Urine And Serum Biomarkers Associated With Diabetic Nephropathy

Abstract

Use of urine and serum biomarkers in diagnosing diabetic nephropathy, staging diabetic nephropathy, monitoring diabetic nephropathy progress, and assessing efficacy of diabetic nephropathy treatments. These biomarkers include urine precursor alpha-2-HS-glycoprotein, urine alpha-1 antitrypsin, urine alpha-1 acid glycoprotein, urine osteopontin, serum osteopontin, their fragments, and combinations thereof.

Description

RELATED APPLICATION

[0001] This application is a continuation of U.S. patent application Ser. No. 12/694,575, filed Jan. 27, 2010, which claims priority to U.S. Provisional Application No. 61/147,778, filed on Jan. 28, 2009. The contents of both prior applications are hereby incorporated by reference in their entirety.

BACKGROUND OF THE INVENTION

[0002] Diabetic nephropathy (DN) is a progressive kidney disease associated with longstanding diabetes mellitus. It causes abnormal fluid filtration and increased urinary albumin excretion, eventually leading to kidney failure.

[0003] DN displays no symptoms in its early course. As such, it is difficult to detect the incipiency of this disease. In fact, present diagnosis of DN depends on development of microalbuminuria, which occurs when kidney damage is already in place. The lack of an early diagnostic test prevents effective treatment of early stage DN.

[0004] It is of great importance to identify reliable biomarkers useful in diagnosing early stage DN.

SUMMARY OF THE INVENTION

[0005] The present invention is based on unexpected discoveries that a number of urine and serum proteins and their fragments, either alone or in combination, are differentially presented in DN patients as compared to DN-free subjects. These protein molecules are therefore useful markers for diagnosing early stage DN.

[0006] Accordingly, one aspect of this invention features a method of diagnosing DN in a subject. This method includes at least two steps: (i) determining in a subject suspected of having DN a level of a biomarker, and (ii) assessing whether the subject has DN based on the level of the biomarker. An increase in the level of the biomarker, as compared to that in a DN-free subject, indicates that the subject has DN.

[0007] The biomarker used in this diagnostic method is one of the four protein molecules listed below:

[0008] (i) a first urine protein molecule that is precursor alpha-2-HS-glycoprotein or a fragment thereof having at least ten amino acid residues, such as, mature alpha-2-HS-glycoprotein, VVSLGSPSGEVSHPRKT (SEQ ID NO:1), or MGVVSLGSPSGEVSHPRKT (SEQ ID NO:2);

[0009] (ii) a second urine protein molecule that is alpha-1 antitrypsin or a fragment thereof having at least ten amino acid residues, such as KGKWERPFEVKDTEEEDF (SEQ ID NO:3); MIEQNTKSPLFMGKVVNPTQK (SEQ ID NO:4), EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAE (SEQ ID NO:5), or EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFA (SEQ ID NO:6);

[0010] (iii) a third urine protein molecule that is a fragment of alpha-1 acid glycoprotein having at least ten amino acid residues, such as GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:7); and

[0011] (iv) a serum protein molecule that is osteopontin or a fragment thereof having at least ten amino acid residues, such as YPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSK (SEQ ID NO:8) or KYPDAVATWLNPDPSQKQNLLAPQTLPSK (SEQ ID NO:9).

[0012] The diagnostic method described above can further include, after the assessing step, a step of correlating the biomarker level with the DN status (i.e., whether it is at early or late stage). When the biomarker is protein molecules (i) or (iv), an increase in its level relative to that in a DN-free subject is indicative of late stage DN. For a biomarker that is protein molecules (ii) or (iii), its level indicates the DN status when compared with pre-determined reference biomarker levels representing early and late stage DN.

[0013] In another aspect, the present invention features a method for assessing efficacy of a DN treatment in a subject (e.g., a human patient or a laboratory animal). This method includes determining in the subject pre-treatment and post-treatment levels of protein molecules (i), (ii), (iii), or (iv), and assessing efficacy of the treatment based on a change in the level of the biomarker after the treatment. If the post-treatment level of the biomarker remains the same or decreases as compared to the pre-treatment level of the biomarker, it indicates that the treatment is effective.

[0014] In yet another aspect, this invention features a method for determining a DN stage, including at least four steps: (i) obtaining a urine sample and optionally, a serum sample from a subject suspected of having diabetic nephropathy, (ii) determining in the sample(s) a level of one of the biomarkers listed in the preceding paragraph, (iii) calculating a disease score based on the level of the biomarker, and (iv) assessing the subject's diabetic nephropathy stage based on the disease score as compared to pre-determined cutoff values indicating different diabetic nephropathy stages. In this method, the calculating step can be performed by ridge regression analysis, factor analysis, discriminant function analysis, and logistic regression analysis.

[0015] The biomarker used in the just-described DN staging method is composed of at least two of the following five protein molecules: protein molecules (i)-(iv) listed above and protein molecule (v) that is urine osteopontin or its fragment described above. In one example, the biomarker is composed of all of the five protein molecules. In another example, it is composed of at least two of protein molecules (i)-(iii) and (v).

[0016] Alternatively, the biomarker is composed of at least two of the five protein molecules listed above and additionally, one or more clinical factors, e.g., age, gender, HbA1c, albuminlcreatinine ratio (ACR), and glomerular filtration rate (GFR).

[0017] In still another aspect, the present invention provides a method for monitoring DN progress based on the level of any of the above-mentioned biomarkers. This method includes obtaining two urine samples and optionally, two serum samples, within a time span of 2 weeks to 12 months (e.g., 2-24 weeks or 3-12 months) from a subject suspected of having DN, determining in the samples a level of one of the biomarkers, calculating disease scores based on the biomarker levels, and assessing DN progress in the subject based on the disease scores. The disease score for the later-obtained samples being greater than that for the earlier-obtained samples is indicative of DN exacerbation.

[0018] The biomarkers mentioned above can also be used to assess efficacy of a DN treatment. The treatment is effective if the post-treatment level of one of the biomarkers remains unchanged or decreases as compared to the pre-treatment level of the same biomarker.

[0019] The present invention further provides a kit for use in any of the methods described above. This kit includes two, three, or four antibodies with different antigen specificities. Each of these antibodies is capable of binding to one of (i) alpha-2-HS-glycoprotein, (ii) alpha-1 antitrypsin, (iii) alpha-1 acid glycoprotein, and (iv) osteopontin. In one example, this kit contains only antibodies specific to antigens to be detected (e.g., biomarkers associated with DN) for practice one of the methods disclosed herein. Namely, it consists essentially of such antibodies.

[0020] Also within the scope of this invention is an isolated antibody specifically binding one of the following peptide:

TABLE-US-00001 (SEQ ID NO: 2) MGVVSLGSPSGEVSHPRKT, (SEQ ID NO: 3) KGKWERPFEVKDTEEEDF, (SEQ ID NO: 4) MIEQNTKSPLFMGKVVNPTQK, (SEQ ID NO: 6) EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFA, (SEQ ID NO: 7) GQEHFAHLLILRDTKTYMLADVNDEKNWGLS, (SEQ ID NO: 8) YPDAVATWLNPDPSQKQ NLLAPQNAVSSEETNDFKQETLPSK, and (SEQ ID NO: 9) KYPDAVATWLNPDPSQKQNLLAPQTLPSK.

[0021] The terms "an isolated antibody" used herein refers to an antibody substantially free from naturally associated molecules. More specifically, a preparation containing the antibody is deemed as "an isolated antibody" when the naturally associated molecules in the preparation constitute at most 20% by dry weight. Purity can be measured by any appropriate method, e.g., column chromatography, polyacrylamide gel electrophoresis, and HPLC.

[0022] Any of the antibodies described above can be used in manufacturing a kit useful in practicing any of the methods of this invention.

[0023] The details of one or more embodiments of the invention are set forth in the description below. Other features or advantages of the present invention will be apparent from the following drawings and detailed description of several embodiments, and also from the appended claims.

BRIEF DESCRIPTION OF THE DRAWING

[0024] The drawing is first described.

[0025] FIG. 1 is a diagram showing boxplots for urine alpha-2-HS-glycoprotein (uDN2; see panel A), urine alpha-1 antitrypsin (uDN5; see panel B), urine alpha-1 acid glycoprotein (uGR3; see panel C), and serum osteopontin (sDNO; see panel D) in various groups of DN patients. The upper and lower limits of the boxes mark the 25% and 75% values with the medians as the lines across the boxes. The upper whisker marks the largest value below the upper fence, which is the 75% value plus 1.5 interquartile range and the lower whisker marks the smallest value above the lower fence, which is the 25% value minus 1.5 interquartile range.

DETAILED DESCRIPTION OF THE INVENTION

[0026] DN is a kidney disorder associated with diabetes. It has five progression phases:

[0027] Stage 1: characterized by diabetic mellitus with normal GFR and normal albuminuria (ACR<30 mg/g);

[0028] Stage 2: characterized by glomerular hyperfiltration (greater than 120 mL/minute/1.73 m.sup.2) and renal enlargement accompanying with normal GFR and normal albuminuria(ACR<30 mg/g);

[0029] Stage 3: characterized by microalbuminuria;

[0030] Stage 4: characterized by overt albuminuria and a progressive decline in GFR; and

[0031] Stage 5: characterized by a GFR of less than 15 mL/minute/1.73 m.sup.2.

Commonly, stages 1-3 are deemed as early stage and stages 4 and 5 are deemed as late stage.

[0032] We have identified a number of biomarkers associated with DN, especially DN in different stages. These biomarkers are composed of one or more of the following four proteins and their fragments, either in urine or in serum: (a) alpha-2-HS-glycoprotein (GenBank accession no. NP.sub.--001613; 10 Jan. 2010); (b) alpha-1-antitrypsin (GenBank accession no. AAB59495; 10 Jan. 2010); (c) alpha-1 acid glycoprotein (GenBank accession no. EAW87416; 10 Jan. 2010); and

(d) Osteopontin, which includes two isoforms known as secreted phosphoprotein 1a (GenBank accession no. NP.sub.--001035147; 17 Jan. 2010) and secreted phosphoprotein 1b (GenBank accession no. NP.sub.--000573; 10 Jan. 2010,).

[0033] The fragments of these four proteins have a minimum length of ten amino acids and preferably, a maximum length of 190 to 410 amino acids. For example, fragments of proteins (a), (b), (c), and (d) can contain up to 357, 408, 191, and 290 amino acid residues, respectively.

[0034] We have also found that biomarkers composed of one or more of the above mentioned proteins/fragments, and one or more clinical factors (e.g., age, gender, HbA1c, ACR, and GFR) are also associated with DN in different stages.

[0035] Accordingly, one aspect of the present invention relates to a DN diagnostic method using any of the biomarkers described above. To practice this method, a urine sample and, when necessary, a serum sample, is collected from a subject suspected of having DN and the urine and serum levels of one or more of the four proteins listed above or their fragments can be determined via routine methods, e.g., mass spectrometry and immune analysis. If applicable, the clinical factors are determined by route methods.

[0036] When a biomarker contains a single protein molecule, its level in a subject can be compared with a reference point to determine whether that subject has DN. The reference point, representing the level of the same biomarker in a DN-free subject, can be determined based on the representative levels of the biomarker in groups of DN patients and DN-free subjects. For example, it can be the middle point between the mean levels of these two groups. A biomarker level higher than the reference point is indicative of DN.

[0037] When a biomarker contains at least two protein molecules and optionally, at least one clinical factor, the levels of the protein molecules and the value(s) of the clinical factor(s) can be subjected to a suitable analysis to generate a disease score (e.g., represented by a numeric number) that characterizes the level of the biomarkers. Examples of the analysis include, but are not limited to, discriminate function analysis, logistic regression analysis, ridge regression analysis, principal component analysis, factor analysis, and generalized linear model. The disease score is then compared with a reference point representing the level of the same biomarker in DN-free subjects. The reference point can be determined by conventional methods. For example, it can be a score obtained by analyzing the mean levels of the protein molecules and when necessary, the mean value(s) of the clinical factor(s) in DN-free subjects with the same analysis. The disease score being higher than the reference point is indicative of DN presence.

[0038] Another aspect of this invention relates to a method for determining a DN stage based on any of the biomarkers described above. To practice this method, a biomarker level of a DN patient, preferably represented by a disease score, is compared with a set of pre-determined cutoff values that distinguish different DN stages to determine the subject's DN stage. The cutoff values can be determined by analyzing the representative levels of the same biomarker in different-staged DN patients via the same analysis.

[0039] Described below is an exemplary procedure for determining the aforementioned cutoff values based on a biomarker associated with DN in different stages:

[0040] (1) assigning DN patients to different groups according to their disease conditions (e.g., DN stages and risk factors);

[0041] (2) determining in each patient group the levels/values of the protein molecules and clinical factors constituting the biomarker;

[0042] (4) subjecting the protein levels and clinical factor values to a suitable analysis to establish a model (e.g., formula) for calculating a disease score, and

[0043] (6) determining a cutoff value for each disease stage based on a disease score (e.g., mean value) representing each patient group, as well as other relevant factors, such as sensitivity, specificity, positive predictive value (PPV) and negative predictive value (NPV).

[0044] Any of the models thus generated can be assessed for its diagnosis value by a receiver-operating characteristic (ROC) analysis to create a ROC curve. An optimal multivariable model provides a large Area under Curve (AUC) in the ROC analysis. See the models described in Examples 1-3 below.

[0045] In still another aspect, this invention relates to a method of monitoring nephropathy progress in a subject based on any of the biomarkers described above. More specifically, two urine samples and/or serum samples from a subject can be obtained within a suitable time span (e.g., 2 weeks to 12 months) and examined to determine the levels of one of the biomarkers. Disease scores are then determined as described above. If the disease score representing the biomarker level in the later obtained sample(s) is lower than that in the earlier-obtained sample(s), it indicates DN exacerbation in the subject.

[0046] The monitoring method can be applied to a human subject suffering from or at risk for DN. When the human subject is at risk for or in early stage DN, the level of the biomarker can be examined once every 6 to 12 months to monitor DN progress. When the human subject is already in late stage DN, it is preferred that the biomarker level be examined once every 3 to 6 months.

[0047] The monitoring method described above is also applicable to laboratory animals, following routine procedures, to study DN. The term "a laboratory animal" used herein refers to a vertebrate animal commonly used in animal testing, e.g., mouse, rat, rabbit, cat, dog, pig, and non-human primate. Preferably, a laboratory animal is examined to determine the biomarker level once every 2 to 24 weeks.

[0048] Any of the biomarkers can also be used to assess efficacy of a DN treatment in a subject in need (i.e., a human DN patient or a laboratory animal bearing DN). In this method, disease scores representing levels of one of the biomarkers described above are determined before, during, and after the treatment. If the disease scores remain the same or decline over the course of the treatment, it indicates that the treatment is effective.

[0049] Also disclosed herein is a kit useful in practicing any of the above-described methods. This kit contains two, three, or four antibodies with different antigen specificities. Each of these antibodies is capable of binding to one of (i) alpha-2-HS-glycoprotein, (ii) alpha-1 antitrypsin, (iii) alpha-1 acid glycoprotein, or (iv) osteopontin. The antibodies specific to proteins (i), (ii), (iii), and (iv) can bind to their fragments MGVVSLGSPSGEVSHPRKT (SEQ ID NO:2), KGKWERPFEVKDTEEEDF (SEQ ID NO:3), MIEQNTKSPLFMGKVVNPTQK (SEQ ID NO:4), EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFA (SEQ ID NO:6), GQEHFAHLLILRDTKTYMLADVNDEKNWGLS (SEQ ID NO:7), YPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSK (SEQ ID NO:8), and KYPDAVATWLNPDPSQKQNLLAPQTLPSK (SEQ ID NO:9), i.e., specific to any antibody epitopes contained in these fragments. In one example, this kit contains only antibodies specific to antigens to be detected (e.g., protein molecules associated with DN) for practice one of the methods disclosed herein. Namely, the kit consists essentially of such antibodies.

[0050] The kit described above can include two different antibodies (i.e., a coating antibody and a detecting antibody) that bind to the same antigen. Typically, the detecting antibody is conjugated with a molecule which emits a detectable signal either on its own or via binding to another agent. The term "antibody" used herein refers to a whole immunoglobulin or a fragment thereof, such as Fab or F(ab').sub.2 that retains antigen-binding activity. It can be naturally occurring or genetically engineered (e.g., single-chain antibody, chimeric antibody, or humanized antibody).

[0051] The antibodies included in the kit of this invention can be obtained from commercial vendors. Alternatively, they can be prepared by conventional methods. See, for example, Harlow and Lane, (1988) Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, New York. To produce antibodies against a particular biomarker as listed above, the marker, optionally coupled to a carrier protein (e.g., KLH), can be mixed with an adjuvant, and injected into a host animal. Antibodies produced in the animal can then be purified by affinity chromatography. Commonly employed host animals include rabbits, mice, guinea pigs, and rats. Various adjuvants that can be used to increase the immunological response depend on the host species and include Freund's adjuvant (complete and incomplete), mineral gels such as aluminum hydroxide, CpG, surface-active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, and dinitrophenol. Useful human adjuvants include BCG (bacille Calmette-Guerin) and Corynebacterium parvum. Polyclonal antibodies, i.e., heterogeneous populations of antibody molecules, are present in the sera of the immunized animal.

[0052] Monoclonal antibodies, i.e., homogeneous populations of antibody molecules, can be prepared using standard hybridoma technology (see, for example, Kohler et al. (1975) Nature 256, 495; Kohler et al. (1976) Eur. J. Immunol. 6, 511; Kohler et al. (1976) Eur J Immunol 6, 292; and Hammerling et al. (1981) Monoclonal Antibodies and T Cell Hybridomas, Elsevier, N.Y.). In particular, monoclonal antibodies can be obtained by any technique that provides for the production of antibody molecules by continuous cell lines in culture such as described in Kohler et al. (1975) Nature 256, 495 and U.S. Pat. No. 4,376,110; the human B-cell hybridoma technique (Kosbor et al. (1983) Immunol Today 4, 72; Cole et al. (1983) Proc. Natl. Acad. Sci. USA 80, 2026, and the EBV-hybridoma technique (Cole et al. (1983) Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96). Such antibodies can be of any immunoglobulin class including IgG, IgM, IgE, IgA, IgD, and any subclass thereof. The hybridoma producing the monoclonal antibodies of the invention may be cultivated in vitro or in vivo. The ability to produce high titers of monoclonal antibodies in vivo makes it a particularly useful method of production.

[0053] Moreover, antibody fragments can be generated by known techniques. For example, such fragments include, but are not limited to, F(ab').sub.2 fragments that can be produced by pepsin digestion of an antibody molecule, and Fab fragments that can be generated by reducing the disulfide bridges of F(ab').sub.2 fragments.

[0054] Without further elaboration, it is believed that one skilled in the art can, based on the above description, utilize the present invention to its fullest extent. The following specific embodiments are, therefore, to be construed as merely illustrative, and not limitative of the remainder of the disclosure in any way whatsoever. All publications cited herein are incorporated by reference.

EXAMPLE 1

Diagnosing DN Based on Urine Alpha-2-HS-Glycoprotein, Urine Alpha-1 Antitrypsin, Urine Alpha-1 Acid Glycoprotein, or Serum Osteopontin

Material and Methods

(i) Subjects

[0055] 83 diabetic mellitus patients (designated "DM subjects"), and 82 DN patients (designated "DN subjects") were recruited at the Tri-General Military Hospital in Taipei, Taiwan, following the standards set forth by the American Diabetic Association and also described below:

[0056] DM: suffering from diabetic mellitus but free of DN (see the standards described below);

[0057] DN: suffering from diabetic mellitus and secreting urinary protein at a level greater than 1 g per day, having DN as proven by biopsy, or having uremia.

[0058] All of the subjects were assigned into a training group and a testing group at a ratio of 7:3.

(ii) Sample Collection and Processing

[0059] First-morning-void urinary samples and serum samples were collected from each of the subjects mentioned above. Peptides contained in the urine samples were examined by urinary matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF-MS) and by isobaric tags for relative and absolute quantification (iTRAQ).

[0060] Protein molecules, including alpha-2-HS-glycoprotein (DN2), alpha-1-anthtrypsin (DN5), osteopontin (DNO), and alpha-1 acid glycoprotein (GR3), were examined to determine their concentrations in both the urine and serum samples by ELISA. Briefly, urine samples were mixed with protease inhibitors and diluted at 1:100 with a dilution buffer and the serum samples were diluted at 1:10. The diluted samples were placed in ELISA plates in triplicates. The levels of DNO, DN2, DN5 and GR3 concentrations were measured via the standard sandwich ELISA method.

[0061] A 5-parameter standard curve was used for concentration calculation. Only standards and samples with % CV of less than 15 were included, those not meeting criteria were repeated. The protein levels in the urine samples were normalized against the creatinine levels in the same urine samples, which were measured with the Quantichrom Creatinine Assay (BioAssay Systems, (Hayward) Calif., USA).

(iii) Statistical Analysis

[0062] The data indicating the urine and serum protein concentrations of each examined protein was statistically analyzed and performed as represented by auROC from 0.44-0.87 in their independent ability to distinguish DN subjects from DM subjects.

[0063] For each subject, correlation between values was determined by Spearman or Pearson analysis depending on results of test for normality. Group mean or median comparisons were made with the Student T-test or the Nonparametric Mann-Whitney Test as appropriate. Statistical significance was obtained when p<0.05. Statistics were presented either as mean .+-.standard error of mean (SEM) or as median with [25%, 75%].

[0064] Results

(i) Patient Characteristics

[0065] Tables 1 and 2 below show the characteristics of patients in the training group and testing group and those in DM, and DN groups.

TABLE-US-00002 TABLE 1 Training Testing (n = 118) (n = 47) P value Characteristics of Patients in Training and Testing Groups Age, mean (SD) 59.94 (9.37) 60.28 (9.48) 0.8362 Female, n (%) 83 (70) 27 (57) 0.16 MDRD_S_GFR, mean (SD) 86.56 (33.11) 83.05 (43.96) 0.5785 ACR(ug/mg), mean (SD) 737.82 (1465.47) 1084.18 (2030.98) 0.2239 Urine TP/Cr (mg/mg), mean (SD) 1.01 (2.01) 1 (1.78) 0.9963 Serum Creatinine (mg/dL), mean (SD) 1.02 (0.87) 1.34 (1.44) 0.0903 HbA1c (%), mean (SD) 8.49 (1.5) 8.29 (2.19) 0.5356 Markers (creatinine-adjusted), mean (SD) uDNO (ng/mg) 1452.71 (1416.7) 1488.77 (1222.2) 0.8687 sDNO (ng/ml) 40.65 (34.52) 38.35 (34.13) 0.6926 uDN2 (ng/mg) 4225.77 (9279.63) 5999.64 (10305.95) 0.2983 uDN5 (ng/mg) 15951.12 (94956.78) 45479.82 (199827.84) 0.3228 uGR3 (ng/mg) 32823.47 (62290.96) 42709.23 (103787.54) 0.5333

[0066] Statistically significant differences in GFR, ACR, protein, and serum creatinine levels were observed in the DN subjects versus in the DM subjects. There was no difference in gender distribution among the groups.

TABLE-US-00003 TABLE 2 Characteristics of Patients in DM and DN Groups Training (n = 118) Testing (n = 47) DM (n = 61) DN (n = 57) P value DM (n = 22) DN (n = 25) P value Age, mean (SD) 57.11 (8.05) 62.96 (9.8) 0.0006 59.09 (8.82) 61.32 (10.09) 0.4230 Female, n (%) 43 (70) 40 (70) 1.00 12 (55) 15 (60) 0.93 MDRD_S_GFR, mean (SD) 111.21 (15.75) 60.18 (25.59) <.0001 115.6 (33.66) 54.41 (29.79) <.0001 ACR (ug/mg), mean (SD) 11.35 (6.81) 1515.26 (1815.72) <.0001 9.63 (5.61) 2029.78 (2432.31) 0.0004 Urine TP/Cr (mg/mg), mean (SD) 0.17 (0.51) 1.9 (2.56) <.0001 0.17 (0.32) 1.7 (2.18) 0.0019 Serum Creatinine 0.66 (0.12) 1.42 (1.12) <.0001 0.67 (0.15) 1.92 (1.79) 0.0019 (mg/dL), mean (SD) HbA1c (%), mean (SD) 8.34 (1.48) 8.7 (1.53) 0.2311 8.37 (1.61) 8.22 (2.66) 0.8238 Markers (creatinine-adjusted), mean (SD) uDNO (ng/mg) 1422.18 (1105.46) 1366.77 (1347.92) 0.8083 1769.54 (1260.15) 1516.44 (1945.7) 0.5953 sDNO (ng/ml) 29.03 (19.32) 46.17 (37.32) 0.0026 26.2 (11.53) 64.52 (50.47) 0.0010 uDN2 (ng/mg) 1968.47 (4218.58) 8084.87 (13101.68) 0.0013 968.79 (1144.47) 7348.69 (10865.95) 0.0074 uDN5 (ng/mg) 390.24 (1327.63) 40036.86 (147186.58) 0.0467 336.21 (568.08) 71802.69 (264863.27) 0.1899 uGR3 (ng/mg) 3576.06 (13562.8) 67470.92 (105208.28) <.0001 2447.77 (2742.38) 71693.1 (82996.86) 0.0003

(ii) Protein Molecules Associated with DN

[0067] Via urine proteomic analysis, the peptides listed in Table 3 below were found to be differentially presented in urine samples from the DM subjects and DN subjects.

TABLE-US-00004 TABLE 3 Differentially Presented Urine/Serum Peptides and Proteins in Which They are Located Corresponding Peptide Sequences Proteins VVSLGSPSGEVSHPRKT Alpha-2-HS (SEQ ID NO: 1) glycoprotein MGVVSLGSPSGEVSHPRKT (DN2) (SEQ ID NO: 2) KGKWERPFEVKDTEEEDF Alpha-1- (SEQ ID NO: 3) antitrypsin MIEQNTKSPLFMGKVVNPTQK (DN5) (SEQ ID NO: 4) EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAE (SEQ ID NO: 5) EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFA (SEQ ID NO:6) YPDAVATWLNPDPSQKQ Osteopontin NLLAPQNAVSSEETNDFKQETLPSK (DNO) (SEQ ID NO: 8) GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS Alpha-1 acid (SEQ ID NO: 7) glycoprotein (GR3)

[0068] Via ELISA analysis, three urine protein molecules, i.e., uDN2, uGR3, and uDN5, and one serum protein molecule, i.e., sDNO, were found to be associated with DN. See FIG. 1, panels A-D and Table 2 above. More specifically, the levels of uDN2, uDN5, uGR3, and sDNO were found to be elevated in DN subjects as compared with DMs (free of DN), indicating that they are reliable markers for DN. Further, the levels of uDN5 and uGR3 in DN subjects exhibiting macroalbumiuria (ACR>300 mg/g) were higher than those in DN subjects exhibiting microalbumiuria (ACR 30 mg/g to 300 mg/g). Macroalbumiuria is an indicator of late stage DN and microalbumiuria indicates early stage DN.

EXAMPLE 2

Staging DN Based on a Combination of uDN2, uDN5, uGR3, uDNO, and sDNO

Two Protein Model

[0069] The combined levels of two of uDN2, uDN5, uGR3, uDNO, and sDNO in DM subjects, and DN subjects were subjected to discriminant function analysis, logistic regression analysis, and ridge regression analysis. The results from this study indicate that any combination of two of the five proteins or their fragments can be used as reliable markers for determining DN stages.

[0070] Shown below is an exemplary two-protein model, i.e., uDN5 and uGR3, including equations for calculating disease scores based on the combined levels of these two protein molecules. Also shown below are tables (i.e., Tables 4- 9) listing cutoff values, sensitivities, specificities, positive predictive values (PPV) and negative predictive values (NPV), and area under the ROC curve (AUROC) for this two-protein model.

Discriminant Function Analysis:

[0071] Disease Score=0.3303.times.log.sub.2[uDN5](ng/mg)+0.2732.times.log.sub.2[uGR3](ng- /mg)+5

TABLE-US-00005 TABLE 4 Cutoff Values Representing DN Early and Late Stages Indicated by Urine Albumin Levels Training set (n = 118) Testing set (n = 47) DM, Micro DM, Micro albuminuria albuminuria vs. vs. Macro Macro DM vs. DN albuminuria DM vs. DN albuminuria Cut-off 11.227 11.691 11.227 11.691 Sensitivity (%) 93 93 96 100 Specificity (%) 90 90 77 83 PPV (%) 90 83 83 78 NPV (%) 93 96 94 100 AUROC 0.95 0.96 0.98 0.96

TABLE-US-00006 TABLE 5 Cutoff Values Representing DN Stages 1-5 Training set (n = 118) Testing set (n = 47) DN-Stage 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 Cut-off 11.066 11.227 11.691 14.017 11.066 11.227 11.691 14.017 Sensitivity (%) 75 93 93 75 84 96 100 100 Specificity (%) 89 90 90 90 75 77 83 80 PPV (%) 92 90 83 21 87 83 78 18 NPV (%) 69 93 96 99 71 94 100 100 AUROC 0.86 0.95 0.96 0.95 0.9 0.98 0.96 0.91

Logistic Regression Analysis:

[0072] Disease Score=exp(Logit_value)/(1+exp(Logit_value)), in which

Logit_value=-12.5332+0.7197.times.log.sub.2[uDN5](ng/mg)+0.4941.times.lo- g.sub.2[uGR3](ng/mg)

TABLE-US-00007 TABLE 6 Cutoff Values Representing DN Early and Late Stages Indicated by Urine Albumin Levels Training set (n = 118) Testing set (n = 47) DM, Micro DM, Micro albuminuria albuminuria vs. vs. Macro Macro DM vs. DN albuminuria DM vs. DN albuminuria Cut-off 0.445 0.676 0.445 0.676 Sensitivity (%) 93 93 100 100 Specificity (%) 90 90 82 83 PPV (%) 90 83 86 78 NPV (%) 93 96 100 100 AUROC 0.95 0.96 0.98 0.97

TABLE-US-00008 TABLE 7 Cutoff Values Representing DN Stages 1-5 Training set (n = 118) Testing set (n = 47) DN-Stage 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 Cut-off 0.383 0.445 0.676 0.996 0.383 0.445 0.676 0.996 Sensitivity (%) 75 93 93 75 84 100 100 50 Specificity (%) 89 90 90 90 75 82 83 80 PPV (%) 92 90 83 21 87 86 78 10 NPV (%) 69 93 96 99 71 100 100 97 AUROC 0.86 0.95 0.96 0.95 0.9 0.98 0.97 0.88

Ridge Regression Analysis:

[0073] Disease Score=-1.7697+0.1520.times.log.sub.2[uDN5](ng/mg)+0.2254.times.log.sub.2[- uGR3](ng/mg)

TABLE-US-00009 TABLE 8 Cutoff Values Representing DN Early and Late Stages Indicated by Urine Albumin Levels Training set (n = 118) Testing set (n = 47) DM, Micro DM, Micro albuminuria albuminuria vs. vs. Macro Macro DM vs. DN albuminuria DM vs. DN albuminuria Cut-off 2.254 2.606 2.254 2.606 Sensitivity (%) 93 93 100 94 Specificity (%) 90 90 77 79 PPV (%) 90 83 83 74 NPV (%) 93 96 100 96 AUROC 0.94 0.96 0.98 0.96

TABLE-US-00010 TABLE 9 Cutoff Values Representing DN Stages 1-5 Training set (n = 118) Testing set (n = 47) DN-Stage 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 Cut-off 2.185 2.254 2.606 4.016 2.185 2.254 2.606 4.016 Sensitivity (%) 75 93 93 75 84 100 94 100 Specificity (%) 89 90 90 90 75 77 79 84 PPV (%) 92 90 83 21 87 83 74 22 NPV (%) 69 93 96 99 71 100 96 100 AUROC 0.86 0.94 0.96 0.95 0.89 0.98 0.96 0.91

Three Protein Model

[0074] The combined levels of three of uDN2, uDN5, uGR3, uDNO, and sDNO in DM subjects and DN subjects were subjected to discriminant function analysis, logistic regression analysis, factor analysis, and ridge regression analysis. The results indicate that any three-protein combination can be used as a reliable marker for DN staging.

[0075] Shown below is an exemplary three-protein model, i.e., uDN2, uDN5 and uGR3, including equations for calculating disease scores based on the combined levels of these three protein molecules. Also shown below are tables (i.e., Tables 10- 17) listing cutoff values, sensitivities, specificities, PPV, NPV, and AUROC for this three-protein model.

Discriminant Function Analysis

[0076] Disease Score=0.3340.times.log.sub.2[uDN5](ng/mg)-0.0142.times.log.sub.2[uDN2](ng- /mg)+0.2784.times.log.sub.2[uGR3](ng/mg)+5

TABLE-US-00011 TABLE 10 Cutoff Values Representing DN Early and Late Stages Indicated by Urine Albumin Levels Training set (n = 118) Testing set (n = 47) DM, Micro DM, Micro albuminuria albuminuria vs. vs. Macro Macro DM vs. DN albuminuria DM vs. DN albuminuria Cut-off 11.190 11.663 11.190 11.663 Sensitivity (%) 93 93 96 100 Specificity (%) 90 90 77 83 PPV (%) 90 83 83 78 NPV (%) 93 96 94 100 AUROC 0.95 0.96 0.98 0.96

TABLE-US-00012 TABLE 11 Cutoff Values Representing DN Stages 1-5 Training set (n = 118) Testing set (n = 47) DN Stage 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 Cut-off 11.064 11.190 11.663 13.986 11.064 11.190 11.663 13.986 Sensitivity (%) 75 93 93 75 84 96 100 100 Specificity (%) 89 90 90 90 75 77 83 82 PPV (%) 92 90 83 21 87 83 78 20 NPV (%) 69 93 96 99 71 94 100 100 AUROC 0.87 0.95 0.96 0.95 0.9 0.98 0.96 0.91

Factor Analysis

[0077] Disease Score=0.9190.times.log.sub.2[uDN5](ng/mg)+0.6997.times.log.sub.2[uDN2](ng- /mg)+0.9003.times.log.sub.2[uGR3](ng/mg)

TABLE-US-00013 TABLE 12 Cutoff Values Representing DN Early and Late Stages Indicated by Urine Albumin Levels Training set Testing set (n = 118) (n = 47) DM, Micro DM, Micro albuminuria albuminuria vs. vs. Macro Macro DM vs. DN albuminuria DM vs. DN albuminuria Cut-off 26.356 28.057 26.356 28.057 Sensitivity (%) 84 93 88 100 Specificity (%) 90 90 91 86 PPV (%) 89 83 92 82 NPV (%) 86 96 87 100 AUROC 0.93 0.95 0.99 0.97

TABLE-US-00014 TABLE 13 Cutoff Values Representing DN Stages 1-5 Training set (n = 118) Testing set (n = 47) DN Stage 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 Cut-off 25.669 26.356 28.057 36.464 25.669 26.356 28.057 36.464 Sensitivity (%) 68 84 93 75 84 88 100 50 Specificity (%) 89 90 90 90 88 91 86 84 PPV (%) 91 89 83 21 93 92 82 12 NPV (%) 63 86 96 99 74 87 100 97 AUROC 0.83 0.93 0.95 0.95 0.91 0.99 0.97 0.86

Logistic Regression Analysis:

[0078] Disease Score=exp(Logit_value)/(1+exp(Logit_value)), in which

Logit value=-11.2820+0.8810.times.log.sub.2[uDN5](ng/mg)-0.3478.times.lo- g.sub.2[uDN2](ng/mg)+0.5576.times.log.sub.2[uGR3](ng/mg)

TABLE-US-00015 TABLE 14 Cutoff Values Representing DN Early and Late Stages Indicated by Urine Albumin Levels Training set Testing set (n = 118) (n = 47) DM, Micro DM, Micro albuminuria albuminuria vs. vs. Macro Macro DM vs. DN albuminuria DM vs. DN albuminuria Cut-off 0.462 0.798 0.462 0.798 Sensitivity (%) 91 88 96 94 Specificity (%) 90 90 82 83 PPV (%) 90 82 86 77 NPV (%) 92 93 95 96 AUROC 0.95 0.96 0.97 0.95

TABLE-US-00016 TABLE 15 Cutoff Values Representing DN Stages 1-5 Training set (n = 118) Testing set (n = 47) DN Stage 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 Cut-off 0.361 0.462 0.798 0.997 0.361 0.462 0.798 0.997 Sensitivity (%) 75 91 88 75 90 96 94 100 Specificity (%) 89 90 90 90 75 82 83 82 PPV (%) 92 90 82 21 88 86 77 20 NPV (%) 69 92 93 99 80 95 96 100 AUROC 0.88 0.95 0.96 0.95 0.89 0.97 0.95 0.93

Ridge Regression Analysis:

[0079] Disease Score=-1.2900+0.1800.times.log.sub.2[uDN5](ng/mg)-0.1013.times.log.sub.2[- uDN2](ng/mg)+0.2505.times.log.sub.2[uGR3](ng/mg)

TABLE-US-00017 TABLE 16 Cutoff Values Representing DN Early and Late Stages Indicated by Urine Albumin Levels Training set Testing set (n = 118) (n = 47) DM, Micro DM, Micro albuminuria albuminuria vs. vs. Macro Macro DM vs. DN albuminuria DM vs. DN albuminuria Cut-off 2.122 2.831 2.122 2.831 Sensitivity (%) 95 85 100 94 Specificity (%) 90 90 68 86 PPV (%) 90 81 78 81 NPV (%) 95 92 100 96 AUROC 0.95 0.95 0.97 0.95

TABLE-US-00018 TABLE 17 Cutoff Values Representing DN Stages 1-5 Training set (n = 118) Testing set (n = 47) DN Stage 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 Cut-off 2.083 2.122 2.831 3.943 2.083 2.122 2.831 3.943 Sensitivity (%) 78 95 85 75 87 100 94 100 Specificity (%) 89 90 90 90 69 68 86 82 PPV (%) 92 90 81 21 84 78 81 20 NPV (%) 71 95 92 99 73 100 96 100 AUROC 0.88 0.95 0.95 0.95 0.89 0.97 0.95 0.93

Four-Protein Model

[0080] The combined levels of four of uDN2, uDN5, uGR3, uDNO, and sDNO in DM subjects and DN subjects were subjected to discriminant function analysis, logistic regression analysis, factor analysis, and ridge regression analysis. The results indicate that any combination of four of the five proteins or their fragments can be used as a reliable marker for determining DN stages.

[0081] Shown below is an exemplary four-protein model, i.e., uDN2, uDN5, uGR3, and sDNO, including equations for calculating disease scores based on the combined levels of these four protein molecules. Also shown below are tables (i.e., Tables 18-25) listing cutoff values, sensitivities, specificities, PPVs, NPVs, and AUROC for this four-protein model.

Discriminant Function Analysis:

[0082] Disease Score=0.2972.times.log.sub.2[uDN5](ng/mg)+0.0159.times.log.sub.2[uDN2](ng- /mg)+0.2014.times.log.sub.2[uGR3](ng/mg)+0.5688.times.log.sub.2[sDNO](ng/m- l)+5

TABLE-US-00019 TABLE 18 Cutoff Values Representing DN Early and Late Stages Indicated by Urine Albumin Levels Training set Testing set (n = 118) (n = 47) DM, Micro DM, Micro albuminuria albuminuria vs. vs. Macro Macro DM vs. DN albuminuria DM vs. DN albuminuria Cut-off 12.945 13.520 12.945 13.520 Sensitivity (%) 88 95 96 100 Specificity (%) 90 90 82 86 PPV (%) 89 83 86 82 NPV (%) 89 97 95 100 AUROC 0.94 0.96 0.97 0.97

TABLE-US-00020 TABLE 19 Cutoff Values Representing DN Stages 1-5 Training set (n = 118) Testing set (n = 47) DN-Stages 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 Cut-off 12.887 12.945 13.520 15.560 12.887 12.945 13.520 15.560 Sensitivity (%) 73 88 95 100 81 96 100 100 Specificity (%) 89 90 90 90 81 82 86 82 PPV (%) 91 89 83 27 89 86 82 20 NPV (%) 67 89 97 100 68 95 100 100 AUROC 0.87 0.94 0.96 0.97 0.93 0.97 0.97 0.89

Factor Analysis:

[0083] Disease Score=0.9132.times.log.sub.2[uDN5](ng/mg)+0.6950.times.log.sub.2[uDN2](ng- /mg)+0.9080.times.log.sub.2[uGR3](ng/mg)+0.4549.times.log.sub.2[sDNO](ng/m- l)

TABLE-US-00021 TABLE 20 Cutoff Values Representing DN Early and Late Stages Indicated by Urine Albumin Levels Training set Testing set (n = 118) (n = 47) DM, Micro DM, Micro albuminuria albuminuria vs. Macro vs. Macro DM vs. DN albuminuria DM vs. DN albuminuria Cut-off 28.459 30.095 28.459 30.095 Sensitivity (%) 82 93 92 100 Specificity (%) 90 90 91 83 PPV (%) 89 83 92 78 NPV (%) 85 96 91 100 AUROC 0.93 0.96 0.99 0.98

TABLE-US-00022 TABLE 21 Cutoff Values Representing DN Stages 1-5 Training set (n = 118) Testing set (n = 47) DN-Stage 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 Cut-off 28.347 28.459 30.095 38.624 28.347 28.459 30.095 38.624 Sensitivity (%) 67 82 93 75 81 92 100 50 Specificity (%) 89 90 90 90 94 91 83 84 PPV (%) 91 89 83 21 96 92 78 12 NPV (%) 62 85 96 99 71 91 100 97 AUROC 0.84 0.93 0.96 0.95 0.92 0.99 0.98 0.86

Logistic Regression Analysis:

[0084] Disease Score=exp(Logit_value)/(1+exp(Logit_value)), in which

Logit_value=-13.7529+0.9460.times.log.sub.2[uDN5](ng/mg)-0.3110.times.lo- g.sub.2[uDN2](ng/mg)+0.4957.times.log.sub.2[uGR3](ng/mg)+0.4787.times.log.- sub.2[sDNO](ng/ml)

TABLE-US-00023 TABLE 22 Cutoff Values Representing DN Early and Late Stages Indicated by Urine Albumin Levels Training set (n = 118) Testing set (n = 47) DM, Micro DM, Micro albuminuria albuminuria vs. vs. Macro Macro DM vs. DN albuminuria DM vs. DN albuminuria Cut-off 0.423 0.804 0.423 0.804 Sensitivity (%) 91 88 96 100 Specificity (%) 90 90 77 86 PPV (%) 90 82 83 82 NPV (%) 92 93 94 100 AUROC 0.96 0.96 0.97 0.96

TABLE-US-00024 TABLE 23 Cutoff Values Representing DN States 1-5 Training set (n = 118) Testing set (n = 47) DN-Stages 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 Cut-off 0.341 0.423 0.804 0.998 0.341 0.423 0.804 0.998 Sensitivity (%) 75 91 88 75 90 96 100 100 Specificity (%) 89 90 90 90 75 77 86 82 PPV (%) 92 90 82 21 88 83 82 20 NPV (%) 69 92 93 99 80 94 100 100 AUROC 0.89 0.96 0.96 0.96 0.91 0.97 0.96 0.9

Ridge Regression Analysis:

[0085] Disease Score=-1.7588+0.1729.times.log.sub.2[uDN5](ng/mg)-0.0971.times.log.sub.2[- uDN2](ng/mg)+0.2381.times.log.sub.2[uGR3](ng/mg)+0.1312.times.log.sub.2[sD- NO](ng/ml)

TABLE-US-00025 TABLE 24 Cutoff Values Representing DN Early and Late Stages Indicated by Urine Albumin Levels Training set Testing set (n = 118) (n = 47) DM, Micro DM, Micro albuminuria albuminuria vs. vs. Macro Macro DM vs. DN albuminuria DM vs. DN albuminuria Cut-off 2.261 2.854 2.261 2.854 Sensitivity (%) 91 85 96 94 Specificity (%) 90 90 77 90 PPV (%) 90 81 83 85 NPV (%) 92 92 94 96 AUROC 0.95 0.95 0.97 0.95

TABLE-US-00026 TABLE 25 Cutoff Values Representing DN Stages 1-5 Training set (n = 118) Testing set (n = 47) DN-Stage 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 Cut-off 2.079 2.261 2.854 3.950 2.079 2.261 2.854 3.950 Sensitivity (%) 77 91 85 75 87 96 94 100 Specificity (%) 89 90 90 90 69 77 90 82 PPV (%) 92 90 81 21 84 83 85 20 NPV (%) 70 92 92 99 73 94 96 100 AUROC 0.89 0.95 0.95 0.95 0.89 0.97 0.95 0.93

Five-Protein Model

[0086] The combined levels of uDN2, uDN5, uGR3, uDNO, and sDNO in DM subjects and DN subjects were subjected to discriminant function analysis, logistic regression analysis, factor analysis, and ridge regression analysis. The results indicate that the combination of these five proteins or their fragments can be used as a reliable marker for determining DN stages.

[0087] Shown below are equations for calculating disease scores based on the combined levels of these five protein molecules, as well as tables (i.e., Tables 26-33) listing cutoff values, sensitivities, specificities, NPVs, PPVs, and AUROC for this five-protein model.

Discriminant Function Analysis:

[0088] Disease Score=0.2780.times.log.sub.2[uDN5](ng/mg)+0.0231.times.log.sub.2[uDN2](ng- /mg)+0.2236.times.log.sub.2[uGR3](ng/mg)+0.6043.times.log2[sDNO](ng/ml)-0.- 1513.times.log2[uDNO](ng/mg)+5

TABLE-US-00027 TABLE 26 Cutoff Values Representing DN Early and Late Stages Indicated by Urine Albumin Levels Training set (n = 118) Testing set (n = 47) DM, Micro DM, Micro albuminuria albuminuria vs. vs. Macro Macro DM vs. DN albuminuria DM vs. DN albuminuria Cut-off 11.818 12.164 11.818 12.164 Sensitivity (%) 86 98 96 100 Specificity (%) 90 90 86 86 PPV (%) 89 83 89 82 NPV (%) 87 99 95 100 AUROC 0.94 0.97 0.98 0.98

TABLE-US-00028 TABLE 27 Cutoff Values Representing DN States 1-5 Training set (n = 118) Testing set (n = 47) DN Stages 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 Cut-off 11.766 11.818 12.164 14.432 11.766 11.818 12.164 14.432 Sensitivity (%) 73 86 98 100 81 96 100 100 Specificity (%) 89 90 90 90 88 86 86 82 PPV (%) 91 89 83 27 93 89 82 20 NPV (%) 67 87 99 100 70 95 100 100 AUROC 0.86 0.94 0.97 0.98 0.94 0.98 0.98 0.91

Factor Analysis:

[0089] Disease Score=0.9117.times.log.sub.2[uDN5](ng/mg)+0.6949.times.log.sub.2[uDN2](ng- /mg)+0.9095.times.log.sub.2[uGR3](ng/mg)+0.4554.times.log2[sDNO](ng/ml)+0.- 0384.times.log2[uDNO](ng/mg)

TABLE-US-00029 TABLE 28 Cutoff Values Representing DN Early and Late Stages Indicated by Urine Albumin Levels Training set Testing set (n = 118) (n = 47) DM, Micro DM, Micro albuminuria albuminuria vs. vs. Macro Macro DM vs. DN albuminuria DM vs. DN albuminuria Cut-off 29.475 30.541 29.475 30.541 Sensitivity (%) 81 93 88 100 Specificity (%) 90 90 91 83 PPV (%) 88 83 92 78 NPV (%) 83 96 87 100 AUROC 0.93 0.96 0.99 0.98

TABLE-US-00030 TABLE 29 Cutoff Values Representing DN Stages 1-5 Training set (n = 118) Testing set (n = 47) DN Stages 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 Cut-off 28.740 29.475 30.541 39.042 28.740 29.475 30.541 39.042 Sensitivity (%) 67 81 93 75 81 88 100 50 Specificity (%) 89 90 90 90 94 91 83 84 PPV (%) 91 88 83 21 96 92 78 12 NPV (%) 62 83 96 99 71 87 100 97 AUROC 0.84 0.93 0.96 0.95 0.92 0.99 0.98 0.86

Logistic Regression Analysis:

[0090] Disease Score=exp(Logit_value)/(1+exp (Logit_value)), in which

Logit_value=-11.4318+0.8188.times.log.sub.2[uDN5](ng/mg)-0.5376.times.lo- g.sub.2[uDN2](ng/mg)+0.7561.times.log.sub.2[uGR3](ng/mg)+0.3940.times.log.- sub.2[sDNO](ng/ml)-0.1741.times.log.sub.2[uDNO](ng/mg)

TABLE-US-00031 TABLE 30 Cutoff Values Representing DN Early and Late Stages Indicated by Urine Albumin Levels Training set (n = 118) Testing set (n = 47) DM, Micro DM, Micro albuminuria albuminuria vs. vs. Macro Macro DM vs. DN albuminuria DM vs. DN albuminuria Cut-off 0.436 0.780 0.436 0.780 Sensitivity (%) 91 93 96 100 Specificity (%) 90 90 77 86 PPV (%) 90 83 83 82 NPV (%) 92 96 94 100 AUROC 0.96 0.96 0.97 0.96

TABLE-US-00032 TABLE 31 Cutoff Values Representing DN States 1-5 Training set (n = 118) Testing set (n = 47) DN Stages 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 Cut-off 0.329 0.436 0.780 0.997 0.329 0.436 0.780 0.997 Sensitivity (%) 75 91 93 100 90 96 100 100 Specificity (%) 89 90 90 90 75 77 86 80 PPV (%) 92 90 83 27 88 83 82 18 NPV (%) 69 92 96 100 80 94 100 100 AUROC 0.89 0.96 0.96 0.96 0.91 0.97 0.96 0.91

Ridge Regression Analysis:

[0091] Disease Score=-1.3112+0.1648.times.log.sub.2[uDN5](ng/mg)-0.0968.times.log.sub.2[- uDN2](ng/mg)+0.2468.times.log.sub.2[uGR3](ng/mg)+0.1426.times.log2[sDNO](n- g/ml)-0.0552.times.log2[uDNO](ng/mg)

TABLE-US-00033 TABLE 32 Cutoff Values Representing DN Early and Late Stages Indicated by Urine Albumin Levels Training set Testing set (n = 118) (n = 47) DM, Micro DM, Micro albuminuria albuminuria vs. vs. Macro Macro DM vs. DN albuminuria DM vs. DN albuminuria Cut-off 2.244 2.729 2.244 2.729 Sensitivity (%) 91 88 96 100 Specificity (%) 90 90 82 90 PPV (%) 90 82 86 86 NPV (%) 92 93 95 100 AUROC 0.95 0.95 0.98 0.97

TABLE-US-00034 TABLE 33 Cutoff Values Representing DN Stages 1-5 Training set (n = 118) Testing set (n = 47) DN Stages 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 Cut-off 2.043 2.244 2.729 3.913 2.043 2.244 2.729 3.913 Sensitivity (%) 77 91 88 100 87 96 100 100 Specificity (%) 89 90 90 90 69 82 90 80 PPV (%) 92 90 82 27 84 86 86 18 NPV (%) 70 92 93 100 73 95 100 100 AUROC 0.89 0.95 0.95 0.96 0.9 0.98 0.97 0.93

EXAMPLE 3

Staging DN Based on a Combination of uDN2, uDN5, uGR3, and Age

[0092] Shown below are equations for calculating disease scores determined by discriminant function analysis, factor analysis, logistic regression analysis, and ridge regression analysis, based on the level of a biomarker composed of three protein molecules, i.e., uDN2, uDN5, and uGR3, and one clinical factor, i.e., age. Also shown below are tables (i.e., Tables 34-41) listing cutoff values, sensitivities, specificities, PPVs, NPVs, and AUROC for this model.

Discriminant Function Analysis:

[0093] Disease Score=0.3342.times.log.sub.2[uDN5](ng/mg)-0.0201.times.log.sub.2[uDN2](ng- /mg)+0.2826.times.log.sub.2[uGR3](ng/mg)+0.0059.times.Age(year)+5

TABLE-US-00035 TABLE 34 Cutoff Values Representing DN Early and Late Stages Indicated by Urine Albumin Levels Training set Testing set (n = 118) (n = 47) DM, Micro DM, Micro albuminuria albuminuria vs. vs. Macro Macro DM vs. DN albuminuria DM vs. DN albuminuria Cut-off 11.515 12.088 11.515 12.088 Sensitivity (%) 93 93 100 100 Specificity (%) 90 90 77 79 PPV (%) 90 83 83 75 NPV (%) 93 96 100 100 AUROC 0.95 0.96 0.98 0.97

TABLE-US-00036 TABLE 35 Cutoff Values Representing DN Stages 1-5 Training set (n = 118) Testing set (n = 47) DN-Stage 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 Cut-off 11.353 11.515 12.088 14.343 11.353 11.515 12.088 14.343 Sensitivity (%) 75 93 93 75 84 100 100 100 Specificity (%) 89 90 90 90 75 77 79 80 PPV (%) 92 90 83 21 87 83 75 18 NPV (%) 69 93 96 99 71 100 100 100 AUROC 0.87 0.95 0.96 0.95 0.9 0.98 0.97 0.9

Factor Analysis:

[0094] Disease Score=0.9184.times.log.sub.2[uDN5](ng/mg)+0.7006.times.log.sub.2[uDN2](ng- /mg)+0.9005.times.log.sub.2[uGR3](ng/mg)+0.1863.times.Age(year)

TABLE-US-00037 TABLE 36 Cutoff Values Representing DN Early and Late Stages Indicated by Urine Albumin Levels Training set Testing set (n = 118) (n = 47) DM, Micro DM, Micro albuminuria albuminuria vs. vs. Macro Micro DM vs. DN albuminuria DM vs. DN albuminuria Cut-off 38.341 40.075 38.341 40.075 Sensitivity (%) 82 85 96 100 Specificity (%) 90 90 86 83 PPV (%) 89 81 89 78 NPV (%) 85 92 95 100 AUROC 0.93 0.94 0.99 0.98

TABLE-US-00038 TABLE 37 Cutoff Values Representing DN Stages 1-5 Training set (n = 118) Testing set (n = 47) DN-Stages 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 Number of patients (%) 73 (62) 57 (48) 41 (35) 4 (3) 31 (66) 25 (53) 18 (38) 2 (4) Cut-off 38.341 38.341 40.075 48.538 38.341 38.341 40.075 48.538 Sensitivity (%) 66 82 85 50 81 96 100 50 Specificity (%) 89 90 90 90 88 86 83 89 PPV (%) 91 89 81 15 93 89 78 17 NPV (%) 62 85 92 98 70 95 100 98 AUROC 0.82 0.93 0.94 0.91 0.9 0.99 0.98 0.77

Logistic Regression Analysis:

[0095] Disease Score=exp(Logit_value)/(1+exp(Logit_value)), in which

Logit_value=-15.9748+0.8688.times.log.sub.2[uDN5](ng/mg)-0.4966.times.lo- g.sub.2[uDN2](ng/mg)+0.6436.times.log.sub.2[uGR3](ng/mg)+0.0879.times.Age(- year)

TABLE-US-00039 TABLE 38 Cutoff Values Representing DN Early and Late Stages Indicated by Urine Albumin Levels Training set Testing set (n = 118) (n = 47) DM, Micro DM, Micro albuminuria albuminuria vs. vs. Macro Macro DM vs. DN albuminuria DM vs. DN albuminuria Cut-off 0.321 0.889 0.321 0.889 Sensitivity (%) 93 80 100 94 Specificity (%) 90 90 77 83 PPV (%) 90 80 83 77 NPV (%) 93 90 100 96 AUROC 0.96 0.95 0.97 0.95

TABLE-US-00040 TABLE 39 Cutoff Values Representing DN Stages 1-5 Training set (n = 118) Testing set (n = 47) DN-Stages 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 Cut-off 0.301 0.321 0.889 0.997 0.301 0.321 0.889 0.997 Sensitivity (%) 75 93 80 75 87 100 94 100 Specificity (%) 89 90 90 90 75 77 83 89 PPV (%) 92 90 80 21 87 83 77 29 NPV (%) 69 93 90 99 75 100 96 100 AUROC 0.89 0.96 0.95 0.92 0.88 0.97 0.95 0.91

Ridge Regression Analysis:

[0096] Disease Score=-2.1690+0.1771.times.log.sub.2[uDN5](ng/mg)-0.1074.times.log.sub.2[- uDN2](ng/mg)+0.2474.times.log.sub.2[uGR3](ng/mg)+0.0168.times.Age(year)

TABLE-US-00041 TABLE 40 Cutoff Values Representing DN Early and Late Stages Indicated by Urine Albumin Levels Training set Testing set (n = 118) (n = 47) DM, Micro DM, Micro albuminuria albuminuria vs. vs. Macro Macro DM vs. DN albuminuria DM vs. DN albuminuria Cut-off 2.139 2.880 2.139 2.880 Sensitivity (%) 93 85 100 89 Specificity (%) 90 90 73 83 PPV (%) 90 81 81 76 NPV (%) 93 92 100 92 AUROC 0.96 0.95 0.98 0.96

TABLE-US-00042 TABLE 41 Cutoff Values Representing DN Stages 1-5 Training set (n = 118) Testing set (n = 47) DN-Stage 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 1 vs. 2-5 1-2 vs. 3-5 1-3 vs. 4-5 1-4 vs. 5 Cut-off 2.128 2.139 2.880 4.051 2.128 2.139 2.880 4.051 Sensitivity (%) 75 93 85 75 84 100 89 100 Specificity (%) 89 90 90 90 69 73 83 89 PPV (%) 92 90 81 21 84 81 76 29 NPV (%) 69 93 92 99 69 100 92 100 AUROC 0.89 0.96 0.95 0.92 0.89 0.98 0.96 0.92

Other Embodiments

[0097] All of the features disclosed in this specification may be combined in any combination. Each feature disclosed in this specification may be replaced by an alternative feature serving the same, equivalent, or similar purpose. Thus, unless expressly stated otherwise, each feature disclosed is only an example of a generic series of equivalent or similar features.

[0098] From the above description, one skilled in the art can easily ascertain the essential characteristics of the present invention, and without departing from the spirit and scope thereof, can make various changes and modifications of the invention to adapt it to various usages and conditions. Thus, other embodiments are also within the claims.

Sequence CWU 1

1

9117PRTArtificial SequenceFragment of alpha-2-HS-glycoprotein 1Val Val Ser Leu Gly Ser Pro Ser Gly Glu Val Ser His Pro Arg Lys1 5 10 15Thr219PRTArtificial SequenceFragment of alpha-2-HS-glycoprotein 2Met Gly Val Val Ser Leu Gly Ser Pro Ser Gly Glu Val Ser His Pro1 5 10 15Arg Lys Thr318PRTArtificial SequenceFragment of alpha-1 antitrypsin 3Lys Gly Lys Trp Glu Arg Pro Phe Glu Val Lys Asp Thr Glu Glu Glu1 5 10 15Asp Phe421PRTArtificial SequenceFragment of alpha-1 antitrypsin 4Met Ile Glu Gln Asn Thr Lys Ser Pro Leu Phe Met Gly Lys Val Val1 5 10 15Asn Pro Thr Gln Lys 20532PRTArtificial SequenceFragment of alpha-1 antitrypsin 5Glu Asp Pro Gln Gly Asp Ala Ala Gln Lys Thr Asp Thr Ser His His1 5 10 15Asp Gln Asp His Pro Thr Phe Asn Lys Ile Thr Pro Asn Leu Ala Glu 20 25 30634PRTArtificial SequenceFragment of alpha-1 antitrypsin 6Glu Asp Pro Gln Gly Asp Ala Ala Gln Lys Thr Asp Thr Ser His His1 5 10 15Asp Gln Asp His Pro Thr Phe Asn Lys Ile Thr Pro Asn Leu Ala Glu 20 25 30Phe Ala732PRTArtificial SequenceFragment of alpha-1 acid glycoprotein 7Gly Gln Glu His Phe Ala His Leu Leu Ile Leu Arg Asp Thr Lys Thr1 5 10 15Tyr Met Leu Ala Phe Asp Val Asn Asp Glu Lys Asn Trp Gly Leu Ser 20 25 30842PRTArtificial SequenceFragment of osteopontin 8Tyr Pro Asp Ala Val Ala Thr Trp Leu Asn Pro Asp Pro Ser Gln Lys1 5 10 15Gln Asn Leu Leu Ala Pro Gln Asn Ala Val Ser Ser Glu Glu Thr Asn 20 25 30Asp Phe Lys Gln Glu Thr Leu Pro Ser Lys 35 40929PRTArtificial SequenceFragment of osteopontin 9Lys Tyr Pro Asp Ala Val Ala Thr Trp Leu Asn Pro Asp Pro Ser Gln1 5 10 15Lys Gln Asn Leu Leu Ala Pro Gln Thr Leu Pro Ser Lys 20 25

Claims

1. An isolated antibody specifically binding to a peptide selected from the group consisting of: TABLE-US-00043 (SEQ ID NO: 2) MGVVSLGSPSGEVSHPRKT, (SEQ ID NO: 3) KGKWERPFEVKDTEEEDF, (SEQ ID NO: 4) MIEQNTKSPLFMGKVVNPTQK, (SEQ ID NO: 6) EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFA, (SEQ ID NO: 7) GQEHFAHLLILRDTKTYMLADVNDEKNWGLS, (SEQ ID NO: 8) YPDAVATWLNPDPSQKQ NLLAPQNAVSSEETNDFKQETLPSK, and (SEQ ID NO: 9) KYPDAVATWLNPDPSQKQNLLAPQTLPSK.

2. The antibody of claim 1, specifically binding to MGVVSLGSPSGEVSHPRKT (SEQ ID NO:2).

3. The antibody of claim 1, specifically binding to KGKWERPFEVKDTEEEDF (SEQ ID NO:3).

4. The antibody of claim 1, specifically binding to MIEQNTKSPLFMGKVVNPTQK (SEQ ID NO:4).

5. The antibody of claim 1, specifically binding to EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFA (SEQ ID NO:6).

6. The antibody of claim 1, specifically binding to GQEHFAHLLILRDTKTYMLADVNDEKNWGLS (SEQ ID NO:7).

7. The antibody of claim 1, specifically binding to YPDAVATWLNPDPSQKQ NLLAPQNAVSSEETNDFKQETLPSK (SEQ ID NO:8).

8. The antibody of claim 1, specifically binding to KYPDAVATWLNPDPSQKQNLLAPQTLPSK (SEQ ID NO:9).

9. The antibody of claim 1, wherein the antibody is a monoclonal antibody.

10. The antibody of claim 1, wherein the antibody is a whole immunoglobulin molecule.

11. A kit for diagnosing diabetic nephropathy, comprising two, three, or four antibodies, each of which is capable of binding to (i) alpha-2-HS-glycoprotein, (ii) alpha-1 antitrypsin, (iii) alpha-1 acid glycoprotein, or (iv) osteopontin, wherein the two, three, or four antibodies have different antigen specificities.

12. The kit of claim 11, wherein the antibodies are whole immunoglobulin molecules.

13. The kit of claim 11, wherein the antibodies are monoclonal antibodies.

14. The kit of claim 11, wherein the antibodies are selected from the group consisting of: an antibody specifically binding to MGVVSLGSPSGEVSHPRKT (SEQ ID NO:2); an antibody specifically binding to KGKWERPFEVKDTEEEDF (SEQ ID NO:3); an antibody specifically binding to MIEQNTKSPLFMGKVVNPTQK (SEQ ID NO:4); an antibody specifically binding to EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFA (SEQ ID NO:6); an antibody specifically binding to GQEHFAHLLILRDTKTYMLADVNDEKNWGLS (SEQ ID NO:7); an antibody specifically binding to YPDAVATWLNPDPSQKQ NLLAPQNAVSSEETNDFKQETLPSK (SEQ ID NO:8); and an antibody specifically binding to KYPDAVATWLNPDPSQKQNLLAPQTLPSK (SEQ ID NO:9).

15. The kit of claim 11, consisting essentially of two, three, or four antibodies, each of which is capable of binding to (i) alpha-2-HS-glycoprotein, (ii) alpha-1 antitrypsin, (iii) alpha-1 acid glycoprotein, or (iv) osteopontin, wherein the two, three, or four antibodies have different antigen specificities.

16. The kit of claim 11, further comprising reagents and materials for an immunoassay, the immunoassay being ELISA, Westernblot, RIA, FIA or LIA.