach or by a grafting approach. After
the site has been developed, the site or sites are operatively
integrated into the select areas of the scaffold polymer.
[0102] In an embodiment, the contrast agent is stable in a
physiological environment. The phrase "physiological environment"
can be described as cell, cellular conditions, tissues, organs, and
vertebrate/invertebrates, animal/human or buffer conditions (e.g.,
pH of about 6-8 and a temperature of about 5-45.degree. C.) mimic
closely to the cellular, or in vivo conditions. The term "stable"
in reference to "physiological environment" means that the contrast
agent is able to provide contrast capability and remain intact. In
an embodiment, the phrase "stable in a physiological environment"
refers to the contrast agent including at least one metal ion and
the binding of the metal ion causes no changes or substantially no
changes (e.g., less than 50%) to the protein (scaffold protein)
conformation or to the binding affinity of the tailored metal ion
binding site under clinical conditions (physiological environment)
that would cause premature release of the metal ion, and that the
contrast agent functions as a contrast agent as described
herein.
[0103] In an embodiment, the scaffold polymer of the contrast agent
includes polyethylene glycerol compounds (PEG) attached to the
polymer. The PEGs can be attached (e.g., bonded) to the polymer via
an amino acid residue such as lysine (Lys), glutamic acid (Glu),
aspartic acid (Asp), cysteine (Cys), and/or carboxyl/amino
terminals. The position of the amino acids on the polymer can be
selected to position the PEGs so that the PEGs do not substantially
interfere (e.g., decrease metal binding affinity more than 20%)
with or interfere with the metal ion binding sites ability to
interact with the metal ion of interest or the conformation of the
polymer. In an embodiment, the PEGs are attached to one or more Lys
residues since the position of the Lys residues on the polymer is
such that the PEGs do not substantially interfere with or interfere
with the metal ion binding site ability to interact with the metal
ion of interest or the conformation of the polymer. Unless
otherwise indicated or understood from the context of the sentence
or the embodiments being described, reference to "contrast agent"
refers to a contrast agent that includes PEGs. As noted herein,
embodiments of the present disclosure include contrast agents that
include PEGs and contrast agents that do not include PEGs.
Additional details regarding PEGs are described herein.
[0104] Embodiments of the present disclosure provide for PEGylated
contrast agents, where the PEGylation increases the blood
circulation time of the contrast agent in CD-1 mice. In addition,
PEGylation of the contrast agent increased the solubility of the
contrast agent by more than two-fold, three-fold, four-fold,
five-fold, six-fold, seven-fold, eight-fold, nine-fold, ten-fold,
or more relative to the un-PEGylated contrast agent. It should also
be noted that PEGylation of the contrast agent further increased
the in vitro of one or both R1 and R2 relaxivities of the contrast
agents by about 10%, 25%, 50%, 75%, 100%, or 2-3 fold or more,
relative to the un-PEGylated contrast agent. Although not intending
to be bound by theory, the increase in molecular size due to the
PEGylation and the addition of a hydration layer due to water
retention by Poly-PEG chain on protein surface may be the reasons
for the increases in the relaxivities.
[0105] Embodiments of this disclosure include contrast agents
capable of enhancing image contrast by affecting water molecule
proton relaxation rates. Such contrast agents are effective for
magnetic resonance imaging, in part, because the water proton
relaxation rate in the target tissue is affected differently from
the relaxation rate of the water protons in the surrounding tissue.
In an embodiment of the present disclosure, the contrast agents are
paramagnetic species, which form complexes with metal ions, so to
alter the relaxation rates of adjacent nuclei.
[0106] In an embodiment, the scaffold polymer (referred to as a
"protein" or "peptide" hereinafter) for MRI applications are a
protein that will host the tailored metal ion binding sites and has
the following characteristics:
[0107] (a) stability in a physiological environment,
[0108] (b) a topology suitable for the integration of metal ion
sites,
[0109] (c) a rotational correlation time optimized for the magnetic
field (e.g., around 100 milliseconds in a magnetic field of 1.3 to
3T), e.g., higher magnetic field application can demand a host
protein with a larger molecular weight, and
[0110] (d) a water exchange rate such that the relaxivity of the
protein is not limited by the water exchange rate.
[0111] In another embodiment, the contrast agent for use in MRI
applications can include a scaffold protein (referred to as a
"protein", "polymer", or "peptide") that includes a natural metal
binding protein or a fragment/domain of natural metal binding
proteins either with metal binding sites modified by at least one
amino acid or protein modification.
[0112] Properties of the scaffold protein also may include water
solubility, low interaction with the other cellular metal ions and
low toxicity. While all these properties are not required, the
optimal properties of the scaffold protein can depend on the
specific parameters of the imaging application.
[0113] Another property of the scaffold protein is its ability to
accept the introduction of metal ion binding sites therein. In an
embodiment, the scaffold protein has a three-dimensional structure
or an amino sequence with some homology to the proteins whose
structures have been solved, at least in part. Specifically, the
scaffold protein is screened to determine whether it can tolerate
the integration of various binding sites without excessive
denaturation. For example, the integration of metal ion binding
sites into the scaffold protein should not denature or unfold the
protein. Thus, the metal ion binding site should not be placed by
mutating a hydrophobic core or in a position that results in
substantial structural perturbation. This can be examined by
sequence alignment of proteins in the same family. In an
embodiment, the amino acids that have an essential role in folding
of the structure or the function will be conserved among different
species of this same type of the protein.
[0114] In an embodiment, metal ion binding sites are placed into a
scaffold protein such that the metal can be tumbled together with
the protein. It is better to find a location that is not so
flexible or the same flexibility as the protein body so as to match
the correction time. In an embodiment, it is preferred to design or
create the binding pocket in the protein. Although insertion could
work, it is preferable to do so in a relatively not so flexible
region. Usually the protein can be checked by looking at the B
factor (temperature factor for X-ray) or S2 factor (dynamic
flexibility factor for NMR) of the pdb (protein data bank) file of
the structure.
[0115] In an embodiment, more than one metal binding site may be
integrated into a scaffold protein. The inclusion of more than one
binding site improves the sensitivity of the contrast agent. In
embodiments where more than one binding site is integrated into the
protein, the site could have different affinities, but should still
have strong enough affinity for the selected metal so to avoid
competition with physiological metal ions. Both metal ions should
be embedded into the host protein with preferred rotational
correlation times and water exchange rates to provide MRI contrast
with an increased sensitivity.
[0116] In an embodiment, the contrast agent can have a high
affinity to and can preferentially select a particular metal ion
(e.g., Gd.sup.3+, Mn.sup.2+, or Fe.sup.3+). In one example,
exemplary contrast agents showed a dissociation constant K.sub.d
less than 10.sup.12 [M] for Gd.sup.3+ in an environment having
physiological metal ions and prevented those metal ions from
precipitation under physiological conditions. Thus, the present
disclosure may be used to create contrast agents having optimal
selectivity for a specific metal ion.
[0117] Embodiments of the present disclosure can provide a new
mechanism to increase the relaxivity of contrast agents. This is
accomplished by designing the metal ion binding sites, e.g.,
Gd.sup.3+, in proteins, which can eliminate the mobility and
flexibility of the chelating moiety associated with currently
available contrast agents. High proton relaxivity by contrast
agents can further enhance images.
[0118] An advantage of the present disclosure is that it provides
contrast agents that can preferentially chelate a specific metal
ion. For example, a preferred contrast agent having Gd.sup.3+
binding site(s) will preferentially chelate Gd.sup.3+ over other
metal ions, such as Mg.sup.2+ or Ca.sup.2+. The ability to
preferentially chelate a specific metal ion can improve the
specificity of a contrast agent and reduces the cytotoxicity of the
contrast agent.
[0119] As mentioned above, some embodiments of the contrast agents
include PEGs attached to the protein. Inclusion of the PEGs in the
contrast agent increases blood circulation time, increases the
solubility of the contrast agent in a physiological system, and/or
increases R1 and R2 relaxivities, relative to un-PEGylated contrast
agents. In an embodiment, the PEGs are bonded to the protein via an
amino acid residue such as lysine (Lys), glutamic acid (Glu),
aspartic acid (Asp), cysteine (Cys), carboxyl/amino terminals, or
combinations thereof. As mentioned above, the position of the amino
acids on the polymer should position the PEGs so that the PEGs do
not substantially interfere with or interfere with the metal ion
binding site ability to interact with the metal ion of interest or
the conformation of the polymer.
[0120] In another embodiment, a fusion protein/peptide/polymer or a
non-degradable particle moiety can be added to the protein contrast
agent with a linker to tune the correlation time for optimal
contrast sensitivity, targeting (e.g., subcellular, cellular,
tissue and organ selectivity), biodistribution (e.g., affiibody
against to Her-2 was fused to CA1 as a targeted contrast agent to
breast cancer), and/or bioelimination (e.g., using proteins with
molecular weight less than 60 KDa). One of ordinary skill in the
art may determine such linkers without undue experimentation.
[0121] An additional advantage of the contrast agent of the present
disclosure is that targets of interest (e.g., specific tissues,
specific organs, and biomarkers for molecular imaging of tissues
and tissue growths such as cancerous cells or tissue, precancerous
cells or tissue, cancer, or tumors) can be imaged. The active
targeting of contrast agents to specific organs or tissues can be
achieved by attaching (directly or indirectly via linking) a
compound (e.g., peptide, antibody, antigen, and the like) having an
affinity for the target of interest. Thus, the contrast agent can
be administered to the host, and the contrast agent will interact
with the target of interest. Subsequently, the host can be imaged
to determine the presence or absence, as well as the location of
the target of interest. Additional details are provided herein.
Scaffold Proteins
[0122] Scaffold proteins suitable with the present disclosure
include proteins or organic polymers containing amino acids. In an
embodiment, the scaffold proteins can be modified. The scaffold
proteins are inclusive of both natural amino acids and unnatural
amino acids (e.g., beta-alanine, phenylglycine, and homoarginine,
Gamma-carboxyglutamate (Gla)). In an embodiment, the amino acids
are alpha-amino acids, which can be either of the L-optical isomer
or the D-optical isomer. In an embodiment, the amino acids are
D-optical isomers, as such isomers are less subject to proteolytic
degradation. Such amino acids can be commonly encountered amino
acids that are not gene-encoded, although preferred amino acids are
those that are encodable. In an embodiment, a Near-IR functional
group (e.g., Cy5.5, Cy7, Alexflour, and indocyanine green) for
Near-IR detection is covalently bound to the scaffold protein, a
PEG, and/or a targeting agent.
[0123] As mentioned previously, in some embodiments the scaffold
proteins should include one or more amino acid residues (e.g., Lys,
Glu, Asp, Cys, or combinations thereof) able to bond with the PEGs
or otherwise modified. In this regard, the position of the amino
acids on the protein should position the PEGs so that the PEGs do
not substantially interfere with or interfere with the metal ion
binding site ability to interact with the metal ion of interest or
the conformation of the polymer.
[0124] Various scaffold proteins may be used according to the
disclosure, but in general they will be proteins, and organic
polymers. More specifically, suitable scaffold proteins can be
selected properties suitable for diagnostic applications. The
scaffold protein for use with this disclosure may be of unitary
construction (a particulate, a polychelant or a dendrimeric
polymer). Scaffold proteins suitable with this disclosure may be
selected without undue experimentation.
[0125] Embodiments of the present disclosure can include proteins
such as CD2 proteins (a cell adhesion protein) that exhibit high
stability against proteolysis, thermal conditions (Tm 67.degree.
C.), pH (2-10), and salt (0-4 M NaCl) denaturation. CD2 proteins
can be suitable with this disclosure because such proteins are
stable in physiological environments, have a topology suitable for
the integration of at least one or multiple metal ion chelating
sites, and typically have a relaxivity greater than 10
mM.sup.-1s.sup.-1 (some of them up to about 50 mM.sup.-1s.sup.-1).
In addition, CD2 proteins can tolerate multiple surface mutations
without unfolding the protein. In another embodiment, the CD2
proteins can be used as a host protein to design calcium binding
sites. Examples using CD2 are described herein.
[0126] Fluorescent proteins are another class of preferred scaffold
protein for this disclosure, as these proteins are stable in a
physiological environment against proteolytic degradation and pH
denaturation (pH 5-10). Such fluorescent proteins include an array
of fluorescent proteins including those related to Aequorea.
Suitable fluorescent proteins should have a useful excitation and
emission spectra and may have been engineered from naturally
occurring Aequorea victoria green fluorescent proteins (GFPs). Such
modified GFPs may have modified nucleic acid and protein sequences
and may include elements from other proteins. The cDNA of GFPs may
be concatenated with those encoding many other proteins--the
resulting chimerics are often fluorescent and retain the
biochemical features of the partner proteins. Such proteins also
are included in the disclosure.
[0127] One advantage of using fluorescent proteins is that contrast
agents constructed from such proteins can be multi-functional
probes. In this embodiment, the contrast agent constructed from
fluorescent proteins can be screened using both fluorescence and MR
imaging. This can be advantageous as such properties equip the
contrast agent with both the fluorescence needed for fluorescence
detection methods and sensitivity needed for the deep tissue
detection from MRI. Such contrast agents are multifunctional
contrast agents.
[0128] Other proteins may be used as scaffold proteins for this
disclosure. In an embodiment, scaffold proteins are able to
tolerate the addition of the metal ion binding site without
substantial disruption to its structure. One of ordinary skill in
the art can select a scaffold protein based on preferences without
undue experimentation. Embodiments of this disclosure include
natural calcium binding proteins with metal binding site such as
calcium binding sites as scaffold protein proteins. These natural
metal binding proteins such as calmodulin, calbindin D9K, troponin
C, and parvalbumin, can be engineered to bind paramagnetic metal
ions with very strong metal binding affinity thus are capable of
enhancing image contrast by affecting water molecule proton
relaxation rates. In addition, their selectivity over calcium and
other physiologic metal ions such as zinc and magnesium is more
than 10.sup.5 fold higher, which is similar to that of clinically
approved contrast agents such as DTPA or DTPA-BMA. More than one
water molecule can be in the coordination shells and protein
surface, and this likely contributes to their extremely high
relaxivity. Furthermore, functional sites of these engineered
proteins, such as binding to the target molecules by calmodulin,
were altered and PEGylation of these engineered proteins increases
solubility and reduced immunogenicity and increase relaxivity (See,
Example 3).
[0129] Embodiments of scaffold protein sequences (SEQ ID Nos: 1-53)
that can be included in the contrast agent are provided that
include the unmodified scaffold proteins and modified scaffold
proteins (insertions and/or deletions) for a variety of
illustrative scaffold proteins that include metal ion binding
sites. The scaffold protein sequences include one or more possible
locations for attachment of PEGs, mutation sites, C-terminal sites
for pegylation or conjugation of moieties (e.g., fluorescent dyes),
and the like.
PEGs
[0130] As mentioned above, embodiments of the present disclosure
include contrast agents where PEGs are attached to the protein via
one or more amino acid residues such as Lys, Glu, Asp, Cys,
carboxyl/amino terminals, or combinations thereof. In an
embodiment, the PEGs are attached to amino acid residues so that
the PEGs do not substantially interfere with or interfere with the
metal ion binding site ability to interact with the metal ion of
interest or the conformation of the polymer. The PEGs can be
attached to the amino acid residues through PEGylation processes
known in the art. The PEGylation may, for example, be performed at
a pH of about 7.5 to 9 or about 8 to 8.5.
[0131] The PEGs can be linear PEGs, multi-arm PEGs, branched PEGs,
and combinations thereof. The molecular weight of the PEGs can be
about 1 kDa to 100 kDa, about 1 kDa to 50 kDa, about 1 kDa to 40
kDa, about 1 kDa to 30 kDa, about 1 kDa to 20 kDa, about 1 kDa to
12 kDa, about 1 kDa to 10 kDa, or about 1 kDa to 8 kDa. It should
be noted that the molecular weight can be any integer within any of
the values mentioned above. When used in reference to PEG moieties,
the word "about" indicates an approximate average molecular weight
and reflects the fact that there will normally be a certain
molecular weight distribution in a given polymer preparation. In an
embodiment, 1 to 10 PEGs can be attached to the scaffold protein.
In an embodiment, 2 to 6 PEGs can be attached to the scaffold
protein. In an embodiment, 2 to 4 PEGs can be attached to the
scaffold protein.
[0132] The PEGs can have additional functional groups to allow us
to further modify the contrast agent by adding other moieties such
as signal peptides (such as GRP signal peptide for targeting to
prostate cancer).
Targeting Agent
[0133] In an embodiment, the contrast agent can have a specific
affinity for a target by attaching (directly or indirectly, via the
scaffold protein or the PEGs) a targeting agent to the contrast
agent. In this regard, the term "affinity" means that the contrast
agent is preferentially attracted to the target(s) as opposed to
all other targets in the human subject. The contrast agent can be
designed to have the affinity using one or more polypeptides (e.g.,
proteins) or chemical moieties on a target. If the targeting agent
is attached to the scaffold protein (attached directly or
indirectly), like the PEG (attached directly or indirectly), the
targeting agent does not substantially interfere with or interfere
with the metal ion binding site ability to interact with the metal
ion of interest or the conformation of the polymer.
[0134] In an embodiment, a targeting agent can be attached (e.g.,
directly or indirectly) to the scaffold polymer or the PEG, where
the targeting agent has an affinity for a target (e.g., a cell, a
tissue, a protein, an antibody, an antigen, and the like). The
targeting agent can include, but is not limited to, polypeptides
(e.g., proteins such as, but not limited to, antibodies (monoclonal
or polyclonal)), antigens, nucleic acids (both monomeric and
oligomeric), polysaccharides, sugars, fatty acids, steroids,
purines, pyrimidines, ligands, or combinations thereof, where the
targeting agent binds or otherwise interacts with the target. In an
embodiment, the targeting agent specifically interacts with a
specific type of target or specific target and substantially (e.g.,
90%, 95%, 99% or more specificity to the target or type of target)
or completely excludes other targets. In an embodiment, the
targeting agent has an affinity for one or more targets. In
general, the target can include, but is not limited to, a cell
type, a cell surface, extracellular space, intracellular space, a
tissue type, a tissue surface, vascular, a polypeptide, a nucleic
acid, a polysaccharide, a sugar, a fatty acid, a steroid, a purine,
a pyrimidine, a hapten, a ligand, and the like, related to a
condition, disease, or related biological event or other chemical,
biochemical, and/or biological event of the sample or host. In an
embodiment, the targeting agent can be selected based on the target
selected and the environment the target is in and/or conditions
that the target is subject to. In an embodiment, the targeting
agent can include: a biomarker probe, a precancerous targeting
agent, a cancer targeting agent, a tumor targeting agent, and a
probe or agent that targets at least two of a biomarker, a
precancerous cell, a cancer cell, and a tumor.
[0135] The targeting agent can be linked, directly or indirectly,
using a stable physical, biological, biochemical, and/or chemical
association. In an embodiment, the targeting agent can be
independently linked to the scaffold polymer or the PEG using, but
not limited to, a covalent link, a non-covalent link, an ionic
link, a chelated link, as well as being linked through interactions
such as, but not limited to, hydrophobic interactions, hydrophilic
interactions, charge-charge interactions, .pi.-stacking
interactions, combinations thereof, and like interactions.
[0136] In an embodiment, the targeting agent can include, but is
not limited to, (gastrin release peptide (GRP) that can bind to
specific types of cancer receptors, i.e. GRP receptors, and, RGD
peptides (Arg-Gly-Asp) (corresponding to integrin
.alpha..sub.v.beta..sub.3 target). In an embodiment, molecules that
can be targets include, but are not limited to, vascular receptors
(e.g., Vascular endothelial growth factor receptor (VEGF-R)),
extracellular matrix proteins (e.g., proteases, MMP, thrombin),
cell membrane receptors (e.g., epidermal growth factor receptor
(EGFR) (e.g., HER2)), intracellular proteins, enzymes (e.g.,
caspases and PSA), serum proteins (e.g., albumin), and the
like.
Metal Ion Binding Sites
[0137] The affinity of the metal ion binding site may vary the
contrast agent affinity for metal ions. Specifically, as affinity
and sensitivity of the metal ion binding sites may be modified, the
relaxivity and metal affinity of the contrast agent may be
modified. Preferably, the metal ion binding site has optimal
imaging properties including metal binding affinity, selectivity,
relaxivity, NMRD profile, and water exchange rates.
[0138] Embodiments of the metal ion binding site of the present
disclosure may be constructed using three methods:
[0139] (1) A computational design approach in which the metal ion
binding site with a selectivity and affinity for a metal ion is
engineered and rationally designed de novo based on optimal binding
characteristics of a metal ion with other moieties; and
[0140] (2) A grafting method in which the metal ion binding site
with a selectivity and affinity for a metal ion is engineered and
constructed selectively by varying the primary, secondary, and
tertiary of an identified binding site.
[0141] (3) Direct modification of natural metal binding proteins in
which the metal binding affinity to the desired metal ions are
significantly increased while the affinity to the physiological
metal ions are decreased.
[0142] An engineered metal binding site can be created by a
combination of more than one above mentioned methods.
The Computational Design Approach
[0143] The computational design approach focuses on designing a
metal ion binding site de novo. This design approach focuses on
using an algorithm to construct and engineer an optimal binding
site. Preferably, the computation design approach is used to create
optimal binding sites by, e.g., varying the coordination geometry
of the site, the water number in the coordination shells, the
ligand types, and the charges.
[0144] The computational design approach comprises the following
steps:
[0145] (1) Accessing one or more databases having structural,
coordination, and/or 3-dimensional structure or model on metal ion
binding sites; or creating model structures based on the sequence
homology;
[0146] (2) Generating one or more preliminary metal ion binding
sites from portions of the structural data;
[0147] (3) Selecting rationally one or more suitable metal ion
binding sites from the generated preliminary binding sites based
on, e.g., coordination geometry; and
[0148] (4) Creating a metal ion binding site by tailoring and
tuning the selected metal ion binding site.
[0149] The metal ion binding site may be incorporated into a
scaffold protein, e.g., a fluorescent or CD2 protein. Further, such
a method may be used to alter metal ion binding properties of
proteins and generate new materials with various ion binding
affinities.
[0150] More particularly, the method involves searching and
accessing public and or private databases for preferred components
of a metal ion binding site. Such databases that may be searched
for the criteria or components may include public domain banks
(e.g., NBCI or PubMed) or knowledge banks such as protein modeling
structure data banks (e.g., Cambridge or RCSB Protein Data Bank
Data Bank and BioMagResBank database) or data bank. Further, the
database could include structural data from metal ion binding
proteins whose structures have been characterized previously. One
of ordinary skill in the art can identify databases and sources of
material for databases suitable with this disclosure. Use of a
computer obviously would greatly speed up the searching and is
preferred.
[0151] These databases may be used to provide structural analysis
of one to several thousand different small molecules or metal ions
that bind to a protein. Such analysis may include local
coordination properties, types of residues or atoms commonly used
to bind a desired metal ion, chemical features (e.g., pKa or
changes), the number of charged residues on a site, and the range
or deviation of the known binding sites. Further, such analysis may
include the environment, such as types of atoms, residues,
hydrophobicity, solvent accessibility, shapes of the metal binding
sites, electrostatic potentials, and the dynamic properties (e.g.,
B-factors or the order factors of the proteins) of the binding
sites. Such analysis also may include whether a binding site for a
particular metal ion is a continuous or discontinuous binding
site.
[0152] Once preliminary metal ion binding sites are found, using
the structural data and analysis, one or more suitable metal ion
binding sites may be generated based on rational factors.
Specifically, different search algorithms may be used to generate
potential metal ion binding sites based on other key features in
addition to, for example, the geometric descriptors. These key
features include the properties of the original residues in the
scaffold protein, ligand positions that are essential to protein
folding, the number of the charged residues and their arrangement
and number of water molecules in the coordination shell. The
hydrogen bond network and the electrostatic interactions with the
designed ligand residues also can be evaluated. Furthermore, the
protein environments of metal ion binding sites can be analyzed
according to solvent accessibility, charge distribution, backbone
flexibility, and properties of scaffold proteins. Thus, one of
ordinary skill in the art may rationally select a binding site
based on desired parameters.
[0153] Once the metal ion binding sites are generated, a site may
be tailored using two complementary approaches of computational
design and grafting (see below). First, as discussed above, the
metal ion binding site may be tailored using a grafting method in
which the primary, secondary, tertiary, and/or quaternary
structures are tuned. Second, the metal ion binding site may be
tailored using a computational design approach. It is understood
that one or both of these approaches may be used to tailor the
binding site.
[0154] The computational design approach includes modifying the
metal ion binding site by modifying residues in the scaffold of the
metal ion binding site. In one embodiment, a geometric description
of the ligands around a metal ion, a three-dimensional structure of
the backbone of proteins, and a library of side-chain rotamers of
amino acids (or atoms from the main chain) can identify a set of
potential metal-binding sites using a computer. Using the geometric
and graph description of a particular metal ion site, key ligand
residues are carefully placed in the amino acid sequence to form
the metal (metal ion) binding pocket. This binding pocket can be
created automatically by the computer algorithm according to the
coordination description and the user's preferred affinity.
[0155] The created potential metal ion binding sites can be
optimized and tuned to specification. A backbone structure of the
metal ion binding site with different degrees of flexibility may be
used according to the need or the flexibility of the metal ion
binding site. The designed metal ion binding sites are further
filtered and scored based on the local factors, which may include
the shape of the metal ion binding sites, locations, charge
numbers, dynamic properties, the number of mutation needed, solvent
accessibility, and side chain clashes. To achieve the maximums
relaxivity, one to two oxygen atoms from the solvent water
molecules in the coordination shell may provide additional
coordination without reducing the required binding affinity and
selectivity.
[0156] Stronger metal ion binding affinities of the designed sites
may be developed based on several modeled factors that contribute
to metal ion affinity. For example, the number of ligand residues
is a factor to directly chelate a specific metal ion. In some
cases, in order to have a strong metal ion affinity with a K.sub.d
necessary to measure a metal ion concentration, it is necessary to
include residues from the protein frame for optimal metal ion
binding. In other cases, the number of charged residues is able to
change metal ion affinity. In still other cases, the ligand type is
a factor as the binding preferences of a chelate may depend on the
particular ligand type. Other factors, such as negatively charged
environments, may contribute to the binding affinity of a metal ion
binding protein and can be taken into account by those of ordinary
skill in the art without undue experimentation. These charged
residues could increase the water-exchange rate to avoid its
limitation for the required relaxivity.
[0157] An illustrative version of this computational approach is
the computerized (or otherwise automated) querying of one or more
databases that comprise structural data on metal ion binding sites
using selected criteria relevant to the metal ion binding site,
generating at least one preliminary metal ion binding site from the
database information based on compatibility with the selected
criteria, and selecting one or more suitable metal ion binding
sites from the preliminary metal ion binding sites based on optimal
compatibility with the selected criteria. Once a suitable metal ion
binding site is selected, the nucleic acid sequence of the selected
metal ion binding site is obtained, tailored, and operatively
linked with a scaffold protein sequence, whereby the nucleic acid
sequence of the selected metal ion binding site is tailored so to
achieve the metal ion binding site having a desired specificity for
the metal ion. Further, a nucleic acid sequence encoding the
preliminary binding sites can be generated from the structural or
model data. The computational approach also can be used to produce
the metal ion binding site.
[0158] The computational approach can be performed on or by a
system comprising at least one database that comprises the
structural data on metal ion binding sites, an algorithm for
generating the preliminary metal ion binding sites from portions of
the structural or model data using selected criteria relevant to
the metal ion binding site and rating the preliminary metal ion
binding sites based on specificity for a selected metal ion, and a
computer for executing the algorithm so as to query the databases
to generate the preliminary metal ion binding sites. The algorithm
generally is a relatively simple searching algorithm that will
query the databases based on inputted criteria.
The Grafting Method
[0159] The grafting method focuses on engineering and constructing
a metal ion binding site by modifying the primary, secondary,
tertiary, and/or quaternary structure of an identified binding
site. By selectively manipulating the structure of the binding
site, it is possible to obtain a metal ion binding site that can be
engineered into a scaffold protein, e.g., CD2 or fluorescent
protein, without significantly denaturing the protein. Using the
grafting method, it is possible to achieve a binding site that has
a stronger preference for one metal ion over another metal ion.
Such modifications may allow for improved contrast abilities.
[0160] Initially, an identified binding site for use with the
grafting method may be any continuous sequence site that has some
affinity for a metal ion. Such binding sites may derive from either
known binding peptides such as an individual EF-hand site or from
short fragments that have demonstrated the ability to bind specific
metal ions such as alpha-lactalbumin. Such peptides may be highly
conserved in nature and prevalent throughout nature or may be
unnatural but known to have an affinity for a particular metal ion.
One of ordinary skill in the art is able to identify binding sites
with affinity for a metal ion without undue experimentation.
[0161] Once the binding site has been identified, the primary
structure of the metal ion binding site may be altered and tuned to
achieve a metal ion binding site with improved binding
characteristics. For example, more charged ligand residues such
aspartate and glutamate may be engineered by inserting codon(s)
into the metal ion binding site so as to tune the responsiveness of
the site or the scaffold protein. The inclusion of additional
charged ligands can allow the contrast agent to achieve an affinity
for selected paramagnetic metal ions and to have a desired
selectivity. Further, one or two water molecules can also be
introduced into the coordination shell by removing or modifying
ligand residues and their environments. Further other mutations to
the primary structure include removing or adding amino acids to
change properties such as flexibility or rigidity of the site.
Adding or removing amino acids from the binding site alters the
primary structure of the binding site.
[0162] The secondary structure of the metal ion binding site, that
is the spatial arrangement of amino acid residues that are near one
another in linear sequence, may be modified to tune the sensitivity
and responsiveness of the metal ion binding site. The residues on
the site itself, the flanking or the neighboring structures such as
helices, beta strands, or turns may be modified by changing
properties such as hydrophobicity, salt bridges, secondary
structure propensity (e.g., helicity and .beta.-sheets), and charge
interactions with different amino acids, which all may inherently
change the secondary structure.
[0163] The tertiary structure of the metal ion binding site may be
modified to further tune the sensitivity and responsiveness of the
metal ion binding site. The affinity of the metal ion binding site
for the metal ion may be varied by selectively manipulating and
adding helices, loops, bridges and/or linkers and chemical
properties such as hydrogen bonding, electrostatic interactions and
hydrophobic interactions. In fact, such variations in tertiary
structure may add stability and affinity by increasing secondary
structure propensity, adding charge interaction of the side chains,
and by stabilizing the metal ion binding coordination chemistry. As
such, it may be possible to increase or decrease the binding
affinity of the continuous binding site by tuning the tertiary
structure of the metal ion binding site. In addition, the dynamic
properties can be modified by increasing the packing of the protein
and replacing residues with amino acids or other moieties with more
rigid (e.g., Pro) or flexible (e.g., Gly) properties,
[0164] One method of directly altering the primary, secondary,
and/or tertiary structure of the metal ion binding site is by
altering the charges in the site. As the charges in any binding
site have a significant role in the structure of the site, changing
the charges or charge ratio may have significant impact on the
structure of the site. In addition, as the charged side chains
exhibit a strong influence on the metal ion binding affinity even
though they are not directly involved as ligands, the variation of
these chains results in variations in metal ion binding affinities
and selectivity. A metal ion binding site may have stronger
affinities to and better selectivity for a desired metal ion over a
competitive metal ion by designing or modifying the site, e.g.,
changing the number of charged ligand residues to form metal ion
binding pockets. For example, the metal ion binding affinity of the
metal ion binding site may be varied by changing the charged side
chains that are present on the metal ion binding site and/or the
neighboring environment. The replacement of charged residues such
as aspartate or glutamate with a residue such as alanine may
dramatically reduce the binding affinity for the metal ion by up to
100 times.
[0165] In the case of multifunctional contrast agents, e.g., where
the contrast agent is a fluorescent protein, it can be a factor to
induce the metal binding site without altering significantly the
chromophore environment to reduce the fluorescent signal. These
metal binding sites can be added at remote locations away from the
chromophore or simply fusion to the fluorescent moieties. Such
locations can be evident from the sequence and protein folding.
[0166] In another embodiment, the grafting approach may be used
with the design approach to create an optimal metal binding site.
For example, metal binding sites can be created by using part of
continuous site and part of ligand residues created by computer
design. The loops or any sequences of the proteins can be removed
or modified to achieve optimal required binding affinity, metal
selectivity, relaxivity and stability.
[0167] Thus, by varying the primary, secondary, and/or tertiary
structure of the metal ion binding site, it is possible to achieve
a metal ion binding site with desired specificity and affinity and
more importantly contrast abilities.
The Modification Method of Natural Metal Binding Proteins
[0168] Natural metal binding proteins' their metal binding affinity
can be altered by directly modifying the proteins such as the
addition of metal ligand residues in the calcium binding proteins
to increase metal binding affinity to lanthanides. In an
embodiment, fragments and/or domains of the natural metal binding
proteins encompassing metal binding sites can also serve as
scaffold protein of the contrast agents if they exhibit strong
metal binding affinity for Ln.sup.3+ or other paramagnetic metal
ions, serum stability, and desired relaxation properties. The
affinity to natural metal ions such as physiological metal ions,
e.g., calcium, zinc, and magnesium, will be significantly reduced
by deleting metal binding ligand residues or reducing the
cooperativity between coupled metal binding sites. As noted in
Example 3, the calcium binding sites in the natural calcium binding
protein such as calmodulin and parvalbumin were modified so that
the modified proteins have a strong metal binding affinity to
lanthanides. On the other hand, the metal selectivity for
lanthanides over calcium, magnesium and zinc are very high. If it
is necessary, the molecular recognition sites of these natural
calcium binding proteins can be altered by deletion at the active
sites or PEGylation.
[0169] In addition, sequences for N- and C-terminal domains of
calmodulin and its variants are listed that can be serve as a
protein contrast agents (See sequences included herein). Additional
modifications can performed to reduce their intrinsic biological
function, avoid immunogenicity, increase serum stability, and
targeting capability.
Selecting Metal ion Binding Sites in the Scaffold Protein
[0170] The metal ion binding sites may be selectively introduced
into numerous sites of a scaffold protein without substantially
impairing its secondary structure. A number of methods for
identifying integration sites in proteins, such CD2 proteins,
fluorescent proteins (e.g., GFP, YFP, CFP, and RFP) are known in
the art, including, for example, site directed mutagenesis,
insertional mutagenesis, and deletional mutagenesis. Other methods,
including the one exemplified below and in the Examples, are known
or easily ascertained by one skilled in art.
[0171] The sites of the fluorescent protein that can tolerate the
insertion of a metal ion binding site also may be determined and
identified by gene manipulation and screening. By generating mutant
proteins and by manipulating the DNA sequence, it is possible to
obtain a variety of different insertions, which then may be
screened to determine whether the protein maintains its intrinsic
activities. Preferably, sites that remove or interfere with the
intrinsic fluorescence of the fluorescent protein are not optimal
and may be screened out. Variants identified in this fashion reveal
sites that can tolerate insertions while retaining
fluorescence.
[0172] The metal ion binding sites for use with scaffold proteins
may be selected by considering five criteria so to as optimize the
local properties of the metal binding site, the fluorescent
protein, and the protein environment. First, the geometry of the
metal ion binding site should have relatively minor deviations from
the desired coordination geometry. Second, negatively charged
residues should be varied by no more than 3-5 charges according to
the desired affinity for metal ion (K.sub.d). Third, the water
coordination shell of the metal ion chelating sites should be able
to coordinate at least 1-2 water molecules. Fourth, the residues
from the loops between the secondary structures with good solvent
accessibility are desired for both the folding of the protein and
the fast kinetics required for the contrast agent.
[0173] The mutation or the introduction of the metal ion binding
site should not substantially interfere with the synthesis and
folding of the protein. More particularly, the introduction of the
metal ion binding site does not interfere with either
post-translational chromophore formation or intermolecular
interactions required for stabilizing the chromophores and folding
of the protein frame. Furthermore, the introduced side chain should
not be overpacked and should not clash with the protein frame of
the scaffold protein (e.g., the fluorescent protein). The direct
use of chromophore residues as chelating sites is not preferred but
is within the scope of this disclosure.
[0174] In an embodiment, the metal binding sites in the natural
metal binding proteins can be directly modified to have proper
metal binding affinity to the desired metal ions.
Metal Ions
[0175] One or more metal ions are atoms and ions, including the
respective isotopes and radioisotopes, that can bind to proteins or
peptides. A metal ion may bind reversibly or irreversibly and such
a bond may be covalent or non-covalent. While Gd.sup.3+ is used in
some embodiments of this disclosure as an exemplary metal ion, it
is understood that metal ions suitable with this disclosure
include, but are not limited to metal ions including Group IIA
metal ions, transition metal ions, and Lanthanide Series ions.
Exemplary metal ions include, but are not limited to, the ion,
isotope, and/or radioisotope forms of magnesium, calcium, scandium,
titanium, manganese, iron, boron, chromium, cobalt, nickel, cooper,
zinc, gallium, strontium, yttrium, strontium, technetium,
ruthenium, indium, hafnium, tungsten, rhenium, osmium, and bismuth.
Exemplary radioisotopes include, but are not limited to, .sup.64Cu,
.sup.67Cu, .sup.67Ga, .sup.68Ga, .sup.88Y, .sup.89Sr, .sup.90Y,
.sup.97Ru, .sup.99mTc, .sup.103Ru, .sup.111In, .sup.153Sm,
.sup.186Re, .sup.188Re, .sup.203Pb, .sup.211Bi, .sup.212Bi,
.sup.213Bi, and .sup.214Bi.
[0176] The metal ions chosen to be chelated by the contrast agents
depend in part on the diagnostic role of the metal ion. Metals that
can be incorporated, e.g., through chelation, include lanthanides
and other metal ions, including isotopes and radioisotopes thereof.
For MR imaging applications, the preferred metal ion is gadolinium
(III). One of ordinary skill in the art can select a metal ion for
chelation, based on the intended diagnostic application, without
undue experimentation.
[0177] As mentioned, the choice of metal ions to be held in chelate
complexes by the contrast agents of the disclosure depends upon the
diagnostic technique for which the agent is to be used. For MRI or
MRS applications, the metal ions should be paramagnetic, and
preferably non-radioactive. For X-ray and ultrasound imaging, heavy
metal ions, e.g., with atomic numbers of at least 37, and in an
embodiment, at least 50, should be used, again preferably
non-radioactive species. For scintigraphy the metal ions should be
ions of radioactive isotopes. For MR, X-ray, EIT or magnetometric
imaging, one may use chelating groups to bind to heavy metal
clusters (e.g., polyoxoanions and full or partial sulfur analogues)
or to iron oxides or other superparamagnetic polyatomic
species.
[0178] Methods of complexing metal ions with chelants and
polychelants are known to those with ordinary skill in the art.
Metal may be incorporated into the contrast agent, i.e., the
tailored binding sites, by direct incorporation, template
synthesis, and transmetallation. Preferably, the metal ion is
chelated into the contrast by direct incorporation, which involves
titration with solution of sub-stoichiometric levels up to full
incorporation.
[0179] In an embodiment, one or two or more metal ions can bind to
the contrast agent. In an embodiment, the contrast agent includes
one or two or more metal ion binding sites. In an embodiment, each
of the metal ion binding sites binds to the same metal ion. In an
embodiment, each of the metal ion binding sites binds to a
different metal.
Methods of Use
[0180] Embodiments of the contrast agents (e.g., contrast agents
including PEGs or not including PEGs, and/or including targeting
agents or not including targeting agents) can be used in any one of
a number of methods. Embodiments of this disclosure include, but
are not limited to: methods of detecting, studying, monitoring,
evaluating, and/or screening, diseases, conditions, and other
biological events in vivo or in vitro. The conditions can include,
but are not limited to, altered growth rate of tissues, cancerous
transformation of tissues, inflammation or infection of a tissue,
altered volume of a tissue, altered density of a tissue, altered
blood flow in a tissue, altered physiological function, altered
metabolism of a tissue, loss of tissue viability, presence of edema
or fibrosis in a tissue, altered perfusion in tissue, and
combinations thereof. In particular, embodiments of the present
disclosure include: methods of imaging tissue; methods of
diagnosing the presence of a disease, precancerous cells or tissue,
cancer cells or tissue cancer, and tumors, as well as related
biological events; methods of monitoring the progress of a disease,
precancerous cells or tissue, cancer cells or tissue cancer, and
tumors, as well as related biological events; and the like.
[0181] Embodiments of the present disclosure include, but are not
limited to, imaging, detecting, studying, monitoring, evaluating,
and/or screening biological materials (e.g., organs, tissues,
tumors, cells, and the like), in vivo or in vitro. The tissue types
that can be studied using the methods of the present disclosure
include, but are not limited to, myocardial tissues, nervous
tissue, lymphoid tissue, skeletal and smooth muscle tissue, bones
and cartilages, tissues of various organs (e.g., the kidney, the
liver, the spleen, the prostate, the uterus, the testicles, and the
ovaries), and select portions of each.
[0182] Embodiments of the methods can use one or more types of
detecting or imaging systems such as, but not limited to, magnetic
resonance imaging (MRI), SPECT, PET, ultrasound, X-ray, CAT,
optical imaging, and combinations thereof. In an embodiment, the
contrast agent is a multimodality contrast agent that includes a
polymer having optical properties (GFP). Thus, the polymer having
optical properties can be detected using optical imaging, while the
metal can be detected using another technique such as a MRI
system.
[0183] In general, embodiments of the contrast agent are
administered to a host using one or more techniques or routes
(e.g., oral, mucosal, parenteral, and the like). After an
appropriate amount of time, the host can be introduced to an
appropriate detection or imaging system. The detection or imaging
system can detect the contrast agent. In particular, the detection
or imaging system can detect the location(s) of the contrast
agents, the concentration of the contrast agent, and the like. The
information obtained from the detection or imaging system can be
used to create or form an image of the host or a portion thereof.
The image would include the position and/or concentration of the
contrast agent in the host.
[0184] In an embodiment, the contrast agents can be used to study,
image, diagnose the presence of, and/or treat cancerous cells or
tissue, precancerous cells or tissue, cancer, or tumors. For
example, the presence and location of the cancerous cells or
tissue, precancerous cells or tissue, cancer, or tumors can provide
insight into the appropriate diagnosis and/or treatment. It should
be noted that contrast agents could include targeting agents
specific for other diseases or conditions so that other diseases or
conditions can be imaged, diagnosed, and/or treated using
embodiments of the present disclosure. In an embodiment, other
diseases and/or conditions can be studied, imaged, diagnosed,
and/or treated in a manner consistent with the discussion below as
it relates to cancerous cells, precancerous cells, cancer, and/or
tumors.
[0185] In an embodiment, the contrast agent can be used to study,
image, diagnose the presence of, and/or treat cancerous cells or
tissue, precancerous cells or tissue, cancer, or tumors. In
studying, imaging, diagnosing, and/or treating cancerous cells or
tissue, precancerous cells or tissue, cancer, or tumors in a host,
the contrast agent is administered to the host in an amount
effective to result in uptake of the contrast agent into the
cancerous cells or tissue, precancerous cells or tissue, cancer, or
tumors. After administration of the contrast agent, the cancerous
cells or tissue, precancerous cells or tissue, cancer, or tumors
that takes up the contrast agent is detected using an appropriate
imaging system. Embodiments of the present disclosure can
non-invasively image the cancerous cells or tissue, precancerous
cells or tissue, cancer, or tumors throughout a host.
[0186] In an embodiment, the contrast agent includes a targeting
agent having an affinity for a specific cancer. Detecting the
presence of the contrast agent, in particular, the presence of the
contrast agent at the typical location of the specific cancer can
be used in the diagnosis of the presence of the cancer (or vice
versa). Imaging the host over a time period (e.g., days, weeks,
months, or years) can provide information about the progression of
the cancer or other disease or condition.
[0187] The contrast agent or compositions including the contrast
agent may be administered to a subject in an amount effective to
achieve the desired result at the appropriate dosages and for the
desired periods of time. An effective amount of the contrast agent
or compositions may vary according to factors such as the age, body
weight, general health, sex, and diet of the host; the time of
administration; the route of administration; the rate of excretion
of the specific compound employed; the duration of the treatment;
the existence of other drugs used in combination or coincidental
with the specific compositions employed; the ability of the
composition to elicit a desired response in the subject; and like
factors well known in the medical arts. An effective amount is also
one in which any toxic or detrimental effects (e.g., side effects)
of the contrast agent or compositions are outweighed by the
therapeutically or diagnostically beneficial effects. The contrast
agent or compositions of the disclosure may be administered at a
concentration of, for example, about 1 to 3.0 .mu.mole/kg or about
6-20 mM.
Dosage Forms
[0188] Unit dosage forms of the contrast agents of this disclosure
may be suitable for oral, mucosal (e.g., nasal, sublingual,
vaginal, buccal, or rectal), parenteral (e.g., intramuscular,
subcutaneous, intravenous, intra-arterial, or bolus injection),
topical, or transdermal administration to a patient. Examples of
dosage forms include, but are not limited to: tablets; caplets;
capsules, such as hard gelatin capsules and soft elastic gelatin
capsules; cachets; troches; lozenges; dispersions; suppositories;
ointments; cataplasms (poultices); pastes; powders; dressings;
creams; plasters; solutions; patches; aerosols (e.g., nasal sprays
or inhalers); gels; liquid dosage forms suitable for oral or
mucosal administration to a patient, including suspensions (e.g.,
aqueous or non-aqueous liquid suspensions, oil-in-water emulsions,
or water-in-oil liquid emulsions), solutions, and elixirs; liquid
dosage forms suitable for parenteral administration to a patient;
and sterile solids (e.g., crystalline or amorphous solids) that can
be reconstituted to provide liquid dosage forms suitable for
parenteral administration to a patient.
[0189] The composition, shape, and type of dosage forms of the
contrast agents of the disclosure typically vary depending on their
use. For example, a parenteral dosage form may contain smaller
amounts of the active ingredient than an oral dosage form used to
treat the same condition or disorder. These and other ways in which
specific dosage forms encompassed by this disclosure vary from one
another will be readily apparent to those skilled in the art (See,
e.g., Remington's Pharmaceutical Sciences, 18th ed., Mack
Publishing, Easton, Pa. (1990)).
[0190] Typical compositions including the contrast agent and dosage
forms of the compositions of the disclosure can include one or more
excipients. Suitable excipients are well known to those skilled in
the art of pharmacy or pharmaceutics, and non-limiting examples of
suitable excipients are provided herein. Whether a particular
excipient is suitable for incorporation into a composition or
dosage form depends on a variety of factors well known in the art
including, but not limited to, the way in which the dosage form
will be administered to a patient. For example, oral dosage forms,
such as tablets or capsules, may contain excipients not suited for
use in parenteral dosage forms. The suitability of a particular
excipient may also depend on the specific active ingredients in the
dosage form. For example, the decomposition of some active
ingredients can be accelerated by some excipients, such as lactose,
or by exposure to water. Active ingredients that include primary or
secondary amines are particularly susceptible to such accelerated
decomposition.
[0191] The disclosure encompasses compositions including the
contrast agent and dosage forms of the compositions of the
disclosure that can include one or more compounds that reduce the
rate by which an active ingredient will decompose. Such compounds,
which are referred to herein as "stabilizers," include, but are not
limited to, antioxidants such as ascorbic acid, pH buffers, or salt
buffers. In addition, pharmaceutical compositions or dosage forms
of the disclosure may contain one or more solubility modulators,
such as sodium chloride, sodium sulfate, sodium or potassium
phosphate, or organic acids. An exemplary solubility modulator is
tartaric acid.
[0192] Like the amounts and types of excipients, the amounts and
specific type of active ingredient in a dosage form may differ
depending on various factors. It will be understood, however, that
the total daily usage of the compositions of the present disclosure
will be decided by the attending physician or other attending
professional within the scope of sound medical judgment. The
specific effective dose level for any particular host will depend
upon a variety of factors, including for example, the activity of
the specific composition employed; the specific composition
employed; the age, body weight, general health, sex, and diet of
the host; the time of administration; the route of administration;
the rate of excretion of the specific compound employed; the
duration of the treatment; the existence of other drugs used in
combination or coincidental with the specific composition employed;
and like factors well known in the medical arts. For example, it is
well within the skill of the art to start doses of the composition
at levels lower than those required to achieve the desired effect
and to gradually increase the dosage until the desired effect is
achieved.
Kits
[0193] This disclosure encompasses kits, which may include, but are
not limited to, a contrast agent and directions (instructions for
their use (written or electronic)). The components listed above can
be tailored to the particular disease or condition to be monitored.
The kit can further include appropriate reagents known in the art
for administering various combinations of the components listed
above to the host organism or patient.
EXAMPLES
Example 1
Rational Design of Protein Based MRI Contrast Agents
Introduction:
[0194] This Example describes the rational design of a novel class
of magnetic resonance imaging contrast agents with an engineered
protein chelated with gadolinium. The design of protein based
contrast agents involves creating high coordination Gd.sup.3+
binding sites in a stable host protein using amino acid residues
and water molecules as metal coordinating ligands. Designed
proteins show strong selectivity for Gd.sup.3+ over physiological
metal ions such as Ca.sup.2+, Zn.sup.2+, and Mg.sup.2+. These
agents exhibit a 20-fold increase in longitudinal and transverse
relaxivity values over the current clinically used contrast agent,
Gd-DTPA. They provide strong contrast enhancement in vivo with much
longer vascular retention time. These protein contrast agents have
good biocompatibility and potential functionalities may extend MRI
applications in targeting disease markers.
[0195] Magnetic resonance imaging (MRI) is a non-invasive technique
providing high resolution, three-dimensional images of
morphological features as well as functional and physiological
information about tissues in vivo. It is capable of detecting
abnormalities in deep tissues and allows for whole body imaging. It
has emerged as a primary diagnostic imaging technique for human
diseases..sup.1,2 Exogenous MRI contrast agents are often used to
enhance the contrast between pathological and normal tissues by
altering the longitudinal and transverse (i.e., T.sub.1 and
T.sub.2) relaxation times of water protons..sup.3-5 Gadolinium
(Gd.sup.3+) is the most frequently used MRI contrast agent due to
its high magnetic moment, asymmetric electronic ground state and
potential for increased MRI intensity..sup.6,7 The relaxivity (unit
capability of the agent to change the relaxation time) of a
contrast agent is dependent on several factors including the number
of water molecules in the coordination shell, the exchange rate of
the coordinated water with the bulk water, and the rotational
correlation time .tau..sub.R of the contrast agent..sup.8-10. The
MRI contrast agent can have: 1) high relaxivity for high
contrast-to-noise ratio (CNR) and dose efficiency, 2) thermodynamic
stability, especially metal selectivity for the target ions over
excess physiological metal ions, to minimize the release of toxic
paramagnetic metal ions, 3) adequate vascular, tissue retention
time to allow imaging, and 4) proper excretion from the body.
[0196] To date, the most commonly used MRI contrast agent in
diagnostic imaging is Gd-DTPA, or its derivatives such as
Gd-DTPA-BMA. With an intrinsic rotational correlation time,
.tau..sub.R, of 100 picoseconds, these small molecular gadolinium
contrast agents have longitudinal and transverse proton
relaxivities, r.sub.1 and r.sub.2, less than 10 mM.sup.-1s.sup.-1,
much lower than the theoretically maximal value (>100
mM.sup.-1s.sup.-1)..sup.9, 11 In addition, these small molecule
contrast agents exhibit very short blood circulation (within
several minutes) and tissue retention time, limiting some MRI
applications that require longer data collection time..sup.12 To
increase correlation time, .tau..sub.R, small contrast agents were
covalently or non-covalently conjugated to macromolecules such as
linear polymers,.sup.13 dendrimers,.sup.14, 15
carbohydragates,.sup.16 proteins,.sup.17-21 viral capsids,.sup.22
and liposomes.sup.23. However, conjugation yields limited
improvement due to internal mobility and restricted water exchange
rate (FIG. 1.1a)..sup.11 An increase in relaxivity was observed
when Gd.sup.3+ binds to calcium binding peptides.sup.24 or proteins
such as concannavalin A and bovine serum albumin (BSA)..sup.6
However, the application of these short peptides or proteins as MRI
contrast agents is limited due to their weak metal binding affinity
for Gd (K.sub.d.about.100 .mu.M for Eu.sup.3+) and dynamic
flexibility..sup.24,25
[0197] This Example describes the development of a new class of MRI
contrast agents with significantly improved relaxivity using
rational design of Gd.sup.3+-binding proteins. This class of
contrast agents was created by designing the metal binding sites
into a stable host protein with desired dynamic properties and
metal selectivity to increase relaxivity by optimizing local
.tau..sub.R. This approach provides a new platform for developing
MRI contrast agents with high relaxivity and functionality.
Materials and Methods
[0198] Determination of r.sub.1 and r.sub.2 Relaxivity Values.
Relaxation times, T.sub.1 and T.sub.2, were determined at 1.5, 3,
9.4 Tesla using a Siemens whole-body MR system (1.5, 3T) or a
Bruker MRI scanner (9.4T). T.sub.1 was determined using inversion
recovery and T.sub.2 using a multi-echo Carr-Purcell-Meiboom-Gill
(CPMG) sequence. The contrast agent samples (200 .mu.l) with
different concentrations were placed in eppendorf tubes. The tubes
were placed on a tube rack, which was placed in MRI scanners for
the measurement of relaxation times. r.sub.1 and r.sub.2 were
calculated based on
r.sub.1(mM.sup.-1S.sup.-1)=(1/T.sub.1s-1/T.sub.1c)/C and
r.sub.2(mM.sup.-1S.sup.-1)=(1/T.sub.2s-1/T.sub.2c)/C, where
T.sub.1s and T.sub.2s are relaxation times with contrast agent and
T.sub.1c and T.sub.2c are relaxation times without contrast agent.
C is the concentration of contrast agent in mM (the measured
Gd.sup.3+ concentrations by ICP-MS).
[0199] Measurement of Water Coordination Number by Terbium Life
Time Luminescence. The number of water ligands coordinated to
Gd.sup.3+-CA1.CD2 complex was determined by measuring Tb.sup.3+
luminescence decay in H.sub.2O or D.sub.2O. Tb.sup.3+ excited state
lifetime was measured using a fluorescence spectrophotometer
(Photon Technology International, Inc.) with a 10 mm path length
quartz cell at 22.degree. C. Following excitation at 265 nm with a
XenoFlash (Photon Technology International, Inc.), Tb.sup.3+
emission was monitored at 545 nm in a time series experiment in
both H.sub.2O and D.sub.2O systems. Luminescence decay lifetime was
obtained by fitting the acquired data with a mono-exponential decay
function. H.sub.2O in CA1.CD2 solution was replaced with D.sub.2O
by lypholization and re-dissolved in D.sub.2O at least three times.
A standard curve correlating the .DELTA.k.sub.obs with water number
under our experimental conditions was established by using
well-characterized chelators, such as EDTA (q=3), DTPA (q=1), NTA
(q=5), and Aquo Tb.sup.3+ (q=9) solution with
R.sup.2=0.997..sup.26,27 Water number coordinated to
Tb.sup.3+-CA1.CD2 complex was then obtained by fitting the acquired
.DELTA.k.sub.obs value to the standard curve.
[0200] Gd.sup.3+-binding Affinity Determination. Gd.sup.3+-binding
affinity of CA1.CD2 was determined by a competition titration with
Fluo-5N applied as a Gd.sup.3+ indicator. The fluorescence spectra
of Fluo-5N were obtained with a fluorescence spectrophotometer
(Photon Technology International, Inc.) with a 10 mm path length
quartz cell at 22.degree. C. Fluo-5N emission spectra were acquired
at 500 nm to 650 nm with an excitation at 488 nm. Gd.sup.3+-binding
affinity of Fluo-5N, K.sub.d1, was first determined by a Gd.sup.3+
titration with Gd.sup.3+ buffer system of 1 mM nitrilotriacetic
acid (NTA). Free Gd.sup.3+ concentration was calculated with a NTA
Gd.sup.3+-binding affinity of 2.6.times.10.sup.-12 M..sup.28
Fluo-5N was mixed with Gd.sup.3+ in 1:1 ratio for a competition
titration. The experiment was performed with a gradual addition of
CA1.CD2. An apparent constant, K.sub.app, was estimated by fitting
the fluorescence emission intensity of Fluo-5N at 520 nm with
different CA1.CD2 concentrations as a 1 to 1 binding model.
Gd.sup.3+-binding affinity of CA1.CD2, K.sub.d2, was calculated
with the following equation:
K d 2 = K app K d 1 K d 1 + [ Fluo - 5 N ] T ( 1 ) ##EQU00001##
[0201] Mouse MR Imaging. Care of experimental animals was in
accordance with institutional guidelines. CD-1 mice (25-30 g, four
mice were imaged) were anesthetized with an isoflurane gas mixture.
The anesthetized animal was positioned and stabilized with
soft-supporting material (e.g., foam) in the scanner in the coil
cradle and was kept warm during the MRI scan. The mice were scanned
prior to the administration of any contrast agent (pre-contrast).
Approximately 50 .mu.l of Gd-CA1.CD2 (.about.1.2 mM) or Gd-DTPA
(.about.300 mM) were injected into the animal via the tail vein. MR
images were collected at different times (indicated). For T.sub.1
weighted imaging at 3T, spin echo sequence with TE/TR=15 ms/500 ms
was employed. Rectangular Field of View (FOV) at 100/40 mm, an
acquisition matrix of 196.sup.2 and 1.1 mm slice thickness without
gap were used. Images were collected from both transverse and
coronal sections. The in-plane resolution of images was less than
0.5 mm after they were reconstructed to the matrix of 196.sup.2.
For T.sub.2 weighted imaging at 9.4T, MR images were recorded using
a multi-echo Carr-Purcell-Meiboom-Gill (CPMG) sequence. The data
were collected and processed by Dicomworks software. The MR signal
intensity in several organs was ascertained by the average
intensity in ROIs or points within the organs. Signal intensity for
each organ was normalized to that of the leg muscle.
[0202] Blood Circulation Time, Tissue Retention Time, and
Bio-distribution. CD-1 mice (25-30 g, a group of four mice were
tested) were anesthetized with isoflurane. Appropriate dosages of
Gd-CA1.CD2 or Gd-DTPA were i.v. injected (via tail vein). Blood
(.about.50 .mu.l) samples were collected via orbital sinus of the
mouse at different time points. The mouse was euthanized at the
final time point. Tissue samples from kidney, liver, heart, and
lung, were collected. Serum samples were prepared from the
collected blood. For the bio-distribution analyses, the animals
were euthanized at single time point (indicated) after i.v.
administration of the contrast agent (indicated). The organ/tissue
samples were collected. Tissue extracts were freshly made from
collected samples using commercially available tissue extracting
kits (Qiagen). CA1.CD2 was detected and quantified by
immunoblotting and Sandwich-ELISA using a monoclonal antibody
(OX45, detecting antibody) and a home made polyclonal antibody
(PabCD2, capture antibody). A series of known amounts of CA1.CD2
samples mixed with blank mouse serum or tissue extracts were used
as standard in Sandwich-ELISA. ELISA signal from HRP was monitored
using a Fluorstar fluorescence microplate reader. For
quantification of Gd.sup.3+ in the serum and tissue samples one
hour (or indicated times) after the contrast agent administration,
animals were sacrificed and critical organs were collected, and the
tissues were then digested with concentrated nitric acid at
120-130.degree. C. with proper amount of .sup.157Gd spike as an
internal marker. The digested solution was analyzed by ICP-MS
(Element 2) using an isotope dilution method.
[0203] Toxicity Analyses. The MR imaged CD-1 mice that received the
i.v. administered Gd-CA1.CD2 (at a dose of .about.2.4 .mu.mol/kg)
were returned to their cages (one mouse per cage). The mice were
observed for five days and were euthanized at the end of the fifth
day. Tissue samples from kidney, liver, spleen, and lung were
collected. Gd.sup.3+ ion contents in the tissue samples were
analyzed by ICP-MS (see above paragraph).
[0204] Two groups of mice were used to examine potential renal
and/or liver damage by Gd-CA1.CD2. One group of mice received (i.v.
tail veil) 50 .mu.l of saline-buffer (as control). Another group
received (i.v. tail veil) Gd-CA1.CD2 at 4 .mu.mole/kg. The mice
were observed for 48 hours and were euthanized. Blood samples were
collected from the experimental mice. Serum samples were prepared
from the collected blood. Liver enzymes in serum samples, including
Alanine transaminase (ALT), Alkaline phosphatase (ALP), Aspartate
transaminase (AST), Gamma glutamyl transpeptidase (GGT), and
bilirubin and urea nitrogen were analyzed by a commercially
available source (MU Research Animal Diagnostic Laboratory). All
clinical chemistry parameters were measured on an Olympus AU 400
analyzer.
[0205] Cytotoxicity was analyzed by MTT assay of the cells that
were treated with Gd-CA1.CD2 at appropriate doses (indicated in
figure). The cells were grown under normal growth medium in 96 well
plates. Gd-CA1.CD2 or saline-phosphate buffer was added to the cell
culture medium. The cells were incubated for appropriate times. A
standard MTT assay was employed to assess the cell growth status of
the treated cells.
[0206] Serum stability. CA1.CD2 (40 .mu.M) in complex with
Gd.sup.3+ was incubated with 75% human serum over 3 or 6 hours at
37.degree. C. The degradation of the protein (disappearance of 12
kDa protein band) was analyzed by SDS-PAGE and visualized by
coomassie blue staining. In parallel, the degradation of the
protein was also analyzed by immunoblot using antibodies OX54 or
PabCD2. The identities of the 12 kDa bands as CA1.CD2 were always
verified by immunobloting using antibody PabCD2.
Results
[0207] Rational Design of Gd.sup.3+-binding Proteins. FIG. 1.1
shows the simulation of the dependence of r.sub.1 and r.sub.2 on
the rotational correlation time, .tau..sub.R, of a contrast agent
at different magnetic field strengths according to the theory
developed by Blombergen, Solomon.sup.6,7 (for detailed simulation
procedures, please see on-line supporting materials). For small
molecules such as Gd-DPTA with .tau..sub.R at hundreds of ps, the
relaxivity is <10 mM.sup.-1s.sup.-1 regardless of how the other
parameters are adjusted. On the other hand, the simulation clearly
suggests that contrast agents with .tau..sub.R of 10-50 ns have the
highest r.sub.1 and r.sub.2 values at clinically relevant magnetic
field strengths from 0.47-4.7 Tesla (T)..sup.11 Thus, we envisioned
that high-relaxivity MRI contrast agents can be developed by
directly designing Gd.sup.3+ binding sites in proteins with desired
.tau..sub.R. Coordinating Gd.sup.3+ ions directly to the rigid
protein frame eliminates the high internal mobility associated with
chelator-macromolecule conjugates (FIG. 1.1a).
[0208] We chose domain 1 of rat CD2 (referred to as CD2), a cell
adhesion protein with a common immunoglobin fold, as a scaffold
(FIG. 1.1c). CD2 protein exhibits strong stability against pH
changes and excellent tolerance against various mutations,.sup.29
which are essential features of functional protein engineering. In
addition, it has a compact structure with rotational correlation
time, .tau..sub.R, of .about.10 ns, corresponding to optimal
relaxivity for the current clinically allowed magnetic field
strength..sup.30 Moreover, its molecular size (12 kDa) is suitable
for good tissue penetration and easy renal exclusion..sup.17
[0209] We next designed a series of Gd.sup.3+ binding sites into
CD2 using computational methods..sup.32,33 The design was based on
the established structural parameters obtained from detailed
analysis of metal binding sites in over 500 small chelators and
metalloproteins. Gd.sup.3+, Tb.sup.3+, La.sup.3+ and other
Ln.sup.3+ ions have coordination properties similar to those of
Ca.sup.2+ with a strong preference for oxygen ligand atoms..sup.34
Small chelators usually have on average 9.3 and 6.9 total
coordinating atoms for Gd.sup.3+ and Ca.sup.2+, respectively. For
example, DTPA has 5 oxygen ligand atoms and 2 nitrogen ligand
atoms. For macromolecules such as proteins, the coordination atoms
are almost always oxygen atoms, and the coordination numbers are
lower than small chelators with an average of 7.2 for Ln.sup.3+ and
6.0-6.5 for Ca.sup.2+. These effects are possibly due to steric
crowding and sidechain packing..sup.34 Previously, we successfully
designed Ca.sup.2+ and Ln.sup.3+ binding sites in a scaffold
protein with strong selectivity over excess physiological metal
ions..sup.35 Structure determination by solution NMR revealed that
the actual coordination geometry in a designed variant is the same
as our design, verifying the computational methods and the design
strategy of metal-binding sites in proteins..sup.31
[0210] The designed proteins were named CA1.CD2-CA9.CD2 reflecting
Gd-binding sites at different locations. FIG. 1.1c shows an example
of designed Gd.sup.3+-binding protein CA1.CD2 with a metal binding
site formed by the six potential oxygen ligands from the carboxyl
side chains of Glu15, Glu56, Asp58, Asp62 and Asp64. Based on our
studies of charged residues in the coordination shell,.sup.36 we
placed 5 negatively charged residues to provide these six oxygen
ligand atoms in the coordination shell of CA1.CD2 to increase the
selectivity for Gd.sup.3+ over Ca.sup.2+. To achieve the desired
relaxation property, one position of the metal binding geometry was
left open in the design to allow fast water exchange between the
paramagnetic metal ion and the bulk solvent (FIG. 1.1a). The
Gd.sup.3+-binding site has minimal internal flexibility as the
ligand residues originate from rigid stretches of the protein
frame. To test the requirement for rigid embodiment in achieving
high relaxivity, another Gd.sup.3+-binding protein, CA9.CD2, was
engineered by fusing a continuous cation-binding EF-hand loop from
calmodulin with flexible glycine linkers to the host
protein..sup.37,38 This protein mimics previously reported highly
flexible chelate-based contrast agents conjugated to
macromolecules..sup.24,25
[0211] All of the designed Gd.sup.3+ binding proteins were
expressed in E. coli and subsequently purified by procedures
previously published from our laboratory..sup.30,31 All of the
designed proteins form the expected metal:protein complex as
demonstrated by ESI-Mass spectrometry (FIG. 1.5). Since metal
selectivity for Gd.sup.3+ over other physiological metal ions is
for minimizing the toxicity of the agents,.sup.39,40 we measured
metal binding constants using dye-competition assays with various
chelate-metal buffer systems (Table 1). Low limit metal binding
affinities of the proteins were also estimated based on
Tb.sup.3+-sensitized FRET and competition assays. CA1.CD2 exhibited
disassociation constants (K.sub.d) of 7.0.times.10.sup.-13,
1.9.times.10.sup.-7, 6.times.10.sup.-3, and >1.times.10.sup.-2 M
for Gd.sup.3+, Zn.sup.2+, Ca.sup.2+, and Mg.sup.2+, respectively.
The selectivity K.sub.d.sup.ML/K.sub.d.sup.GdL for Gd.sup.3+ over
physiological divalent cations Zn.sup.2+, Ca.sup.2+, and Mg.sup.2+
are 10.sup.5.34, >10.sup.9.84, and >10.sup.10.06,
respectively. The metal selectivity of CA1.CD2 is significantly
greater than or comparable to that of FDA approved contrast agents
DTPA- and DTPA-BMA.sup.40 (Table 1). The high metal binding
selectivity of CA1.CD2 was further supported by the observation
that r.sub.1 and r.sub.2 of Gd-CA1.CD2 were not altered in the
presence of excess Ca.sup.2+ (10 mM) (FIG. 1.2). Further assays
showed that potential chelators in serum, such as phosphate (50
mM), were not able to remove the Gd.sup.3+ from the protein. This
is considered for in vivo applications of the contrast agent as the
phosphate concentration in serum is maintained at .about.1.3
mM..sup.6,9 The stability of a contrast agent in blood circulation
is another factor for in vivo applications. We characterized the
stability by incubating Gd-CA1.CD2 with 75% human serum at
37.degree. C. for 3 and 6 hours. The protein-Gd complex remained
intact after 6 hours of incubation. The result suggests that the
protein is stable in blood. Taken together, the designed protein
contrast agent is comparable to the clinically used contrast agents
with good metal binding stability and selectivity..sup.6,7
TABLE-US-00001 TABLE 1 Example 1. Metal binding constants (Log
K.sub.a) and metal selectivity of DTPA, DTPA-BMA and CA1.CD2 Log
Log Log Sample Gd.sup.3+ Zn.sup.2+ Ca.sup.2+ Mg.sup.2+
(K.sub.Gd/K.sub.Zn) (K.sub.Gd/K.sub.Ca) (K.sub.Gd/K.sub.Mg)
DTPA.sup.28 22.45 18.29 10.75 18.20 4.17 11.70 4.25 DTPA-BMA.sup.41
16.85 12.04 7.17 na* 4.81 9.68 na* CA1.CD2 12.06 6.72 <2.22
<2.0 5.34 >9.84 >10.06 *na: not available.
[0212] The designed Gd-binding proteins exhibit high r1 and r2
relaxivity. We have determined the relaxivity values of the
designed protein contrast agents at 1.5, 3.0 and 9.4 Tesla field
strengths (FIG. 1.2). FIG. 1.2a shows that, at a concentration of
50 .mu.M, the designed contrast agents Gd-CA1.CD2 and Gd-CA2.CD2
were able to introduce contrast enhancement in T1 weighted imaging
at 3.0 T while 100 .mu.M Gd-DTPA and protein CA1.CD2 alone did not
lead to significant enhancement. The in vitro relaxivity values of
the designed Gd-binding proteins were measured (Table 2).
Gd-CA1.CD2 exhibits r.sub.1 up to 117 mM.sup.-1s.sup.-1 at 1.5T,
about 20-fold higher than that of Gd-DTPA. In contrast, Gd-CA9.CD2,
which carries a flexibly-conjugated Gd.sup.3+-binding site, had
significantly lower relaxivity values (3.4 and 3.6
mM.sup.-1s.sup.-1, for r1 and r2 respectively, at 3.0 T), that are
comparable to those of Gd-DTPA (Table 2). These data support the
concept that elimination of the intrinsic mobility of the metal
binding site resulted in the desired high relaxivity values.
TABLE-US-00002 TABLE 2 Example 1. Proton relaxivity of different
classes of contrast agents Compounds r.sub.1 r.sub.2 B0 MW CA class
(ligand residues) (mM.sup.-1 s.sup.-1) (mM.sup.-1 s.sup.-1) (T)
(kDa) Designed proteins CA1 117 129 1.5 12 (E15/E56/D58/D62/D64) 48
88 3 6 50 9.4 CA2 (D15/D17/N60/D62) 35 58 3 12 CA3 130 1.5
(E15/E56/D58/D62/E64) 34 57 3 12 CA9 (Add EF-loop III from 3.5 3.6
3 12 Calmodulin) Small compound GdDTPA 5.4 8 1.5 4.2 6.8 3 0.743
*Protein carriers Albumin 11.5 12.4 0.25 80 Poly-lysine 13 15 0.47
52 *Dendrimers Gadomer-17 13 1.5 35 *Liposome ACPL 12 11 1.5
>10.sup.3 *Nanoparticle Gd-perfluorocarbon 34 50 1.5
>10.sup.3 emulsion nanoparticles *Based on
references..sup.17,19-21
[0213] The r.sub.1 and r.sub.2 of Gd-CA1.CD2 exhibited an inverse
relationship with the magnetic field strength (Table 2, Example 1).
In contrast, the r.sub.1 and r.sub.2 of Gd-DPTA showed weak
dependence on field strengths. The magnetic field strength
dependent changes in relaxivity are consistent with our simulation
results based on the rotational .tau..sub.R of the contrast agent
(FIG. 1.1b). The results showed that the protein contrast agent
offers much higher relaxivities for MRI contrast enhancement at
clinical magnetic field strengths (1.5-3.0 T). Interestingly, the
transverse relaxivity of designed contrast agent is very high (i.g.
>50 mM.sup.-1s.sup.-1) at 9.4T compared to Gd-DTPA, making it
appropriate as a T.sub.2 contrast agent (Table 2) at high fields.
It should be pointed out that r2 of our protein-based contrast
agent is smaller than the currently used r2 agents such as iron
oxides..sup.42 This property allows our contrast agents to fill a
gap between small Gd-chelators and iron oxide nanoparticles,
extending the range of MRI applications both at clinically relevant
field strength and possibly higher field strength.
[0214] One factor that contributes greatly to the relaxivity of an
MRI contrast agent is its rotational correlation time,
.tau..sub.R..sup.11, 30, 31 Dynamic NMR studies showed that the
overall correlation time of our designed protein (CA1.CD2) is
similar in the absence (9.20 ns) and presence of bound metal ions
(9.08 ns), consistent with that for proteins of similar
size..sup.43 The values of the order factor S.sup.2 of the ligand
residues are similar to the average value of the protein,
suggesting that the metal binding pocket tumbles with the protein
as a whole (FIG. 1.3a). Therefore, the measured correlation time of
the protein directly reflects the .tau..sub.R of the metal binding
site. In contrast, the flexible metal binding loop in CA9.CD2 has
an S.sup.2 order value of 0.3-0.4, which is very different from
CA1.CD2 with an S.sup.2 value very close to that of the backbone of
the protein.
[0215] The hydration number of an MRI contrast agent is another
determinant for r.sup.1 and r.sup.2. The hydration number of the
designed protein-based contrast agents was determined by measuring
the luminescence lifetime of Tb.sup.3+..sup.26 The free Tb.sup.3+
in H.sub.2O and D.sub.2O has a life time value of 410 .mu.s and
2,796 .mu.s, respectively. The formation of M-protein complex
significantly increases Tb.sup.3+ life time to 859 .mu.s. The
Tb.sup.3+ life time values of CA1.CD2 were 1,679 .mu.s in D.sub.2O,
suggesting a hydration number of 2.1 (FIG. 1.3b). Interestingly, a
well-known Ca.sup.2+-binding protein troponin C exhibits a
hydration number of 1.8 (FIG. 1.3b). It was determined by the X-ray
crystal structure that trponin C has only one water molecule
coordinated Tb.sup.3+ in the metal binding pocket..sup.44
Therefore, it is conceivable that the hydration water molecules
either from the coordination shell or the outer shell of the
protein also contribute to the observed high relaxivity of
CA1.CD2.
[0216] Application of the Designed Gd-binding Proteins for in vivo
MR Imaging. The effect of MRI contrast enhancement of the protein
contrast agent was tested in mice (CD-1 mice). Gd-CA1.CD2 was
administered via tail vein at a dose of .about.2.4 .mu.mole Gd/kg
body weight, about 35 fold lower than the dosage of Gd-DTPA used in
diagnostic imaging. Comparison of pre- and post-contrast T.sub.1
weighted spin echo images obtained at 3T showed the contrast
enhancement in several organs with the greatest enhancement of the
MRI contrast observed in the kidney (FIG. 1.4a, arrows indicated),
which exhibited a time dependent change of the contrast enhancement
over a period of 2 hours (FIG. 1.4b). Careful analysis of image
data showed the distribution of the contrast enhancement at
different organs (FIG. 1.4b). The tissue dependent enhancement is
consistent with the biodistribution of Gd.sup.3+ analyzed at 1 hour
time point using inductively coupled plasma mass spectrometry
(ICP-MS) (FIG. 1.4c). The T.sub.1 contrast enhancement in the
kidney cortex diminished substantially at 18 hours after the
administration of Gd-CA1.CD2, suggesting that the agent was
gradually cleared from the kidney and other organs. Consistent with
the simulations and relaxivity values determined in vitro, a strong
T.sub.2 contrast enhancement was observed at 9.4T. T.sub.2-weighted
images at the 9.4T and T.sub.1-weighted images at 3T showed very
similar tissue and organ distribution patterns (FIG. 1.7). At the
same concentration, Gd-DTPA failed to exhibit contrast enhancements
at either 3T or 9.4T.
[0217] Furthermore, contrast enhancement by Gd-CA1.CD2 was
sustained over 4-7 hours at multiple organs (FIG. 1.8b), indicating
much longer tissue retention time of the agent than that of
Gd-DTPA. The tissue retention and blood circulation time of
Gd-CA1.CD2 in mice were characterized by administering various
doses of agents in mice and analyzing the collected blood samples
or tissue sections from sacrificed animals using immunoblots and
ELISA with monoclonal (OX45) and in-house developed polyclonal
(PabCD2) antibodies. In contrast to the short blood circulation
time of Gd-DPTA, Gd-CA1.CD2 exhibited a prolonged blood circulation
time. No significant decrease in the CA1.CD2 levels in blood was
observed until 45 minutes after i.v. administration. The protein
remained in blood circulation for more than 3 hours (FIG. 1.8a).
This property is considered for imaging of biological events that
require prolonged imaging time, or imaging of pathological features
that require time for delivery of the agent to the targeted site.
In the kidney, CA1.CD2 was first detectable at 15 minutes and
peaked at 4-5 hours. There was less than 10% of the injected dose
of the contrast agent remaining in the kidney 15 hours after
injection (by measurements of both Gd.sup.3+ and CA1.CD2). This
result, along with the observation of MRI contrast changes in the
bladder, suggests a clearance of the agent by kidney.
[0218] Gd-CA1.CD2 did not exhibit acute toxicity at the dose
(.about.2.4 .mu.mole/kg) used for MRI. All mice that received the
contrast agents (>10) showed no adverse effects before
euthanization five days after agent injection. The effects of
Gd-CA1.CD2 on liver enzymes (ALT, ALP, AST), serum urea nitrogen,
bilirubin, and total protein from CD-1 mice 48 hours post-contrast
injection were negligible compared to those in the control mice
(Example 1, Table 3). In addition, no cytotoxicity was observed in
tested cell lines, SW620, SW480 and HEK293, that were treated with
50 .mu.M Gd-CA1.CD2, by MTT assay (FIG. 1.8b). Based on the
preliminary characterization of toxicity, we conclude that the
protein contrast agent did not possess acute toxicity at current
dosages for mice.
TABLE-US-00003 TABLE 3 Example 1. Summary of Animal Clinical
Pathology Profiles Test mice.sup.a Control mice.sup.b Normal
rang.sup.c Urea Nitrogen (mg/L) 26.0 .+-. 0.2.sup.d 27.0 .+-. 0.2
18-31 Total Urine Protein 5.2 .+-. 0.2 5.3 .+-. 0.2 5.9-10.3 (g/L)
Total Bili (mg/L) 0.4 .+-. 0.2 0.5 .+-. 0.2 0.3-0.8 Direct Bili
(mg/L) 0.0 0.0 ALT (U/L) 49.0 .+-. 0.2 72.0 .+-. 0.2 44-87 ALP
(U/L) 115.0 .+-. 0.2 302.0 .+-. 0.2 43-71 AST (U/L) 280.0 .+-. 0.2
219.0 .+-. 0.2 101-214 GGT (U/L) 0.0 -3.0 .sup.aFour mice per group
were injected with Gd-CA1.CD2 at dose of 4.0 .mu.mole/kg. All
clinical chemistry parameters are measured on an Olympus AU 400
analyzer by MU Research Animal Diagnostic Laboratory (details see
Material and Methods). .sup.bControl group mice were injected with
50 .mu.l of phosphate buffered saline pH = 7.4. .sup.cNormal range
values are from Quesenberry, K. E. and J. W. Carpenter; Ferrets,
Rabbits, and Rodents Clinical Medicine and Surgery; W. B. Saunders:
Philadelphia, 2003. .sup.dThe standard deviations of measurements
with four animal (n = 4).
Discussion
[0219] While new developments of Gd.sup.3+ chelators.sup.4, 5, 11,
21, 46 continue to expand the applications of small molecular
contrast agents, macro-molecular agents are increasingly attractive
for functional and molecular imaging applications. A common
approach of using small molecular GdDTPA to bind albumin in serum
(e.g., MS-325) has the capability to enhance the relaxivity in
vivo. However, this class of contrast agents is currently limited
to imaging the vascular system.sup.47-50 with the complex
pharmacokinetics..sup.51 Conjugation or encapsulation of small
Gd-chelators to or in the liposome, fullerene, and nanotube, indeed
resulted in increases in relaxivity; however, several important
drawbacks limit the applications of these agents. Our approach of
using an engineered protein to chelate the Gd.sup.3+ for contrast
enhancing effect differs fundamentally from those previous studies
in several respects.
[0220] First, we have created a Gd.sup.3+-binding site with strong
metal selectivity in a stable and potentially fully functioning
host protein by de novo design. This is significantly different
from using a small peptide fragment to cross-link small
Gd.sup.3+-chelate in stability and rigidity of the binding site as
well as biological functions of the protein. To our knowledge, this
is the first example that an MRI protein contrast agent was made
using an engineered Gd.sup.3+ binding protein without using
existing small metal chelators. This is an achievement in protein
design, involving the rational development of a metalloprotein with
high coordination number and charged ligand residues in the
coordination shell.
[0221] Second, our approach provides a new platform for developing
MRI contrast agents with further improved relaxivity and metal
selectivity and stability by protein engineering. Our studies
reveal that three factors are key in achieving high relaxivity: 1)
the longer rotational correlation time .tau..sub.R of the designed
agents, 2) the direct coordination of Gd.sup.3+ ions to amino acid
ligands at the rigid protein matrix to eliminate internal mobility,
and 3) the increased hydration of water molecules. As predicted by
the Solomon-Bloembergen-Morgan equation (Supplementary Equation 1),
relaxivities can be significantly increased by increasing the
number of hydration water molecules. Unfortunately, previous
attempts to increase relaxivities by increasing the number of
coordinating water molecules from 1 to 2 for BTPA and DTPA-BMA did
not yield successful results. Our studies demonstrated an excellent
example that it is possible to increase in relaxivity by increasing
the hydration number of protein MRI contrast agent without
sacrifice the metal binding properties, such as affinity and metal
specificity. Presumably, the concept demonstrated in this study may
be applied to the design of other macromolecule based MRI contrast
agents. Using protein to chelate Gd.sup.3+ as an MRI contrast agent
has several potential advantages over currently used Gd-DTPA in
functional and molecular imaging applications: 1) it greatly
increases the contrast-to-noise ratio (CNR); 2) it improves dose
efficiency with reduced metal toxicity; 3) it prolongs the tissue
retention time, which enables imaging of abnormalities that
requires prolonged tissue enhancement; and 4) provide a potential
functioning protein or a protein carrier that can conjugate target
specific ligands to a biomarker for targeted molecular MR
imaging.
[0222] ESI-Mass spectrometry of metal:protein complex,
determination of metal binding constants, MRI imaging and its data
analysis, tissue retention and blood circulation time of contrast
agents, toxicity, and simulation of contrast agent
relaxivities.
Computational Simulation of Contrast Agent Relaxivities.sup.52
[0223] The simulation of R.sub.1 and R.sub.2 as a function of
magnetic field strength is performed based on supplementary
equations 1 and 2:
R 1 = cq 55.5 1 T 1 m + .tau. m ( 1 ) R 2 = cq 55.5 T 2 m - 2 +
.tau. m - 1 T 2 m - 1 + .DELTA. .omega. m 2 .tau. m ( ( .tau. m - 1
+ T 2 m - 1 ) 2 + .DELTA. .omega. m 2 ) ( 2 ) ##EQU00002##
[0224] In these equations, the water coordination number, q, is
assumed to be 1 and the agent concentration is 0.001 M; .tau..sub.m
is the dwelling time of the coordination water; and
.DELTA..omega..sub.m is the chemical shift difference between the
bound and free water. Since .DELTA..omega..sub.m.sup.2 is much
smaller than other components, equation 2 is simplified to
supplementary equation 3 and used in this simulation:
R 2 = cq 55.5 1 T 2 m + .tau. m ( 3 ) ##EQU00003##
[0225] T.sub.im is determined by dipole-dipole (DD) and scalar or
contact (SC) mechanisms as shown in supplementary equation 4:
1 T im = 1 T i DD + 1 T i SC i = 1 , 2 ( 4 ) ##EQU00004##
[0226] Because the contribution from T.sub.i.sup.DD is much greater
than that of T.sub.i.sup.SC, only the former is used in the
simulation, which is obtained using supplementary equations 5 and
6:
1 T 1 DD = 2 15 .gamma. I 2 g 2 .mu. B 2 r GdH 6 S ( S + 1 ) ( .mu.
0 4 .pi. ) 2 [ 7 .tau. c 2 1 + .omega. s 2 .tau. c 2 2 + 3 .tau. c
1 1 + .omega. I 2 .tau. c 1 2 ] ( 5 ) 1 T 2 DD = 1 15 .gamma. I 2 g
2 .mu. B 2 r GdH 6 S ( S + 1 ) ( .mu. 0 4 .pi. ) 2 [ 13 .tau. c 2 1
+ .omega. s 2 .tau. c 2 2 + 3 .tau. c 1 1 + .omega. I 2 .tau. c 1 2
+ 4 .tau. c 1 ] ( 6 ) ##EQU00005##
[0227] The following values are used in the calculation: the
gyro-magnetic constant for proton .gamma..sub.1,
2.675.times.10.sup.8T.sup.-1s.sup.-1; g, 2.0; Bohr magneton
.mu..sub.B, 9.274.times.10.sup.-24 J T.sup.-1; S, 7/2; permeability
of vacuum .mu..sub.0, 1.257.times.10.sup.-6N A.sup.-2; and the
distance between the Gd.sup.3+ and proton r.sub.GdH,
3.0.times.10.sup.-10 m (normally 2.7-3.3 .ANG.). The frequency of
proton .omega..sub.1 equals to the .gamma..sub.1 multiplied by the
magnetic field while the frequency of electron .omega..sub.s is
658-fold of .omega..sub.1. The .tau..sub.ci is determined by the
rotational correlation time .tau..sub.R, the water dwelling time
.tau..sub.m, and T.sub.ie as shown in supplementary equation 7:
1 .tau. ci = 1 .tau. R + 1 .tau. m + 1 T ie i = 1 , 2 ( 7 )
##EQU00006##
[0228] T.sub.ie is related to the electron frequency .omega..sub.s
as well as the .tau..sub.v (correlation time of splitting) and
.DELTA..sup.2 (mean square zero field splitting energy) of the
Gd.sup.3+ as in supplementary equations 8-10:
1 T 1 e = 2 C ( 1 1 + .omega. s 2 .tau. v 2 + 4 1 + 4 .omega. s 2
.tau. v 2 ) ( 8 ) 1 T 2 e = C ( 5 1 + .omega. s 2 .tau. v 2 + 2 1 +
4 .omega. s 2 .tau. v 2 + 3 ) ( 9 ) ##EQU00007##
Where
[0229] C = 1 50 .DELTA. 2 .tau. v { 4 S ( S + 1 ) - 3 } ( 10 )
##EQU00008##
[0230] Various combinations of .tau..sub.R (1 ps, 10 ps, 100 ps, 1
ns, 10 ns, and 100 ns), .tau..sub.m (1 ps, 10 ps, 100 ps, 1 ns, 10
ns, and 100 ns), .tau..sub.v (1 and 10 ps), and .DELTA..sup.2
(10.sup.17, 10.sup.18, 10.sup.19, and 10.sup.20 s.sup.-2) have been
proposed for the calculation of magnetic field-dependent
relaxivities under magnetic field strengths ranging from 0.001 MHz
to more than 1000 MHz. For small molecules such as DPTA with
.tau..sub.R at hundreds of ps level, the relaxivity is <10
mM.sup.-1s.sup.-1 no matter how the other parameters are adjusted.
On the other hand, for the contrast agents with .tau..sub.R at 10
ns level, such as the CD2 derivatives in our study, the relaxivity
can reach a much higher level by adjusting other parameters such as
the .tau..sub.m.
Toxicity of Contrast Agent Gd-CA1.CD2
[0231] The protein contrast agent Gd-CA1.CD2 did not exhibit acute
toxicity at the MRI imaging dose (.about.2.4 mole/kg), as
demonstrated by the fact that all MR imaged mice that received the
contrast agent (>10) behaved normally and remained healthy
(sacrificed five days after agent injection). The effects of
Gd-CA1.CD2 on liver enzymes (ALT, ALP, AST), serum urea nitrogen,
bilirubin, and total protein from CD-1 mice 48 hours post-contrast
injection were negligible compared to the control mice (Table 3).
In addition, no cytotoxicity was observed in tested cell lines,
SW620, SW480 and HEK293 that were treated with 50 .mu.M Gd-CA1.CD2,
by MTT assay (FIG. 1.7b). Based on the preliminary characterization
of toxicity, we conclude that the protein contrast agent is
relatively safe. References for Example 1, each of which are
incorporated herein by reference: [0232] 1. Tyszka, J. M.; Fraser,
S. E.; Jacobs, R. E., Curr Opin Biotechnol 2005, 16, (1), 93-99.
[0233] 2. Lippard, S. J., Nat Chem Biol 2006, 2, (10), 504-507.
[0234] 3. Louie, A. Y.; Huber, M. M.; Ahrens, E. T.; Rothbacher,
U.; Moats, R.; Jacobs, R. E.; Fraser, S. E.; Meade, T. J., Nat
Biotechnol 2000, 18, (3), 321-325. [0235] 4. Frangioni, J. V., Nat
Biotechnol 2006, 24, (8), 909-913. [0236] 5. Woods, M.; Woessner,
D. E.; Sherry, A. D., Chem Soc Rev 2006, 35, (6), 500-511. [0237]
6. Lauffer, R. B., Chem. Rev. 1987, 87, 901-927. [0238] 7. Aime,
S.; Barge, A.; Cabella, C.; Crich, S. G.; Gianolio, E., Curr Pharm
Biotechnol 2004, 5, (6), 509-518. [0239] 8. Toth, E.; Helm, L.;
Merbach, A. E., Contrast Agents I. Magnetic Resonance Imaging W.
Krause, Ed. 2002, 221, 61-102. [0240] 9. Merbach, A. E.; Toth, E.,
The chemistry of contrast agent agents in medical magnetic
resonance Imaging. 2001. [0241] 10. Geraldes, C. F.; Sherry, A. D.;
Cacheris, W. P.; Kuan, K. T.; Brown, R. D., 3rd; Koenig, S. H.;
Spiller, M., Magn Reson Med 1988, 8, (2), 191-199. [0242] 11.
Caravan, P., Chem Soc Rev 2006, 35, (6), 512-523. [0243] 12.
Weinmann, H. J.; Press, W. R.; Gries, H., Invest Radiol 1990, 25
Suppl 1, S49-50. [0244] 13. Opsahl, L. R.; Uzgiris, E. E.; Vera, D.
R., Acad Radiol 1995, 2, (9), 762-767. [0245] 14. Langereis, S.; de
Lussanet, Q. G.; van Genderen, M. H.; Meijer, E. W.; Beets-Tan, R.
G.; Griffioen, A. W.; van Engelshoven, J. M.; Backes, W. H., NMR
Biomed 2006, 19, (1), 133-141. [0246] 15. Bryant, L. H., Jr.;
Brechbiel, M. W.; Wu, C.; Bulte, J. W.; Herynek, V.; Frank, J. A.,
J Magn Reson Imaging 1999, 9, (2), 348-352. [0247] 16. Sirlin, C.
B.; Vera, D. R.; Corbeil, J. A.; Caballero, M. B.; Buxton, R. B.;
Mattrey, R. F., Acad Radiol 2004, 11, (12), 1361-1369. [0248] 17.
Lanza, G. M.; Winter, P.; Caruthers, S.; Schmeider, A.; Crowder,
K.; Morawski, A.; Zhang, H.; Scott, M. J.; Wickline, S. A., Curr
Pharm Biotechnol 2004, 5, (6), 495-507. [0249] 18. Karfeld, L. S.;
Bull, S. R.; Davis, N. E.; Meade, T. J.; Barron, A. E., Bioconjug
Chem 2007, 18, (6), 1697-1700. [0250] 19. Gillies, R. J., J Cell
Biochem Suppl 2002, 39, 231-238. [0251] 20. Artemov, D.; Bhujwalla,
Z. M.; Bulte, J. W., Curr Pharm Biotechnol 2004, 5, (6), 485-494.
[0252] 21. Aime, S.; Cabella, C.; Colombatto, S.; Geninatti Crich,
S.; Gianolio, E.; Maggioni, F., J Magn Reson Imaging 2002, 16, (4),
394-406. [0253] 22. Anderson, E. A.; Isaacman, S.; Peabody, D. S.;
Wang, E. Y.; Canary, J. W.; Kirshenbaum, K., Nano Lett 2006, 6,
(6), 1160-1164. [0254] 23. Strijkers, G. J.; Mulder, W. J.; van
Heeswijk, R. B.; Frederik, P. M.; Bomans, P.; Magusin, P. C.;
Nicolay, K., MAGMA 2005, 18, (4), 186-192. [0255] 24. Caravan, P.;
Greenwood, J. M.; Welch, J. T.; Franklin, S. J., Chem Commun (Camb)
2003, (20), 2574-2575. [0256] 25. Kim, Y.; Welch, J. T.; Lindstrom,
K. M.; Franklin, S. J., J Biol Inorg Chem 2001, 6, (2), 173-181.
[0257] 26. Sudnick, D. R.; Horrocks, W. D., Jr., Biochim Biophys
Acta 1979, 578, (1), 135-144. [0258] 27. Beeby, A.; Clarkson, I.
M.; Dickins, R. S.; Faulkner, S.; Parker, D.; Royle, L.; de Sousa,
A. S.; Gareth Williams, J. A.; Woods, M., J. Chem. Soc., Perkin
Trans. 1999, 2, 493-504. [0259] 28. Martell, A. E.; Simth, R. M.;
Motekaitis, R. J., NIST Standard Reference Data, Gaithersburg, Md.
1993. [0260] 29. Wilkins, A. L.; Yang, W.; Yang, J. J., Curr
Protein Pept Sci 2003, 4, (5), 367-373. [0261] 30. Yang, W.;
Wilkins, A. L.; Li, S.; Ye, Y.; Yang, J. J., Biochemistry 2005, 44,
(23), 8267-8273. [0262] 31. Yang, W.; Wilkins, A. L.; Ye, Y.; Liu,
Z. R.; Li, S. Y.; Urbauer, J. L.; Hellinga, H. W.; Kearney, A.; van
der Merwe, P. A.; Yang, J. J., J Am Chem Soc 2005, 127, (7),
2085-2093. [0263] 32. Deng, H.; Chen, G.; Yang, W.; Yang, J. J.,
Proteins 2006, 64, (1), 34-42. [0264] 33. Yang, W.; Lee, H. W.;
Hellinga, H.; Yang, J. J., Proteins 2002, 47, (3), 344-356. [0265]
34. Pidcock, E.; Moore, G. R., J Biol Inorg Chem 2001, 6, (5-6),
479-489. [0266] 35. Yang, W.; Jones, L. M.; Isley, L.; Ye, Y.; Lee,
H. W.; Wilkins, A.; Liu, Z. R.; Hellinga, H. W.; Malchow, R.;
Ghazi, M.; Yang, J. J., J Am Chem Soc 2003, 125, (20), 6165-6171.
[0267] 36. Maniccia, A. W.; Yang, W.; Li, S. Y.; Johnson, J. A.;
Yang, J. J., Biochemistry 2006, 45, (18), 5848-5856. [0268] 37. Ye,
Y.; Lee, H. W.; Yang, W.; Shealy, S. J.; Wilkins, A. L.; Liu, Z.
R.; Torshin, I.; Harrison, R.; Wohlhueter, R.; Yang, J. J., Protein
Eng 2001, 14, (12), 1001-1013. [0269] 38. Ye, Y.; Lee, H. W.; Yang,
W.; Shealy, S.; Yang, J. J., J Am Chem Soc 2005, 127, (11),
3743-3750. [0270] 39. Wedeking, P.; Shukla, R.; Kouch, Y. T.; Nunn,
A. D.; Tweedle, M. F., Magn Reson Imaging 1999, 17, (4), 569-575.
[0271] 40. Kumar K.; Tweedle, M. F.; Malley, M. F.; Cougoutas, J.
Z., Inorg. Chem. 1995, 34, 6472-6480. [0272] 41. Cacheris, W. P.;
Quay, S.C.; Rocklage, S. M., Magn Reson Imaging 1990, 8, (4),
467-481. [0273] 42. Bulte, J. W.; Kraitchman, D. L., NMR Biomed
2004, 17, (7), 484-499. [0274] 43. Wyss, D. F.; Dayie, K. T.;
Wagner, G., Protein Sci 1997, 6, (3), 534-542. [0275] 44. Rao, S.
T.; Satyshur, K. A.; Greaser, M. L.; Sundaralingam, M., Acta
Crystallogr D Biol Crystallogr 1996, 52, (Pt 5), 916-922. [0276]
45. Barnhart, J. L.; Kuhnert, N.; Bakan, D. A.; Berk, R. N., Magn
Reson Imaging 1987, 5, (3), 221-231. [0277] 46. van Zijl, P. C.;
Jones, C. K.; Ren, J.; Malloy, C. R.; Sherry, A. D., Proc Natl Acad
Sci USA 2007, 104, (11), 4359-4364. [0278] 47. Lauffer, R. B.;
Parmelee, D. J.; Ouellet, H. S.; Dolan, R. P.; Sajiki, H.; Scott,
D. M.; Bernard, P. J.; Buchanan, E. M.; Ong, K. Y.; Tyeklar, Z.;
Midelfort, K. S.; McMurry, T. J.; Walovitch, R. C., Acad Radiol
1996, 3 Suppl 2, S356-358. [0279] 48. Lauffer, R. B.; Parmelee, D.
J.; Dunham, S. U.; Ouellet, H. S.; Dolan, R. P.; Witte, S.;
McMurry, T. J.; Walovitch, R. C., Radiology 1998, 207, (2),
529-538. [0280] 49. Parmelee, D. J.; Walovitch, R. C.; Ouellet, H.
S.; Lauffer, R. B., Invest Radiol 1997, 32, (12), 741-747. [0281]
50. Allen, M. J.; Meade, T. J., J Biol Inorg Chem 2003, 8, (7),
746-750. [0282] 51. Brasch, R.; Turetschek, K., Eur J Radiol 2000,
34, (3), 148-155. [0283] 52. Toth, E.; Helm, L.; Merbach, A. E.
Contrast Agents I: Magnetic Resonance Imaging W. Krause, Ed. 2002,
221, 61-102.
Example 2
PEGylation Modification of Protein MRI Contrast Agents with
Enhanced Relaxivity and Reduced Immunogenicity
Introduction:
[0284] In this Example, we report our progress in optimizing
designed protein contrast agents for in vivo imaging by pegylation.
Our experimental results clearly demonstrate that PEGylation
substantially increases the solubility of protein by more than 100
fold without reducing metal binding affinity and selectivity. In
addition, the serum stability is significantly improved.
Interestingly, PEGylation further increased the in vitro R1 and R2
relaxivities of the developed protein contrast agents by 2-3 fold,
which is in contrast to the loss of functionality of protein drug
by pegylation. Such increased relaxivity is a result of the
addition of a hydration layer due to water retention by Poly-PEG
chain on the protein surface and alteration of correlation time.
The agent demonstrated a strong contrast enhancement in the animal
imaging with a dose 70 fold lower than that of Gd-DTPA. Our
developed contrast agent showed a much longer blood circulation
time, and the blood circulation time and its distribution of our
protein contrast agent in mice can be modified by using different
lengths of PEG. Furthermore, the immunogencity of the contrast
agent has been significantly decreased by pegylation. The optimized
properties of protein contrast agents by pegylation facilitate the
disease targeted tissue and molecular imaging.
[0285] PEGylation of protein is a method used to improve the
pharmacokinetics and pharmaco-dynamics of various protein and
peptide drugs. PEGylation involves modifications of Lys, Glu, Asp,
or Cys residues of a protein or peptide with various sizes of
polyethylene glycerol chain. The result of PEGylation modifications
is the attachment of the different size of polyethylene glycerol
chains on the surface of the modified protein or peptide. The
protein or peptide experiences several property changes, especially
in pharmacokinetics and pharmaco-dynamics. Two changes are obvious:
(1) the increase in molecular size, especially in the case of small
peptide, and (2) the reduction in surface charges of protein and
peptide. A consequence of these two changes is the increase in
blood circulation time and delay in the renal secretion. Another
effect of the changes is the reduced immunogenicity of the protein
or peptide drugs after PEGylation. The strategy has been
successfully employed in a number of protein or peptide drugs for
increased efficacy and/or reduced immuno-response of the drug.
Since the polyethylene glycerol chains are strongly hydrophilic,
PEGylation of protein will also result in a dramatic increase in
solubility of protein or peptide drugs. However, the most
significant drawback of PEGylation for a protein or peptide drug is
that the bulk volume of the polyethylene glycerol chains on the
surface of proteins often blocks the bio-active site(s) leading to
significant decrease in bio-activity.
[0286] We have previously reported the development of protein-based
MRI contrast agents by rational design of Gd.sup.3+ binding sites
into a stable protein using amino acids residues as metal
coordinating ligands. The designed protein contrast agent exhibits
a 10-20-fold increase in in vitro R1 and R2 relaxivities compared
to the current clinically used contrast agent Gd-DTPA. To apply
this class of novel class of protein contrast agents to in vivo
imaging, several additional factors must be considered. First,
contrast agents need to have high solubility. Because of
limitations in the sensitivity of MRI techniques and injection
volumes for animals, in order to provide significant in vivo tissue
contrast, requires up to a 300-500 mM injection dose for a
clinically used DTPA with a relaxivity of 5 mM.sup.-1s.sup.-1.
Compared to DTPA, our protein contrast agents with a 10-20 fold
increase of relaxivity require a soluble concentration of 30-50 mM.
Second, proper blood circulation time is required to facilitate
targeted tissue or molecular MR imaging. Third, the in vivo
stability of the contrast agents against degradation and kinetic
stability against metal transformation is essential to reduce
toxicity. Fifth, the immunogenicity of the protein contrast agents
needs to be reduced.
[0287] In this Example, we report our progress in optimizing
designed protein contrast agents for in vivo imaging by pegylation.
Our experimental results clearly demonstrate that PEGylation
substantially increases the solubility of protein by more than 100
fold without reducing metal binding affinity and selectivity. In
addition, the serum stability is significantly improved.
Interestingly, PEGylation further increased the in vitro R1 and R2
relaxivities of the developed protein contrast agents by 2-3 fold,
which is contrast to the loss of functionality of protein drug by
pegylation. The agent demonstrated a strong contrast enhancement in
the animal imaging with a dose 70 fold lower than that of Gd-DTPA.
Our developed contrast agent showed a much longer blood circulation
time, and the blood circulation time and its distribution of our
protein contrast agent in mice can be modified by using different
lengths of PEG. Furthermore, the immunogencity of the contrast
agent has been significantly decreased by pegylation. The optimized
properties of protein contrast agents by pegylation facilitate the
disease targeted tissue and molecular imaging.
2. Material and Methods
[0288] All pegylation reagents were purchased. Metal and dye
reagents were purchased from Molecular Probes and Sigma. Cys was
added at the C-terminal of the CA1.CD2 and subcloned in pet20b for
protein expression. Site-directed mutagenesis method was used to
remove Lys at different locations. DNA sequences were verified by
DNA sequence core facility.
2.1 Protein Expression and Purification
[0289] Protein was expressed in E. coli as inclusion body and
purified using urea refolding and ion-exchange column. N15 labeled
protein was expressed in SV medium as GST fusion (Yang et al.,
Biochem 2006) and purification was by GST-4B affinity column and SP
column. Protein was verifed by mass spectrometry. Protein
concentration was calculated using extinction coefficient of w.t.
CD2 of 11,000 (Ye et al., 2001). Protein solubility was determined
by concentrating proteins to reach to precipitation using speed
vac.
2.2 Pegylation
[0290] We first carried out the PEGylation modifications of Lys
residues on our designed protein MRI contrast agents using
different preactivated NHS with PEG units of 4, 12, 40, 12K, and 20
K (FIGS. 2.2-2.4). Typically reactions were carried out using 3:1
or 5:1 PEG:protein at room temperature for 1-2 hours. Reactions at
pH 6, 7 and 9 were also performed with no major change in the
pegylation results. N-terminal pegylation of Lys was performed at
pH 6 according to published papers (1-5).All reactions were
quenched by adding free amino acids and stored at -20.degree. C.
for further purification. Specifically modification at the Cys at
the C-terminal was performed by using published methods (1-5).
[0291] Separation of pegylated proteins were achieved by 10 fold
dilution of reaction mix and loaded on sp column using a pH
gradient from 2 to 7. Free PEG was not able to bind to the column
and washed away before pH gradient. Free unpegylated protein
fractions were eluted out at the latest fraction at high pH.
Separated protein samples were then verified by mass spectrometry
analysis, metal binding and NMR.
2.3 Mass Spectrometry
[0292] ESI and MALDI spectrometry were used to identify the number
of pegylation sites and metal binding stoichiometry. The pegylation
sites were identified using trypsin cleavage followed by Mass
analysis using TOF/TOF.
2.4 Gd.sup.3+-Binding Affinity Determination.
[0293] Gd.sup.3+-binding affinities of CA1.CD2 and its pegylated
variants were determined by a competition titration with Fluo-5N
applied as a Gd.sup.3+ indicator (Yang et al., JACS, 2008). The
fluorescence spectra of Fluo-5N were obtained with a fluorescence
spectrophotometer (Photon Technology International, Inc.) with a 10
mm path length quartz cell at 22.degree. C. Fluo-5N emission
spectra were acquired at 500 nm to 650 nm with an excitation at 488
nm. Gd.sup.3+-binding affinity of Fluo-5N, K.sub.d1, was first
determined by a Gd.sup.3+ titration with Gd.sup.3+ buffer system of
1 mM nitrilotriacetic acid (NTA). Free Gd.sup.3+ concentration was
calculated with a NTA Gd.sup.3+-binding affinity of
2.6.times.10.sup.-12 M..sup.28 Fluo-5N was mixed with Gd.sup.3+ in
1:1 ratio for a competition titration. The experiment was performed
with a gradual addition of CA1.CD2 or its variants. An apparent
constant, K.sub.app, was estimated by fitting the fluorescence
emission intensity of Fluo-5N at 520 nm with different CA1.CD2
concentrations as a 1 to 1 binding model. Gd.sup.3+-binding
affinity of CA1.CD2, K.sub.d2, was calculated with the following
equation:
K d 2 = K app K d 1 K d 1 + [ Fluo - 5 N ] T ( 1 ) ##EQU00009##
[0294] Metal binding affinity for Ca.sup.2+ and Zn.sup.2+ were
determined using similar competition methods and specific dyes with
proper Kd values.
2.5 Measurement of Water Coordination Number by Terbium Life Time
Luminescence.
[0295] The numbers of water ligands coordinated to
Gd.sup.3+-CA1.CD2 and variants complex were determined by measuring
Tb.sup.3+ luminescence decay in H.sub.2O or D.sub.2O (Yang et al.,
2008). Tb.sup.3+ excited state lifetime was measured using a
fluorescence spectrophotometer (Photon Technology International,
Inc.) with a 10 mm path length quartz cell at 22.degree. C.
Following excitation at 265 nm with a XenoFlash (Photon Technology
International, Inc.), Tb.sup.3+ emission was monitored at 545 nm in
a time series experiment in both H.sub.2O and D.sub.2O systems.
Luminescence decay lifetime was obtained by fitting the acquired
data with a mono-exponential decay function. H.sub.2O in CA1.CD2
solution was replaced with D.sub.2O by lypholization and
re-dissolved in D.sub.2O at least three times. A standard curve
correlating the .DELTA.k.sub.obs with water number under our
experimental conditions was established by using well-characterized
chelators, such as EDTA (q=3), DTPA (q=1), NTA (q=5), and Aquo
Tb.sup.3+ (q=9) solution with R.sup.2=0.997..sup.26,27 Water number
coordinated to Tb.sup.3+-CA1.CD2 complex was then obtained by
fitting the acquired .DELTA.k.sub.obs value to the standard
curve.
2.6 In Vitro MRI Relaxivity
[0296] Relaxivity was determined using 0.47 T (20 Hz) minispec
Magnetic Relaxometer (Bruker) and 300 and 500 MHz NMR (Varian).
2.7 NMR
[0297] Pulse field diffusion NMR was applied to measure the
hydrodynamic radii of the protein (Lee et al., BBA 2003) with
Protein samples CA1.CD2 and its variants of 0.2 mM in buffer.
Lysozme and diaxone were used as an external and internal reference
for calibration. The correlation size of the protein was measured
using TauC pulse sequence developed by the Prestegard lab at UGA
using .sup.15N labeled protein.
2.8 In Vivo Mouse MR Imaging.
[0298] Care of experimental animals was in accordance with
institutional guidelines. CD-1 mice (25-30 g, four mice were
imaged) were anesthetized with an isoflurane gas mixture. The
anesthetized animal was positioned and stabilized with
soft-supporting material (e.g. foam) in the scanner in the coil
cradle and was kept warm during the MRI scan. The mice were scanned
prior to the administration of any contrast agent (pre-contrast).
Approximately 50 .mu.l of Gd-CA1.CD2 (.about.1.2 mM) or Gd-DTPA
(.about.300 mM) were injected into the animal via the tail vein. MR
images were collected at different times (indicated). For T.sub.1
weighted imaging at 3T, spin echo sequence with TE/TR=15 ms/500 ms
was employed. Rectangular Field of View (FOV) at 100/40 mm, an
acquisition matrix of 196.sup.2 and 1.1 mm slice thickness without
gap were used. Images were collected from both transverse and
coronal sections. The in-plane resolution of images was less than
0.5 mm after they were reconstructed to the matrix of 196.sup.2.
For T.sub.2 weighted imaging at 9.4T, MR images were recorded using
a multi-echo Carr-Purcell-Meiboom-Gill (CPMG) sequence. The data
were collected and processed by Dicomworks software. The MR signal
intensity in several organs was ascertained by the average
intensity in ROIs or points within the organs. Signal intensity for
each organ was normalized to that of the leg muscle.
2.9 Blood Circulation Time, Tissue Retention Time, and
Bio-Distribution.
[0299] CD-1 mice (25-30 g) were anesthetized with isoflurane.
Appropriate dosages of Gd-CA1.CD2 and its PEgylated variants (with
Gd and .sup.153Gd) or Gd-DTPA were i.v. injected (via tail vein).
Blood (.about.50 .mu.l) samples were collected via orbital sinus of
the mouse at different time points. The mouse was euthanized at the
final time point. Tissue samples from kidney, liver, heart, and
lung were collected. Serum samples were prepared from the collected
blood. For the bio-distribution analyses, the animals were
euthanized at single time point (indicated) after i.v.
administration of the contrast agent (indicated). The organ/tissue
samples were collected. Tissue extracts were freshly made from
collected samples using commercially available tissue extracting
kits (Qiagen). CA1.CD2 and its variants were detected and
quantified by immunoblotting and Sandwich-ELISA using a monoclonal
antibody (OX45, detecting antibody) and a home made polyclonal
antibody (PabCD2, capture antibody). A series of known amounts of
CA1.CD2 samples mixed with blank mouse serum or tissue extracts
were used as standard in Sandwich-ELISA. ELISA signal from HRP was
monitored using a Fluorstar fluorescence microplate reader. For
quantification of Gd.sup.3+ in the serum and tissue samples one
hour (or indicated times) after the contrast agent administration,
animals were sacrificed and critical organs were collected, and the
tissues were then digested with concentrated nitric acid at
120-130.degree. C. with proper amount of .sup.153Gd spike as an
internal marker. The digested solution was analyzed.
2.10 Immunogenicity
[0300] Rabbits were i.p. injected with Gd-CA1.CD2 and its pegylated
variants. The agents (CA1.CD2) were mixed with adjuvant or with
buffer saline and injected at a dose of 3.0 nmole/kg according to
the standard protocol for the antibody production. The rabbits were
subjected to double immunolizations in four weeks interval. Blood
samples were taken from the immunolized rabbits 3 weeks after each
injection. Production of antibodies against the protein contrast
agent in each rabbit was examined by ELISA
2.11 Toxicity Analyses.
[0301] The MR imaged CD-1 mice that received the i.v. administered
Gd-CA1.CD2 and its variants (at a dose of .about.2.4 .mu.mol/kg)
spiked with .sup.157Gd.sup.3+ were returned to their cages (one
mouse per cage). The mice were observed for five days and were
euthanized at the end of the fifth day. Tissue samples from kidney,
liver, spleen, and lung were collected. Gd.sup.3+ contents in the
tissue samples were analyzed by radioactivity counter.
[0302] Two groups of mice were used to examine potential renal
and/or liver damage by Gd-CA1.CD2. One group of mice received (i.v.
tail veil) 50 .mu.l of saline-buffer (as control). Another group
received (i.v. tail veil) Gd-CA1.CD2 and variants at 4 .mu.mole/kg.
The mice were observed for 48 hours and were euthanized. Blood
samples were collected from the experimental mice. Serum samples
were prepared from the collected blood. Liver enzymes in serum
samples, including Alanine transaminase (ALT), Alkaline phosphatase
(ALP), Aspartate transaminase (AST), Gamma glutamyl transpeptidase
(GGT), and bilirubin and urea nitrogen were analyzed by a
commercially available source (MU Research Animal Diagnostic
Laboratory). All clinical chemistry parameters were measured on an
Olympus AU 400 analyzer.
[0303] Cytotoxicity was analyzed by MTT assay of the cells that
were treated with Gd-CA1.CD2 and its variants at appropriate doses
(indicated in figure). The cells were grown under normal growth
medium in 96 well plates. Gd-CA1.CD2 or saline-phosphate buffer was
added to the cell culture medium. The cells were incubated for
appropriate times. A standard MTT assay was employed to assess the
cell growth status of the treated cells.
2.12 Serum Stability.
[0304] CA1.CD2 (40 .mu.M) in complex with Gd.sup.3+ was incubated
with 75% human serum over 3 or 6 hours at 37.degree. C. The
degradation of the protein (disappearance of 12 kDa protein band)
was analyzed by SDS-PAGE and visualized by coomassie blue staining
for protein and idiol staining for PEG moiety. In parallel, the
degradation of the protein was also analyzed by immunoblot using
antibodies OX54 or PabCD2. The identities of CA1.CD2 and pegylated
variants were verified by immunobloting using antibody PabCD2 and
idiol staining.
3. Results
3.1 PEGylation Modifications of Designed Protein Contrast Agent
CA1.CD2
[0305] We previously reported the development of a novel class of
protein-based MRI contrast agents. The contrast agents exhibit a 20
fold increase in R1 and R2 relaxivities and provide a strong
contrast enhancement in the mouse MR imaging (Yang, et. al. JACS
2008). The developed MRI contrast agent also demonstrated a
prolonged blood circulation time, which is considered for the
application of the agents in disease targeted molecular imaging. In
the processes of preparing the protein contrast agent for animal MR
imaging, we realized that it is desirable to have a higher protein
concentration up to 30-50 mM based on the in vivo application dose
of DTPA (300-500 mM) per 100 ul injection. However, the solubility
of the current formulation of our protein contrast CA1.CD2 is
.about.0.7 mM.
[0306] As shown in FIG. 2.1, the designed contrast agent CA1.CD2
has eight Lys residues with different solvent accessibility and six
Lys residues are well exposed. Based on the considerations of
solubility, circulation, relaxivity and serum stability, we
therefore carried out PEGylation of our protein contrast agents by
modifying surface Lys residues and site specific pegylation. First,
preactivated PEG units with varied chain length and branches of 4,
12 (Poly-PEG.sub.12), 40 (PolyPEG.sub.40k), 5K, and 12 K (see FIG.
2.1b) were used to modify surface lys residues. Site-specific
pegylation was performed at both N-terminal Lys and C-terminal
Cys.
[0307] To identify optimal conditions for pegylation, PeG reactions
were performed at different reaction time, pH 6, 7 and 9, and
reaction ratio. FIGS. 2.2-2.4 shows the SDS gel of the protein
contrast agent CA1.CD2 pegylated with PEGylation kits with
different reaction moieties stained by both commassie blue for
protein and idiol for the PEG moiety.
[0308] FIG. 2.2 shows that the PEGylated proteins were separated
using ion exchange column, size exchange column, and a C.sub.18
reverse phase HPLC chromatography column. The modified proteins
were purified by HPLC to relative homogeneity. FIG. 2.2 shows that
there were several major peaks of the PEGylated proteins on the
FPLC chromatography. MALD-Mass analyses of the separated protein
fraction reveal that at pH 7.4 with 5:1 pEG:protein:preactivated
pEG reagents, CA1.CD2 was pegylated mainly with 2, 3 with P4-P40
and 1 PEG unit with PEG 12 K to 20K.
3.2 Determination of PeGylation Numbers
[0309] With the addition of N-terminal NH.sub.2 groups, the CA1.CD2
has total of seven potential PEGylation sites. The PEGylation sites
of the purified protein were examined first by trypsin cleavage to
generate the peptides/fragments and then sequenced by TOF/TOF MS.
Usually 2-4 PEG units were attached to each protein depending on
the ratio of PEG:protein under reaction and the reaction
conditions.
3.3 Conformation and Metal Binding Capabilities
[0310] FIG. 2.4a of Trp fluorescence spectra shows that these
PEGylated proteins (CA1.CD2-PEG12 and CA1.CD2-PEG40) maintain the
native structure of the protein contrast agents with unchanged Trp
emission maximum compared with CA1.CD2.
[0311] All of the designed Gd.sup.3+ binding proteins were
expressed in E. coli and subsequently purified by procedures
previously published from our laboratory..sup.30,31 All of the
designed proteins form the expected metal:protein complex as
demonstrated by ESI-Mass spectrometry.
[0312] Tb-FRET was first used to monitor the effect of pegylation
on the metal binding capabilities. As shown in FIG. 2.4b, the
pegylated A1.CD2 is able to have Tb-sensitized energy transfer
similar to that of CA1.CD2. FIG. 2.5 shows that PEGylated
CA1.CD2-P40 remains intact after incubate with human serum for 24
hours at 37.degree. C. monitored by SDS Page.
[0313] Gd.sup.3+-binding affinity of CA1.CD2 was further determined
by a competition titration with fluorescent dye applied as a
Gd.sup.3+ indicator in various chelate-metal buffer systems. The
PEGylated variants exhibit similar metal binding affinities to
unpegylated ones for Ca.sup.2+, Gd.sup.3+ and Zn.sup.2+.
3.4 The Effect of PEGylation on the Relaxivities of the Protein
Contrast Agent
[0314] We first measured the in vitro relaxivities of the PEGylated
protein contrast agent in MRI scanner such as at 0.47, 3.0, and
9.4T field strengths (FIG. 2.6). Very similar procedure used in our
previous studies in measuring the relaxivities of protein MRI
contrast agent {Yang, et. al., JACS 2008} was employed here to
measure the relaxivities of PEGylated CA1.CD2. It was clear that
the relaxivities (both R1 and R2) were increased compared to those
of the same protein contrast agent before PEGylation modification.
In addition, the MRI relaxivity increases with the increase of PEG
length as shown in FIG. 2.6.
[0315] Increasing the degree of PEGylation modification increased
the R1 and R2 relaxivities (FIG. 2.6). The R1 and R2 relaxivities
of the PEGylated protein were also affected by the size of the PEG
chains. The relaxivities of the PEGylated protein contrast agents
demonstrated higher increases when the protein was modified by a
longer PEG chain. Interestingly, both R1 and R2 relaxivities of the
PEGylated protein contrast agent experienced the most dramatic
increases at higher magnetic field. This is contrary to the case of
unPEGylated protein, in which dramatic decreases in R1 and R2
relaxivities were observed at high field (Yang et al., JACS, 2008).
FIG. 2.6 shows the MRI relaxivity as a function of chain
dependencies. Specific modification of the N-terminal amine and Cys
residues at the C-terminus have a similar effect on the relaxivity
of the protein.
[0316] Table 2.1 of Example 2 shows that the water numbers in the
coordination shell of CA1.CD2 increased from 2 to 3 upon PEGylation
with PEG40. This may contribute to the increased relaxivity by
PEGylation.
3.6 PEGylation Improved Blood Circulation Time
[0317] PEGylation has been demonstrated to increase blood
circulation time and reduce immunogenicity of a number of protein
drugs. While longer blood circulation time is a desired property
for the applications of MRI contrast agents. Elimination or
reduction of immunogenicity is essential for clinical applications
of the protein MRI contrast agents. We therefore examined whether
PEGylation of CA1.CD2 changed the bio-distribution and
immunogenicity properties of the agent. The PEGylated or
unPEGylated CA1.CD2 was introduced to CD-1 mice via i.v. tail vein
injection. Distributions of the administrated agent among different
organs/tissues and blood circulation were analyzed at different
time intervals by quantization of both the protein CA1.CD2 using
immunochemical assays and the metal Gd.sup.3+ using
.gamma.-radiation counting the radio-isotope .sup.157Gd.sup.3+. It
was clear from analyses of both protein CA1.CD2 and Gd.sup.3+ in
multiple organ sites and blood that the PEGylation changed the
bio-distribution of the protein contrast agent. First, PEGylation
increased the blood circulation time of the agent. Before
PEGylation modifications, a sharp decrease in blood concentration
of both Gd.sup.3+ and CA1.CD2 was observed at about 50 minutes post
i.v. injection. In contrast, no significant decrease was observed
with PEGylated proteins 6 hour post injection. The longer
circulation time was observed with the protein with higher degree
of PEGylation modifications. Serum stability was further examined
by measuring the protein content incubating with serum. Gegylated
proteins remain stable after 48 hours.
3.7 PEGylation Reduced Immunogenicity
[0318] Immunogenicity is one of the main concerns on the
application of our developed protein MRI contrast agent. We
therefore carried out experiments to test immunogenicity in rabbits
by i.p. injection. The agents (CA1.CD2) were mixed with adjuvant or
with buffer saline and injected at a dose of 3.0 nmole/kg according
to the standard protocol for antibody production. The rabbits were
subjected to double immunolizations in four weeks interval. Blood
samples were taken from the immunolized rabbits 3 weeks after each
injection. Production of antibodies against the protein contrast
agent in each rabbit was examined by ELISA (FIG. 2.7 Left) and
Immunobloting (FIG. 2.7 Right) using our previous polyclonal
antibody PabCD2 as positive control and the pre-bleed from each
rabbit as negative controls. It was clear that without adjuvant,
injection of CA1.CD2 alone did not lead to antibody production in
rabbits even after a double dose immunization. Addition of adjuvant
indeed resulted in immuno-responses. PEGylation modifications of
protein dramatically reduced immuno-responses. There was almost no
antibody production in the first immunization. The production of
antibody was negligible three weeks after the second immunization.
Our results suggest that the immunogenicity of the protein contrast
agent may not be very strong, especially without addition of
adjuvant. Modification of the protein by PEGylation substantially
reduced the immune responses.
[0319] FIG. 2.7 shows that PEGylation with P40 completely
eliminates the binding of CA1.CD2 by antibody OX55 and decreases by
50% binding of OX34 in Western Blot. Since the epitope binding
sites of OX55 and OX34 are well known, we have shown that K66, K45,
K44, and K47 exhibit a high probability for the specific PEGylation
by PEG12. These results confirm that antibody recognition sites can
be eliminated by PEGylation, which is essential for the reduction
of immunogenicity.
[0320] References for Example 2, each of which is incorporated
herein by reference [0321] 1. Gaberc-Porekar V, Zore I, Podobnik B,
Menart V. Obstacles and pitfalls in the PEGylation of therapeutic
proteins. Curr Opin Drug Discov Devel. 2008 March; 11(2):242-50.
[0322] 2. Fishburn C S. The pharmacology of PEGylation: Balancing
PD with PK to generate novel therapeutics. J Pharm Sci. 2008 Jan.
15; [0323] 3. Veronese F M, Pasut G. PEGylation, successful
approach to drug delivery. Drug Discov Today. 2005 Nov. 1;
10(21):1451-8. Review. [0324] 4. Harris J M, Chess R B. Effect of
pegylation on pharmaceuticals. Nat Rev Drug Discov. 2003 March;
2(3):214-21. Review. [0325] 5 Yang, W., Wilkins, A. L., Li, S., Ye,
Y., and Yang, J. J. (2005) The effects of Ca2+ binding on the
dynamic properties of a designed Ca2+-binding protein. Biochemistry
44, 8267-73. [0326] 6 Adair, F., and Ozanne, D. (2002) The
immunogenicity of therapeutic proteins. Biopharm--the Applied
Technologies of Biopharmaceutical Development 15, 30-+. [0327] 7
Leyland-Jones, B., Arnold, A., Gelmon, K., Verma, S., Ayoub, J. P.,
Seidman, A., Dias, R., Howell, J., and Rakhit, A. (2001)
Pharmacologic insights into the future of trastuzumab. Ann Oncol 12
Suppl 1, S43-7. [0328] 8 Hermeling, S., Crommelin, D. J.,
Schellekens, H., and Jiskoot, W. (2004) Structure-immunogenicity
relationships of therapeutic proteins. Pharm Res 21, 897-903.
[0329] 9 Lucas, A., and McFadden, G. (2004) Secreted
immunomodulatory viral proteins as novel biotherapeutics. J Immunol
173, 4765-74. [0330] 10 Schellekens, H. (2002) Immunogenicity of
therapeutic proteins: clinical implications and future prospects.
Clin Ther 24, 1720-40; discussion 1719. [0331] 10 Schellekens, H.
(2002) Bioequivalence and the immunogenicity of biopharmaceuticals.
Nat Rev Drug Discov 1, 457-62. [0332] 11 Federico, R., Cona, A.,
Caliceti, P., and Veronese, F. M. (2006) Histaminase PEGylation:
Preparation and characterization of a new bioconjugate for
therapeutic application. J Control Release 115, 168-174. [0333] 12
Veronese, F. M., and Pasut, G. (2005) PEGylation, successful
approach to drug delivery. Drug Discov Today 10, 1451-8. [0334] 13
Bhadra, D., Bhadra, S., Jain, P., and Jain, N. K. (2002) Pegnology:
a review of PEG-ylated systems. Pharmazie 57, 5-29. [0335] 14
Bailon, P., Palleroni, A., Schaffer, C. A., Spence, C. L., Fung, W.
J., Porter, J. E., Ehrlich, G. K., Pan, W., Xu, Z. X., Modi, M. W.,
Farid, A., Berthold, W., and Graves, M. (2001) Rational design of a
potent, long-lasting form of interferon: a 40 kDa branched
polyethylene glycol-conjugated interferon alpha-2a for the
treatment of hepatitis C. Bioconjug Chem 12, 195-202. [0336] 15
Basu, A., Yang, K., Wang, M., Liu, S., Chintala, R., Palm, T.,
Zhao, H., Peng, P., Wu, D., Zhang, Z., Hua, J., Hsieh, M. C., Zhou,
J., Petti, G., Li, X., Janjua, A., Mendez, M., Liu, J., Longley,
C., Zhang, Z., Mehlig, M., Borowski, V., Viswanathan, M., and
Filpula, D. (2006) Structure-function engineering of
interferon-beta-1b for improving stability, solubility, potency,
immunogenicity, and pharmacokinetic properties by site-selective
mono-PEGylation. Bioconjug Chem 17, 618-30. [0337] 16 Kozlowski,
A., Charles, S. A., and Harris, J. M. (2001) Development of
pegylated interferons for the treatment of chronic hepatitis C.
BioDrugs 15, 419-29. [0338] 17 Kozlowski, A., and Harris, J. M.
(2001) Improvements in protein PEGylation: pegylated interferons
for treatment of hepatitis C. J Control Release 72, 217-24. [0339]
18 Yang, Z., Wang, J., Lu, Q., Xu, J., Kobayashi, Y., Takakura, T.,
Takimoto, A., Yoshioka, T., Lian, C., Chen, C., Zhang, D., Zhang,
Y., Li, S., Sun, X., Tan, Y., Yagi, S., Frenkel, E. P., and
Hoffman, R. M. (2004) PEGylation confers greatly extended half-life
and attenuated immunogenicity to recombinant methioninase in
primates. Cancer Res 64, 6673-8. [0340] 19 Nie, Y., Zhang, X.,
Wang, X., and Chen, J. (2006) Preparation and stability of
N-terminal mono-PEGylated recombinant human endostatin. Bioconjug
Chem 17, 995-9. [0341] 20 Daugherty, A. L., and Mrsny, R. J. (2006)
Formulation and delivery issues for monoclonal antibody
therapeutics. Adv Drug Deliv Rev 58, 686-706. [0342] 21 Mohs, A.
M., Zong, Y., Guo, J., Parker, D. L., and Lu, Z. R. (2005)
PEG-g-poly(GdDTPA-co-L-cystine): effect of PEG chain length on in
vivo contrast enhancement in MRI. Biomacromolecules 6, 2305-11.
[0343] 22 Luciani, A., Olivier, J. C., Clement, O., Siauve, N.,
Brillet, P. Y., Bessoud, B., Gazeau, F., Uchegbu, I. F., Kahn, E.,
Frija, G., and Cuenod, C. A. (2004) Glucose-receptor MR imaging of
tumors: study in mice with PEGylated paramagnetic niosomes.
Radiology 231, 135-42.23 Yang J J, Yang J, Wei L, Zurkiya O, Yang
W, Li S, Zou J, Zhou Y, Maniccia A L, Mao H, Zhao F, Malchow R,
Zhao S, Johnson J, Hu X, Krogstad E, Liu Z R. Rational design of
protein-based MRI contrast agents. J Am Chem Soc, 2008. 130(29): p.
9260-7.
Example 3
Developing Protein-Based MRI Contrast Agents with Multiple
Metal-Binding Sites by Engineering of Natural Calcium Binding
Proteins
[0344] Natural calcium binding proteins with continuous calcium
binding sites such as calmodulin, calbindin D9K, troponin C,
parvalbumin and discontinuous calcium binding sites such as
thermintase subtilisin have exhibited high metal binding affinity
for calcium as shown in Table 3.1 (shown in FIG. 3.10). Most of
these calcium binding proteins have multiple calcium binding sites
and their protein stabilities against temperature and proteolysis
were significantly increased. For example, calcium binding to
calmodulin has increased its stability to higher than 100.degree.
C. While a great deal of research has shown that the calcium
binding affinity of naturally evolved proteins can be reduced by
site-directed mutagenesis, methods to increase calcium binding
affinity have rarely been reported. In addition, while lanthanide
ions were shown to have coordination chemistry properties similar
to calcium and often were able to compete with calcium for the
metal binding sites, the accurate measurement of lanthanide metal
binding affinities was not reported due to the limitation of
extremely high metal binding affinity. Traditional titration
methods by direct addition of metal ions monitoring lanthanide
emission or Tb-sensitized energy transfer only provide low
estimation of the metal binding sites. Furthermore, calcium ions in
the strong metal binding sites of proteins are often difficult to
remove and require careful treatment.
[0345] In this study, we report the engineering of protein based
contrast agents by modifying calcium binding pockets of natural
calcium binding proteins using calmodulin (CBP1) (FIG. 3.1) and
parvalbumin (CBPP) as examples. These engineered proteins exhibit
strong metal binding affinity to Gd.sup.3+ and other lanthanide
(FIG. 3.2). Both proteins have strong Gd.sup.3+ binding affinity
dissociation constants (K.sub.d, M) of 1.0.times.10.sup.-15 to
1.0.times.10.sup.-18M. In addition, their selectivity over calcium
and other metal ions such as zinc and magnesium is more than
10.sup.5 fold higher, which is similar to that of clinically
approved contrast agents such as DTPA or DTPA-BMA. CBPP and its
variants exhibit strong metal selectivity for Ln3+ over calcium,
magnesium, zinc and copper (FIG. 3.2c). Furthermore, the water
numbers in the coordination site can be estimated by Tb-sensitized
energy transfer in water and in D.sub.2O. These data suggest that
more than one water molecules are in the coordination shells and
protein surface, and this likely contributes to their extremely
high relaxivity. FIG. 3.8 shows that calmodulin and its variants
can be pegylated with peg units of 4, 12, 40, 5K, 12K, 20 K and
reaction products can be well separated by size-exclusion and ion
exchange columns (FIG. 3.3 and FIG. 3.4).
[0346] Furthermore, functional sites of these engineered proteins,
such as binding to the target molecules by calmodulin and
parvalbumin, were eliminated by both deleting the molecular
recognition sites and creating submodulin without completed
recognition sites. Moreover, pegylation of these engineered
proteins further reduced the natural function of CBP with increased
solubility and reduced immunogenicity.
[0347] The conformation and metal binding properties of PEGylated
proteins were not changed as revealed by Tyr emission spectra and
Tb.sup.3+ sensitized energy transfer and CD methods (FIG. 3.5).
FIG. 3.6 shows that both BCBP1 and CBBP1 and their variants have
strong serum stability revealed by SDS page. These proteins remain
intact upon incubation with serum greater than 48 hours.
[0348] These engineered proteins exhibit extremely high r.sub.1 and
r.sub.2 relaxivities that are about 20 fold higher than DTPA. More
strikingly, a clear in vivo mice imaging shown in FIG. 3.7 and FIG.
3.9 can be achieved using one dose tail vein injection with 6 mM of
engineered protein contrast agent, CBP1 and its pegylated variant
CBP1-P40. This dosage is about 70 fold lower than that of DTPA,
with relaxivity values at 20-40 mM.sup.-1s.sup.-1 at 0.47 T. These
values are comparable to CA1.CD2 and 5-8 fold greater than that of
DTPA (FIG. 3.8). Example 3, FIG. 3.9 (left) illustrates mice MRI
images at slice 3 (top) and slice 4 (bottom) at 4.7T with tail vein
injection of 6 mM CBP1-P40 at 0, and 13 mins post injection.
Relative MRI intensity at different organs is shown on right.
[0349] Based on the fact that the blood circulation and
biodistribution can be further optimized and the existence of ample
natural calcium binding proteins with multiple sites and different
molecular weights/sizes, in addition to their superior capability
for targeting our reported approach opens a new way to engineer MRI
contrast agents with significantly improved relaxivity and in vivo
properties for both blood pool and molecular imaging.
Example 4
Developing PEGylated Protein Contrast Agents Capable of Target
Cancer Tumor Biomarkers Both in Cells and in Mice
[0350] Embodiment of the PEGyation method of the present disclosure
was applied to enhance the performance of developed contrast agents
in imaging cancer biomarker.
[0351] Example 4 describes a novel protein-based MRI contrast agent
for molecular targeting cancer marker HER2 has been developed by
modification with pegylation. The MRI contrast agent also carries a
near-IR dye Cy5.5 for dual modality imaging of HER2 in cancer
(Section 4.1).
[0352] In addition, Example 4 describes the development of a
contrast agent that demonstrates specific interaction with HER2
positive cancer cells but not HER2 negative cells (4.2). The in
vitro MR imaging experiments with different cells that express
different levels of HER2 have shown a close correlation between MRI
contrast enhancements and HER2 levels (Section 4.3).
[0353] Furthermore, Example 4 describes that the MR imaging of
xenograft models of human HER2 positive cell line SKOV3 and HER2
negative cell line MDA-MB-231 has indicated a HER2 level-dependent
MRI contrast enhancement. This image intensity enhancement is
further confirmed by NIR imaging (Section 4.4).
[0354] In addition, Example 4 describes immunohistochemical
staining of tissue samples (including tumor tissue) collected after
imaging analyses has shown that the designed contrast agent
penetrated deep into the tumor mass (i.e., distant from tumor
vasculature), demonstrating a good tissue penetration of the MRI
contrast agent. Differential targeting of the MRI contrast agent to
HER2 positive and to HER2 negative tumors was further verified by
immunoblot and ELISA analyses of the tissue samples collected from
imaging mice (Section 4.5).
4.1 Design of HER2 Targeting MRI Contrast Agent
[0355] To apply this MRI contrast agent in targeted molecular MR
imaging, we fused a high affinity 58 amino acid HER2 affibody at
the C-terminal of the protein via a flexible linker GGSGG. We also
introduced a photo-probe by conjugating a near-IR dye Cy5.5 to a
Cys residue added to the C-terminal of the protein (FIG. 4.1). The
designed dual probe protein was expressed in E. coli and
subsequently purified by procedures described in our previous
report {{Yang, et. al., JACS 2008}, which is incorporated herein by
reference}.
[0356] PEGylation of the designed Gd-binding protein not only
increases protein solubility and blood circulation time, but also
decreases immunogenicity of the protein without decrease of MRI
relaxivity of the protein contrast agent. Therefore the designed
HER2 targeting protein contrast agent was PEGylated using PEG-40, a
PEG molecule with triple-branched 12 units PEG. The resulting agent
(PEG-CA1-Affi) exhibits very similar Gd.sup.3+ binding properties
and its T1 and T2 relaxivity values are similar to its parent
protein CA1.CD2. Modifications did not change the overall protein
fold as demonstrated by circular dichroism and fluorescence
spectra.
4.2 The HER2 Targeting MRI Contrast Agent Targeted to HER2 Positive
Cells but not HER2 Negative Cells
[0357] We first examined whether the designed CA1.HER2/Affi can
target cancer cells by cell binding analyses. We used two cancer
cell lines for the binding analyses. AU565 is derived from breast
carcinoma. EMT6 is a mouse mammary tumor cell line. AU565 cells
express very high levels of HER2. The EMT is regarded as a HER2
negative cell line. Binding of the Gd-CA1.HER2/Affi to the cancer
cells was first analyzed by immuno-fluorescence staining using a
polyclonal antibody against PEGylated parental protein CA1.CD2
(PAbPGCA1). A substantial increase in staining intensities of
CA1-Affi bound to AU565 cells was observed at both 37 and 4.degree.
C. The protein did not bind to EMT6 cells. As a control, CA1.CD2
without HER2 affibody did not bind to either of the tested cultured
cells (FIG. 4.2). Proteins binding to cell surface HER2 with a
clear membrane staining pattern in AU565 cells was observed at
4.degree. C. The binding of the proteins to the cells triggered
receptor-mediated endocytosis at 37.degree. C. as demonstrated by
the staining of the protein inside the cells. In addition,
PEGylation of the targeted contrast agent PEG-CA1-Affi does not
change its target capability the positive cell as shown in FIG. 4.2
at both 4 and 37.degree. C. Further labeling with NIR dye Cy5.5,
the binding of the contrast agent (PEG-CA1-Affi-Cy5.5) to both
AU565 and SKOV-3, a cell line derived from ovarian cancer with very
high HER2 expression, is readily detected by our fluorescence
microscope.
[0358] Binding of the Gd-CA1-Affi to the cancer cells was further
analyzed by quantification of cell bound Gd.sup.3+ with AU565 and
EMT6 cells. The amounts of Gd.sup.3+ were quantified by
.gamma.-counting the trace of isotope .sup.153Gd.sup.3+ in the
Gd-protein complexes. The quantification of cell bound Gd.sup.3+
supported our immuno-analyses that Gd-CA1-Affi exhibited targeted
binding to AU565 cells but not to EMT6 cells (FIG. 4.3). The
protein without the HER2 affibody targeting moiety could not bind
to the cells that express HER2. Interestingly, calculating the
amounts of bound Gd.sup.3+ from .gamma.-counting revealed that the
Gd.sup.3+ ions were bound to cells at .about.0.2 fmole Gd/cell.
Based on the assumption that 1.times.10.sup.7 cells occupy a volume
of 50-100 .mu.l, this binding capacity leads to the accumulation of
Gd.sup.3+ at 5-15 .mu.M in the cell pellets. This local
concentration is sufficient to produce strong MRI contrast,
especially with high relaxivity protein-based contrast agent.
Further, the level of HER expression can be monitored by ELISA
(FIG. 4.3).
4.3 MRI Imaging of Different Cancer Cells by the Developed HER2
Targeting Contrast Agents.
[0359] Experiments demonstrated that the developed MRI contrast
agent binds specifically to HER2 expression cells. To test whether
our designed proteins are applicable for targeted imaging, we
carried out MR imaging of cancer cells that were incubated with the
designed protein contrast agents Gd-CA1-Affi using four different
cancer cell lines with different expression levels of HER2. Cancer
cells AU565 and SKOV3, with high numbers of HER2, exhibit a
brighter imaging in the presence of our contrast agent
Gd-CA1.HER2-Affi. In contrast, no significant changes in MR image
were observed in the imaging pellets of AU565 and SKOV3 cells that
were incubated with Gd-CA1.CD2, without the HER2 targeting moiety.
The MR imaging of MDA-MB-231, another breast cancer cell line with
limited HER2 expression, demonstrated slight contrast enhancement.
Almost no contrast enhancement was observed with MR imaging of EMT6
cells using our HER2 targeting contrast agent. Quantification of
the MR image intensity revealed a strong correlation between MR
imaging intensity and the HER2 levels among the different cell
lines used. These results confirm that the addition of HER2
targeting affibody to our protein contrast agent has the potential
to provide molecular imaging of cancer cells via receptor-mediated
recognition. The MR image contrast enhancements from the contrast
agent can be correlated to the HER2 levels.
4.4 The HER2 Targeting Contrast Agent Provided Strong MR Image
Contrast Enhancement in Nude Mice Xenograft Model
[0360] We next tested whether our designed contrast agent would
produce MR imaging contrast enhancement in nude mice xenograft
models of two human cancer cell lines, SKOV3 and MDA-MB-231. Since
AU565 did not grow tumors in nude mice, we used SKOV3 and
MDA-MB-231 cell lines. The HER2 positive SKOV3 and negative
MDA-MB-231 tumors were implanted on the right and left flanks,
respectively, of different mice (FIG. 4.5). The contrast agent
Gd-CA1.HER2/Affi (60 .mu.l) was introduced via the tail vein at
concentration of 6 mM. Pre- and post-contrast MRIs were collected
at different time points using T1 weighted spin echo or gradient
echo sequences. At an early time point (40 minutes), little
contrast enhancement was observed with either HER2 positive or
negative tumors. The contrast enhancements with both positive and
negative tumors were apparent at 4 hours post-contrast agent
injection. However, after 21 hours post-contrast, the image
enhancements of the negative tumor decreased dramatically, while
conversely there were no significant decreases in the MRI
intensities in the positive tumor. In parallel, the mice were
imaged using a Kodak in vivo FX-pro animal imaging system.
Consistent with MRI imaging, we observed strong NIR light emission
from both positive and negative tumor sites at early time points
(50 minutes post-injection). After 24 hours post-contrast, the NIR
intensities at the negative tumor site were almost identical with
the background, while the light intensities at the positive tumor
experienced only a minor decrease (FIG. 4.5). The in vivo imaging
experiments were repeated with four tumor-bearing mice (four
positive tumor mice and four negative tumor mice) with similar
results. FIG. 4.4, shows the result of another mouse. 5 mM of
contrast agent CA1.Affi-P40 (100 fold lower than clinic used DTPA)
was injected via tail vein. MRI images at 4.7 T using fast spin
echo were acquired before injection, 5 min, 30 min, 3 hr, 24 hr and
52 hr post injection. Positive tumor shows a strong contrast after
30 mins and peaked at 24 hour with about 35% enhancement. Contrast
capability was decreased after 52 hours, suggesting that the
contrast agent was secreted of out the animal. This mouse was alive
and looks normal after 52 hours MRI scanning.
4.5 IHC Analyses and NIR Imaging Indicate Molecular Targeting
Rather than Vascular Retention
[0361] To further analyze the HER2 targeting properties of the
protein contrast agent, tumors and organs from the imaged mice were
collected after imaging at 45 minutes or 24 hours. The organs and
tumors were imaged under the Kodak in vivo FX-pro animal imaging
system. It was clear that there were very high levels of
accumulation of Cy5.5 at the liver and HER2 positive tumor, with
moderate levels of the NIR dye present in the kidney and spleen.
NIR fluorescence intensities in the lung and heart were very weak.
The IHC analyses are consistent with our biodistribution analyses
of the contrast agent in CD1 mouse. The levels of Cy5.5 at the
negative tumor were also very weak (FIG. 4.6). There was almost no
detectable NIR fluorescence in the muscles.
[0362] Targeting of the protein contrast agent to HER2 positive
tumor was further analyzed by immunoblot. To this end, protein
extracts were made from the tissue samples that were collected from
the imaged mice. Immunoblot experiments were performed with the
protein extracts using the antibody PAbPGCA1. Consistently, we
detected very high levels of PEGylated protein contrast agent in
extracts made from liver, kidney, and positive tumor. The antibody
detected very faint bands in the extracts made from muscle and
negative tumor samples (FIG. 4.6). The results strongly suggested
that our protein contrast agent led to a HER2 specific MR image
enhancement.
[0363] In addition, we carried out immunohistochemistry (IHC)
staining using the antibody PAbPGCA1 with tissue slides made from
the tissue samples from the imaged mice, including HER2 positive
and negative tumors. Strongest staining was observed with liver and
HER2 positive tumor tissue slides (FIG. 4.7). Close examination of
the staining patterns of the positive tumor slides revealed very
high CA1-Affi protein levels inside the cancer cells, indicating
internalization (endocytosis) of the protein contrast agent. The
results also suggested that the contrast agent penetrated the tumor
tissue, rather than being trapped in the tumor vasculature. This is
an important property for HER2 targeting in the whole cancer mass.
The kidney slides also gave strong immunostaining. Interestingly,
the areas near proximal tubes showed the strongest staining in the
slides made from the kidney (FIG. 4.7), indicating that the protein
contrast agent was ready to be filtered through the kidney. This is
consistent with observations that there were good levels of both
Gd.sup.3+ (by .gamma.-counting of Gd.sup.3+-153) and protein
CA1-Affi (by NIR fluorescence) in the urine of mice that were
injected with PEGylated Gd-CA1-Affi. Co-immunostaining the slides
made from HER2 positive tumor with the antibody PAbPGCA1 and the
antibody against CD31, an endothelial molecular marker,
demonstrated that the protein contrast agent largely localized in
tissue areas other than the tumor micro-vascular structure (CD31
positive areas). This staining pattern suggested that the designed
protein contrast had penetrated tissue rather than simply being
trapped in the blood in the micro-vasculature of the tumor
tissue.
4.6 HER2-Targeted Contrast Agent has been Generated by Engineering
Metal Binding Sites in Natural Calcium Binding Proteins
[0364] We have created the second generation contrast agent by
grafting affibody within the engineered multiple metal binding
protein CBP1 based on calmodulin (CBP1-affi). In addition
GRP/Bombesin sequence was also inserted into CBP1 to create a
contrast agent to specifically target to prostate cancer with GRPR
over expressed (CBP1-Bom). These targeted contrast agents were then
PEGylated by PEG with different units and purified. Initial binding
to HER2 has been studied. The HER2 positive cell line SKOV-3 and
HER2 negative cell line MDA-MB-231 was treated with CBP1-affi at
different concentration: 10 .mu.M and 20 .mu.M in 1 ml medium. Both
of the cell numbers is about 1.times.10.sup.5. One hour later, the
medium will be carefully washed for 3 times. The non-binding
proteins will be washed away. Then the cells will be lysized by
RIPA buffer for 30 min and centrifuged to obtain the cell lysate.
The cell lysate is used to run western blot to measure the binding
of CBP1-affi with HER2 positive cells. FIG. 4.8 shows that the
bands in SKOV-3 cells are much darker than those in MDA-MB-231
cells, which means the binding of CBP1-affi to HER2 is
specific.
[0365] The two cell lines been treated with CBP1-affi are fixed in
chamber by cold methanol for 5 min. Then primary antibody against
CBP1-affi and secondary antibody will be applied consequently.
Finally, the slides will be mounted by anti fade reagent with DAPI
staining. The second day, images will be taken under microscope.
The green color indicates FITC staining on CBP1-affi; the blue
color indicates the nuclear staining. FIG. 4.9 shows the HER2
positive cell line SKOV-3 has been stained. The staining on the
negative cell line is rarely.
4.7 GRP Receptor Targeted Contrast Agents Have been Created for
Both NIR Fluorescence and MRI to Image Prostate Cancer Both in
Cells and in Mice
[0366] We have also created targeted contrast agents to against
biomarker GRPR that are over-expressed in prostate, colon, breast,
and pancreatic cancers by grafting Bom/GRP sequence into CA1.CD2
(CA1.CD2-52I-Bom. This protein was also pegylated by PEG40
(CA1.CD2-52I-Bom-P40). NIR dye such as Cy5.5 was also conjugated at
the C-terminal Cys (CA1.CD2-52I-Bom-P40-Cy5.5). FIG. 4.9 shows the
uptake and internalization of CA1.Bom (CA1.CD2-52I-Bom)
specifically to GRPR positive cell lines (PC-3 and DU-145 cells) by
using confocal fluorescent microscope.
[0367] DU-145, PC-3 and H441 cells (8.times.10.sup.4) were seeded
in 4-well chambers (BD) at 37.degree. C. overnight. In the second
day, fresh medium was changed. Contrast agents were incubated with
cells at different time point at 37.degree. C. Subsequently, the
cells were washed with PBS for three times and fixed with 3%
formaldehyde for 15 minutes. After cells were rinsed in PBS for
three times, 0.2% Triton X-100 was added to permeablize cells for
10 minutes. The cells were washed and four drops of Image-IT Fx
signal enhancer (Invitrogen, CA) was applied in each sample to
block unspecific binding. After three time washes, CD2 antibody was
used as primary antibody. Goat anti-mouse IgG conjugated with Alexa
Fluor 488 was used as detection antibody (Invitrogen, CA). The
fluorescence image was acquired using 488 nm and UV lasers.
[0368] FIG. 4.11 shows NIR-fluorescence imaging of nude mice
xenografted with DU-145 tumor (positive control left) and H441
tumor (control, right) post injection of CA1.CD2-52Ibom-cy5.5-P40
26 hours via tail vein. 50 uM Cy5-CA1.CD2-52I was injected into
mouse tail vein. After 26 hours, mouse was analyzed by Kodak
Imaging System. Tissue organs were taken out and analyzed. Tumor
intensity was analyzed by Image J. FIG. 4.12 shows NIR imaging
(top) and NIR intensity (bottom) of CA1.CD2-52I-Bom-Cy5.5-P40 at
different organs of the mice. The developed contrast agent is able
to target to the GRPR expressed tumor monitored by NIR
fluorescence.
[0369] It should be noted that ratios, concentrations, amounts, and
other numerical data may be expressed herein in a range format. It
is to be understood that such a range format is used for
convenience and brevity, and thus, should be interpreted in a
flexible manner to include not only the numerical values explicitly
recited as the limits of the range, but also to include all the
individual numerical values or sub-ranges encompassed within that
range as if each numerical value and sub-range is explicitly
recited. To illustrate, a concentration range of "about 0.1% to 5%"
should be interpreted to include not only the explicitly recited
concentration of about 0.1 wt % to about 5 wt %, but also include
individual concentrations (e.g., 1%, 2%, 3%, and 4%) and the
sub-ranges (e.g., 0.5%, 1.1%, 2.2%, 3.3%, and 4.4%) within the
indicated range. The term "about" can include .+-.1%, .+-.2%,
.+-.3%, .+-.4%, .+-.5%, .+-.6%, .+-.7%, .+-.8%, .+-.9%, or .+-.10%,
or more of the numerical value(s) being modified. In addition, the
phrase "about `x` to `y`" includes "about `x` to about `y`".
[0370] The above discussion is meant to be illustrative of the
principles and various embodiments of the present disclosure.
Numerous variations and modifications will become apparent to those
skilled in the art once the above disclosure is fully appreciated.
It is intended that the following claims be interpreted to embrace
all such variations and modifications.
Sequence Listings:
[0371] Listed sequences are representative examples from protein
families where sequences of the same protein across different
species typically share 50-98% sequence homology. As an embodiment,
attributes in the cited sequence can be inferred to apply to
homologous, related sequences, which would be known to someone
familiar with the art.
K Possible PEGylated sites X Mutation sites, C is added at the
C-terminal for specific pegylation or conjugating to fluorescence
dye. Specific pegylation can also be at N-terminal These sequences
include for different species. A SEQ ID No: ("#") is noted by each
sequence below.
Rat Calmodulin and its Variants (CBPO1 and Variants)
TABLE-US-00004 [0372] WT (wild type) (1)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN 60
D93A (2)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN 60
D129A (3)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN 60
D56A (4)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVAADGN 60
D20A (5)
ADQLTEEQIAEFKEAFSLFAKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN 60
Y99W (6)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN 60
T26W (7)
ADQLTEEQIAEFKEAFSLFDKDGDGWITTKELGTVMRSLGQNPTEAELQDMINEVDADGN 60
N60D-N97D (8)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGD 60
Deletion (9)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN 60
D-N60D-N97D (10)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGD 60 WT
GTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDIDGNGYISAAELRHVMTNLGEKLTDEE 120
D93A GTIDFPEFLTMMARKMKDTDSEEEIREAFRVFAIDGNGYISAAELRHVMTNLGEKLTDEE
120 D129A
GTIDFPEFETMMARKMKDTDSEEEIREAFRVFDIDGNGYISAAELRHVMTNLGEKLTDEE 120
D56A GTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDIDGNGYISAAELRHVMTNLGEKLTDEE
120 D20A
GTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDIDGNGYISAAELRHVMTNLGEKLTDEE 120
Y99W GTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDIDGNGWISAAELRHVMTNLGEKLTDEE
120 T26W
GTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDIDGNGYISAAELRHVMTNLGEKLTDEE 120
N60D-N97D
GTIDEPEFLTMMARKMKDTDSEEEIREAFRVFDKDGDGYISAAELRHVMTNLGEKLTDEE 120
Deletion
GTIDFPEFLTMMARK------EEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEE 115
D-N60D-N97D
GTIDFPEFLTMMARK------EEEIREAFRVFDKDGDGYISAAELRHVMTNLGEKLTDEE 115 WT
VDEMIREADIDGDGQVNYEEFVQMMTAK 148 D93A VDEMIREADIDGDGQVNYEEFVQMMTAK
148 D129A VDEMIREAAIDGDGQVNYEEFVQMMTAK 148 D56A
VDEMIREADIDGDGQVNYEEFVQMMTAK 148 D20A VDEMIREADIDGDGQVNYEEFVQMMTAK
148 Y99W VDEMIREADIDGDGQVNYEEFVQMMTAK 148 T26W
VDEMIREADIDGDGQVNYEEFVQMMTAK 148 N60D-N97D
VDEMIREADIDGDGQVNYEEFVQMMTAK 148 Deletion
VDEMIREADIDGDGQVNYEEFVQMMTAK 143 D-N60D-N97D
VDEMIREADIDGDGQVNYEEFVQMMTAK 143
Rat N-Calmodulin (N-Terminal Domain of Calmodulin and Variants)
TABLE-US-00005 [0373] N-CaM (11)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN 60
N-N6OD (12)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGD 60
N-CaM GTIDFPEFLTMMARK 75 N-N6OD GTIDFPEFLTMMARK 75
Rat C-Calmodulin (N-Terminal Domain of Calmodulin and Variants)
TABLE-US-00006 [0374] C-CaM (13)
MKDTDSEEEIREAFRVFDIDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQ 60
C-N97D (14)
MKDTDSEEEIREAFRVFDIDGDGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQ 60
C-CaM VNYEEFVQMMTAK 73 C-N97D VNYEEFVQMMTAK 73
Rat Calmodulin-Affibody (15)
TABLE-US-00007 [0375]
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQD
MINEVDADGDGTIDFPEFLTMMARKMKDTGGSGGVDNKFNKEMRNAYWEI
ALLPNLNNQQKRAFIRSLYDDPSQSANLLAEAKKLNDAQAPKGGSGGDSE
EEIREAFRVFDKDGDGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDG
DGQVNYEEFVQMMTAK
Rat CaM-Bombesin (16)
TABLE-US-00008 [0376]
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQD
MINEVDADGDGTIDFPEFLTMMARKMKDTGGNQWAVGHLMGGDSEEEIRE
AFRVFDKDGDGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN YEEFVQMMTAK
Calmodulin Different Species
TABLE-US-00009 [0377] Human (17)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADDL 60
Mouse (18)
ADQLTEEQIAEFKEAFSLFDKDGDNTITTKELGTVMRSLGQNPTEAELQDMINEVDAD-- 58 Rat
(19) ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD--
58 Rabbit (20)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD-- 58
Paramecium (21)
AEQLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD-- 58
Human PGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVEDKDGNGYISAAELRHVMTNLGEKLT
120 Mouse
-GNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLT 117
Rat -GNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLT
117 Rabbit
-GNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLT 117
Paramecium
-GNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLT 117
Human DEEVDEMIREADIDGDGQVNYEEFVQMMTAK 151 Mouse
DEEVDEMIREADIDGDGQVNYEEFVQMMTAK 148 Rat
DEEVDEMIREADIDGDGQVNYEEFVQMMTAK 148 Rabbit
DEEVDEMIREADIDGDGQVNYEEFVQMMTAK 148 Paramecium
DDEVDEMIREADIDGDGHINYEEFVRMMVSK 148
Rat CA1-CD2-Affibody
TABLE-US-00010 [0378] CA1-WT (22)
GSRDSGTVWGALGHGIELNIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFLKSGAFEID 60
CA1-Z.sub.HER2-4 (23)
GSRDSGTVWGALGHGIELNIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFLKSGAFEID 60
CA1-Z.sub.HER342 (24)
GSRDSGTVWGALGHGIELNIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFLKSGAFEID 60
CA1-WT ANGDLDIKNLTRDDSGTYNVTVYSTNGTRILNKALDLRILEGGSGGVDNKENKEQQNAFY
120 CA1-Z.sub.HER2-4
ANGDLDIKNLTRDDSGTYNVTVYSTNGTRILNKALDLRILEGGSGGVDNKFNKELRQAYW 120
CA1-Z.sub.HER342
ANGDLDIKNLTRDDSGTYNVTVYSTNGTRILNKALDLRILEGGSGGVDNKFNKEMRNAYW 120
CA1-WT EILHLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKKLNDAQAPK 164
CA1-Z.sub.HER2-4 EIQALPNLNWTQSRAFIRSLYDDPSQSANLLAEANKLNDAQAPK 164
CA1-Z.sub.HER342 EIALLPNLNNQQKRAFIRSLYDDPSQSANLLAEAKKLNDAQAPK
164
Rat CA1-CD2-Bombesin (C-Terminal) (25)
TABLE-US-00011 [0379] RDSGTVWGAL GHGIELNIPN FQMTDDIDEV RWERGSTLVA
EFKRKMKPFL KSGAFEIDAN GDLDIKNLTR DDSGTYNVTV YSTNGTRILN KALDLRILEG
GSGGSGNQWA VGHLM
Rat CA1-CD2-Bombesin (52I) (26)
TABLE-US-00012 [0380] RDSGTVWGAL GHGIELNIPN FQMTDDIDEV RWERGSTLVA
EFKRKMKPFL KSGGSGGGNQ WAVGHLMGGS GGGAFEIDAN GDLDIKNLTR DDSGTYNVTV
YSTNGTRILN KALDLRILE
Rat Parvalbumin
TABLE-US-00013 [0381] WT (27)
MSMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIE 60
S56D (28)
MSMTDELSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKDGFIE 60
S56D-F103W(29)
MSMTDELSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKDGFIE 60
E60D (30)
MSMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFID 60
E60D-F103W (31)
MSMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFID 60
G99D (32)
MSMTDELSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIE 60
G99D-F103W (33)
MSMTDELSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIE 60
D53S-F103W (34)
MSMTDELSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILSKDKSGFIE 60
D53E-F103W (36)
MSMTDELSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILEKDKSGFIE 60
F103WC104 (37)
MSMTDELSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIE 60
F103W (38)
MSMTDELSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIE 60
Human (39)
MSMTDELNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIE 60 WT
EDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEFSTLVAES- 110 S56D
EDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEFSTLVAES- 110 S56D-F103W
EDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEWSTLVAES- 110 E6OD
EDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEFSTLVAES- 110 E60D-F103W
EDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEWSTLVAES- 110 G99D
EDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIDVEEFSTLVAES- 110 G99D-F103W
EDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIDVEEWSTLVAES- 110 G99D-F103W
EDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIDVEEWSTLVAES- 110 G99D-F103W
EDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIDVEEWSTLVAES- 110 F103WC104
EDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEWSTLVAESC 111 F103W
EDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEWSTLVAES- 110 Human
EDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES- 110
Rat-Parvalbumin Insertion Variants
TABLE-US-00014 [0382] PV_Collagen (39)
MSMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKDGFIE 60
PV_Bombsin (40)
MSMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKDGFIE 60
PV_Selectin (41)
MSMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKDGFIE 60
PV_RGD (42)
MSMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKDGFIE 60
PV_Cys (43)
MSMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKDGFIE 60
PV_AFFIBODY (44)
MSMIDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKDGFIE 60
PV_Collagen
EDELGSILKGFSSDARDLSAKETKTLMAAGDEDGDGKIGVEEWSTLVAESGGGKKWHCYT 120
PV_Bombsin
EDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEWSTLVAESGGGAQMAVGH 120
PV_Selectin
EDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEWSTLVAESGGG-KYDGDI 119
PV_RGD EDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEWSTLVAESGGGRGDRGDR
120 PV_Cys
EDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEWSTLVAESC--------- 111
PV_AFFIBODY
EDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEWSTLVAESGGSGGVDNKF 120
PV_Collagen YFPNHYCVYG-------------------------------------------
130 PV_Bombsin
LM--------------------------------------------------- 122
PV_Selectin TWDQLWDLMK-------------------------------------------
129 PV_RGD GDRGD------------------------------------------------
125 PV_Cys ------------------------------------------------------
PV_AFFIBODY NKEMRNAYWEIALLPNLNNQQKRAFIRSLYDDPSQSANLLAEAKKLNDAQAPK
173
Human-Calbindin D9k
TABLE-US-00015 [0383] CalbindinD9k (45)
MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKN 60
CalbindinD9kF67W (46)
MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKN 60
CalbindinD9kP43M (47)
MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGMNTLDDLFQELDKN 60
CalbindinD9kCys (48)
MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFFSLLKGPNTLDDLFQELDKN 60
CalbindinD9k GDGEVSFEEFQVLVKKISQ- 79 CalbindinD9kF67W
GDGEVSFEEWQVLVKKISQ- 79 CalbindinD9kP43M GDGEVSFEEWQVLVKKISQ- 79
CalbindinD9kCys GDGEVSFEEFQVLVKKISQC 80
Human-Troponin C (49)
TABLE-US-00016 [0384]
MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQT
PTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECF
RIFDRNADGYIDPGELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFD EFLKMMEGVQ
Rat CA1-CD2-Bombesin-RGD (52I)-Cend (50)
TABLE-US-00017 [0385] RDSGTVWGAL GHGIELNIPN FQMTDDIDEV RWERGSTLVA
EFKRKMKPFL KSGGSGGGNQ WAVGHLMGGS GGGAFEIDAN GDLDIKNLTR DDSGTYNVTV
YSTNGTRILN KALDLRILE-RGD
Rat CA1-CD2-Bombesin-RGD (52I)-Need (51)
TABLE-US-00018 [0386] RGDRDSGTVWGAL GHGIELNIPN FQMTDDIDEV
RWERGSTLVA EFKRKMKPFL KSGGSGGGNQ WAVGHLMGGS GGGAFEIDAN GDLDIKNLTR
DDSGTYNVTV YSTNGTRILN KALDLRILE
Rat CA1-CD2-RGD-83I (52)
TABLE-US-00019 [0387] RDSGTVWGAL GHGIELNIPN FQMTDDIDEV RWERGSTLVA
EFKRKMKPFL KSGAFEIDAN GDLDIKNLTR DDSGTYNVTV YSTGGSGGRGDGGSGGNGTRILN
KALDLRILEG
Rat CA1-CD2-Bom-52I-RGD-83I (53)
TABLE-US-00020 [0388] RGDRDSGTVWGAL GHGIELNIPN FQMTDDIDEV
RWERGSTLVA EFKRKMKPFL KSGGSGGGNQ WAVGHLMGGS GGGAFEIDAN GDLDIKNLTR
DDSGTYNVTV YSTGGSGGRGDGGSGGNGTRILN KALDLRILE
Sequence CWU 1
1
531148PRTRattus norvegicus 1Ala Asp Gln Leu Thr Glu Glu Gln Ile Ala
Glu Phe Lys Glu Ala Phe1 5 10 15Ser Leu Phe Asp Lys Asp Gly Asp Gly
Thr Ile Thr Thr Lys Glu Leu 20 25 30Gly Thr Val Met Arg Ser Leu Gly
Gln Asn Pro Thr Glu Ala Glu Leu 35 40 45Gln Asp Met Ile Asn Glu Val
Asp Ala Asp Gly Asn Gly Thr Ile Asp 50 55 60Phe Pro Glu Phe Leu Thr
Met Met Ala Arg Lys Met Lys Asp Thr Asp65 70 75 80Ser Glu Glu Glu
Ile Arg Glu Ala Phe Arg Val Phe Asp Ile Asp Gly 85 90 95Asn Gly Tyr
Ile Ser Ala Ala Glu Leu Arg His Val Met Thr Asn Leu 100 105 110Gly
Glu Lys Leu Thr Asp Glu Glu Val Asp Glu Met Ile Arg Glu Ala 115 120
125Asp Ile Asp Gly Asp Gly Gln Val Asn Tyr Glu Glu Phe Val Gln Met
130 135 140Met Thr Ala Lys1452148PRTArtificial SequenceChemically
synthesized Calmoudulin protein variant D93A 2Ala Asp Gln Leu Thr
Glu Glu Gln Ile Ala Glu Phe Lys Glu Ala Phe1 5 10 15Ser Leu Phe Asp
Lys Asp Gly Asp Gly Thr Ile Thr Thr Lys Glu Leu 20 25 30Gly Thr Val
Met Arg Ser Leu Gly Gln Asn Pro Thr Glu Ala Glu Leu 35 40 45Gln Asp
Met Ile Asn Glu Val Asp Ala Asp Gly Asn Gly Thr Ile Asp 50 55 60Phe
Pro Glu Phe Leu Thr Met Met Ala Arg Lys Met Lys Asp Thr Asp65 70 75
80Ser Glu Glu Glu Ile Arg Glu Ala Phe Arg Val Phe Ala Ile Asp Gly
85 90 95Asn Gly Tyr Ile Ser Ala Ala Glu Leu Arg His Val Met Thr Asn
Leu 100 105 110Gly Glu Lys Leu Thr Asp Glu Glu Val Asp Glu Met Ile
Arg Glu Ala 115 120 125Asp Ile Asp Gly Asp Gly Gln Val Asn Tyr Glu
Glu Phe Val Gln Met 130 135 140Met Thr Ala Lys1453148PRTArtificial
SequenceChemically synthesized Calmoudulin protein variant D129A
3Ala Asp Gln Leu Thr Glu Glu Gln Ile Ala Glu Phe Lys Glu Ala Phe1 5
10 15Ser Leu Phe Asp Lys Asp Gly Asp Gly Thr Ile Thr Thr Lys Glu
Leu 20 25 30Gly Thr Val Met Arg Ser Leu Gly Gln Asn Pro Thr Glu Ala
Glu Leu 35 40 45Gln Asp Met Ile Asn Glu Val Asp Ala Asp Gly Asn Gly
Thr Ile Asp 50 55 60Phe Pro Glu Phe Leu Thr Met Met Ala Arg Lys Met
Lys Asp Thr Asp65 70 75 80Ser Glu Glu Glu Ile Arg Glu Ala Phe Arg
Val Phe Asp Ile Asp Gly 85 90 95Asn Gly Tyr Ile Ser Ala Ala Glu Leu
Arg His Val Met Thr Asn Leu 100 105 110Gly Glu Lys Leu Thr Asp Glu
Glu Val Asp Glu Met Ile Arg Glu Ala 115 120 125Ala Ile Asp Gly Asp
Gly Gln Val Asn Tyr Glu Glu Phe Val Gln Met 130 135 140Met Thr Ala
Lys1454148PRTArtificial SequenceChemically synthesized Calmoudulin
protein variant D56A 4Ala Asp Gln Leu Thr Glu Glu Gln Ile Ala Glu
Phe Lys Glu Ala Phe1 5 10 15Ser Leu Phe Asp Lys Asp Gly Asp Gly Thr
Ile Thr Thr Lys Glu Leu 20 25 30Gly Thr Val Met Arg Ser Leu Gly Gln
Asn Pro Thr Glu Ala Glu Leu 35 40 45Gln Asp Met Ile Asn Glu Val Ala
Ala Asp Gly Asn Gly Thr Ile Asp 50 55 60Phe Pro Glu Phe Leu Thr Met
Met Ala Arg Lys Met Lys Asp Thr Asp65 70 75 80Ser Glu Glu Glu Ile
Arg Glu Ala Phe Arg Val Phe Asp Ile Asp Gly 85 90 95Asn Gly Tyr Ile
Ser Ala Ala Glu Leu Arg His Val Met Thr Asn Leu 100 105 110Gly Glu
Lys Leu Thr Asp Glu Glu Val Asp Glu Met Ile Arg Glu Ala 115 120
125Asp Ile Asp Gly Asp Gly Gln Val Asn Tyr Glu Glu Phe Val Gln Met
130 135 140Met Thr Ala Lys1455148PRTArtificial SequenceChemically
synthesized Calmoudulin protein variant D20A 5Ala Asp Gln Leu Thr
Glu Glu Gln Ile Ala Glu Phe Lys Glu Ala Phe1 5 10 15Ser Leu Phe Ala
Lys Asp Gly Asp Gly Thr Ile Thr Thr Lys Glu Leu 20 25 30Gly Thr Val
Met Arg Ser Leu Gly Gln Asn Pro Thr Glu Ala Glu Leu 35 40 45Gln Asp
Met Ile Asn Glu Val Asp Ala Asp Gly Asn Gly Thr Ile Asp 50 55 60Phe
Pro Glu Phe Leu Thr Met Met Ala Arg Lys Met Lys Asp Thr Asp65 70 75
80Ser Glu Glu Glu Ile Arg Glu Ala Phe Arg Val Phe Asp Ile Asp Gly
85 90 95Asn Gly Tyr Ile Ser Ala Ala Glu Leu Arg His Val Met Thr Asn
Leu 100 105 110Gly Glu Lys Leu Thr Asp Glu Glu Val Asp Glu Met Ile
Arg Glu Ala 115 120 125Asp Ile Asp Gly Asp Gly Gln Val Asn Tyr Glu
Glu Phe Val Gln Met 130 135 140Met Thr Ala Lys1456148PRTArtificial
SequenceChemically synthesized Calmoudulin protein variant Y99W
6Ala Asp Gln Leu Thr Glu Glu Gln Ile Ala Glu Phe Lys Glu Ala Phe1 5
10 15Ser Leu Phe Asp Lys Asp Gly Asp Gly Thr Ile Thr Thr Lys Glu
Leu 20 25 30Gly Thr Val Met Arg Ser Leu Gly Gln Asn Pro Thr Glu Ala
Glu Leu 35 40 45Gln Asp Met Ile Asn Glu Val Asp Ala Asp Gly Asn Gly
Thr Ile Asp 50 55 60Phe Pro Glu Phe Leu Thr Met Met Ala Arg Lys Met
Lys Asp Thr Asp65 70 75 80Ser Glu Glu Glu Ile Arg Glu Ala Phe Arg
Val Phe Asp Ile Asp Gly 85 90 95Asn Gly Trp Ile Ser Ala Ala Glu Leu
Arg His Val Met Thr Asn Leu 100 105 110Gly Glu Lys Leu Thr Asp Glu
Glu Val Asp Glu Met Ile Arg Glu Ala 115 120 125Asp Ile Asp Gly Asp
Gly Gln Val Asn Tyr Glu Glu Phe Val Gln Met 130 135 140Met Thr Ala
Lys1457148PRTArtificial SequenceChemically synthesized Calmoudulin
protein variant T26W 7Ala Asp Gln Leu Thr Glu Glu Gln Ile Ala Glu
Phe Lys Glu Ala Phe1 5 10 15Ser Leu Phe Asp Lys Asp Gly Asp Gly Trp
Ile Thr Thr Lys Glu Leu 20 25 30Gly Thr Val Met Arg Ser Leu Gly Gln
Asn Pro Thr Glu Ala Glu Leu 35 40 45Gln Asp Met Ile Asn Glu Val Asp
Ala Asp Gly Asn Gly Thr Ile Asp 50 55 60Phe Pro Glu Phe Leu Thr Met
Met Ala Arg Lys Met Lys Asp Thr Asp65 70 75 80Ser Glu Glu Glu Ile
Arg Glu Ala Phe Arg Val Phe Asp Ile Asp Gly 85 90 95Asn Gly Tyr Ile
Ser Ala Ala Glu Leu Arg His Val Met Thr Asn Leu 100 105 110Gly Glu
Lys Leu Thr Asp Glu Glu Val Asp Glu Met Ile Arg Glu Ala 115 120
125Asp Ile Asp Gly Asp Gly Gln Val Asn Tyr Glu Glu Phe Val Gln Met
130 135 140Met Thr Ala Lys1458148PRTArtificial SequenceChemically
synthesized Calmoudulin protein variant N60D-N97D 8Ala Asp Gln Leu
Thr Glu Glu Gln Ile Ala Glu Phe Lys Glu Ala Phe1 5 10 15Ser Leu Phe
Asp Lys Asp Gly Asp Gly Thr Ile Thr Thr Lys Glu Leu 20 25 30Gly Thr
Val Met Arg Ser Leu Gly Gln Asn Pro Thr Glu Ala Glu Leu 35 40 45Gln
Asp Met Ile Asn Glu Val Asp Ala Asp Gly Asp Gly Thr Ile Asp 50 55
60Phe Pro Glu Phe Leu Thr Met Met Ala Arg Lys Met Lys Asp Thr Asp65
70 75 80Ser Glu Glu Glu Ile Arg Glu Ala Phe Arg Val Phe Asp Lys Asp
Gly 85 90 95Asp Gly Tyr Ile Ser Ala Ala Glu Leu Arg His Val Met Thr
Asn Leu 100 105 110Gly Glu Lys Leu Thr Asp Glu Glu Val Asp Glu Met
Ile Arg Glu Ala 115 120 125Asp Ile Asp Gly Asp Gly Gln Val Asn Tyr
Glu Glu Phe Val Gln Met 130 135 140Met Thr Ala
Lys1459142PRTArtificial SequenceChemically synthesized Calmoudulin
protein variant 9Ala Asp Gln Leu Thr Glu Glu Gln Ile Ala Glu Phe
Lys Glu Ala Phe1 5 10 15Ser Leu Phe Asp Lys Asp Gly Asp Gly Thr Ile
Thr Thr Lys Glu Leu 20 25 30Gly Thr Val Met Arg Ser Leu Gly Gln Asn
Pro Thr Glu Ala Glu Leu 35 40 45Gln Asp Met Ile Asn Glu Val Asp Ala
Asp Gly Asn Gly Thr Ile Asp 50 55 60Phe Pro Glu Phe Leu Thr Met Met
Ala Arg Lys Glu Glu Glu Ile Arg65 70 75 80Glu Ala Phe Arg Val Phe
Asp Lys Asp Gly Asn Gly Tyr Ile Ser Ala 85 90 95Ala Glu Leu Arg His
Val Met Thr Asn Leu Gly Glu Lys Leu Thr Asp 100 105 110Glu Glu Val
Asp Glu Met Ile Arg Glu Ala Asp Ile Asp Gly Asp Gly 115 120 125Gln
Val Asn Tyr Glu Glu Phe Val Gln Met Met Thr Ala Lys 130 135
14010142PRTArtificial SequenceChemically synthesized Calmoudulin
protein variant D60D-N97D 10Ala Asp Gln Leu Thr Glu Glu Gln Ile Ala
Glu Phe Lys Glu Ala Phe1 5 10 15Ser Leu Phe Asp Lys Asp Gly Asp Gly
Thr Ile Thr Thr Lys Glu Leu 20 25 30Gly Thr Val Met Arg Ser Leu Gly
Gln Asn Pro Thr Glu Ala Glu Leu 35 40 45Gln Asp Met Ile Asn Glu Val
Asp Ala Asp Gly Asp Gly Thr Ile Asp 50 55 60Phe Pro Glu Phe Leu Thr
Met Met Ala Arg Lys Glu Glu Glu Ile Arg65 70 75 80Glu Ala Phe Arg
Val Phe Asp Lys Asp Gly Asp Gly Tyr Ile Ser Ala 85 90 95Ala Glu Leu
Arg His Val Met Thr Asn Leu Gly Glu Lys Leu Thr Asp 100 105 110Glu
Glu Val Asp Glu Met Ile Arg Glu Ala Asp Ile Asp Gly Asp Gly 115 120
125Gln Val Asn Tyr Glu Glu Phe Val Gln Met Met Thr Ala Lys 130 135
1401174PRTArtificial SequenceChemically synthesized Calmoudulin
N-terminal fragment 11Ala Asp Gln Leu Thr Glu Glu Gln Ile Ala Glu
Phe Lys Glu Ala Phe1 5 10 15Ser Leu Phe Asp Lys Asp Gly Asp Gly Thr
Ile Thr Thr Lys Glu Leu 20 25 30Gly Thr Val Met Arg Ser Leu Gly Gln
Asn Pro Thr Glu Ala Glu Leu 35 40 45Gln Asp Met Ile Asn Glu Val Asp
Ala Asp Gly Gly Thr Ile Asp Phe 50 55 60Pro Glu Phe Leu Thr Met Met
Ala Arg Lys65 701275PRTArtificial SequenceChemically synthesized
Calmoudulin N-terminal fragment N60D 12Ala Asp Gln Leu Thr Glu Glu
Gln Ile Ala Glu Phe Lys Glu Ala Phe1 5 10 15Ser Leu Phe Asp Lys Asp
Gly Asp Gly Thr Ile Thr Thr Lys Glu Leu 20 25 30Gly Thr Val Met Arg
Ser Leu Gly Gln Asn Pro Thr Glu Ala Glu Leu 35 40 45Gln Asp Met Ile
Asn Glu Val Asp Ala Asp Gly Asp Gly Thr Ile Asp 50 55 60Phe Pro Glu
Phe Leu Thr Met Met Ala Arg Lys65 70 751373PRTArtificial
SequenceChemically synthesized Calmoudulin C-terminal fragment
13Met Lys Asp Thr Asp Ser Glu Glu Glu Ile Arg Glu Ala Phe Arg Val1
5 10 15Phe Asp Ile Asp Gly Asn Gly Tyr Ile Ser Ala Ala Glu Leu Arg
His 20 25 30Val Met Thr Asn Leu Gly Glu Lys Leu Thr Asp Glu Glu Val
Asp Glu 35 40 45Met Ile Arg Glu Ala Asp Ile Asp Gly Asp Gly Gln Val
Asn Tyr Glu 50 55 60Glu Phe Val Gln Met Met Thr Ala Lys65
701473PRTArtificial SequenceChemically synthesized Calmoudulin
C-terminal fragment N97D 14Met Lys Asp Thr Asp Ser Glu Glu Glu Ile
Arg Glu Ala Phe Arg Val1 5 10 15Phe Asp Ile Asp Gly Asp Gly Tyr Ile
Ser Ala Ala Glu Leu Arg His 20 25 30Val Met Thr Asn Leu Gly Glu Lys
Leu Thr Asp Glu Glu Val Asp Glu 35 40 45Met Ile Arg Glu Ala Asp Ile
Asp Gly Asp Gly Gln Val Asn Tyr Glu 50 55 60Glu Phe Val Gln Met Met
Thr Ala Lys65 7015216PRTArtificial SequenceChemically synthesized
Calmoudulin-affibody peptide 15Ala Asp Gln Leu Thr Glu Glu Gln Ile
Ala Glu Phe Lys Glu Ala Phe1 5 10 15Ser Leu Phe Asp Lys Asp Gly Asp
Gly Thr Ile Thr Thr Lys Glu Leu 20 25 30Gly Thr Val Met Arg Ser Leu
Gly Gln Asn Pro Thr Glu Ala Glu Leu 35 40 45Gln Asp Met Ile Asn Glu
Val Asp Ala Asp Gly Asp Gly Thr Ile Asp 50 55 60Phe Pro Glu Phe Leu
Thr Met Met Ala Arg Lys Met Lys Asp Thr Gly65 70 75 80Gly Ser Gly
Gly Val Asp Asn Lys Phe Asn Lys Glu Met Arg Asn Ala 85 90 95Tyr Trp
Glu Ile Ala Leu Leu Pro Asn Leu Asn Asn Gln Gln Lys Arg 100 105
110Ala Phe Ile Arg Ser Leu Tyr Asp Asp Pro Ser Gln Ser Ala Asn Leu
115 120 125Leu Ala Glu Ala Lys Lys Leu Asn Asp Ala Gln Ala Pro Lys
Gly Gly 130 135 140Ser Gly Gly Asp Ser Glu Glu Glu Ile Arg Glu Ala
Phe Arg Val Phe145 150 155 160Asp Lys Asp Gly Asp Gly Tyr Ile Ser
Ala Ala Glu Leu Arg His Val 165 170 175Met Thr Asn Leu Gly Glu Lys
Leu Thr Asp Glu Glu Val Asp Glu Met 180 185 190Ile Arg Glu Ala Asp
Ile Asp Gly Asp Gly Gln Val Asn Tyr Glu Glu 195 200 205Phe Val Gln
Met Met Thr Ala Lys 210 21516161PRTArtificial SequenceChemically
synthesized Calmoudulin-bombesin peptide 16Ala Asp Gln Leu Thr Glu
Glu Gln Ile Ala Glu Phe Lys Glu Ala Phe1 5 10 15Ser Leu Phe Asp Lys
Asp Gly Asp Gly Thr Ile Thr Thr Lys Glu Leu 20 25 30Gly Thr Val Met
Arg Ser Leu Gly Gln Asn Pro Thr Glu Ala Glu Leu 35 40 45Gln Asp Met
Ile Asn Glu Val Asp Ala Asp Gly Asp Gly Thr Ile Asp 50 55 60Phe Pro
Glu Phe Leu Thr Met Met Ala Arg Lys Met Lys Asp Thr Gly65 70 75
80Gly Asn Gln Trp Ala Val Gly His Leu Met Gly Gly Asp Ser Glu Glu
85 90 95Glu Ile Arg Glu Ala Phe Arg Val Phe Asp Lys Asp Gly Asp Gly
Tyr 100 105 110Ile Ser Ala Ala Glu Leu Arg His Val Met Thr Asn Leu
Gly Glu Lys 115 120 125Leu Thr Asp Glu Glu Val Asp Glu Met Ile Arg
Glu Ala Asp Ile Asp 130 135 140Gly Asp Gly Gln Val Asn Tyr Glu Glu
Phe Val Gln Met Met Thr Ala145 150 155 160Lys17151PRTHomo sapiens
17Ala Asp Gln Leu Thr Glu Glu Gln Ile Ala Glu Phe Lys Glu Ala Phe1
5 10 15Ser Leu Phe Asp Lys Asp Gly Asp Gly Thr Ile Thr Thr Lys Glu
Leu 20 25 30Gly Thr Val Met Arg Ser Leu Gly Gln Asn Pro Thr Glu Ala
Glu Leu 35 40 45Gln Asp Met Ile Asn Glu Val Asp Ala Asp Asp Leu Pro
Gly Asn Gly 50 55 60Thr Ile Asp Phe Pro Glu Phe Leu Thr Met Met Ala
Arg Lys Met Lys65 70 75 80Asp Thr Asp Ser Glu Glu Glu Ile Arg Glu
Ala Phe Arg Val Phe Asp 85 90 95Lys Asp Gly Asn Gly Tyr Ile Ser Ala
Ala Glu Leu Arg His Val Met 100 105 110Thr Asn Leu Gly Glu Lys Leu
Thr Asp Glu Glu Val Asp Glu Met Ile 115 120 125Arg Glu Ala Asp Ile
Asp Gly Asp Gly Gln Val Asn Tyr Glu Glu Phe 130 135 140Val Gln Met
Met Thr Ala Lys145 15018148PRTMus musculus 18Ala Asp Gln Leu Thr
Glu Glu Gln Ile Ala Glu Phe Lys Glu Ala Phe1 5 10 15Ser Leu Phe Asp
Lys Asp Gly Asp Asn
Thr Ile Thr Thr Lys Glu Leu 20 25 30Gly Thr Val Met Arg Ser Leu Gly
Gln Asn Pro Thr Glu Ala Glu Leu 35 40 45Gln Asp Met Ile Asn Glu Val
Asp Ala Asp Gly Asn Gly Thr Ile Asp 50 55 60Phe Pro Glu Phe Leu Thr
Met Met Ala Arg Lys Met Lys Asp Thr Asp65 70 75 80Ser Glu Glu Glu
Ile Arg Glu Ala Phe Arg Val Phe Asp Lys Asp Gly 85 90 95Asn Gly Tyr
Ile Ser Ala Ala Glu Leu Arg His Val Met Thr Asn Leu 100 105 110Gly
Glu Lys Leu Thr Asp Glu Glu Val Asp Glu Met Ile Arg Glu Ala 115 120
125Asp Ile Asp Gly Asp Gly Gln Val Asn Tyr Glu Glu Phe Val Gln Met
130 135 140Met Thr Ala Lys14519148PRTRattus norvegicus 19Ala Asp
Gln Leu Thr Glu Glu Gln Ile Ala Glu Phe Lys Glu Ala Phe1 5 10 15Ser
Leu Phe Asp Lys Asp Gly Asp Gly Thr Ile Thr Thr Lys Glu Leu 20 25
30Gly Thr Val Met Arg Ser Leu Gly Gln Asn Pro Thr Glu Ala Glu Leu
35 40 45Gln Asp Met Ile Asn Glu Val Asp Ala Asp Gly Asn Gly Thr Ile
Asp 50 55 60Phe Pro Glu Phe Leu Thr Met Met Ala Arg Lys Met Lys Asp
Thr Asp65 70 75 80Ser Glu Glu Glu Ile Arg Glu Ala Phe Arg Val Phe
Asp Lys Asp Gly 85 90 95Asn Gly Tyr Ile Ser Ala Ala Glu Leu Arg His
Val Met Thr Asn Leu 100 105 110Gly Glu Lys Leu Thr Asp Glu Glu Val
Asp Glu Met Ile Arg Glu Ala 115 120 125Asp Ile Asp Gly Asp Gly Gln
Val Asn Tyr Glu Glu Phe Val Gln Met 130 135 140Met Thr Ala
Lys14520148PRTOryctolagus cuniculus 20Ala Asp Gln Leu Thr Glu Glu
Gln Ile Ala Glu Phe Lys Glu Ala Phe1 5 10 15Ser Leu Phe Asp Lys Asp
Gly Asp Gly Thr Ile Thr Thr Lys Glu Leu 20 25 30Gly Thr Val Met Arg
Ser Leu Gly Gln Asn Pro Thr Glu Ala Glu Leu 35 40 45Gln Asp Met Ile
Asn Glu Val Asp Ala Asp Gly Asn Gly Thr Ile Asp 50 55 60Phe Pro Glu
Phe Leu Thr Met Met Ala Arg Lys Met Lys Asp Thr Asp65 70 75 80Ser
Glu Glu Glu Ile Arg Glu Ala Phe Arg Val Phe Asp Lys Asp Gly 85 90
95Asn Gly Tyr Ile Ser Ala Ala Glu Leu Arg His Val Met Thr Asn Leu
100 105 110Gly Glu Lys Leu Thr Asp Glu Glu Val Asp Glu Met Ile Arg
Glu Ala 115 120 125Asp Ile Asp Gly Asp Gly Gln Val Asn Tyr Glu Glu
Phe Val Gln Met 130 135 140Met Thr Ala Lys14521148PRTParamecium
tetraurelia 21Ala Glu Gln Leu Thr Glu Glu Gln Ile Ala Glu Phe Lys
Glu Ala Phe1 5 10 15Ala Leu Phe Asp Lys Asp Gly Asp Gly Thr Ile Thr
Thr Lys Glu Leu 20 25 30Gly Thr Val Met Arg Ser Leu Gly Gln Asn Pro
Thr Glu Ala Glu Leu 35 40 45Gln Asp Met Ile Asn Glu Val Asp Ala Asp
Gly Asn Gly Thr Ile Asp 50 55 60Phe Pro Glu Phe Leu Ser Leu Met Ala
Arg Lys Met Lys Glu Gln Asp65 70 75 80Ser Glu Glu Glu Leu Ile Glu
Ala Phe Lys Val Phe Asp Arg Asp Gly 85 90 95Asn Gly Leu Ile Ser Ala
Ala Glu Leu Arg His Val Met Thr Asn Leu 100 105 110Gly Glu Lys Leu
Thr Asp Asp Glu Val Asp Glu Met Ile Arg Glu Ala 115 120 125Asp Ile
Asp Gly Asp Gly His Ile Asn Tyr Glu Glu Phe Val Arg Met 130 135
140Met Val Ser Lys14522164PRTRattus norvegicus 22Gly Ser Arg Asp
Ser Gly Thr Val Trp Gly Ala Leu Gly His Gly Ile1 5 10 15Glu Leu Asn
Ile Pro Asn Phe Gln Met Thr Asp Asp Ile Asp Glu Val 20 25 30Arg Trp
Glu Arg Gly Ser Thr Leu Val Ala Glu Phe Lys Arg Lys Met 35 40 45Lys
Pro Phe Leu Lys Ser Gly Ala Phe Glu Ile Asp Ala Asn Gly Asp 50 55
60Leu Asp Ile Lys Asn Leu Thr Arg Asp Asp Ser Gly Thr Tyr Asn Val65
70 75 80Thr Val Tyr Ser Thr Asn Gly Thr Arg Ile Leu Asn Lys Ala Leu
Asp 85 90 95Leu Arg Ile Leu Glu Gly Gly Ser Gly Gly Val Asp Asn Lys
Phe Asn 100 105 110Lys Glu Gln Gln Asn Ala Phe Tyr Glu Ile Leu His
Leu Pro Asn Leu 115 120 125Asn Glu Glu Gln Arg Asn Ala Phe Ile Gln
Ser Leu Lys Asp Asp Pro 130 135 140Ser Gln Ser Ala Asn Leu Leu Ala
Glu Ala Lys Lys Leu Asn Asp Ala145 150 155 160Gln Ala Pro
Lys23164PRTArtificial SequenceChemically synthesized
CA1-CD2-affibody peptide 23Gly Ser Arg Asp Ser Gly Thr Val Trp Gly
Ala Leu Gly His Gly Ile1 5 10 15Glu Leu Asn Ile Pro Asn Phe Gln Met
Thr Asp Asp Ile Asp Glu Val 20 25 30Arg Trp Glu Arg Gly Ser Thr Leu
Val Ala Glu Phe Lys Arg Lys Met 35 40 45Lys Pro Phe Leu Lys Ser Gly
Ala Phe Glu Ile Asp Ala Asn Gly Asp 50 55 60Leu Asp Ile Lys Asn Leu
Thr Arg Asp Asp Ser Gly Thr Tyr Asn Val65 70 75 80Thr Val Tyr Ser
Thr Asn Gly Thr Arg Ile Leu Asn Lys Ala Leu Asp 85 90 95Leu Arg Ile
Leu Glu Gly Gly Ser Gly Gly Val Asp Asn Lys Phe Asn 100 105 110Lys
Glu Leu Arg Gln Ala Tyr Trp Glu Ile Gln Ala Leu Pro Asn Leu 115 120
125Asn Trp Thr Gln Ser Arg Ala Phe Ile Arg Ser Leu Tyr Asp Asp Pro
130 135 140Ser Gln Ser Ala Asn Leu Leu Ala Glu Ala Lys Lys Leu Asn
Asp Ala145 150 155 160Gln Ala Pro Lys24164PRTArtificial
SequenceChemically synthesized CA1-CD2 affibody peptide 24Gly Ser
Arg Asp Ser Gly Thr Val Trp Gly Ala Leu Gly His Gly Ile1 5 10 15Glu
Leu Asn Ile Pro Asn Phe Gln Met Thr Asp Asp Ile Asp Glu Val 20 25
30Arg Trp Glu Arg Gly Ser Thr Leu Val Ala Glu Phe Lys Arg Lys Met
35 40 45Lys Pro Phe Leu Lys Ser Gly Ala Phe Glu Ile Asp Ala Asn Gly
Asp 50 55 60Leu Asp Ile Lys Asn Leu Thr Arg Asp Asp Ser Gly Thr Tyr
Asn Val65 70 75 80Thr Val Tyr Ser Thr Asn Gly Thr Arg Ile Leu Asn
Lys Ala Leu Asp 85 90 95Leu Arg Ile Leu Glu Gly Gly Ser Gly Gly Val
Asp Asn Lys Phe Asn 100 105 110Lys Glu Met Arg Asn Ala Tyr Trp Glu
Ile Ala Leu Leu Pro Asn Leu 115 120 125Asn Asn Gln Gln Lys Arg Ala
Phe Ile Arg Ser Leu Tyr Asp Asp Pro 130 135 140Ser Gln Ser Ala Asn
Leu Leu Ala Glu Ala Lys Lys Leu Asn Asp Ala145 150 155 160Gln Ala
Pro Lys25115PRTArtificial SequenceChemically synthesized
CA1-CD2-Bombesin C-terminal peptide 25Arg Asp Ser Gly Thr Val Trp
Gly Ala Leu Gly His Gly Ile Glu Leu1 5 10 15Asn Ile Pro Asn Phe Gln
Met Thr Asp Asp Ile Asp Glu Val Arg Trp 20 25 30Glu Arg Gly Ser Thr
Leu Val Ala Glu Phe Lys Arg Lys Met Lys Pro 35 40 45Phe Leu Lys Ser
Gly Ala Phe Glu Ile Asp Ala Asn Gly Asp Leu Asp 50 55 60Ile Lys Asn
Leu Thr Arg Asp Asp Ser Gly Thr Tyr Asn Val Thr Val65 70 75 80Tyr
Ser Thr Asn Gly Thr Arg Ile Leu Asn Lys Ala Leu Asp Leu Arg 85 90
95Ile Leu Glu Gly Gly Ser Gly Gly Ser Gly Asn Gln Trp Ala Val Gly
100 105 110His Leu Met 11526119PRTArtificial SequenceChemically
synthesized CA1-CD2-Bombesin peptide 26Arg Asp Ser Gly Thr Val Trp
Gly Ala Leu Gly His Gly Ile Glu Leu1 5 10 15Asn Ile Pro Asn Phe Gln
Met Thr Asp Asp Ile Asp Glu Val Arg Trp 20 25 30Glu Arg Gly Ser Thr
Leu Val Ala Glu Phe Lys Arg Lys Met Lys Pro 35 40 45Phe Leu Lys Ser
Gly Gly Ser Gly Gly Gly Asn Gln Trp Ala Val Gly 50 55 60His Leu Met
Gly Gly Ser Gly Gly Gly Ala Phe Glu Ile Asp Ala Asn65 70 75 80Gly
Asp Leu Asp Ile Lys Asn Leu Thr Arg Asp Asp Ser Gly Thr Tyr 85 90
95Asn Val Thr Val Tyr Ser Thr Asn Gly Thr Arg Ile Leu Asn Lys Ala
100 105 110Leu Asp Leu Arg Ile Leu Glu 11527110PRTRattus norvegicus
27Met Ser Met Thr Asp Leu Leu Ser Ala Glu Asp Ile Lys Lys Ala Ile1
5 10 15Gly Ala Phe Thr Ala Ala Asp Ser Phe Asp His Lys Lys Phe Phe
Gln 20 25 30Met Val Gly Leu Lys Lys Lys Ser Ala Asp Asp Val Lys Lys
Val Phe 35 40 45His Ile Leu Asp Lys Asp Lys Ser Gly Phe Ile Glu Glu
Asp Glu Leu 50 55 60Gly Ser Ile Leu Lys Gly Phe Ser Ser Asp Ala Arg
Asp Leu Ser Ala65 70 75 80Lys Glu Thr Lys Thr Leu Met Ala Ala Gly
Asp Lys Asp Gly Asp Gly 85 90 95Lys Ile Gly Val Glu Glu Phe Ser Thr
Leu Val Ala Glu Ser 100 105 11028110PRTArtificial
SequenceChemically synthesized Parvalbumin protein variant S56D
28Met Ser Met Thr Asp Leu Leu Ser Ala Glu Asp Ile Lys Lys Ala Ile1
5 10 15Gly Ala Phe Thr Ala Ala Asp Ser Phe Asp His Lys Lys Phe Phe
Gln 20 25 30Met Val Gly Leu Lys Lys Lys Ser Ala Asp Asp Val Lys Lys
Val Phe 35 40 45His Ile Leu Asp Lys Asp Lys Asp Gly Phe Ile Glu Glu
Asp Glu Leu 50 55 60Gly Ser Ile Leu Lys Gly Phe Ser Ser Asp Ala Arg
Asp Leu Ser Ala65 70 75 80Lys Glu Thr Lys Thr Leu Met Ala Ala Gly
Asp Lys Asp Gly Asp Gly 85 90 95Lys Ile Gly Val Glu Glu Phe Ser Thr
Leu Val Ala Glu Ser 100 105 11029110PRTArtificial
SequenceChemically synthesized Parvalbumin protein variant
S56D-F103W 29Met Ser Met Thr Asp Leu Leu Ser Ala Glu Asp Ile Lys
Lys Ala Ile1 5 10 15Gly Ala Phe Thr Ala Ala Asp Ser Phe Asp His Lys
Lys Phe Phe Gln 20 25 30Met Val Gly Leu Lys Lys Lys Ser Ala Asp Asp
Val Lys Lys Val Phe 35 40 45His Ile Leu Asp Lys Asp Lys Asp Gly Phe
Ile Glu Glu Asp Glu Leu 50 55 60Gly Ser Ile Leu Lys Gly Phe Ser Ser
Asp Ala Arg Asp Leu Ser Ala65 70 75 80Lys Glu Thr Lys Thr Leu Met
Ala Ala Gly Asp Lys Asp Gly Asp Gly 85 90 95Lys Ile Gly Val Glu Glu
Trp Ser Thr Leu Val Ala Glu Ser 100 105 11030110PRTArtificial
SequenceChemically synthesized Parvalbumin protein variant E60D
30Met Ser Met Thr Asp Leu Leu Ser Ala Glu Asp Ile Lys Lys Ala Ile1
5 10 15Gly Ala Phe Thr Ala Ala Asp Ser Phe Asp His Lys Lys Phe Phe
Gln 20 25 30Met Val Gly Leu Lys Lys Lys Ser Ala Asp Asp Val Lys Lys
Val Phe 35 40 45His Ile Leu Asp Lys Asp Lys Ser Gly Phe Ile Asp Glu
Asp Glu Leu 50 55 60Gly Ser Ile Leu Lys Gly Phe Ser Ser Asp Ala Arg
Asp Leu Ser Ala65 70 75 80Lys Glu Thr Lys Thr Leu Met Ala Ala Gly
Asp Lys Asp Gly Asp Gly 85 90 95Lys Ile Gly Val Glu Glu Phe Ser Thr
Leu Val Ala Glu Ser 100 105 11031110PRTArtificial
SequenceChemically synthesized Parvalbumin protein variant
E60D-F103W 31Met Ser Met Thr Asp Leu Leu Ser Ala Glu Asp Ile Lys
Lys Ala Ile1 5 10 15Gly Ala Phe Thr Ala Ala Asp Ser Phe Asp His Lys
Lys Phe Phe Gln 20 25 30Met Val Gly Leu Lys Lys Lys Ser Ala Asp Asp
Val Lys Lys Val Phe 35 40 45His Ile Leu Asp Lys Asp Lys Ser Gly Phe
Ile Asp Glu Asp Glu Leu 50 55 60Gly Ser Ile Leu Lys Gly Phe Ser Ser
Asp Ala Arg Asp Leu Ser Ala65 70 75 80Lys Glu Thr Lys Thr Leu Met
Ala Ala Gly Asp Lys Asp Gly Asp Gly 85 90 95Lys Ile Gly Val Glu Glu
Trp Ser Thr Leu Val Ala Glu Ser 100 105 11032110PRTArtificial
SequenceChemically synthesized Parvalbumin protein variant G99D
32Met Ser Met Thr Asp Leu Leu Ser Ala Glu Asp Ile Lys Lys Ala Ile1
5 10 15Gly Ala Phe Thr Ala Ala Asp Ser Phe Asp His Lys Lys Phe Phe
Gln 20 25 30Met Val Gly Leu Lys Lys Lys Ser Ala Asp Asp Val Lys Lys
Val Phe 35 40 45His Ile Leu Asp Lys Asp Lys Ser Gly Phe Ile Glu Glu
Asp Glu Leu 50 55 60Gly Ser Ile Leu Lys Gly Phe Ser Ser Asp Ala Arg
Asp Leu Ser Ala65 70 75 80Lys Glu Thr Lys Thr Leu Met Ala Ala Gly
Asp Lys Asp Gly Asp Gly 85 90 95Lys Ile Asp Val Glu Glu Phe Ser Thr
Leu Val Ala Glu Ser 100 105 11033110PRTArtificial
SequenceChemically synthesized Parvalbumin protein variant
G99D-F103W 33Met Ser Met Thr Asp Leu Leu Ser Ala Glu Asp Ile Lys
Lys Ala Ile1 5 10 15Gly Ala Phe Thr Ala Ala Asp Ser Phe Asp His Lys
Lys Phe Phe Gln 20 25 30Met Val Gly Leu Lys Lys Lys Ser Ala Asp Asp
Val Lys Lys Val Phe 35 40 45His Ile Leu Asp Lys Asp Lys Ser Gly Phe
Ile Glu Glu Asp Glu Leu 50 55 60Gly Ser Ile Leu Lys Gly Phe Ser Ser
Asp Ala Arg Asp Leu Ser Ala65 70 75 80Lys Glu Thr Lys Thr Leu Met
Ala Ala Gly Asp Lys Asp Gly Asp Gly 85 90 95Lys Ile Asp Val Glu Glu
Trp Ser Thr Leu Val Ala Glu Ser 100 105 11034110PRTArtificial
SequenceChemically synthesized Parvalbumin protein variant
D53S-F103W 34Met Ser Met Thr Asp Leu Leu Ser Ala Glu Asp Ile Lys
Lys Ala Ile1 5 10 15Gly Ala Phe Thr Ala Ala Asp Ser Phe Asp His Lys
Lys Phe Phe Gln 20 25 30Met Val Gly Leu Lys Lys Lys Ser Ala Asp Asp
Val Lys Lys Val Phe 35 40 45His Ile Leu Ser Lys Asp Lys Ser Gly Phe
Ile Glu Glu Asp Glu Leu 50 55 60Gly Ser Ile Leu Lys Gly Phe Ser Ser
Asp Ala Arg Asp Leu Ser Ala65 70 75 80Lys Glu Thr Lys Thr Leu Met
Ala Ala Gly Asp Lys Asp Gly Asp Gly 85 90 95Lys Ile Asp Val Glu Glu
Trp Ser Thr Leu Val Ala Glu Ser 100 105 11035110PRTArtificial
SequenceChemically synthesized Parvalbumin protein variant
D53E-F103W 35Met Ser Met Thr Asp Leu Leu Ser Ala Glu Asp Ile Lys
Lys Ala Ile1 5 10 15Gly Ala Phe Thr Ala Ala Asp Ser Phe Asp His Lys
Lys Phe Phe Gln 20 25 30Met Val Gly Leu Lys Lys Lys Ser Ala Asp Asp
Val Lys Lys Val Phe 35 40 45His Ile Leu Glu Lys Asp Lys Ser Gly Phe
Ile Glu Glu Asp Glu Leu 50 55 60Gly Ser Ile Leu Lys Gly Phe Ser Ser
Asp Ala Arg Asp Leu Ser Ala65 70 75 80Lys Glu Thr Lys Thr Leu Met
Ala Ala Gly Asp Lys Asp Gly Asp Gly 85 90 95Lys Ile Asp Val Glu Glu
Trp Ser Thr Leu Val Ala Glu Ser 100 105 11036111PRTArtificial
SequenceChemically synthesized Parvalbumin protein variant
F103WC104 36Met Ser Met Thr Asp Leu Leu Ser Ala Glu Asp Ile Lys Lys
Ala Ile1 5 10 15Gly Ala Phe Thr Ala Ala Asp Ser Phe Asp His Lys Lys
Phe Phe Gln
20 25 30Met Val Gly Leu Lys Lys Lys Ser Ala Asp Asp Val Lys Lys Val
Phe 35 40 45His Ile Leu Asp Lys Asp Lys Ser Gly Phe Ile Glu Glu Asp
Glu Leu 50 55 60Gly Ser Ile Leu Lys Gly Phe Ser Ser Asp Ala Arg Asp
Leu Ser Ala65 70 75 80Lys Glu Thr Lys Thr Leu Met Ala Ala Gly Asp
Lys Asp Gly Asp Gly 85 90 95Lys Ile Gly Val Glu Glu Trp Ser Thr Leu
Val Ala Glu Ser Cys 100 105 11037110PRTArtificial
SequenceChemically synthesized Parvalbumin protein variant F103W
37Met Ser Met Thr Asp Leu Leu Ser Ala Glu Asp Ile Lys Lys Ala Ile1
5 10 15Gly Ala Phe Thr Ala Ala Asp Ser Phe Asp His Lys Lys Phe Phe
Gln 20 25 30Met Val Gly Leu Lys Lys Lys Ser Ala Asp Asp Val Lys Lys
Val Phe 35 40 45His Ile Leu Asp Lys Asp Lys Ser Gly Phe Ile Glu Glu
Asp Glu Leu 50 55 60Gly Ser Ile Leu Lys Gly Phe Ser Ser Asp Ala Arg
Asp Leu Ser Ala65 70 75 80Lys Glu Thr Lys Thr Leu Met Ala Ala Gly
Asp Lys Asp Gly Asp Gly 85 90 95Lys Ile Gly Val Glu Glu Trp Ser Thr
Leu Val Ala Glu Ser 100 105 11038110PRTHomo sapiens 38Met Ser Met
Thr Asp Leu Leu Asn Ala Glu Asp Ile Lys Lys Ala Val1 5 10 15Gly Ala
Phe Ser Ala Thr Asp Ser Phe Asp His Lys Lys Phe Phe Gln 20 25 30Met
Val Gly Leu Lys Lys Lys Ser Ala Asp Asp Val Lys Lys Val Phe 35 40
45His Met Leu Asp Lys Asp Lys Ser Gly Phe Ile Glu Glu Asp Glu Leu
50 55 60Gly Phe Ile Leu Lys Gly Phe Ser Pro Asp Ala Arg Asp Leu Ser
Ala65 70 75 80Lys Glu Thr Lys Met Leu Met Ala Ala Gly Asp Lys Asp
Gly Asp Gly 85 90 95Lys Ile Gly Val Asp Glu Phe Ser Thr Leu Val Ala
Glu Ser 100 105 11039130PRTArtificial SequenceChemically
synthesized Parvalbumin protein variant PV_Collagen 39Met Ser Met
Thr Asp Leu Leu Ser Ala Glu Asp Ile Lys Lys Ala Ile1 5 10 15Gly Ala
Phe Thr Ala Ala Asp Ser Phe Asp His Lys Lys Phe Phe Gln 20 25 30Met
Val Gly Leu Lys Lys Lys Ser Ala Asp Asp Val Lys Lys Val Phe 35 40
45His Ile Leu Asp Lys Asp Lys Asp Gly Phe Ile Glu Glu Asp Glu Leu
50 55 60Gly Ser Ile Leu Lys Gly Phe Ser Ser Asp Ala Arg Asp Leu Ser
Ala65 70 75 80Lys Glu Thr Lys Thr Leu Met Ala Ala Gly Asp Lys Asp
Gly Asp Gly 85 90 95Lys Ile Gly Val Glu Glu Trp Ser Thr Leu Val Ala
Glu Ser Gly Gly 100 105 110Gly Lys Lys Trp His Cys Tyr Thr Tyr Phe
Pro His His Tyr Cys Val 115 120 125Tyr Gly 13040122PRTArtificial
SequenceChemically synthesized Parvalbumin protein variant
PV_Bombesin 40Met Ser Met Thr Asp Leu Leu Ser Ala Glu Asp Ile Lys
Lys Ala Ile1 5 10 15Gly Ala Phe Thr Ala Ala Asp Ser Phe Asp His Lys
Lys Phe Phe Gln 20 25 30Met Val Gly Leu Lys Lys Lys Ser Ala Asp Asp
Val Lys Lys Val Phe 35 40 45His Ile Leu Asp Lys Asp Lys Asp Gly Phe
Ile Glu Glu Asp Glu Leu 50 55 60Gly Ser Ile Leu Lys Gly Phe Ser Ser
Asp Ala Arg Asp Leu Ser Ala65 70 75 80Lys Glu Thr Lys Thr Leu Met
Ala Ala Gly Asp Lys Asp Gly Asp Gly 85 90 95Lys Ile Gly Val Glu Glu
Trp Ser Thr Leu Val Ala Glu Ser Gly Gly 100 105 110Gly Ala Gln Trp
Ala Val Gly His Leu Met 115 12041129PRTArtificial
SequenceChemically synthesized Parvalbumin protein variant
PV_Selectin 41Met Ser Met Thr Asp Leu Leu Ser Ala Glu Asp Ile Lys
Lys Ala Ile1 5 10 15Gly Ala Phe Thr Ala Ala Asp Ser Phe Asp His Lys
Lys Phe Phe Gln 20 25 30Met Val Gly Leu Lys Lys Lys Ser Ala Asp Asp
Val Lys Lys Val Phe 35 40 45His Ile Leu Asp Lys Asp Lys Asp Gly Phe
Ile Glu Glu Asp Glu Leu 50 55 60Gly Ser Ile Leu Lys Gly Phe Ser Ser
Asp Ala Arg Asp Leu Ser Ala65 70 75 80Lys Glu Thr Lys Thr Leu Met
Ala Ala Gly Asp Lys Asp Gly Asp Gly 85 90 95Lys Ile Gly Val Glu Glu
Trp Ser Thr Leu Val Ala Glu Ser Gly Gly 100 105 110Gly Lys Tyr Asp
Gly Asp Ile Thr Trp Asp Gln Leu Trp Asp Leu Met 115 120 125Lys
42125PRTArtificial SequenceChemically synthesized Parvalbumin
protein variant PV_RGD 42Met Ser Met Thr Asp Leu Leu Ser Ala Glu
Asp Ile Lys Lys Ala Ile1 5 10 15Gly Ala Phe Thr Ala Ala Asp Ser Phe
Asp His Lys Lys Phe Phe Gln 20 25 30Met Val Gly Leu Lys Lys Lys Ser
Ala Asp Asp Val Lys Lys Val Phe 35 40 45His Ile Leu Asp Lys Asp Lys
Asp Gly Phe Ile Glu Glu Asp Glu Leu 50 55 60Gly Ser Ile Leu Lys Gly
Phe Ser Ser Asp Ala Arg Asp Leu Ser Ala65 70 75 80Lys Glu Thr Lys
Thr Leu Met Ala Ala Gly Asp Lys Asp Gly Asp Gly 85 90 95Lys Ile Gly
Val Glu Glu Trp Ser Thr Leu Val Ala Glu Ser Gly Gly 100 105 110Gly
Arg Gly Asp Arg Gly Asp Arg Gly Asp Arg Gly Asp 115 120
12543111PRTArtificial SequenceChemically synthesized Parvalbumin
protein variant PV_Cys 43Met Ser Met Thr Asp Leu Leu Ser Ala Glu
Asp Ile Lys Lys Ala Ile1 5 10 15Gly Ala Phe Thr Ala Ala Asp Ser Phe
Asp His Lys Lys Phe Phe Gln 20 25 30Met Val Gly Leu Lys Lys Lys Ser
Ala Asp Asp Val Lys Lys Val Phe 35 40 45His Ile Leu Asp Lys Asp Lys
Asp Gly Phe Ile Glu Glu Asp Glu Leu 50 55 60Gly Ser Ile Leu Lys Gly
Phe Ser Ser Asp Ala Arg Asp Leu Ser Ala65 70 75 80Lys Glu Thr Lys
Thr Leu Met Ala Ala Gly Asp Lys Asp Gly Asp Gly 85 90 95Lys Ile Gly
Val Glu Glu Trp Ser Thr Leu Val Ala Glu Ser Cys 100 105
11044173PRTArtificial SequenceChemically synthesized Parvalbumin
protein variant PV_AFFIBODY 44Met Ser Met Thr Asp Leu Leu Ser Ala
Glu Asp Ile Lys Lys Ala Ile1 5 10 15Gly Ala Phe Thr Ala Ala Asp Ser
Phe Asp His Lys Lys Phe Phe Gln 20 25 30Met Val Gly Leu Lys Lys Lys
Ser Ala Asp Asp Val Lys Lys Val Phe 35 40 45His Ile Leu Asp Lys Asp
Lys Asp Gly Phe Ile Glu Glu Asp Glu Leu 50 55 60Gly Ser Ile Leu Lys
Gly Phe Ser Ser Asp Ala Arg Asp Leu Ser Ala65 70 75 80Lys Glu Thr
Lys Thr Leu Met Ala Ala Gly Asp Lys Asp Gly Asp Gly 85 90 95Lys Ile
Gly Val Glu Glu Trp Ser Thr Leu Val Ala Glu Ser Gly Gly 100 105
110Ser Gly Gly Val Asp Asn Lys Phe Asn Lys Glu Met Arg Asn Ala Tyr
115 120 125Trp Glu Ile Ala Leu Leu Pro Asn Leu Asn Asn Gln Gln Lys
Arg Ala 130 135 140Phe Ile Arg Ser Leu Tyr Asp Asp Pro Ser Gln Ser
Ala Asn Leu Leu145 150 155 160Ala Glu Ala Lys Lys Leu Asn Asp Ala
Gln Ala Pro Lys 165 1704579PRTHomo sapiens 45Met Ser Thr Lys Lys
Ser Pro Glu Glu Leu Lys Arg Ile Phe Glu Lys1 5 10 15Tyr Ala Ala Lys
Glu Gly Asp Pro Asp Gln Leu Ser Lys Asp Glu Leu 20 25 30Lys Leu Leu
Ile Gln Ala Glu Phe Pro Ser Leu Leu Lys Gly Pro Asn 35 40 45Thr Leu
Asp Asp Leu Phe Gln Glu Leu Asp Lys Asn Gly Asp Gly Glu 50 55 60Val
Ser Phe Glu Glu Phe Gln Val Leu Val Lys Lys Ile Ser Gln65 70
754679PRTArtificial SequenceChemically synthesized variant
Calbindin D9k F67W 46Met Ser Thr Lys Lys Ser Pro Glu Glu Leu Lys
Arg Ile Phe Glu Lys1 5 10 15Tyr Ala Ala Lys Glu Gly Asp Pro Asp Gln
Leu Ser Lys Asp Glu Leu 20 25 30Lys Leu Leu Ile Gln Ala Glu Phe Pro
Ser Leu Leu Lys Gly Pro Asn 35 40 45Thr Leu Asp Asp Leu Phe Gln Glu
Leu Asp Lys Asn Gly Asp Gly Glu 50 55 60Val Ser Phe Glu Glu Trp Gln
Val Leu Val Lys Lys Ile Ser Gln65 70 754779PRTArtificial
SequenceChemically synthesized variant Calbindin D9k P43M 47Met Ser
Thr Lys Lys Ser Pro Glu Glu Leu Lys Arg Ile Phe Glu Lys1 5 10 15Tyr
Ala Ala Lys Glu Gly Asp Pro Asp Gln Leu Ser Lys Asp Glu Leu 20 25
30Lys Leu Leu Ile Gln Ala Glu Phe Pro Ser Leu Leu Lys Gly Met Asn
35 40 45Thr Leu Asp Asp Leu Phe Gln Glu Leu Asp Lys Asn Gly Asp Gly
Glu 50 55 60Val Ser Phe Glu Glu Trp Gln Val Leu Val Lys Lys Ile Ser
Gln65 70 754880PRTArtificial SequenceChemically synthesized variant
Calbindin D9k Cys 48Met Ser Thr Lys Lys Ser Pro Glu Glu Leu Lys Arg
Ile Phe Glu Lys1 5 10 15Tyr Ala Ala Lys Glu Gly Asp Pro Asp Gln Leu
Ser Lys Asp Glu Leu 20 25 30Lys Leu Leu Ile Gln Ala Glu Phe Pro Ser
Leu Leu Lys Gly Pro Asn 35 40 45Thr Leu Asp Asp Leu Phe Gln Glu Leu
Asp Lys Asn Gly Asp Gly Glu 50 55 60Val Ser Phe Glu Glu Phe Gln Val
Leu Val Lys Lys Ile Ser Gln Cys65 70 75 8049160PRTHomo sapiens
49Met Thr Asp Gln Gln Ala Glu Ala Arg Ser Tyr Leu Ser Glu Glu Met1
5 10 15Ile Ala Glu Phe Lys Ala Ala Phe Asp Met Phe Asp Ala Asp Gly
Gly 20 25 30Gly Asp Ile Ser Val Lys Glu Leu Gly Thr Val Met Arg Met
Leu Gly 35 40 45Gln Thr Pro Thr Lys Glu Glu Leu Asp Ala Ile Ile Glu
Glu Val Asp 50 55 60Glu Asp Gly Ser Gly Thr Ile Asp Phe Glu Glu Phe
Leu Val Met Met65 70 75 80Val Arg Gln Met Lys Glu Asp Ala Lys Gly
Lys Ser Glu Glu Glu Leu 85 90 95Ala Glu Cys Phe Arg Ile Phe Asp Arg
Asn Ala Asp Gly Tyr Ile Asp 100 105 110Pro Gly Glu Leu Ala Glu Ile
Phe Arg Ala Ser Gly Glu His Val Thr 115 120 125Asp Glu Glu Ile Glu
Ser Leu Met Lys Asp Gly Asp Lys Asn Asn Asp 130 135 140Gly Arg Ile
Asp Phe Asp Glu Phe Leu Lys Met Met Glu Gly Val Gln145 150 155
16050122PRTArtificial SequenceChemically synthesized variant Rat
CA1-CD2-bombesin-RGD(521)-Cend 50Arg Asp Ser Gly Thr Val Trp Gly
Ala Leu Gly His Gly Ile Glu Leu1 5 10 15Asn Ile Pro Asn Phe Gln Met
Thr Asp Asp Ile Asp Glu Val Arg Trp 20 25 30Glu Arg Gly Ser Thr Leu
Val Ala Glu Phe Lys Arg Lys Met Lys Pro 35 40 45Phe Leu Lys Ser Gly
Gly Ser Gly Gly Gly Asn Gln Trp Ala Val Gly 50 55 60His Leu Met Gly
Gly Ser Gly Gly Gly Ala Phe Glu Ile Asp Ala Asn65 70 75 80Gly Asp
Leu Asp Ile Lys Asn Leu Thr Arg Asp Asp Ser Gly Thr Tyr 85 90 95Asn
Val Thr Val Tyr Ser Thr Asn Gly Thr Arg Ile Leu Asn Lys Ala 100 105
110Leu Asp Leu Arg Ile Leu Glu Arg Gly Asp 115
12051122PRTArtificial SequenceChemically synthesized variant Rat
CA1-CD2-bombesin-RGD(521)-Nend 51Arg Gly Asp Arg Asp Ser Gly Thr
Val Trp Gly Ala Leu Gly His Gly1 5 10 15Ile Glu Leu Asn Ile Pro Asn
Phe Gln Met Thr Asp Asp Ile Asp Glu 20 25 30Val Arg Trp Glu Arg Gly
Ser Thr Leu Val Ala Glu Phe Lys Arg Lys 35 40 45Met Lys Pro Phe Leu
Lys Ser Gly Gly Ser Gly Gly Gly Asn Gln Trp 50 55 60Ala Val Gly His
Leu Met Gly Gly Ser Gly Gly Gly Ala Phe Glu Ile65 70 75 80Asp Ala
Asn Gly Asp Leu Asp Ile Lys Asn Leu Thr Arg Asp Asp Ser 85 90 95Gly
Thr Tyr Asn Val Thr Val Tyr Ser Thr Asn Gly Thr Arg Ile Leu 100 105
110Asn Lys Ala Leu Asp Leu Arg Ile Leu Glu 115
12052113PRTArtificial SequenceChemically synthesized variant Rat
CA1-CD2-bombesin-RGD-831 52Arg Asp Ser Gly Thr Val Trp Gly Ala Leu
Gly His Gly Ile Glu Leu1 5 10 15Asn Ile Pro Asn Phe Gln Met Thr Asp
Asp Ile Asp Glu Val Arg Trp 20 25 30Glu Arg Gly Ser Thr Leu Val Ala
Glu Phe Lys Arg Lys Met Lys Pro 35 40 45Phe Leu Lys Ser Gly Ala Phe
Glu Ile Asp Ala Asn Gly Asp Leu Asp 50 55 60Ile Lys Asn Leu Thr Arg
Asp Asp Ser Gly Thr Tyr Asn Val Thr Val65 70 75 80Tyr Ser Thr Gly
Gly Ser Gly Gly Arg Gly Asp Gly Gly Ser Gly Gly 85 90 95Asn Gly Thr
Arg Ile Leu Asn Lys Ala Leu Asp Leu Arg Ile Leu Glu 100 105 110Gly
53135PRTArtificial SequenceChemically synthesized variant Rat
CA1-CD2-bombesin-521-RGD-831 53Arg Gly Asp Arg Asp Ser Gly Thr Val
Trp Gly Ala Leu Gly His Gly1 5 10 15Ile Glu Leu Asn Ile Pro Asn Phe
Gln Met Thr Asp Asp Ile Asp Glu 20 25 30Val Arg Trp Glu Arg Gly Ser
Thr Leu Val Ala Glu Phe Lys Arg Lys 35 40 45Met Lys Pro Phe Leu Lys
Ser Gly Gly Ser Gly Gly Gly Asn Gln Trp 50 55 60Ala Val Gly His Leu
Met Gly Gly Ser Gly Gly Gly Ala Phe Glu Ile65 70 75 80Asp Ala Asn
Gly Asp Leu Asp Ile Lys Asn Leu Thr Arg Asp Asp Ser 85 90 95Gly Thr
Tyr Asn Val Thr Val Tyr Ser Thr Gly Gly Ser Gly Gly Arg 100 105
110Gly Asp Gly Gly Ser Gly Gly Asn Gly Thr Arg Ile Leu Asn Lys Ala
115 120 125Leu Asp Leu Arg Ile Leu Glu 130 135
* * * * *