U.S. patent application number 12/819618 was filed with the patent office on 2010-12-30 for multivariable antigens complexed with targeting humanized monoclonal antibody.
This patent application is currently assigned to BAYLOR RESEARCH INSTITUTE. Invention is credited to Anne-Laure Flamar, Eynav Klechevsky, Gerard Zurawski.
Application Number | 20100330115 12/819618 |
Document ID | / |
Family ID | 39682338 |
Filed Date | 2010-12-30 |
![](/patent/app/20100330115/US20100330115A1-20101230-C00001.png)
![](/patent/app/20100330115/US20100330115A1-20101230-C00002.png)
![](/patent/app/20100330115/US20100330115A1-20101230-C00003.png)
![](/patent/app/20100330115/US20100330115A1-20101230-C00004.png)
![](/patent/app/20100330115/US20100330115A1-20101230-C00005.png)
![](/patent/app/20100330115/US20100330115A1-20101230-C00006.png)
![](/patent/app/20100330115/US20100330115A1-20101230-C00007.png)
![](/patent/app/20100330115/US20100330115A1-20101230-C00008.png)
![](/patent/app/20100330115/US20100330115A1-20101230-C00009.png)
![](/patent/app/20100330115/US20100330115A1-20101230-C00010.png)
![](/patent/app/20100330115/US20100330115A1-20101230-C00011.png)
View All Diagrams
United States Patent
Application |
20100330115 |
Kind Code |
A1 |
Zurawski; Gerard ; et
al. |
December 30, 2010 |
Multivariable Antigens Complexed with Targeting Humanized
Monoclonal Antibody
Abstract
The present invention includes compositions and methods for
designing, making and using modular recombinant antibodies or
fragments thereof with one half of a cohesin-dockerin pair that
permits the rapid assembly of multivariant antigen conjugates.
Inventors: |
Zurawski; Gerard;
(Midlothian, TX) ; Flamar; Anne-Laure; (Dallas,
TX) ; Klechevsky; Eynav; (Dallas, TX) |
Correspondence
Address: |
CHALKER FLORES, LLP
2711 LBJ FRWY, Suite 1036
DALLAS
TX
75234
US
|
Assignee: |
BAYLOR RESEARCH INSTITUTE
Dallas
TX
|
Family ID: |
39682338 |
Appl. No.: |
12/819618 |
Filed: |
June 21, 2010 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
12024036 |
Jan 31, 2008 |
7786267 |
|
|
12819618 |
|
|
|
|
60888029 |
Feb 2, 2007 |
|
|
|
Current U.S.
Class: |
424/196.11 ;
424/193.1; 424/197.11; 435/320.1; 435/325; 435/69.7; 435/7.21;
514/1.1; 514/19.3; 514/2.3; 530/350; 530/391.7; 530/412;
536/23.4 |
Current CPC
Class: |
A61K 39/44 20130101;
A61P 35/00 20180101; C07K 16/28 20130101; C07K 16/00 20130101; A61P
37/02 20180101; C07K 2317/24 20130101; C07K 2317/54 20130101; C07K
14/33 20130101; A61P 31/00 20180101; C07K 2317/35 20130101; C07K
2319/00 20130101; C07K 2319/33 20130101; C07K 2317/55 20130101;
A61P 37/06 20180101 |
Class at
Publication: |
424/196.11 ;
424/193.1; 424/197.11; 435/7.21; 435/69.7; 435/325; 435/320.1;
514/1.1; 514/2.3; 514/19.3; 530/350; 530/391.7; 530/412;
536/23.4 |
International
Class: |
A61K 39/385 20060101
A61K039/385; G01N 33/567 20060101 G01N033/567; C12P 21/06 20060101
C12P021/06; C12N 5/10 20060101 C12N005/10; C12N 15/63 20060101
C12N015/63; A61K 38/00 20060101 A61K038/00; A61P 31/00 20060101
A61P031/00; A61P 35/00 20060101 A61P035/00; C07K 14/00 20060101
C07K014/00; C07K 16/00 20060101 C07K016/00; C07K 1/14 20060101
C07K001/14; C07H 21/00 20060101 C07H021/00; A61P 37/06 20060101
A61P037/06 |
Goverment Interests
STATEMENT OF FEDERALLY FUNDED RESEARCH
[0002] This invention was made with U.S. Government support under
Contract No. 1U19AI057234-0100003 awarded by the NIH. The
government has certain rights in this invention.
Claims
1. A modular rAb carrier comprising an antigen-specific binding
domain linked to one or more antigen carrier domains comprising one
half of a cohesin-dockerin binding pair.
2.-10. (canceled)
11. A vaccine comprising a modular rAb carrier comprising an
antigen specific domain linked to one or more domains comprising
one half of the cohesin-dockerin binding pair bound to a
complementary half of the cohesin-dockerin binding pair bound to an
antigen.
12. The vaccine of claim 11, wherein the antigen specific domain is
specific for an immune cell surface protein selected from MHC class
I, MHC class II, CD1, CD2, CD3, CD4, CD8, CD11b, CD14, CD15, CD16,
CD19, CD20, CD29, CD31, CD40,CD43, CD44, CD45, CD54, CD56, CD57,
CD58, CD83, CD86, CMRF-44, CMRF-56, DCIR, DC-ASPGR, CLEC-6, CD40,
BDCA-2, MARCO, DEC-205, mannose receptor, Langerin, DECTIN-1, B7-1,
B7-2, IFN-.gamma. receptor and IL-2 receptor, ICAM-1, Fc.gamma.
receptor or other receptor relatively specifically expressed by
antigen presenting cells.
13. The vaccine of claim 11, wherein the antigen comprises a
bacterial, viral, fungal, protozoan or cancer protein.
14. The vaccine of claim 11, wherein the modular rAb carrier is
further defined: an rAb.Doc:Coh.antigen; an rAb.Coh:Doc.antigen; an
rAb.(Coh).sub.x:(Doc.antigen).sub.x; an
rAb.(Doc).sub.x:(Coh.antigen).sub.x; an
rAb.(Coh.Doc).sub.x:(Doc.antigen.sup.1)(Coh.antigen.sup.2); or an
rAb.(Coh).sub.x(Doc).sub.x:(Doc.antigen.sup.1).sub.x(Coh.antigen.sup.2).s-
ub.x; wherein x is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
15. An isolated nucleic acid comprising a coding segment for an
target specific domain and one or more domains and one half of a
cohesin-dockerin binding pair.
16. The nucleic acid of claim 15, wherein the target is an antigen
and the specific domain encodes at least a portion of an
antibody.
17. The nucleic acid of claim 15, wherein the one or more domains
encodes one or more cohesin domains, one or more dockerin domains
or a combination of one or more cohesin and dockerin domains.
18. The nucleic acid of claim 15, wherein the target specific
domain comprises an rAb is further defined as: an rAb.Doc; an
rAb.Coh; an rAb.(Coh).sub.x; an rAb.(Doc).sub.x; an
rAb.(Coh.Doc).sub.x; or an rAb.(Coh).sub.x(Doc).sub.x; wherein x is
1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
19. A vector comprising a nucleic acid encoding an antigen specific
domain and one or more domains that comprise one half of a
cohesin-dockerin binding pair, a one half of a cohesin-dockerin
binding pair with a protein molecule to be carried and combinations
thereof.
20. The vector of claim 19, wherein the one half of a
cohesin-dockerin binding pair, a one half of a cohesin-dockerin
binding pair with a protein molecule to be carried and combinations
thereof are under the control of the same promoter, different
promoters, transcribed in-line, transcribed in opposite
directions.
21. A host cell comprising a vector comprising a nucleic acid
encoding an antigen specific domain and one or more domains and one
half of a cohesin-dockerin binding pair.
22. A method of making a modular rAb carrier comprising: combining
an antigen specific domain linked to one or more domains comprising
one half of a cohesin-dockerin binding pair.
23. The method of claim 22, wherein the rAb is further defined as:
an rAb.Doc; an rAb.Coh; an rAb.(Coh).sub.x; an rAb.(Doc).sub.x; an
rAb.(Coh.Doc).sub.x; or an rAb.(Coh).sub.x(Doc).sub.x; wherein x is
1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
24. The method of claim 22, wherein the rAb is complexed with a
complementary half of a cohesion:dokerin pair bound to an antigen
and is selected from: an rAb.Doc:Coh.antigen; an
rAb.Coh:Doc.antigen; an rAb.(Coh).sub.x:(Doc.antigen).sub.x; an
rAb.(Doc).sub.x:(Coh.antigen).sub.x; an rAb.(Coh.Doc).sub.x:
(Doc.antigen.sup.1)(Coh.antigen.sup.2); or an
rAb.(Coh).sub.x(Doc).sub.x:(Doc.antigen.sup.1).sub.x(Coh.antigen.sup.2).s-
ub.x; wherein x is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
25. An immunotoxin comprising an rAb.Doc:Coh.toxin self-assembled
conjugate, wherein the rAb is specific for a cell target.
26. The immunotoxin of claim 25, wherein the toxin is selected from
wherein the toxin is selected from the group consisting of a
radioactive isotope, metal, enzyme, botulin, tetanus, ricin,
cholera, diphtheria, aflatoxins, perfringens toxin, mycotoxins,
shigatoxin, staphylococcal enterotoxin B, T2, seguitoxin,
saxitoxin, abrin, cyanoginosin, alphatoxin, tetrodotoxin,
aconotoxin, snake venom and spider venom.
27. The immunotoxin of claim 25, wherein the cell target comprises
a cancer cell selected from hematological cancers, leukemias,
lymphomas, neurological tumors, astrocytomas or glioblastomas,
melanoma, breast cancer, lung cancer, head and neck cancer,
gastrointestinal tumors such as gastric or colon cancer, liver
cancer, pancreatic cancer, genitourinary tumors such cervix,
uterus, ovarian cancer, vaginal cancer, testicular cancer, prostate
cancer or penile cancer, bone tumors, vascular tumors, or cancers
of the lip, nasopharynx, pharynx and oral cavity, esophagus,
rectum, gall bladder, biliary tree, larynx, lung and bronchus,
bladder, kidney, brain and other parts of the nervous system,
thyroid, Hodgkin's disease, non-Hodgkin's lymphoma, multiple
myeloma and leukemia.
28. The immunotoxin of claim 25, wherein the cell target comprises
a pathogen selected from a bacteria, a protozoan, a helminth, a
virally-infected cell or a fungus.
29. A method for protein purification, comprising: separating a
cohesin or dockerin fusion protein by interacting the fusion
protein with a rAb that is conjugated to the complementary cohesin
or dockerin bound to a substrate.
30. The method of claim 29, further comprising the step of
administering the protein in a therapeutic application comprising
transplantation, autoimmune disease, infectious disease or
cancer.
31. The use of the cohesin as a fusion partner for toxins for
conferring beneficial biochemical properties favoring ready
purification of active cohesin.toxin fusion protein.
32. The use of anti-DC rAb.Doc to target DC for therapeutic
applications where ablating DC.
33. An anti-DC-SIGN/L antibody provided in an amount that is
sufficient to enhance the survival of dendritic cells, wherein the
antibody matures and activates the dendritic cells for
immunization.
34. The antibody of claim 33, wherein the antibody is targeted in
vivo to dendritic cells as an adjuvant in vaccines.
35. (canceled)
36. A bivalent and multivalent (rAb.Doc:Coh.cytokine),
(rAb.Coh:Doc.cytokine) or (cytokine.sup.1.Coh:cytokine.sup.2 Doc)
self-assembled conjugates as therapeutic, cell proliferation or
maturing agents.
37. A method for making modular rAb comprising: screening one or
more multivalent rAb and/or rAb.cytokine and/or cytokine cytokine
combinations that are capable of specifically binding to a target
cell and delivering the cytokine such that it exerts its effect on
the target cell.
38. The method of claim 37, wherein the cytokine comprises
interleukins, transforming growth factors (TGFs), fibroblast growth
factors (FGFs), platelet derived growth factors (PDGFs), epidermal
growth factors (EGFs), connective tissue activated peptides
(CTAPs), osteogenic factors, and biologically active analogs,
fragments, and derivatives of such growth factors, B/T-cell
differentiation factors, B/T-cell growth factors, mitogenic
cytokines, chemotactic cytokines, colony stimulating factors,
angiogenesis factors, IFN-.alpha., IFN-.beta., IFN-.gamma., IL1,
IL2, IL3, IL4, IL5, IL6, IL7, IL8, IL9, IL10, IL11, IL12, IL13,
IL14, IL15, IL16, IL17, IL18, etc., leptin, myostatin, macrophage
stimulating protein, platelet-derived growth factor, TNF-.alpha.,
TNF-.beta., NGF, CD40L, CD137L/4-1BBL, human lymphotoxin-.beta.,
G-CSF, M-CSF, GM-CSF, PDGF, IL-1.alpha., IL1-.beta., IP-10, PF4,
GRO, 9E3, erythropoietin, endostatin, angiostatin, VEGF,
transforming growth factor (TGF) supergene family include the beta
transforming growth factors (for example TGF-.beta.1, TGF-.beta.2,
TGF-.beta.3); bone morphogenetic proteins (for example, BMP-1,
BMP-2, BMP-3, BMP-4, BMP-5, BMP-6, BMP-7, BMP-8, BMP-9);
heparin-binding growth factors (fibroblast growth factor (FGF),
epidermal growth factor (EGF), platelet-derived growth factor
(PDGF), insulin-like growth factor (IGF)); Inhibins (for example,
Inhibin A, Inhibin B); growth differentiating factors (for example,
GDF-1); and Activins (for example, Activin A, Activin B, Activin
AB).
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims priority to U.S. Provisional
Application Ser. No. 60/888,029, filed Feb. 2, 2007, the contents
of which is incorporated by reference herein in its entirety.
TECHNICAL FIELD OF THE INVENTION
[0003] The present invention relates in general to the field of
novel vaccines, and more particularly, to the design, manufacture
and use of multivariable antigens complexed with targeting
humanized monoclonal antibodies.
BACKGROUND OF THE INVENTION
[0004] Without limiting the scope of the invention, its background
is described in connection with vaccine development.
[0005] Protein engineering technology relating to monoclonal
antibodies is highy advanced regarding humanization (i.e.,
rendering e.g., a rodent mAb sequence into a human mAb sequence
while preserving specific antigen combining sites of the the
original mAb) and production (typically secreted from mammalian
cell lines). In research and development are new applications of
rAbs related to vaccination and are presently based on engineered
rAb-antigen fusion proteins (typically with the antigen coding
region placed in-frame with the C-terminal codon of the rAb heavy
or H chain). A roadblock to this technology is the successful
expression and production of fully functional rAb-antigen. In many,
perhaps most, cases the desired antigen confounds secretion of the
engineered rAb-antigen. Also, the likelihood of poor or null
expression is increased if the desired entity includes multiple
antigen coding regions.
SUMMARY OF THE INVENTION
[0006] The invention provides methods for the assembly of rAb
antigen complexes in a controlled manner by simple mixing
components and accomodates the ability to express and produce the
rAb and antigen(s) in different expression--production systems that
are best suited to the individual rAb and particular antigen. In
addition, the invention demonstrates the novel application of the
high affinity and high specificity cohesin-dockerin interaction to
secreted mammalian expression systems, thus permitting the
development of unique protein engineering formats and production of
new protein tools for research and clinical application.
[0007] More particularly, the present invention uses the
cohesin-dockerin protein domains and their surrounding linker. For
example, the invention permits the controlled assembly of
recombinant monoclonal antibodies (rAbs) complexed to antigens,
toxins, or cellular activating agents. The invention has wide
potential application in vaccination and cancer therapy. Also
claimed are derivatives of this technology that permit the
production of novel proteins with specific affinities for other
proteins.
[0008] The invention is based on particular components of the well
studied bacterial cellulose degrading protein complex called the
cellulosome. Specifically, two protein domains (cohesin and
dockerin) and natural protein linker sequences are utilized via the
invention in novel contexts and applications.
[0009] The present invention is based on the discovery that
particular cohesin and dockerin domains can be sucessfully and
efficiently secreted from mammalian cells as fusion proteins while
maintaining the specific and high affinity cohesin-dockerin
protein-protein interaction. While the extensive cohesin-dockerin
literature teaches the expectation that such fusion proteins should
have this functionality, it does not describe production of such
fusion proteins in mammalian secretion systems. The state of
scientific knowledge does not allow the prediction of the discovery
since the rules (other than features such as signal peptide) for
successful secretion are not fully established. Furthermore, the
cohesin linker regions are known to be glycosylated in their native
bacteria, and the cohesin and dockerin domains contain predicted
glycosylation sites. While this may actually favor secretion from
mammalian cells, it is unclear if `unnatural` glyosylation will
perturb the cohesis-dockerin interaction.
[0010] While cohesin-dockerin interaction for various commercial
applications has been published, the present invention is based on
a previously unrealized potential for this interaction built around
assembling specific protein complexes unrelated to the controlled
assembly enzyme applications.
[0011] The invention includes the use of all cohesin-dockerin
sequences from diverse cellulose degrading microbes, but describes
the application of specific cohesin and dockerin and linker
sequences from the microbe Clostridium thermocellum. For example,
the sequence described herein encodes the H chain of a human IgG4
linked at the C-terminal codon to a Clostridium thermocellum
dockerin sequence (called rAb.doc). Other embodiments of rAb.doc
proteins are described similarly with examples that are engineered
by simply transferring the dockerin coding region as a DNA fragment
to vectors encoding the different H chain entities.
[0012] More particularly, the present invention includes a modular
rAb carrier that includes an antigen-specific binding domain linked
to one or more antigen carrier domains and one half of a
cohesin-dockerin binding pair. The antigen-specific binding domain
may be at least a portion of an antibody and the antibody is a
fusion protein with and the binding pair in a fusion protein with
one half of a cohesin-dockerin binding pair. The rAb may also
include a complementary half of the cohesin-dockerin binding pair
bound to an antigen that forms a complex with the modular rAb
carrier. The complementary half of the cohesin-dockerin binding
pair may itself be a fusion protein with the antigen carried as
part of the complex (modular rAb carrier (cohesin/dockerin) antigen
complex). Examples of antigen specific domain include a full length
antibody, an antibody variable region domain, an Fab fragment, a
Fab' fragment, an F(ab).sub.2 fragment, and Fv fragment, and Fabc
fragment and/or a Fab fragment with portions of the Fc domain. Non
limiting examples of sources for the cohesin-dockerin binding pair
include Clostridium thermocellum, Clostridium josui, Clostridium
cellulolyticum and Bacteroides cellulosolvens and combinations
thereof.
[0013] Non-limiting examples for targeting by the antigen-specific
binding domain include: cell surface marker selected from MHC class
I, MHC class II, CD1, CD2, CD3, CD4, CD8, CD11b, CD14, CD15, CD16,
CD 19, CD20, CD29, CD31, CD40,CD43, CD44, CD45, CD54, CD56, CD57,
CD58, CD83, CD86, CMRF-44, CMRF-56, DCIR, DC-ASPGR, CLEC-6, CD40,
BDCA-2, MARCO, DEC-205, mannose receptor, Langerin, DECTIN-1, B7-1,
B7-2, IFN-.gamma. receptor and IL-2 receptor, ICAM-1, Fc.gamma.
receptor or other receptor relatively specifically expressed by
antigen presenting cells.
[0014] The rAb of the present invention may also includes
combinations of the domains that are defined as: an rAb.Doc; an
rAb.Coh; an rAb.(Coh).sub.x; an rAb.(Doc).sub.x; an
rAb.(Coh.Doc).sub.x; or an rAb.(Coh).sub.x(Doc).sub.x; wherein x is
1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more. Examples of the modular rAb
carrier in a complex include: [0015] an rAb.Doc:Coh.antigen; [0016]
an rAb.Coh:Doc.antigen; [0017] an
rAb.(Coh).sub.x:(Doc.antigen).sub.x; [0018] an
rAb.(Doc).sub.x:(Coh.antigen).sub.x; [0019] an
rAb.(Coh.Doc).sub.x:(Doc.antigen.sup.1)(Coh.antigen.sup.2); or
[0020] an
rAb.(Coh).sub.x(Doc).sub.x:(Doc.antigen.sup.1).sub.x(Coh.antigen.sup.2).s-
ub.x; [0021] wherein x is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
[0022] The present invention also include a vaccine of a modular
rAb carrier that includes an antigen specific domain linked to one
or more domains comprising one half of the cohesin-dockerin binding
pair bound to a complementary half of the cohesin-dockerin binding
pair bound to an antigen. Non-limiting examples for targeting the
rAb include immune cell surface protein selected from MHC class I,
MHC class II, CD1, CD2, CD3, CD4, CD8, CD11b, CD14, CD15, CD16, CD
19, CD20, CD29, CD31, CD40,CD43, CD44,CD45, CD54, CD56, CD57, CD58,
CD83, CD86, CMRF-44, CMRF-56, DCIR, DC-ASPGR, CLEC-6, CD40, BDCA-2,
MARCO, DEC-205, mannose receptor, Langerin, DECTIN-1, B7-1, B7-2,
IFN-.gamma. receptor and IL-2 receptor, ICAM-1, Fc.gamma. receptor
or other receptor relatively specifically expressed by antigen
presenting cells. Targets for vaccination with the rAb antigen
carrier include, e.g., a bacterial, viral, fungal, protozoan or
cancer protein and fragments thereof. The vaccine of claim 11,
wherein the modular rAb carrier is further defined: an
rAb.Doc:Coh.antigen; an rAb.Coh:Doc.antigen; an
rAb.(Coh).sub.x:(Doc.antigen).sub.x; an
rAb.(Doc).sub.x:(Coh.antigen).sub.x; an
rAb.(Coh.Doc).sub.x:(Doc.antigen.sup.1)(Coh.antigen.sup.2); or an
rAb.(Coh).sub.x(Doc).sub.x:(Doc.antigen.sup.1).sub.x(Coh.antigen.sup.2).s-
ub.x; wherein x is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
[0023] The present invention also includes an isolated nucleic acid
comprising a coding segment for a target-specific domain and one or
more domains and one half of a cohesin-dockerin binding pair. For
example, the target may be an antigen and the target specific
domain may encode at least a portion of an antibody. The one or
more domains can encode one or more cohesin domains, one or more
dockerin domains or a combination of one or more cohesin and
dockerin domains. The rAb is further defined as: an rAb.Doc; an
rAb.Coh; an rAb.(Coh).sub.x; an rAb.(Doc).sub.x; an
rAb.(Coh.Doc).sub.x; or an rAb.(Coh).sub.x(Doc).sub.x; wherein x is
1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
[0024] The present invention also includes a vector that includes a
nucleic acid encoding an antigen specific domain and one or more
domains that comprise one half of a cohesin-dockerin binding pair,
a one half of a cohesin-dockerin binding pair with a protein
molecule to be carried and combinations thereof. The one half of a
cohesin-dockerin binding pair, a one half of a cohesin-dockerin
binding pair with a protein molecule to be carried and combinations
thereof are under the control of the same promoter, different
promoters, transcribed in-line, transcribed in opposite
directions.
[0025] The present invention also includes a host cell comprising a
vector comprising a nucleic acid encoding an antigen specific
domain and one or more domains and one half of a cohesin-dockerin
binding pair.
[0026] A method of making a modular rAb carrier by combining an
antigen specific domain linked to one or more domains of one half
of a cohesin-dockerin binding pair. The rAb is further defined as:
an rAb.Doc; an rAb.Coh; an rAb.(Coh).sub.x; an rAb.(Doc).sub.x; an
rAb.(Coh.Doc).sub.x; or an rAb.(Coh).sub.x(Doc).sub.x; wherein x is
1, 2, 3, 4, 5, 6, 7, 8, 9 or 10. Examples of the rAb is complexed
with a complementary half of a cohesion:dokerin pair bound to an
antigen and is selected from: an rAb.Doc:Coh.antigen; an
rAb.Coh:Doc.antigen; an rAb.(Coh).sub.x:(Doc.antigen).sub.x; an
rAb.(Doc).sub.x:(Coh.antigen).sub.x; an
rAb.(Coh.Doc).sub.x:(Doc.antigen.sup.1)(Coh.antigen.sup.2); or an
rAb.(Coh).sub.x(Doc).sub.x:(Doc.antigen.sup.1).sub.x(Coh.antigen.sup.2).s-
ub.x; wherein x is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
[0027] The present invention may also be an immunotoxin that
includes an rAb.Doc:Coh.toxin self-assembled conjugate, wherein the
rAb is specific for a cell target. Examples of toxins include a
radioactive isotope, metal, enzyme, botulin, tetanus, ricin,
cholera, diphtheria, aflatoxins, perfringens toxin, mycotoxins,
shigatoxin, staphylococcal enterotoxin B, T2, seguitoxin,
saxitoxin, abrin, cyanoginosin, alphatoxin, tetrodotoxin,
aconotoxin, snake venom and spider venom. Cell targets for the
immunotoxin include diseased or infected cells. Examples of
diseased cells for targeting include cancer cell for, e.g.,
hematological cancers such as leukemias and lymphomas, neurological
tumors such as astrocytomas or glioblastomas, melanoma, breast
cancer, lung cancer, head and neck cancer, gastrointestinal tumors
such as gastric or colon cancer, liver cancer, pancreatic cancer,
genitourinary tumors such cervix, uterus, ovarian cancer, vaginal
cancer, testicular cancer, prostate cancer or penile cancer, bone
tumors, vascular tumors, or cancers of the lip, nasopharynx,
pharynx and oral cavity, esophagus, rectum, gall bladder, biliary
tree, larynx, lung and bronchus, bladder, kidney, brain and other
parts of the nervous system, thyroid, Hodgkin's disease,
non-Hodgkin's lymphoma, multiple myeloma and leukemia. The
immunotoxin may target pathogens directly, e.g., bacteria, a
protozoan, a helminth, a virally-infected cell or a fungus.
[0028] The present invention also includes a method for protein
purification by separating a cohesin or dockerin fusion protein by
interacting the fusion protein with a rAb that is conjugated to the
complementary cohesin or dockerin bound to a substrate. The present
invention may also use the cohesin as a fusion partner for toxins
for conferring beneficial biochemical properties favoring ready
purification of active cohesin.toxin fusion protein. The present
invention may also use the anti-DC rAb.Doc to target DC for
therapeutic applications where ablating DC. Therapeutic
applications include, e.g., transplantation, autoimmune disease,
infectious disease or cancer. The invention also includes an
anti-DC-SIGN/L antibody provided in an amount that is sufficient to
enhance the survival of dendritic cells, wherein the antibody
matures and activates the dendritic cells for immunization. The
antibody may target cells in vivo, e.g., dendritic cells as an
adjuvant in vaccines.
[0029] Also invented is a bivalent and multivalent
(rAb.sup.1.Doc:Coh.rAb.sup.2) self-assembled conjugates as
therapeutic, diagnostic, and industrial agents. Alternatively, the
invention is a bivalent and multivalent (rAb.Doc:Coh.cytokine),
(rAb.Coh:Doc.cytokine) or (cytokine.sup.1.Coh:cytokine.sup.2.Doc)
self-assembled conjugates as therapeutic, cell proliferation or
maturing agents. The modular rAbs carrier may be made by method
that includes screening one or more multivalent rAb and/or
rAb.cytokine and/or cytokine.cytokine combinations that are capable
of specifically binding to a target cell and delivering the
cytokine such that it exerts its effect on the target cell.
Cytokines for use with the present invention include: interleukins,
transforming growth factors (TGFs), fibroblast growth factors
(FGFs), platelet derived growth factors (PDGFs), epidermal growth
factors (EGFs), connective tissue activated peptides (CTAPs),
osteogenic factors, and biologically active analogs, fragments, and
derivatives of such growth factors, B/T-cell differentiation
factors, B/T-cell growth factors, mitogenic cytokines, chemotactic
cytokines, colony stimulating factors, angiogenesis factors,
IFN-.alpha., IFN-.beta., IFN-.gamma., IL1, IL2, IL3, IL4, IL5, IL6,
IL7, IL8, IL9, IL10, IL11, IL12, IL13, IL14, Il15, IL16, IL17, IL
18, etc., leptin, myostatin, macrophage stimulating protein,
platelet-derived growth factor, TNF-.alpha., TNF-.beta., NGF,
CD40L, CD137L/4-1BBL, human lymphotoxin-.beta., G-CSF, M-CSF,
GM-CSF, PDGF, IL-1.alpha., IL1-.beta., IP-10, PF4, GRO, 9E3,
erythropoietin, endostatin, angiostatin, VEGF, transforming growth
factor (TGF) supergene family include the beta transforming growth
factors (for example TGF-.beta.1, TGF-.beta.2, TGF-.beta.3); bone
morphogenetic proteins (for example, BMP-1, BMP-2, BMP-3, BMP-4,
BMP-5, BMP-6, BMP-7, BMP-8, BMP-9); heparin-binding growth factors
(fibroblast growth factor (FGF), epidermal growth factor (EGF),
platelet-derived growth factor (PDGF), insulin-like growth factor
(IGF)); Inhibins (for example, Inhibin A, Inhibin B); growth
differentiating factors (for example, GDF-1); and Activins (for
example, Activin A, Activin B, Activin AB).
BRIEF DESCRIPTION OF THE DRAWINGS
[0030] For a more complete understanding of the features and
advantages of the present invention, reference is now made to the
detailed description of the invention along with the accompanying
figures and in which:
[0031] FIG. 1 compares the prior art (top portion) with an example
of the multiple antigens targeted in a complex simultaneously with
the same engineered humanized mAb (MATCHMAB) (bottom portion).
[0032] FIG. 2 shows the use of the present invention to form
Bi-specific mAbs.
[0033] FIG. 3 shows Protein G affinity purified secreted rAb
proteins analyzed by reducing SDS.PAGE and Coomassie Brilliant Blue
staining. Lanes are from left to right.
[0034] FIGS. 4A and 4B show the measurement by anti-human IgFc
ELISA of levels of secretion of various rAb.fusion proteins.
[0035] FIG. 5 shows the measurement by anti-human IgFc ELISA (HRP
activity) and LOX-1.alkaline phoshatase binding (AP activity) of
secreted anti-LOX1.sub.--15C4 rAb.(blue symbols) and
anti-LOX1.sub.--15C4.doc rAb (red symbols) proteins.
[0036] FIG. 6 shows that when co-transfected with a mIgG kappa
expression plasmid, rAB-pCMV(mIgG2bH-Dockerin) plasmid directs the
efficient secretion of rAB-mIgG2b.Dockerin fusion protein.
[0037] FIGS. 7A and 7B show that the secreted coh.alkaline
phosphatase (coh.AP) but not AP binds efficiently and specifically
to rAb.Doc immobilized on plastic.
[0038] FIGS. 8A and 8B shows various dilutions of a supernatant
containing secreted G.AP bound to immobilized mIgG2a and mIgG2b,
but not rAb.doc, while coh.AP bound rAb.doc specifically.
[0039] FIG. 9 shows the differential stability of complexes between
a fixed amount of proG.AP or coh.AP or coh2.AP (0.1 ug) and
immobilized mIgG2b or rAb.doc (0.25 ug) assembled by incubation for
1 hr in a micro-titre plate.
[0040] FIG. 10 shows the differential stability in human serum of
complexes between a fixed amount of proG.AP or coh.AP (0.1 ug) and
immobilized mIgG2b or rAb.doc (0.25 ug) were assembled by
incubation for 1 hr in a micro-titre plate.
[0041] FIG. 11 is a gel that shows the reduced vs. non-reduced
SDS.PAGE analysis of rAb.doc:Coh2.AP complexes produced by
sequential application of rAb.doc supernatant and coh.AP
supernatant to the same protein G affinity column.
[0042] FIG. 12 is a non-reduced SDS.PAGE analysis of
rAb.doc:Coh.Flu HA5-1 complexes produced by sequential application
of rAb.doc supernatant and coh.Flu HA5-1 supernatant to the same
protein G affinity column.
[0043] FIG. 13 shows that anti-DC_rAb.doc:coh.Flu M1 complex formed
by mixing the individual purified components was effective in vitro
in expanding Flu M1-specific T cells.
[0044] FIG. 14 shows that Anti-DC_rAb.doc:coh.Flu M1 but not
mIgG2b.doc:coh.Flu M1 complexes formed by mixing the individual
purified components was effective in vitro in expanding Flu
M1-specific T cells.
[0045] FIG. 15 shows CD34+ human DC were sorted into CD1a+ and
CD14+ subtypes and cultured with and without 3 nM Anti-DC_rAb.Flu
M1 PEP or Anti-DC_rAb.
[0046] FIG. 16 shows E. coli harboring expression plasmids
directing the synthesis of coh.pep proteins were grown and induced
for specific protein production. Cells were harvested and broken by
sonication.
[0047] FIG. 17 shows that the DCIR.Doc rAb alone had no effect upon
the survival of DCs, but DC-SIGN/L.Doc rAb ehnaces their
survival.
[0048] FIG. 18 shows that Coh.PE38 alone slightly increase the
number of 7-AAD scored apoptotic cells (from 22.1-29.8%), but when
linked to DCIR or DC-SIGN/L.Doc rAbs, Coh.PE38 greatly enhanced the
number of 7-AAD scored apoptotic cells.
[0049] FIG. 19 shows the expression of anti-DC-SIGN/L and
Anti-DC-ASPGR rAb.Coh and rAb.Doc were efficiently secreted.
[0050] FIG. 20 shows the effect of IL-21 and Coh.IL-21 on the
proliferation of human B cells.
DETAILED DESCRIPTION OF THE INVENTION
[0051] While the making and using of various embodiments of the
present invention are discussed in detail below, it should be
appreciated that the present invention provides many applicable
inventive concepts that can be embodied in a wide variety of
specific contexts. The specific embodiments discussed herein are
merely illustrative of specific ways to make and use the invention
and do not delimit the scope of the invention.
[0052] To facilitate the understanding of this invention, a number
of terms are defined below. Terms defined herein have meanings as
commonly understood by a person of ordinary skill in the areas
relevant to the present invention. Terms such as "a", "an" and
"the" are not intended to refer to only a singular entity, but
include the general class of which a specific example may be used
for illustration. The terminology herein is used to describe
specific embodiments of the invention, but their usage does not
delimit the invention, except as outlined in the claims.
[0053] At present, protein engineering technology enables the ready
and controlled addition of an antigen (or different antigens to one
of the chains) of a recombinant mAb (H or L, usually the C-terminus
of H is often used). If different antigens or different antigen
sets need to be linked to the mAb, then the mAb needs to be
re-engineered, expressed, and purified as a different entity.
[0054] The present invention provides for the complexing of
multiple antigens or proteins (engineered, expressed, and purified
independently from the primary mAb) in a controlled, multivariable
fashion, to one single primary recombinant mAb. Presently, there
are methods for engineering site-specific biotinylation sites that
provide for the addition of different proteins (each engineered
separately linked to streptavidin) to the one primary mAb. However,
the present invention provides for addition to the primary mAb of
multiple combinations, in fixed equimolar ratios and locations, of
separately engineered proteins.
[0055] As used herein, the term "modular rAb carrier" is used to
describe a recombinant antibody system that has been engineered to
provide the controlled modular addition of diverse antigens,
activating proteins, or other antibodies to a single recombinant
monoclonal antibody (mAb). The rAb may be a monoclonal antibody
made using standard hybridoma techniques, recombinant antibody
display, humanized monoclonal antibodies and the like. The modular
rAb carrier can be used to, e.g., target (via one primary
recombinant antibody against an internalizing receptor, e.g., a
human dendritic cell receptor) multiple antigens and/or antigens
and an activating cytokine to dendritic cells (DC). The modular rAb
carrier may also be used to join two different recombinant mAbs
end-to-end in a controlled and defined manner.
[0056] The antigen binding portion of the "modular rAb carrier" may
be one or more variable domains, one or more variable and the first
constant domain, an Fab fragment, a Fab' fragment, an F(ab).sub.2
fragment, and Fv fragment, and Fabc fragment and/or a Fab fragment
with portions of the Fc domain to which the cognate modular binding
portions are added to the amino acid sequence and/or bound. The
antibody for use in the modular rAb carrier can be of any isotype
or class, subclass or from any source (animal and/or
recombinant).
[0057] In one non-limiting example, the modular rAb carrier is
engineered to have one or more modular cohesin-dockerin protein
domains for making specific and defined protein complexes in the
context of engineered recombinant mAbs. The mAb is a portion of a
fusion protein that includes one or more modular cohesin-dockerin
protein domains carboxy from the antigen binding domains of the
mAb. The cohesin-dockerin protein domains may even be attached
post-translationally, e.g., by using chemical cross-linkers and/or
disulfide bonding.
[0058] The modular rAb carrier will be used to carry a separate
molecule, e.g., a peptide, protein, lipid, carbohydrate, nucleic
acid (oligonucleotide, aptamer, vector with or without base or
backbone modifications) or combinations thereof by binding that
separate molecule to the complementary half of the
cohesion:dockerin pair. For example, either the dockerin or cohesin
made be made into a fusion protein or chemically bound to an
antigen, a peptide, a protein, a toxin, a cytokine, an enzyme, a
structural protein, an extracellular matrix protein, another
antibody, a cell or fragments thereof. The modular rAb carrier may
have one or more cohesin, dockerin or both cohesin and dockerin
domains that allow the formation of a complex with one or more
complementary cohesin/dockerin-molecules for delivery via the
antigen recognition domain of the modular rAb carrier.
[0059] The term "antigen" as used herein refers to a molecule that
can initiate a humoral and/or cellular immune response in a
recipient of the antigen. Antigen may be used in two different
contexts with the present invention: as a target for the antibody
or other antigen recognition domain of the rAb or as the molecule
that is carried to and/or into a cell or target by the rAb as part
of a dockerin/cohesin-molecule complement to the modular rAb
carrier. The antigen is usually an agent that causes a disease for
which a vaccination would be advantageous treatment. When the
antigen is presented on MHC, the peptide is often about 8 to about
25 amino acids. Antigens include any type of biologic molecule,
including, for example, simple intermediary metabolites, sugars,
lipids and hormones as well as macromolecules such as complex
carbohydrates, phospholipids, nucleic acids and proteins. Common
categories of antigens include, but are not limited to, viral
antigens, bacterial antigens, fungal antigens, protozoal and other
parasitic antigens, tumor antigens, antigens involved in autoimmune
disease, allergy and graft rejection, and other miscellaneous
antigens.
[0060] The modular rAb carrier is able to carry any number of
active agents, e.g., antibiotics, anti-infective agents, antiviral
agents, anti-tumoral agents, antipyretics, analgesics,
anti-inflammatory agents, therapeutic agents for osteoporosis,
enzymes, cytokines, anticoagulants, polysaccharides, collagen,
cells, and combinations of two or more of the foregoing active
agents. Examples of antibiotics for delivery using the present
invention include, without limitation, tetracycline,
aminoglycosides, penicillins, cephalosporins, sulfonamide drugs,
chloramphenicol sodium succinate, erythromycin, vancomycin,
lincomycin, clindamycin, nystatin, amphotericin B, amantidine,
idoxuridine, p-amino salicyclic acid, isoniazid, rifampin,
antinomycin D, mithramycin, daunomycin, adriamycin, bleomycin,
vinblastine, vincristine, procarbazine, imidazole carboxamide, and
the like.
[0061] Examples of anti-tumor agents for delivery using the present
invention include, without limitation, doxorubicin, Daunorubicin,
taxol, methotrexate, and the like. Examples of antipyretics and
analgesics include aspirin, Motrin.RTM., Ibuprofen.RTM., naprosyn,
acetaminophen, and the like.
[0062] Examples of anti-inflammatory agents for delivery using the
present invention include, without limitation, include NSAIDS,
aspirin, steroids, dexamethasone, hydrocortisone, prednisolone,
Diclofenac Na, and the like.
[0063] Examples of therapeutic agents for treating osteoporosis and
other factors acting on bone and skeleton include for delivery
using the present invention include, without limitation, calcium,
alendronate, bone GLa peptide, parathyroid hormone and its active
fragments, histone H4-related bone formation and proliferation
peptide and mutations, derivatives and analogs thereof.
[0064] Examples of enzymes and enzyme cofactors for delivery using
the present invention include, without limitation, pancrease,
L-asparaginase, hyaluronidase, chymotrypsin, trypsin, tPA,
streptokinase, urokinase, pancreatin, collagenase, trypsinogen,
chymotrypsinogen, plasminogen, streptokinase, adenyl cyclase,
superoxide dismutase (SOD), and the like.
[0065] Examples of cytokines for delivery using the present
invention include, without limitation, interleukins, transforming
growth factors (TGFs), fibroblast growth factors (FGFs), platelet
derived growth factors (PDGFs), epidermal growth factors (EGFs),
connective tissue activated peptides (CTAPs), osteogenic factors,
and biologically active analogs, fragments, and derivatives of such
growth factors. Cytokines may be B/T-cell differentiation factors,
B/T-cell growth factors, mitogenic cytokines, chemotactic
cytokines, colony stimulating factors, angiogenesis factors,
IFN-.alpha., IFN-.beta., IFN-.gamma., IL1, IL2, IL3, IL4, IL5, IL6,
IL7, IL8, IL9, IL10, IL11, IL12, IL13, IL14, IL15, IL16, IL17,
IL18, etc., leptin, myostatin, macrophage stimulating protein,
platelet-derived growth factor, TNF-.alpha., TNF-.beta., NGF,
CD40L, CD137L/4-1BBL, human lymphotoxin-.beta., G-CSF, M-CSF,
GM-CSF, PDGF, IL-1.alpha., IL1-.beta., IP-10, PF4, GRO, 9E3,
erythropoietin, endostatin, angiostatin, VEGF or any fragments or
combinations thereof. Other cytokines include members of the
transforming growth factor (TGF) supergene family include the beta
transforming growth factors (for example TGF-.beta.1, TGF-.beta.2,
TGF-.beta.3); bone morphogenetic proteins (for example, BMP-1,
BMP-2, BMP-3, BMP-4, BMP-5, BMP-6, BMP-7, BMP-8, BMP-9);
heparin-binding growth factors (for example, fibroblast growth
factor (FGF), epidermal growth factor (EGF), platelet-derived
growth factor (PDGF), insulin-like growth factor (IGF)); Inhibins
(for example, Inhibin A, Inhibin B); growth differentiating factors
(for example, GDF-1); and Activins (for example, Activin A, Activin
B, Activin AB).
[0066] Examples of growth factors for delivery using the present
invention include, without limitation, growth factors that can be
isolated from native or natural sources, such as from mammalian
cells, or can be prepared synthetically, such as by recombinant DNA
techniques or by various chemical processes. In addition, analogs,
fragments, or derivatives of these factors can be used, provided
that they exhibit at least some of the biological activity of the
native molecule. For example, analogs can be prepared by expression
of genes altered by site-specific mutagenesis or other genetic
engineering techniques.
[0067] Examples of anticoagulants for delivery using the present
invention include, without limitation, include warfarin, heparin,
Hirudin, and the like. Examples of factors acting on the immune
system include for delivery using the present invention include,
without limitation, factors which control inflammation and
malignant neoplasms and factors which attack infective
microorganisms, such as chemotactic peptides and bradykinins.
[0068] Examples of viral antigens and/or viral antigenic targets
include, but are not limited to, e.g., retroviral antigens such as
retroviral antigens from the human immunodeficiency virus (HIV)
antigens such as gene products of the gag, pol, and env genes, the
Nef protein, reverse transcriptase, and other HIV components;
hepatitis viral antigens such as the S, M, and L proteins of
hepatitis B virus, the pre-S antigen of hepatitis B virus, and
other hepatitis, e.g., hepatitis A, B, and C, viral components such
as hepatitis C viral RNA; influenza viral antigens such as
hemagglutinin and neuraminidase and other influenza viral
components; measles viral antigens such as the measles virus fusion
protein and other measles virus components; rubella viral antigens
such as proteins E1 and E2 and other rubella virus components;
rotaviral antigens such as VP7sc and other rotaviral components;
cytomegaloviral antigens such as envelope glycoprotein B and other
cytomegaloviral antigen components; respiratory syncytial viral
antigens such as the RSV fusion protein, the M2 protein and other
respiratory syncytial viral antigen components; herpes simplex
viral antigens such as immediate early proteins, glycoprotein D,
and other herpes simplex viral antigen components; varicella zoster
viral antigens such as gpI, gpII, and other varicella zoster viral
antigen components; Japanese encephalitis viral antigens such as
proteins E, M-E, M-E-NS1, NS1, NS1-NS2A, 80% E, and other Japanese
encephalitis viral antigen components; rabies viral antigens such
as rabies glycoprotein, rabies nucleoprotein and other rabies viral
antigen components. See Fundamental Virology, Second Edition, eds.
Fields, B. N. and Knipe, D. M. (Raven Press, New York, 1991) for
additional examples of viral antigens.
[0069] Antigens and/or antigenic targets that may be delivered
using the rAb-DC/DC-antigen vaccines of the present invention
include genes encoding antigens such as viral antigens, bacterial
antigens, fungal antigens or parasitic antigens. Viruses include
picornavirus; coronavirus, togavirus, flavirvirus, rhabdovirus,
paramyxovirus, orthomyxovirus, bunyavirus, arenavirus, reovirus,
retrovirus, papilomavirus, parvovirus, herpesvirus, poxvirus,
hepadnavirus, and spongiform virus. Other viral targets include
influenza, herpes simplex virus 1 and 2, measles, dengue, smallpox,
polio or HIV. Pathogens include trypanosomes, tapeworms,
roundworms, helminthes, malaria. Tumor markers, such as fetal
antigen or prostate specific antigen, may be targeted in this
manner. Other examples include: HIV env proteins and hepatitis B
surface antigen. Administration of a vector according to the
present invention for vaccination purposes would require that the
vector-associated antigens be sufficiently non-immunogenic to
enable long term expression of the transgene, for which a strong
immune response would be desired. In some cases, vaccination of an
individual may only be required infrequently, such as yearly or
biennially, and provide long term immunologic protection against
the infectious agent. Specific examples of organisms, allergens and
nucleic and amino sequences for use in vectors and ultimately as
antigens with the present invention may be found in U.S. Pat. No.
6,541,011, relevant portions incorporated herein by reference, in
particular, the tables that match organisms and specific sequences
that may be used with the present invention.
[0070] Bacterial antigens for use with the rAb vaccine disclosed
herein include, but are not limited to, e.g., bacterial antigens
such as pertussis toxin, filamentous hemagglutinin, pertactin,
FIM2, FIM3, adenylate cyclase and other pertussis bacterial antigen
components; diptheria bacterial antigens such as diptheria toxin or
toxoid and other diptheria bacterial antigen components; tetanus
bacterial antigens such as tetanus toxin or toxoid and other
tetanus bacterial antigen components; streptococcal bacterial
antigens such as M proteins and other streptococcal bacterial
antigen components; gram-negative bacilli bacterial antigens such
as lipopolysaccharides and other gram-negative bacterial antigen
components, Mycobacterium tuberculosis bacterial antigens such as
mycolic acid, heat shock protein 65 (HSP65), the 30 kDa major
secreted protein, antigen 85A and other mycobacterial antigen
components; Helicobacter pylori bacterial antigen components;
pneumococcal bacterial antigens such as pneumolysin, pneumococcal
capsular polysaccharides and other pneumococcal bacterial antigen
components; haemophilus influenza bacterial antigens such as
capsular polysaccharides and other haemophilus influenza bacterial
antigen components; anthrax bacterial antigens such as anthrax
protective antigen and other anthrax bacterial antigen components;
rickettsiae bacterial antigens such as rompA and other rickettsiae
bacterial antigen component. Also included with the bacterial
antigens described herein are any other bacterial, mycobacterial,
mycoplasmal, rickettsial, or chlamydial antigens. Partial or whole
pathogens may also be: haemophilus influenza; Plasmodium
falciparum; neisseria meningitidis; streptococcus pneumoniae;
neisseria gonorrhoeae; salmonella serotype typhi; shigella; vibrio
cholerae; Dengue Fever; Encephalitides; Japanese Encephalitis; lyme
disease; Yersinia pestis; west nile virus; yellow fever; tularemia;
hepatitis (viral; bacterial); RSV (respiratory syncytial virus);
HPIV 1 and HPIV 3; adenovirus; small pox; allergies and
cancers.
[0071] Fungal antigens for use with compositions and methods of the
invention include, but are not limited to, e.g., candida fungal
antigen components; histoplasma fungal antigens such as heat shock
protein 60 (HSP60) and other histoplasma fungal antigen components;
cryptococcal fungal antigens such as capsular polysaccharides and
other cryptococcal fungal antigen components; coccidiodes fungal
antigens such as spherule antigens and other coccidiodes fungal
antigen components; and tinea fungal antigens such as trichophytin
and other coccidiodes fungal antigen components.
[0072] Examples of protozoal and other parasitic antigens include,
but are not limited to, e.g., plasmodium falciparum antigens such
as merozoite surface antigens, sporozoite surface antigens,
circumsporozoite antigens, gametocyte/gamete surface antigens,
blood-stage antigen pf 155/RESA and other plasmodial antigen
components; toxoplasma antigens such as SAG-1, p30 and other
toxoplasmal antigen components; schistosomae antigens such as
glutathione-S-transferase, paramyosin, and other schistosomal
antigen components; leishmania major and other leishmaniae antigens
such as gp63, lipophosphoglycan and its associated protein and
other leishmanial antigen components; and trypanosoma cruzi
antigens such as the 75-77 kDa antigen, the 56 kDa antigen and
other trypanosomal antigen components.
[0073] Target antigens on immune cell surfaces that can be targeted
using the antigen recognition site of the antibody portion of the
rAb of the present invention will generally be selected based on a
number of factors, including: likelihood of internalization, level
of immune cell specificity, type of immune cell targeted, level of
immune cell maturity and/or activation and the like. Examples of
cell surface markers for dendritic cells include, but are not
limited to, MHC class I, MHC Class II, CD1, CD2, CD3, CD4, CD8,
CD11b, CD14, CD15, CD16, CD19, CD20, CD29, CD31, CD40, CD43, CD44,
CD45, CD54, CD56, CD57, CD58, CD83, CD86, CMRF-44, CMRF-56, DCIR,
DC-ASPGR, CLEC-6, CD40, BDCA-2, MARCO, DEC-205, mannose receptor,
Langerin, DECTIN-1, B7-1, B7-2, IFN-y receptor and IL-2 receptor,
ICAM-1, Fc.gamma. receptor or other receptor relatively
specifically expressed by antigen presenting cells. Examples of
cell surface markers for antigen presenting cells include, but are
not limited to, MHC class I, MHC Class II, CD1, CD2, CD3, CD4, CD8,
CD11b, CD14, CD15, CD16, CD19, CD20, CD29, CD31, CD40,CD43, CD44,
CD45, CD54, CD56, CD57, CD58, CD83, CD86, CMRF-44, CMRF-56, DCIR,
DC-ASPGR, CLEC-6, CD40, BDCA-2, MARCO, DEC-205, mannose receptor,
Langerin, DECTIN-1, B7-1, B7-2, IFN-.gamma. receptor and IL-2
receptor, ICAM-1, Fc.gamma. receptor or other receptor relatively
specifically expressed by antigen presenting cells. Examples of
cell surface markers for T cells include, but are not limited to,
CD3, CD4, CD8, CD14, CD20, CD11b, CD16, CD45 and HLA-DR.
[0074] Target antigens on cell surfaces for delivery includes those
characteristic of tumor antigens typically will be derived from the
cell surface, cytoplasm, nucleus, organelles and the like of cells
of tumor tissue. Examples of tumor targets for the antibody portion
of the present invention include, without limitation, hematological
cancers such as leukemias and lymphomas, neurological tumors such
as astrocytomas or glioblastomas, melanoma, breast cancer, lung
cancer, head and neck cancer, gastrointestinal tumors such as
gastric or colon cancer, liver cancer, pancreatic cancer,
genitourinary tumors such cervix, uterus, ovarian cancer, vaginal
cancer, testicular cancer, prostate cancer or penile cancer, bone
tumors, vascular tumors, or cancers of the lip, nasopharynx,
pharynx and oral cavity, esophagus, rectum, gall bladder, biliary
tree, larynx, lung and bronchus, bladder, kidney, brain and other
parts of the nervous system, thyroid, Hodgkin's disease,
non-Hodgkin's lymphoma, multiple myeloma and leukemia.
[0075] Examples of antigens that may be delivered alone or in
combination to immune cells for antigen presentation using the
present invention include tumor proteins, e.g., mutated oncogenes;
viral proteins associated with tumors; and tumor mucins and
glycolipids. The antigens may be viral proteins associated with
tumors would be those from the classes of viruses noted above.
Certain antigens may be characteristic of tumors (one subset being
proteins not usually expressed by a tumor precursor cell), or may
be a protein which is normally expressed in a tumor precursor cell,
but having a mutation characteristic of a tumor. Other antigens
include mutant variant(s) of the normal protein having an altered
activity or subcellular distribution, e.g., mutations of genes
giving rise to tumor antigens.
[0076] Specific non-limiting examples of tumor antigens include:
CEA, prostate specific antigen (PSA), HER-2/neu, BAGE, GAGE, MAGE
1-4, 6 and 12, MUC (Mucin) (e.g., MUC-1, MUC-2, etc.), GM2 and GD2
gangliosides, ras, myc, tyrosinase, MART (melanoma antigen), Pmel
17 (gp100), GnT-V intron V sequence (N-acetylglucoaminyltransferase
V intron V sequence), Prostate Ca psm, PRAME (melanoma antigen),
.beta.-catenin, MUM-1-B (melanoma ubiquitous mutated gene product),
GAGE (melanoma antigen) 1, BAGE (melanoma antigen) 2-10, c-ERB2
(Her2/neu), EBNA (Epstein-Barr Virus nuclear antigen) 1-6, gp75,
human papilloma virus (HPV) E6 and E7, p53, lung resistance protein
(LRP), Bcl-2, and Ki-67. In addition, the immunogenic molecule can
be an autoantigen involved in the initiation and/or propagation of
an autoimmune disease, the pathology of which is largely due to the
activity of antibodies specific for a molecule expressed by the
relevant target organ, tissue, or cells, e.g., SLE or MG. In such
diseases, it can be desirable to direct an ongoing
antibody-mediated (i.e., a Th2-type) immune response to the
relevant autoantigen towards a cellular (i.e., a Th1-type) immune
response. Alternatively, it can be desirable to prevent onset of or
decrease the level of a Th2 response to the autoantigen in a
subject not having, but who is suspected of being susceptible to,
the relevant autoimmune disease by prophylactically inducing a Th1
response to the appropriate autoantigen. Autoantigens of interest
include, without limitation: (a) with respect to SLE, the Smith
protein, RNP ribonucleoprotein, and the SS-A and SS-B proteins; and
(b) with respect to MG, the acetylcholine receptor. Examples of
other miscellaneous antigens involved in one or more types of
autoimmune response include, e.g., endogenous hormones such as
luteinizing hormone, follicular stimulating hormone, testosterone,
growth hormone, prolactin, and other hormones.
[0077] Antigens involved in autoimmune diseases, allergy, and graft
rejection can be used in the compositions and methods of the
invention. For example, an antigen involved in any one or more of
the following autoimmune diseases or disorders can be used in the
present invention: diabetes, diabetes mellitus, arthritis
(including rheumatoid arthritis, juvenile rheumatoid arthritis,
osteoarthritis, psoriatic arthritis), multiple sclerosis,
myasthenia gravis, systemic lupus erythematosis, autoimmune
thyroiditis, dermatitis (including atopic dermatitis and eczematous
dermatitis), psoriasis, Sjogren's Syndrome, including
keratoconjunctivitis sicca secondary to Sjogren's Syndrome,
alopecia areata, allergic responses due to arthropod bite
reactions, Crohn's disease, aphthous ulcer, iritis, conjunctivitis,
keratoconjunctivitis, ulcerative colitis, asthma, allergic asthma,
cutaneous lupus erythematosus, scleroderma, vaginitis, proctitis,
drug eruptions, leprosy reversal reactions, erythema nodosum
leprosum, autoimmune uveitis, allergic encephalomyelitis, acute
necrotizing hemorrhagic encephalopathy, idiopathic bilateral
progressive sensorineural hearing loss, aplastic anemia, pure red
cell anemia, idiopathic thrombocytopenia, polychondritis, Wegener's
granulomatosis, chronic active hepatitis, Stevens-Johnson syndrome,
idiopathic sprue, lichen planus, Crohn's disease, Graves
ophthalmopathy, sarcoidosis, primary biliary cirrhosis, uveitis
posterior, and interstitial lung fibrosis. Examples of antigens
involved in autoimmune disease include glutamic acid decarboxylase
65 (GAD 65), native DNA, myelin basic protein, myelin proteolipid
protein, acetylcholine receptor components, thyroglobulin, and the
thyroid stimulating hormone (TSH) receptor. Examples of antigens
involved in allergy include pollen antigens such as Japanese cedar
pollen antigens, ragweed pollen antigens, rye grass pollen
antigens, animal derived antigens such as dust mite antigens and
feline antigens, histocompatiblity antigens, and penicillin and
other therapeutic drugs. Examples of antigens involved in graft
rejection include antigenic components of the graft to be
transplanted into the graft recipient such as heart, lung, liver,
pancreas, kidney, and neural graft components. The antigen may be
an altered peptide ligand useful in treating an autoimmune
disease.
[0078] As used herein, the term "epitope(s)" refer to a peptide or
protein antigen that includes a primary, secondary or tertiary
structure similar to an epitope located within any of a number of
pathogen polypeptides encoded by the pathogen DNA or RNA. The level
of similarity will generally be to such a degree that monoclonal or
polyclonal antibodies directed against such polypeptides will also
bind to, react with, or otherwise recognize, the peptide or protein
antigen. Various immunoassay methods may be employed in conjunction
with such antibodies, such as, for example, Western blotting,
ELISA, RIA, and the like, all of which are known to those of skill
in the art. The identification of pathogen epitopes, and/or their
functional equivalents, suitable for use in vaccines is part of the
present invention. Once isolated and identified, one may readily
obtain functional equivalents. For example, one may employ the
methods of Hopp, as taught in U.S. Pat. No. 4,554,101, incorporated
herein by reference, which teaches the identification and
preparation of epitopes from amino acid sequences on the basis of
hydrophilicity. The methods described in several other papers, and
software programs based thereon, can also be used to identify
epitopic core sequences (see, for example, Jameson and Wolf, 1988;
Wolf et al., 1988; U.S. Pat. No. 4,554,101). The amino acid
sequence of these "epitopic core sequences" may then be readily
incorporated' into peptides, either through the application of
peptide synthesis or recombinant technology.
[0079] As used herein, the term "promoter" describes a control
sequence that is a region of a nucleic acid sequence at which
initiation and rate of transcription are controlled. It may contain
genetic elements at which regulatory proteins and molecules may
bind such as RNA polymerase and other transcription factors. The
phrases "operatively positioned," "operatively linked," "under
control," and "under transcriptional control" mean that a promoter
is in a correct functional location and/or orientation in relation
to a nucleic acid sequence (i.e., ORF) to control transcriptional
initiation and/or expression of that sequence. A promoter may or
may not be used in conjunction with an "enhancer," which refers to
a cis-acting regulatory sequence involved in the, transcriptional
activation of a nucleic acid sequence. A listing of promoters
and/or enhancers that may be used with the present invention is
described in, e.g., U.S. Pat. No. 6,410,241, relevant descriptions
and tables incorporated herein by reference.
[0080] As used herein, the terms "cell," "cell line," and "cell
culture" may be used interchangeably. All of these terms also
include their progeny, which is any and all subsequent generations,
in vivo, ex vivo or in vitro. It is understood that all progeny may
not be identical due to deliberate or inadvertent mutations. In the
context of expressing a heterologous nucleic acid sequence, "host
cell" refers to a prokaryotic or eukaryotic cell, and it includes
any transformable organism that is capable of expressing a
heterologous gene encoded by a vector as delivered using the rAb
protein vector of the present invention. A host cell can, and has
been, used as a recipient for vectors. A host cell may be
"transfected" or "transformed," which refers to a process by which
the exogenous nucleic acid expressing an antigen, as disclosed
herein, is transferred or introduced into the host cell. A
transformed cell includes the primary subject cell and its
progeny.
[0081] The preparation of vaccine compositions that includes the
nucleic acids that encode antigens of the invention as the active
ingredient, may be prepared as injectables, either as liquid
solutions or suspensions; solid forms suitable for solution in, or
suspension in, liquid prior to infection can also be prepared. The
preparation may be emulsified, encapsulated in liposomes. The
active immunogenic ingredients are often mixed with carriers which
are pharmaceutically acceptable and compatible with the active
ingredient.
[0082] The term "pharmaceutically acceptable carrier" refers to a
carrier that does not cause an allergic reaction or other untoward
effect in subjects to whom it is administered. Suitable
pharmaceutically acceptable carriers include, for example, one or
more of water, saline, phosphate buffered saline, dextrose,
glycerol, ethanol, or the like and combinations thereof. In
addition, if desired, the vaccine can contain minor amounts of
auxiliary substances such as wetting or emulsifying agents, pH
buffering agents, and/or adjuvants which enhance the effectiveness
of the vaccine. Examples of adjuvants that may be effective include
but are not limited to: aluminum hydroxide,
N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP),
N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine, MTP-PE and RIBI,
which contains three components extracted from bacteria,
monophosporyl lipid A, trehalose dimycolate and cell wall skeleton
(MPL+TDM+CWS) in a 2% squalene/Tween 80 emulsion. Other examples of
adjuvants include DDA (dimethyldioctadecylammonium bromide),
Freund's complete and incomplete adjuvants and QuilA. In addition,
immune modulating substances such as lymphokines (e.g.,
IFN-.gamma., IL-2 and IL-12) or synthetic IFN-.gamma. inducers such
as poly I:C can be used in combination with adjuvants described
herein.
[0083] Pharmaceutical products that may include a naked
polynucleotide with a single or multiple copies of the specific
nucleotide sequences that bind to specific DNA-binding sites of the
apolipoproteins present on plasma lipoproteins as described in the
current invention. The polynucleotide may encode a biologically
active peptide, antisense RNA, or ribozyme and will be provided in
a physiologically acceptable administrable form. Another
pharmaceutical product that may spring from the current invention
may include a highly purified plasma lipoprotein fraction, isolated
according to the methodology, described herein from either the
patients blood or other source, and a polynucleotide containing
single or multiple copies of the specific nucleotide sequences that
bind to specific DNA-binding sites of the apolipoproteins present
on plasma lipoproteins, prebound to the purified lipoprotein
fraction in a physiologically acceptable, administrable form.
[0084] Yet another pharmaceutical product may include a highly
purified plasma lipoprotein fraction which contains recombinant
apolipoprotein fragments containing single or multiple copies of
specific DNA-binding motifs, prebound to a polynucleotide
containing single or multiple copies of the specific nucleotide
sequences, in a physiologically acceptable administrable form. Yet
another pharmaceutical product may include a highly purified plasma
lipoprotein fraction which contains recombinant apolipoprotein
fragments containing single or multiple copies of specific
DNA-binding motifs, prebound to a polynucleotide containing single
or multiple copies of the specific nucleotide sequences, in a
physiologically acceptable administrable form.
[0085] The dosage to be administered depends to a great extent on
the body weight and physical condition of the subject being treated
as well as the route of administration and frequency of treatment.
A pharmaceutical composition that includes the naked polynucleotide
prebound to a highly purified lipoprotein fraction may be
administered in amounts ranging from 1 .mu.g to 1 mg polynucleotide
and 1 .mu.g to 100 mg protein.
[0086] Administration of the therapeutic virus particle to a
patient will follow general protocols for the administration of
chemotherapeutics, taking into account the toxicity, if any, of the
vector. It is anticipated that the treatment cycles would be
repeated as necessary. It also is contemplated that various
standard therapies, as well as surgical intervention, may be
applied in combination with the described gene therapy.
[0087] Where clinical application of a gene therapy is
contemplated, it will be necessary to prepare the complex as a
pharmaceutical composition appropriate for the intended
application. Generally this will entail preparing a pharmaceutical
composition that is essentially free of pyrogens, as well as any
other impurities that could be harmful to humans or animals. One
also will generally desire to employ appropriate salts and buffers
to render the complex stable and allow for complex uptake by target
cells.
[0088] Aqueous compositions of the present invention may include an
effective amount of the compound, dissolved or dispersed in a
pharmaceutically acceptable carrier or aqueous medium. Such
compositions can also be referred to as inocula. The use of such
media and agents for pharmaceutical active substances is well known
in the art. Except insofar as any conventional media or agent is
incompatible with the active ingredient, its use in the therapeutic
compositions is contemplated. Supplementary active ingredients also
can be incorporated into the compositions. The compositions of the
present invention may include classic pharmaceutical preparations.
Dispersions also can be prepared in glycerol, liquid polyethylene
glycols, and mixtures thereof and in oils. Under ordinary
conditions of storage and use, these preparations contain a
preservative to prevent the growth of microorganisms.
[0089] Disease States. Depending on the particular disease to be
treated, administration of therapeutic compositions according to
the present invention will be via any common route so long as the
target tissue is available via that route in order to maximize the
delivery of antigen to a site for maximum (or in some cases
minimum) immune response. Administration will generally be by
orthotopic, intradermal, subcutaneous, intramuscular,
intraperitoneal or intravenous injection. Other areas for delivery
include: oral, nasal, buccal, rectal, vaginal or topical. Topical
administration would be particularly advantageous for treatment of
skin cancers. Such compositions would normally be administered as
pharmaceutically acceptable compositions that include
physiologically acceptable carriers, buffers or other
excipients.
[0090] Vaccine or treatment compositions of the invention may be
administered parenterally, by injection, for example, either
subcutaneously or intramuscularly. Additional formulations which
are suitable for other modes of administration include
suppositories, and in some cases, oral formulations or formulations
suitable for distribution as aerosols. In the case of the oral
formulations, the manipulation of T-cell subsets employing
adjuvants, antigen packaging, or the addition of individual
cytokines to various formulation that result in improved oral
vaccines with optimized immune responses. For suppositories,
traditional binders and carriers may include, for example,
polyalkylene glycols or triglycerides; such suppositories may be
formed from mixtures containing the active ingredient in the range
of 0.5% to 10%, preferably 1%-2%. Oral formulations include such
normally employed excipients as, for example, pharmaceutical grades
of mannitol, lactose, starch magnesium stearate, sodium saccharine,
cellulose, magnesium carbonate, and the like. These compositions
take the form of solutions, suspensions, tablets, pills, capsules,
sustained release formulations or powders and contain 10%-95% of
active ingredient, preferably 25-70%.
[0091] The antigen encoding nucleic acids of the invention may be
formulated into the vaccine or treatment compositions as neutral or
salt forms. Pharmaceutically acceptable salts include the acid
addition salts (formed with free amino groups of the peptide) and
which are formed with inorganic acids such as, for example,
hydrochloric or phosphoric acids, or with organic acids such as
acetic, oxalic, tartaric, maleic, and the like. Salts formed with
the free carboxyl groups can also be derived from inorganic bases
such as, for example, sodium, potassium, ammonium, calcium, or
ferric hydroides, and such organic bases as isopropylamine,
trimethylamine, 2-ethylamino ethanol, histidine, procaine, and the
like.
[0092] Vaccine or treatment compositions are administered in a
manner compatible with the dosage formulation, and in such amount
as will be prophylactically and/or therapeutically effective. The
quantity to be administered depends on the subject to be treated,
including, e.g., capacity of the subject's immune system to
synthesize antibodies, and the degree of protection or treatment
desired. Suitable dosage ranges are of the order of several hundred
micrograms active ingredient per vaccination with a range from
about 0.1 mg to 1000 mg, such as in the range from about 1 mg to
300 mg, and preferably in the range from about 10 mg to 50 mg.
Suitable regiments for initial administration and booster shots are
also variable but are typified by an initial administration
followed by subsequent inoculations or other administrations.
Precise amounts of active ingredient required to be administered
depend on the judgment of the practitioner and may be peculiar to
each subject. It will be apparent to those of skill in the art that
the therapeutically effective amount of nucleic acid molecule or
fusion polypeptides of this invention will depend, inter alia, upon
the administration schedule, the unit dose of antigen administered,
whether the nucleic acid molecule or fusion polypeptide is
administered in combination with other therapeutic agents, the
immune status and health of the recipient, and the therapeutic
activity of the particular nucleic acid molecule or fusion
polypeptide.
[0093] The compositions can be given in a single dose schedule or
in a multiple dose schedule. A multiple dose schedule is one in
which a primary course of vaccination may include, e.g., 1-10
separate doses, followed by other doses given at subsequent time
intervals required to maintain and or reinforce the immune
response, for example, at 1-4 months for a second dose, and if
needed, a subsequent dose(s) after several months. Periodic
boosters at intervals of 1-5 years, usually 3 years, are desirable
to maintain the desired levels of protective immunity. The course
of the immunization can be followed by in vitro proliferation
assays of peripheral blood lymphocytes (PBLs) co-cultured with
ESAT6 or ST-CF, and by measuring the levels of IFN-.gamma. released
from the primed lymphocytes. The assays may be performed using
conventional labels, such as radionuclides, enzymes, fluorescent
labels and the like. These techniques are known to one skilled in
the art and can be found in U.S. Pat. Nos. 3,791,932, 4,174,384 and
3,949,064, relevant portions incorporated by reference.
[0094] The modular rAb carrier and/or conjugated rAb
carrier-(cohesion/dockerin and/or dockerin-cohesin)-antigen complex
(rAb-DC/DC-antigen vaccine) may be provided in one or more "unit
doses" depending on whether the nucleic acid vectors are used, the
final purified proteins, or the final vaccine form is used. Unit
dose is defined as containing a predetermined-quantity of the
therapeutic composition calculated to produce the desired responses
in association with its administration, i.e., the appropriate route
and treatment regimen. The quantity to be administered, and the
particular route and formulation, are within the skill of those in
the clinical arts. The subject to be treated may also be evaluated,
in particular, the state of the subject's immune system and the
protection desired. A unit dose need not be administered as a
single injection but may include continuous infusion over a set
period of time. Unit dose of the present invention may conveniently
may be described in terms of DNA/kg (or protein/Kg) body weight,
with ranges between about 0.05, 0.10, 0.15, 0.20, 0.25, 0.5, 1, 10,
50, 100, 1,000 or more mg/DNA or protein/kg body weight are
administered. Likewise the amount of rAb-DC/DC-antigen vaccine
delivered can vary from about 0.2 to about 8.0 mg/kg body weight.
Thus, in particular embodiments, 0.4 mg, 0.5 mg, 0.8 mg, 1.0 mg,
1.5 mg, 2.0 mg, 2.5 mg, 3.0 mg, 4.0 mg, 5.0 mg, 5.5 mg, 6.0 mg, 6.5
mg, 7.0 mg and 7.5 mg of the vaccine may be delivered to an
individual in vivo. The dosage of rAb-DC/DC-antigen vaccine to be
administered depends to a great extent on the weight and physical
condition of the subject being treated as well as the route of
administration and the frequency of treatment. A pharmaceutical
composition that includes a naked polynucleotide prebound to a
liposomal or viral delivery vector may be administered in amounts
ranging from 1 .mu.g to 1 mg polynucleotide to 1 .mu.g to 100 mg
protein. Thus, particular compositions may include between about 1
.mu.g, 5 .mu.g, 10 .mu.g, 20 .mu.g, 30 .mu.g, 40 .mu.g, 50 .mu.g,
60 .mu.g, 70 .mu.g, 80 .mu.g, 100 .mu.g, 150 .mu.g, 200 .mu.g, 250
.mu.g, 500 .mu.g, 600 .mu.g, 700 .mu.g, 800 .mu.g, 900 .mu.g or
1,000 .mu.g polynucleotide or protein that is bound independently
to 1 .mu.g, 5 .mu.g, 10 .mu.g, 20 .mu.g, 3.0 .mu.g, 40 .mu.g 50
.mu.g, 60 .mu.g, 70 .mu.g, 80 .mu.g, 100 .mu.g, 150 .mu.g, 200
.mu.g, 250 .mu.g, 500 .mu.g, 600 .mu.g, 700 .mu.g, 800 .mu.g, 900
.mu.g, 1 mg, 1.5 mg, 5 mg, 10 mg, 20 mg, 30 mg, 40 mg, 50 mg, 60
mg, 70 mg, 80 mg, 90 mg or 100 mg vector.
[0095] The present invention was tested in an in vitro cellular
system that measures immune stimulation of human Flu-specific T
cells by dendritic cells to which Flu antigen has been targeted.
The results shown herein demonstrate the specific expansion of such
antigen specific cells at doses of the antigen which are by
themselves ineffective in this system.
[0096] The present invention may also be used to make a modular rAb
carrier that is, e.g., a recombinant humanized mAb (directed to a
specific human dendritic cell receptor) complexed with protective
antigens from Ricin, Anthrax toxin, and Staphylococcus B
enterotoxin. The potential market for this entity is vaccination of
all military personel and stored vaccine held in reserve to
administer to large population centers in response to any biothreat
related to these agents. The invention has broad application to the
design of vaccines in general, both for human and animal use.
Industries of interest is pharmaceutical and biotechnology
[0097] One commercial application of the invention is a recombinant
humanized mAb (directed to the specific human dendritic cell
receptor DCIR) fused through the Ab heavy chain to antigens known
or suspected to encode protective antigens. These include as
examples for vaccination against various agents--hemagglutinins
from Influenza H5N1; HIV gag from attenuated toxins from Ricin,
Anthrax toxin, and Staphylococcus B enterotoxin; `strings` of
antigenic peptides from melanona anigens, etc. The potential market
for this entity is preventative or therapeutic vaccination of at
risk or infected people. The invention has broad application for
vaccination against many diseases and cancers, both for human and
animal use. Industries of interest are pharmaceutical and
biotechnology. In addition, this invention has implications beyond
anti-DCIR application since it describes a method to identify
particularly favorable sequences,to enhance secretion of
recombinant antibodies.
[0098] The application of anti-DCIR combining regions for making
engineered recombinant monoclonal antibodies fused to antigens as
potent therapeutic or preventative vaccination agents. Use of
different V-region sequences against the same combining specificity
to find those most compatible with efficient expression of a H
chain C-terminal linked antigen or other protein sequence.
Example 1
Multiple Antigens Targeted in a Complex Simultaneously with the
same Engineered Humanized mAb (MATCHMAB)
[0099] One type of therapeutic (in this case, vaccination) entity
envisioned is a humanized DC-targeting mAb-antigen fusion protein,
where the antibody variable region specificity is directed against
an internalizing human dendritic cell receptor. The present
state-of-the art is to engineer the fusion of the desired antigen
to the C-terminus of the mAb H chain. This paradigm obviously
allows different antigens (A1, A2, A3) to be engineered to the same
proven targeting mAb backbone (Y in the figure below), thus
extending the utility of the one mAb to immunizing against
different pathogenic agents. This concept can be further extended
by engineering, e.g., the A1, A2, A3 coding regions end-to-end
fused to the IgGFc C-terminal coding region.
[0100] The present invention disclosed a new paradigm for linking
the antigen to the targeting mAb that extends the concept for the
first time to multiple antigens targeted in a complex
simultaneously with the same engineered humanized mAb
(MATCHMAB).
[0101] FIG. 1 compares the prior art (top portion) with an example
of the multiple antigens targeted in a complex simultaneously with
the same engineered humanized mAb (MATCHMAB) (bottom portion). Y
represents the humanized anti-DC targeting mAb; A1, A2, A3 are
independent protective antigens, or any other desired protein
domains; C1, C2, C2 are specific high affinity capture domains for,
respectively, docking domains D1, D2. D3; and DnAn are the
corresponding docking-antigen fusion proteins. Note that the
various domains are not drawn to scale. The mAb itself is
.about.150 kDa, C is .about.17 Da, D is .about.8 kDa and A varies,
but is usually >20 kDa).
[0102] The MATCHMAB is based on using cellulosome-assembly
cohesin-dockerin sequences to form modular non-covalent targeting
mAb-antigen complexes. The relatively small and specific
cohesin-dockerin protein-protein interaction domains can allow
simple customized formulation of targeting mAb-antigen complexes.
Thus, a single manufactured humanized mAb (in the above notation:
Y.C1.C2.C3.Cn) can be use as the basis of delivering multiple
antigens in various, yet strictly defined, combinations.
[0103] Example of sequence encoding C1.C2.C3.Cn is taken from the
public sequence >gi|50656899|gb|AAT79550.1| of cellulosomal
anchoring scaffoldin B precursor (Bacteroides cellulosolvens).
Below with blue showing the leader secretion sequence and yellow
and grey highlighting various cohesin domains. Red regions are
linkers spacing some of the cohesin domains.
##STR00001##
[0104] The cohesin domains (C) interact with small domains (e.g.,
56 residues) called dockerins (D). These are Ca++ containing
structures with two-fold symmetry and they can bind to a cognate
cohesin with various affinities (e.g., 6E6 M, 2E7M). Affinities
between dockerin and multiple cohesins (as found on scaffoldins)
can be much higher (e.g., >E9 M). The interaction is
non-covalent and is well defined (by structure analysis) for at
least one C-D pair. Dockerins are designed to be domains linked to
different domain (enzyme in nature), and cohesions are designed to
function in linear arrays (either directly end-to-end, or joined by
flexible PT-rich linkers of various sizes (e.g., 12, 17, 25, 28,
36). It is known that a particular dockerin can have specificity
for a particular cohesin (e.g., a C-D pair from one bacterial
species may not be interchangeable with a C-D pair from a different
species). This feature makes it is possible to ensure the specific
and precise interaction of various D-antigen fusion proteins with
an engineered mAb containing cohesin domains of various
specificities.
[0105] In practice, this invention includes adapting C-D pairs
known from the literature, newly gleamed from nature, or developed
with new specificities using phage display technology. The latter
technology can also be used to enhance (`mature`) the affinity of a
C-D interaction, should this be desired. Also, engineering cysteine
residues at opposing faces of the C-D interaction (based on
modeling from the published C-D structures) could be used to make a
covalent bond between C-D to strengthen the interaction.
Furthermore, the dimeric nature of the mAb (and therefore the
linked C-domains) can be used to advantage for affinity enhancement
purposes. In this embodiment, e.g., the D-antigen fusion protein is
engineered either with a second identical dockerin domain
(D-antigen-D, or D-D-antigen), or with a homodimerization domain.
This configuration, provided the linkers between domains were not
constraining, will result in the preferred simultaneous binding of
both D domains to the same mAb, with greatly enhanced stability
compared to the single interaction.
[0106] Based on the crystal structure of the cohesin-dockerin
complex (e.g., see PNAS 2003, 13809-13814, Cellulosome assembly
revealed by the crystal structure of the cohesin-dockerin complex.
Ana L. Carvalho *, Fernando M. V. Dias, Jose A. M. Prates, Tibor
Nagy, Harry J. Gilbert, Gideon J. Davies, Luis M. A. Ferreira,
Maria J. Romao and Carlos M. G. A. Fonte), it is apparent that one
embodiment is an antigen-dockerin fusion proteins (i.e., antigen
fused to the N-terminus of a dockerin). However, both from the
structure and from the nature of cohesin domain organization within
scaffoldins, it is apparent that cohesions can be fused end-to-end,
even without spacer sequences. Furthermore, it is apparent that
well-described techniques are available to engineer miniaturized
versions of the cohesin and dockerin domains (see for example,
Proc. Natl. Acad. Sci. USA Vol. 94, pp. 10080-10085, September
1997. Structural mimicry of a native protein by a minimized binding
domain. Melissa A. Starovasnik, Andrew C. Braisted, And James A.
Wells).
[0107] It is recognized herein that the linker sequences have a
propensity for O-linked glycosylation resulting from ST richness.
Also, both the C and D domains can have potential N-linked sites.
These features can be advantageous in enhancing the solubility of
the mammalian cell-expressed engineered mAb through decoration with
carbohydrates. Of course, the consequences of glycosylation of the
C domains needs to be check by function (binding to the cognate D),
and if needed rectified by site directed mutagenesis. An attractive
feature of this invention is that D-A can be expressed in whatever
system is known to be best. For example, the tumor antigen MART1 is
a membrane protein and is best prepared in high yield via E. coli
inclusion bodies. Schema using antigens directly fused to the mAb
are restricted to antigens that are compatible with mammalian-cell
expression.
[0108] Another embodiment of the invention is the use of the D-C
interaction to make bi-specific mAbs joined tail-to-tail. FIG. 2
shows the use of the present invention to form Bi-specific mAbs.
mAb1 (black) is expressed with C-terminal C1 and mAb2 (magenta) is
expressed with C-terminal D1. Mixing equimolar mAb1 and mAb2 will
result in a bi-specific 1:1 complex. Note that, since each mAb
molecule contains two molar equivalents of C or D (the mAb is
itself a dimeric structure), the bi-specific mAb will be greatly
stabilized by two concurrent C-D interactions. Especially at lower
(mAb), this will be the most stable configuration.
Example 2
Combination of Antibody and Cohesion/Dockerin Domains and
Antigens
[0109] Example 2 shows that particular cohesin and dockerin domains
can be sucessfully and efficiently secreted from mammalian cells as
fusion proteins while maintaining the specific and high affinity
cohesin-dockerin protein-protein interaction. While the extensive
cohesin-dockerin literature teaches the expectation that such
fusion proteins should have this functionality, it does not
describe production of such fusion proteins in mammalian secretion
systems. The state of scientific knowledge does not allow the
prediction of the discovery since the rules (other than features
such as signal peptide) for successful secretion are not fully
established. Furthermore, the cohesin linker regions are known to
be glycosylated in their native bacteria, and the cohesin and
dockerin domains contain predicted glycosylation sites. While this
may actually favor secretion from mammalian cells, it is unclear if
`unnatural` glyosylation will perturb the cohesis-dockerin
interaction.
[0110] While cohesin-dockerin interaction for various commercial
applications has been published, the present invention is based on
a previously unrealized utility for this interaction built around
assembling specific protein complexes unrelated to the envisioned
controlled assembly enzyme applications.
[0111] The invention includes the use of all cohesin-dockerin
sequences from diverse cellulose degrading microbes, but describes
the application of specific cohesin and dockerin and linker
sequences from the microbe Clostridium thermocellum. For example,
the sequence described in Table 1 encodes the H chain of a human
IgG4 linked at the C-terminal codon to a Clostridium thermocellum
dockerin sequence (called rAb.doc). Other embodiments of rAb.doc
proteins are described similarly in Table 2 and these are
engineered by simply transferring the dockerin coding region as a
DNA fragment to vectors encoding the different H chain
entities.
[0112] TABLE 1 shows the nucleic acid and amino acid sequences for
rAB-pIRES2(hIgG4H-Dockerin) or C52. DNA (entire coding region) and
amino acid sequence (the predicted secreted product) of human
IgG4H.doc fusion protein is shown below. The dockerin domain (taken
from Clostridium thermocellum celD is highlighted in yellow and the
H chain and dockerin joining sequence is underlined. The highly
predicted N-linked glycosylation site within the dockerin domain is
highlighted in red.
TABLE-US-00001 TABLE 1 rAB-pIRES2 (hIgG4H-Dockerin) or C52. (SEQ ID
NO.: 2) ATGGACCTCCTGTGCAAGAACATGAAGCACCTGTGGTTCTTCCTCC
TGCTGGTGGCGGCTCCCAGATGGGTCCTGTCCCGGCTGCAGCTGCA
GGAGTCGGGCCCAGGCCTGCTGAAGCCTTCGGTGACCCTGTCCCTC
ACCTGCACTGTCTCGGGTGACTCCGTCGCCAGTAGTTCTTATTACT
GGGGCTGGGTCCGTCAGCCCCCAGGGAAGGGACTCGAGTGGATAGG
GACTATCAATTTTAGTGGCAATATGTATTATAGTCCGTCCCTCAGG
AGTCGAGTGACCATGTCGGCAGACATGTCCGAGAACTCCTTCTATC
TGAAATTGGACTCTGTGACCGCAGCAGACACGGCCGTCTATTATTG
TGCGGCAGGACACCTCGTTATGGGATTTGGGGCCCACTGGGGACAG
GGAAAACTGGTCTCCGTCTCTCCAGCTTCCACCAAGGGCCCATCCG
TCTTCCCCCTGGCGCCCTGCTCCAGGAGCACCTCCGAGAGCACAGC
CGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACG
GTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCC
CGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGT
GACCGTGCCCTCCAGCAGCTTGGGCACGAAGACCTACACCTGCAAC
GTAGATCACAAGCCCAGCAACACCAAGGTGGACAAGAGAGTTGAGT
CCAAATATGGTCCCCCATGCCCACCCTGCCCAGCACCTGAGTTCGA
AGGGGGACCATCAGTCTTCCTGTTCCCCCCAAAACCCAAGGACACT
CTCATGATCTCCCGGACCCCTGAGGTCACGTGCGTGGTGGTGGACG
TGAGCCAGGAAGACCCCGAGGTCCAGTTCAACTGGTACGTGGATGG
CGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTTC
AACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGG
ACTGGCTGAACGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGG
CCTCCCGTCCTCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAG
CCCCGAGAGCCACAGGTGTACACCCTGCCCCCATCCCAGGAGGAGA
TGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTA
CCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAG
AACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCT
TCTTCCTCTACAGCAGGCTAACCGTGGACAAGAGCAGGTGGCAGGA
GGGGAATGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAAC
CACTACACACAGAAGAGCCTCTCCCTGTCTCTGGGTAAAGCTAGCA
ATTCTCCTCAAAATGAAGTACTGTACGGAGATGTGAATGATGACGG
AAAAGTAAACTCCACTGACTTGACTTTGTTAAAAAGATATGTTCTT
AAAGCCGTCTCAACTCTCCCTTCTTCCAAAGCTGAAAAGAACGCAG
ATGTAAATCGTGACGGAAGAGTTAATTCCAGTGATGTCACAATACT
TTCAAGATATTTGATAAGGGTAATCGAGAAATTACCAATATAA (SEQ ID NO.: 3)
RLQLQESGPGLLKPSVTLSLTCTVSGDSVASSSYYWGWVRQPPGKG
LEWIGTINFSGNMYYSPSLRSRVTMSADMSENSFYLKLDSVTAADT
AVYYCAAGHLVMGFGAHWGQGKLVSVSPASTKGPSVFPLAPCSRST
SESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS
LSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP
APEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFN
WYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCK
VSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCL
VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDK
SRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKASNSPQNEVLYGD
VNDDGKVNSTDLTLLKRYVLKAVSTLPSSKAEKNADVNRDGRV DVTILSRYLIRVIEKLPI
[0113] TABLE 2 shows the nucleic acid and amino acid sequences for
rAB-pIRES2(mAnti-DCIR2C9H-LV-hIgG4H-C-Dockerin) or C82. DNA (entire
coding region) and amino acid sequence (the predicted secreted
product) is shown below. The dockerin domain is highlighted in
yellow and the H chain and dockerin joining sequence is underlined.
The IgG variable region is highlighted in blue. The highly
predicted N-linked glycosylation site within the dockerin domain is
highlighted in red.
TABLE-US-00002 TABLE 2 rAB-pIRES2
(mAnti-DCIR2C9H-LV-hIgG4H-C-Dockerin) or C82. (SEQ ID NO.: 4)
ATGAAATGCAGCTGGGTCATCTTCTTCCTGATGGCAGTGGTTACAGG
GGTCAATTCAGAGGTTCAGCTGCAGCAGTCTGGGGCTGAGCTTGTGA
GGCCAGGGGCCTTAGTCAAGTTGTCCTGCAAAGCTTCTGGCTTCAAC
ATTAATGACTACTATATCCACTGGGTGAAGCAGCGGCCTGAACAGGG
CCTGGAGCGGATTGGATGGATTGATCCTGACAATGGTAATACTATAT
ATGACCCGAAGTTCCAGGGCAAGGCCAGTATAACAGCAGACACATCC
CCCAACACAGCCTACCTGCAGCTCAGCAGCCTGACATCTGAGGACAC
TGCCGTCTATTACTGTGCTAGAACCCGATCTCCTATGGTTACGACGG
GGTTTGTTTACTGGGGCCAAGGGACTGTGGTCACTGTCTCTGCAGCC
AAAACGAAGGGCCCATCCGTCTTCCCCCTGGCGCCCTGCTCCAGGAG
CACCTCCGAGAGCACAGCCGCCCTGGGCTGCCTGGTCAAGGACTACT
TCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGC
GGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTC
CCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACGAAGA
CCTACACCTGCAACGTAGATCACAAGCCCAGCAACACCAAGGTGGAC
AAGAGAGTTGAGTCCAAATATGGTCCCCCATGCCCACCCTGCCCAGC
ACCTGAGTTCGAAGGGGGACCATCAGTCTTCCTGTTCCCCCCAAAAC
CCAAGGACACTCTCATGATGTCCCGGACCCCTGAGGTCACGTGCGTG
GTGGTGGACGTGAGCCAGGAAGACCCCGAGGTCCAGTTCAACTGGTA
CGTGGATGGCGTGGAGGTGCATAATGCCAAGACRAAGCCGCGGGAGG
AGCAGTTCAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTG
CACCAGGACTGGCTGAACGGCAAGGAGTACAAGTGCAAGGTCTCCAA
CAAAGGCCTCCCGTCCTCCATCGAGAAAACCATCTCCAAAGCCAAAG
GGCAGCCCCGAGAGCCACAGGTGTACACCCTGCCCCCATCCCAGGAG
GAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTT
CTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGG
AGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCC
TTCTTCCTCTACAGCAGGCTAACCGTGGACAAGAGCAGGTGGCAGGA
GGGGAATGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACC
ACTACACACAGAAGAGCCTCTCCCTGTCTCTGGGTAAAGCTAGCAAT
TCTCCTCAAAATGAAGTACTGTACGGAGATGTGAATGATGACGGAAA
AGTAAACTCCACTGACTTGACTTTGTTAAAAAGATATGTTCTTAAAG
CCGTCTCAACTCTCCCTTCTTCCAAAGCTGAAAAGAACGCAGATGTA
AATCGTGACGGAAGAGTTAATTCCAGTGATGTCACAATACTTTCAAG
ATATTTGATAAGGGTAATCGAGAAATTACCAATATAA (SEQ ID NO.: 5)
EVQLQQSGAELVRPGALVKLSCKASGFNINDYYIHWVKQRPEQGLER
IGWIDPDNGNTIYDPKFQGKASITADTSPNTAYLQLSSLTSEDTAVY
YCARTRSPMVTTGFVYWGQGTVVTVSAAKTKGPSVFPLAPCSRSTSE
STAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS
VVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEF
EGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDG
VEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL
PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPS
DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNV
FSCSVMHEALHNHYTQKSLSLSLGKASNSPQNEVLYGDVNDDGKVNS
TDLTLLKRYVLKAVSTLPSSKAEKNADVNRDGRV VTILSRYLIR VIEKLPI.
[0114] TABLE 3 shows the nucleic acid and amino acid sequences for
rAB-(mAnti-ASGPR.sub.--49C11.sub.--7H-SLAML-V-hIgG4H-C-Dockerin) or
C153. DNA (entire coding region) and amino acid sequence (the
predicted secreted product) is shown below. The dockerin domain is
highlighted in yellow and the H chain and dockerin joining sequence
is underlined. The IgG variable region is highlighted in blue. The
highly predicted N-linked glycosylation site within the dockerin
domain is highlighted in red.
TABLE-US-00003 TABLE 3 rAB-(mAnti-ASGPR_49C11_7H-SLAML-V-
hIgG4H-C-Dockerin) or C153. (SEQ ID NO.: 6)
ATGGACCCCAAAGGCTCCCTTTCCTGGAGAATACTTCTGTTTCTCTCC
CTGGCTTTTGAGTTGTCGTACGGAGATGTGCAGCTTCAGGAGTCAGGA
CCTGACCTGGTGAAACCTTCTCAGTCACTTTCACTCACCTGCACTGTC
ACTGGCTACTCCATCACCAGTGGTTATAGCTGGCACTGGATCCGGCAG
TTTCCAGGAAACAAACTGGAATGGATGGGCTACATACTCTTCAGTGGT
AGCACTAACTACAACCCATCTCTGAAAAGTCGAATCTCTATCACTCGA
GACACATCCAAGAACCAGTTCTTCCTGCAGTTGAATTCTGTGACTACT
GAGGACACAGCCACATATTTCTGTGCAAGATCTAACTATGGTTCCTTT
GCTTCCTGGGGCCAAGGGACTCTGGTCACTGTCTCTGCAGCCAAAACA
AAGGGCCCATCCGTCTTCCCCCTGGCGCCCTGCTCCAGGAGCACCTCC
GAGAGCACAGCCGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAA
CCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCAC
ACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGC
GTGGTGACCGTGCCCTCCAGCAGCTTGGGCACGAAGACCTACACCTGC
AACGTAGATCACAAGCCCAGCAACACCAAGGTGGACAAGAGAGTTGAG
TCCAAATATGGTCCCCCATGCCCACCCTGCCCAGCACCTGAGTTCGAA
GGGGGACCATCAGTCTTCCTGTTCCCCCCAAAACCCAAGGACACTCTC
ATGATCTCCCGGACCCCTGAGGTCACGTGCGTGGTGGTGGACGTGAGC
CAGGAAGACCCCGAGGTCCAGTTCAACTGGTACGTGGATGGCGTGGAG
GTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTTCAACAGCACG
TACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAAC
GGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGGCCTCCCGTCCTCC
ATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAGCCACAG
GTGTACACCCTGCCCCCATCCCAGGAGGAGATGACCAAGAACCAGGTC
AGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTG
GAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCT
CCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAGGCTAACC
GTGGACAAGAGCAGGTGGCAGGAGGGGAATGTCTTCTCATGCTCCGTG
ATGCATGAGGCTCTGCACAACCACTACACACAGAAGAGCCTCTCCCTG
TCTCTGGGTAAAGCTAGCAATTCTCCTCAAAATGAAGTACTGTACGGA
GATGTGAATGATGACGGAAAAGTAAACTCCACTGACTTGACTTTGTTA
AAAAGATATGTTCTTAAAGCCGTCTCAACTCTCCCTTCTTCCAAAGCT
GAAAAGAACGCAGATGTAAATCGTGACGGAAGAGTTAATTCCAGTGAT
GTCACAATACTTTCAAGATATTTGATAAGGGTAATCGAGAAATTACCA ATATAA (SEQ ID
NO.: 7) DVQLQESGPDLVKPSQSLSLTCTVTGYSITSGYSWHWIRQFPGNKLEW
MGYILFSGSTNYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYFC
ARSNYGSFASWGQGTLVTVSAAKTKGPSVFPLAPCSRSTSESTAALGC
LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS
LGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFEGGPSVFLF
PPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKP
REEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKA
KGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQP
ENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNH
YTQKSLSLSLGKASNSPQNEVLYGDVNDDGKVNSTDLTLLKRYVLKAV
STLPSSKAEKNADVNRDGRV VTILSRYLIRVIEKLPI
[0115] TABLE 4 shows the nucleic acid and amino acid sequences for
rAB-pIRES2(mAnti-DC-SIGNL16E7H-LV-hIgG4H-C-Dockerin) or C92. DNA
(entire coding region) and amino acid sequence (the predicted
secreted product) is shown below. The dockerin domain is
highlighted in yellow and the H chain and dockerin joining sequence
is underlined. The IgG variable region is highlighted in blue. The
highly predicted N-linked glycosylation site within the dockerin
domain is highlighted in red.
TABLE-US-00004 TABLE 4 rAB-pIRES2 (mAnti-DC-SIGNL16E7H-
LV-hIgG4H-C-Dockerin) or C92 (SEQ ID NO.: 8)
ATGGAAAGGCACTGGATCTTTCTCTTCCTGTTTTCAGTAACTGCAGG
TGTCCACTCCCAGGTCCAGCTTCAGCAGTCTGGGGCTGAGCTGGCAA
AACCTGGGGCCTCAGTGAAGATGTCCTGCAAGGCTTCTGGCTACACC
TTTACTACCTACTGGATGCACTGGGTAAAACAGAGGCCTGGACAGGG
TCTGGAATGGATTGGATACATTAATCCTATCACTGGTTATACTGAGT
ACAATCAGAAGTTCAAGGACAAGGCCACCTTGACTGCAGACAAATCC
TCCAGCACAGCCTACATGCAACTGAGCAGCCTGACATCTGAGGACTC
TGCAGTCTATTACTGTGCAAGAGAGGGTTTAAGTGCTATGGACTATT
GGGGTCAGGGAACCTCAGTCACCGTCACCTCAGCCAAAACAACGGGC
CCATCCGTCTTCCCCCTGGCGCCCTGCTCCAGGAGCACCTCCGAGAG
CACAGCCGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGG
TGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACC
TTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGT
GGTGACCGTGCCCTCCAGCAGCTTGGGCACGAAGACCTACACCTGCA
ACGTAGATCACAAGCCCAGCAACACCAAGGTGGACAAGAGAGTTGAG
TCCAAATATGGTCCCCCATGCCCACCCTGCCCAGCACCTGAGTTCGA
AGGGGGACCATCAGTCTTCCTGTTCCCCCCAAAACCCAAGGACACTC
TCATGATCTCCCGGACCCCTGAGGTCACGTGCGTGGTGGTGGACGTG
AGCCAGGAAGACCCCGAGGTCCAGTTCAACTGGTACGTGGATGGCGT
GGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTTCAACA
GCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGG
CTGAACGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGGCCTCCC
GTCCTCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAG
AGCCACAGGTGTACACCCTGCCCCCATCCCAGGAGGAGATGACCAAG
AACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGA
CATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACA
AGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTAC
AGCAGGCTAACCGTGGACAAGAGCAGGTGGCAGGAGGGGAATGTCTT
CTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACACAGA
AGAGCCTCTCCCTGTCTCTGGGTAAAGCTAGCAATTCTCCTCAAAAT
GAAGTACTGTACGGAGATGTGAATGATGACGGAAAAGTAAACTCCAC
TGACTTGACTTTGTTAAAAAGATATGTTCTTAAAGCCGTCTCAACTC
TCCCTTCTTCCAAAGCTGAAAAGAACGCAGATGTAAATCGTGACGGA
AGAGTTAATTCCAGTGATGTCACAATACTTTCAAGATATTTGATAAG
GGTAATCGAGAAATTACCAATATAA (SEQ ID NO.: 9)
QVQLQQSGAELAKPGASVKMSCKASGYTFTTYWMHWVKQRPGQGLEW
IGYINPITGYTEYNQKFKDKATLTADKSSSTAYMQLSSLTSEDSAVY
YCAREGLSAMDYWGQGTSVTVTSAKTTGPSVFPLAPCSRSTSESTAA
LGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTV
PSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFEGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVH
NAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSI
EKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAV
EWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCS
VMHEALHNHYTQKSLSLSLGKASNSPQNEVLYGDVNDDGKVNSTDLT
LLKRYVLKAVSTLPSSKAEKNADVNRDGRV DVTILSRYLIRVIE KLPI
[0116] Mammalian expression plasmids encoding such rAb.doc IgG H
chain proteins are created using standard molecular biology
techniques and can be based on commercially available expression
plasmid vectors such as pIRES2-DsRed2 (BD Biosciences). To produce
secreted rAb.doc, mammalian cells are co-transfected with this
expression plasmid and an expression plasmid encoding a
complimentary IgG L chain (exemplified in Table 3). Standard
protocols (such as the FreeStyle.TM. 293 Expression System,
Invitrogen) are used as for mammalian cells, transfection reagents,
and culture media. Transfected cells are cultured for 3-7 days and
the culture supernatant is harvested by centrifugation, clarified
by filtration, and the rAB.doc protein purified by Protein G
affinity chromatography using protocols from the column
manufacturer (GE Pharmacia).
[0117] FIG. 3 shows analysis of typical secreted rAb.doc products
by reducing SDS.PAGE with staining by Coomassie Brilliant Blue.
This analysis shows that the rAb.doc is efficiently produced as a
secreted H+L chain dimer. Heterogeneity in the H chain likely
reflects N-linked glycosylation at a highly predicted (Potential
0.6426, NetNGlyc 1.0 Server--Technical University of Denmark) site
within the dockerin sequence.
[0118] TABLE 5 shows the nucleic acid and amino acid sequences for
rAB-pIRES2(mAnti-DC-SIGNL16E7K-LV-hIgGK-C) or C73. DNA (entire
coding region) and amino acid sequence (the predicted secreted
product) of IgG Kappa protein fusing the V region from the
mAnti-DC-SIGNL16E7 hybridoma (highlighted in blue)to a human C
region (highlighted in yellow).
TABLE-US-00005 TABLE 5 rAB-pIRES2(mAnti-DC-SIGNL16E7K-LV-hIgGK-C)
or C73. (SEQ ID NO.: 10)
ATGCATCGCACCAGCATGGGCATCAAGATGGAGTCACAGATTCAGGCATTTGTATTCGTGTTTCTCTGGTTGTC-
TGGTGTTGGCG
GAGACATTGTGATGACCCAGTCTCACAAATTCATGTCCACATCAGTAGGAGACAGGGTCAGCGTCACCTGCAAG-
GCCAGTCAGGA
TGTGACTTCTGCTGTAGCCTGGTATCAACAAAAACCAGGGCAATCTCCTAAACTACTGATTTACTGGGCATCCA-
CCCGGCACACT
GGAGTCCCTGATCGCTTCACAGGCAGTGGATCTGGGACAGATTATACTCTCACCATCAGCAGTGGGCAGGCTGA-
AGACCTGGCAC
TTTATTACTGTCACCAATATTATAGCGCTCCTCGGACGTTCGGTGGAGGCACCAAGCTCGAGATCAAACGAACT-
GTGGCTGCACC
ATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATA-
ACTTCTATCCC
AGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCA-
GGACAGCAAGG
ACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTATGCCTGC-
GAAGTCACCCA TCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTAG
(SEQ ID NO.: 11)
DIVMTQSHKFMSTSVGDRVSVTCKASQDVTSAVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDYTLT-
ISSGQAEDLAL
YYCHQYYSAPRTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNS-
QESVTEQDSKD STYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC.
[0119] FIG. 3 shows Protein G affinity purified secreted rAb
proteins analyzed by reducing SDS.PAGE and Coomassie Brilliant Blue
staining. Lanes are from left to right.
[0120] The invention enbodies the unanticipated presence and use of
this glycosylation site that likely confers onto mammalian
cell-secreted dockerin fusion proteins desirable solubility and
pharmacokinetic properties well known to be associated with
glycosylation. FIG. 2 shows that rAb.antigen fusion proteins
employing identical IgG H and L sequences can differ dramatically
in efficiency of secretion. In both sited examples, rAb.doc
entities are well expressed compared to rAb fused to Influenza HAS
sequences which typically express very poorly. The invention also
embodies the unanticipated capacity of the dockerin domain to not
significantly hinder the secretion of the associated rAb entity.
Furthermore, the invention embodies the property of the dockerin
domain to not hinder the functionality of the rAb specific antigen
combining regions. This property is exemplified in FIG. 5 which
shows concordance between IgFc reactivity and LOX-1 reactivity
between anti-LOX1.sub.--15C4 rAb proteins and
anti-LOX1.sub.--15C4.doc.
[0121] FIGS. 4A and 4B show the measurement by anti-human IgFc
ELISA of levels of secretion of various rAb.fusion proteins. 2.5 ug
each of the H and L chain expression plasmids were transfected into
293F cells and two-fold dilutions of supernatant samples were
tested after three days of culture. Y axis values are arbitrary HRP
activity.
[0122] FIG. 5 shows the measurement by anti-human IgFc ELISA (HRP
activity) and LOX-1.alkaline phoshatase binding (AP activity) of
secreted anti-LOX1.sub.--15C4 rAb.(blue symbols)and
anti-LOX1.sub.--15C4.doc rAb (red symbols) proteins. Different
ratios totalling 5 ug of the H and L chain expression plasmids were
transfected into 293F cells and supernatant samples were tested
after three days of culture.
[0123] The invention embodies the property of the dockerin domain
to be efficiently and functionally expressed in the context of
fusion proteins other than hIgG4 and its close derivatives. For
example, Table 6 shows the sequence of a rAb.doc entity based on a
mouse IgG2b H chain fusion protein.
[0124] TABLE 6 shows the nucleic acid and amino acid sequences for
rAB-pCMV(mIgG2bH-Dockerin) or C19. DNA (entire coding region) and
amino acid sequence (the predicted secreted product) is shown. The
dockerin domain is highlighted in yellow and the H chain and
dockerin joining sequence is underlined. The highly predicted
N-linked glycosylation site within the dockerin domain is
highlighted in red.
TABLE-US-00006 TABLE 6 rAB-pCMV (mIgG2bH-Dockerin) or C19. (SEQ ID
NO.: 12) ATGGGATGGTCATGTATCATCCTTTTTCTAGTAGCAACTGCAACTGGAG
TACATTCACAGGTCCAACTGCAGCAGCCTGGGGCTGAGCTGGTGAGGCC
TGGGACTTCAGTGAAGTTGTCCTGCAAGGCTTCTGGTTACATCTTTACC
AGCTACTGGATGCACTGGGTAAAGCAGAGGCCTGGACAAGGCCTTGAGT
GGATCGGACTGATTGATCCTTCTGATAGTTATAGTAAGTACAATCAAAA
GTTCAAGGGCAAGGCCACATTGACTGTAGACACATCCTCCAGCACAGCC
TACATGCAGCTCAGCAGCCTGACATCTGAGGACTCTGCGGTCTATTACT
GTGCAAGAGGGGAGCTCAGTGACTTCTGGGGCCAAGGCACCACTCTCAC
AGTCTCCTCAGCCAAAACAACACCCCCATCAGTCTATCCACTGGCCCCT
GGGTGTGGAGATACAACTGGTTCCTCTGTGACTCTGGGATGCCTGGTCA
AGGGCTACTTCCCTGAGTCAGTGACTGTGACTTGGAACTCTGGATCCCT
GTCCAGCAGTGTGCACACCTTCCCAGCTCTCCTGCAGTCTGGACTCTAC
ACTATGAGCAGCTCAGTGACTGTCCCCTCCAGCACCTGGCCAAGTCAGA
CCGTCACCTGCAGCGTTGCTCACCCAGCCAGCAGCACCACGGTGGACAA
AAAACTTGAGCCCAGCGGGCCCATTTCAACAATCAACCCCTGTCCTCCA
TGCAAGGAGTGTCACAAATGCCCAGCTCCTAACCTCGAGGGTGGACCAT
CCGTCTTCATCTTCCCTCCAAATATCAAGGATGTACTCATGATCTCCCT
GACACCCAAGGTCACGTGTGTGGTGGTGGATGTGAGCGAGGATGACCCA
GACGTCCGGATCAGCTGGTTTGTGAACAACGTGGAAGTACACACAGCTC
AGACACAAACCCATAGAGAGGATTACAACAGTACTATCCGGGTGGTCAG
TGCCCTCCCCATCCAGCACCAGGACTGGATGAGTGGCAAGGAGTTCAAA
TGCAAGGTCAACAACAAAGACCTCCCATCACCCATCGAGAGAACCATCT
CAAAAATTAAAGGGCTAGTCAGAGCTCCACAAGTATACATCTTGCCGCC
ACCAGCAGAGCAGTTGTCCAGGAAAGATGTCAGTCTCACTTGCCTGGTC
GTGGGCTTCAACCCTGGAGACATCAGTGTGGAGTGGACCAGCAATGGGC
ATACAGAGGAGAACTACAAGGACACCGCACCAGTCCTGGACTCTGACGG
TTCTTACTTCATATACAGCAAGCTCGATATAAAAACAAGCAAGTGGGAG
AAAACAGATTCCTTCTCATGCAACGTGAGACACGAGGGTCTGAAAAATT
ACTACCTGAAGAAGACCATCTCCCGGTCTCCGGGTAAAGCTAGCAATTC
TCCTCAAAATGAAGTACTGTACGGAGATGTGAATGATGACGGAAAAGTA
AACTCCACTGACTTGACTTTGTTAAAAAGATATGTTCTTAAAGCCGTCT
CAACTCTGCCTTCTTCCAAAGCTGAAAAGAACGCAGATGTAAATCGTGA
CGGAAGAGTTAATTCCAGTGATGTCACAATACTTTCAAGATATTTGATA
AGGGTAATCGAGAAATTACCAATATAA (SEQ ID NO.: 13)
QVQLQQPGAELVRPGTSVKLSCKASGYIFTSYWMHWVKQRPGQGLEWIG
LIDPSDSYSKYNQKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYYCAR
GELSDFWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGY
FPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVT
CSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPNLEGGPSVF
IFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVRISWFVNNVEVHTAQTQ
THREDYNSTIRVVSALPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKI
KGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTE
ENYKDTAPVLDSDGSYFIYSKLDIKTSKWEKTDSFSCNVRHEGLKNYYL
KKTISRSPGKASNSPQNEVLYGDVNDDGKVNSTDLTLLKRYVLKAVSTL PSSKAEKNADVNRDGRV
DVTILSRYLIRVIEKLPI.
[0125] FIG. 6 shows that when co-transfected with a mIgG kappa
expression plasmid, rAB-pCMV(mIgG2bH-Dockerin) plasmid directs the
efficient secretion of rAB-mIgG2b.Dockerin fusion protein. In FIG.
6, a Protein G affinity purified rAb proteins secreted from
transfected 293 F cells analyzed by reducing SDS.PAGE and Coomassie
Brilliant Blue staining. Lanes 11 and 12 show mIgG2b.doc
products.
[0126] The use of the rAb.doc invention detailed above is the
assembly of rAb-antigen or toxin or activator or enzyme complexes
via the specificity and tenacity of the dockerin-cohesin
interaction. Table 5 shows one embodiment of the invention in the
form of a cohesin.alkaline phosphatase fusion protein (coh.AP).
Also described are additional embodiments such as an alkaline
phosphatase fusion protein containing two cohesion domains
(coh.coh.AP) and other proteins are examples of the generality of
the invention such as the single cohesin domain fused to other
sequences such as the mature sequence of human prostate specific
antigen (coh.hPSA) and to the HA 1 domain of influenza A HAS
(coh.Flu HA5-1).
[0127] TABLE 7 shows the nucleic acid and amino acid sequences for
Mam-pCDM8(Cohesin-SLAML-AP-6.times. His) or C16. DNA (entire coding
region) and amino acid sequence (the predicted secreted product) is
shown below. The cohesin domain is highlighted in yellow and the
cohesin and alkaline phosphatase joining sequence is underlined.
The highly predicted (G-score>0.5, NetOGlyc 3.1
Server--Technical University of Denmark) O-linked glycosylation
sites within the cohesin domain and the linker distal to the
cohesin domain are highlighted in red. Residues highlighted grey
are a C-terminal His tag to facilitate purification via metal
affinity chromatography.
TABLE-US-00007 TABLE 7 Mam-pCDM8 (Cohesin-SLAML-AP-6xHis) or C16.
(SEQ ID NO.: 14) ATGGATCCCAAAGGATCCCTTTCCTGGAGAATACTTCTGTTT
CTCTCCCTGGCTTTTGAGTTGAGCTACGGACTCGACGATCTG
GATGCAGTAAGGATTAAAGTGGACACAGTAAATGCAAAACCG
GGAGACACAGTAAGAATACCTGTAAGATTCAGCGGTATACCA
TCCAAGGGAATAGCAAACTGTGACTTTGTATACAGCTATGAC
CCGAATGTACTTGAGATAATAGAGATAGAACCGGGAGACATA
ATAGTTGACCCGAATCCTGACAAGAGCTTTGATACTGCAGTA
TATCCTGACAGAAAGATAATAGTATTCCTGTTTGCAGAAGAC
AGCGGAACAGGAGCGTATGCAATAACTAAAGACGGAGTATTT
GCTACGATAGTAGCGAAAGTAAAAGAAGGAGCACCTAACGGA
CTCAGTGTAATCAAATTTGTAGAAGTAGGCGGATTTGCGAAC
AATGACCTTGTAGAACAGAAGACACAGTTCTTTGACGGTGGA
GTAAATGTTGGAGATACAACAGAACCTGCAACACCTACAACA
CCTGTAACAACACCGACAACAACAGATGATCTGGATGCACTC
GAGATCATCCCAGTTGAGGAGGAGAACCCGGACTTCTGGAAC
CGCGAGGCAGCCGAGGCCCTGGGTGCCGCCAAGAAGCTGCAG
CCTGCACAGACAGCCGCCAAGAACCTCATCATCTTCCTGGGC
GATGGGATGGGGGTGTCTACGGTGACAGCTGCCAGGATCCTA
AAAGGGCAGAAGAAGGACAAACTGGGGCCTGAGTTACCCCTG
GCCATGGACCGCTTCCCATATGTGGCTCTGTCCAAGACATAC
AATGTAGACAAACATGTGCCAGACAGTGGAGCCACAGCCACG
GCCTACCTGTGCGGGGTCAAGGGCAACTTCCAGACCATTGGC
TTGAGTGCAGCCGCCCGCTTTAACCAGTGCAACACGACACGC
GGCAACGAGGTCATCTCCGTGATGAATCGGGCCAAGAAAGCA
GGGAAGTCAGTGGGAGTGGTAACCACCACACGAGTGCAGCAC
GCCTCGCCAGCCGGCACCTACGCCCACACGGTGAACCGCAAC
TGGTACTCGGACGCCGACGTGCCTGCCTCGGCCCGCCAGGAG
GGGTGCCAGGACATCGCTACGCAGCTCATCTCCAACATGGAC
ATTGACGTGATCCTAGGTGGAGGCCGAAAGTACATGTTTCGC
ATGGGAACCCCAGACCCTGAGTACCCAGATGACTACAGCCAA
GGTGGGACCAGGCTGGACGGGAAGAATCTGGTGCAGGAATGG
CTGGCGAAGCGCCAGGGTGCCCGGTACGTGTGGAACCGCACT
GAGCTCATGCAGGCTTCCCTGGACCCGTCTGTGACCCATCTC
ATGGGTCTCTTTGAGCCTGGAGACATGAAATACGAGATCCAC
CGAGACTCCACACTGGACCCCTCCCTGATGGAGATGACAGAG
GCTGCCCTGCGCCTGCTGAGCAGGAACCCCCGCGGCTTCTTC
CTCTTCGTGGAGGGTGGTCGCATCGACCATGGTCATCATGAA
AGCAGGGCTTACCGGGCACTGACTGAGACGATCATGTTCGAC
GACGCCATTGAGAGGGCGGGCCAGCTCACCAGCGAGGAGGAC
ACGCTGAGCCTCGTCACTGCCGACCACTCCCACGTCTTCTCC
TTCGGAGGCTACCCCCTGCGAGGGAGCTCCATCTTCGGGCTG
GCCCCTGGCAAGGCCCGGGACAGGAAGGCCTACACGGTCCTC
CTATACGGAAACGGTCCAGGCTATGTGCTCAAGGACGGCGCC
CGGCCGGATGTTACCGAGAGCGAGAGCGGGAGCCCCGAGTAT
CGGCAGCAGTCAGCAGTGCCCCTGGACGAAGAGACCCACGCA
GGCGAGGACGTGGCGGTGTTCGCGCGCGGCCCGCAGGCGCAC
CTGGTTCACGGCGTGCAGGAGCAGACCTTCATAGCGCACGTC
ATGGCCTTCGCCGCCTGCCTGGAGCCCTACACCGCCTGCGAC
CTGGCGCCCCCCGCCGGCACCACCCACCATCACCATCACCAT TGA (SEQ ID NO.: 15)
LDDLDAVRIKVDTVNAKPGDTVRIPVRFSGIPSKGIANCDFV YSYDPNVLEIIEIEPGELIVDPN
KSFDTAVYPDRKMIVF LFAEDSGTGAYAITEDGVFATIVAKVKSGAPNGLSVIKFVEV
GGFANNDLVEQKTQFFDGGVNVGD EPA P P V P
DDLDALEIIPVEEENPDFWNREAAEALGAAKK
LQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPEL
PLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQT
IGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRV
QRASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISN
MDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQ
EWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYE
IHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGH
HESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHV
FSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKD
GARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQ
AHLVHGVQEQTFIAHVMAFAACLEPYTACDLAPPAGT T
[0128] TABLE 8 shows the nucleic acid and amino acid sequences for
Mam-pCDM8(Cohesin-Cohesin-SLAML-AP-6.times. His) or C17. DNA
(entire coding region) and amino acid sequence (the predicted
secreted product) is shown below. The cohesin domain is highlighted
in yellow and the cohesin and alkaline phosphatase joining sequence
is underlined. The highly predicted O-linked glycosylation sites
within the linker distal to the cohesin domains are highlighted in
red as is a single highy predicted N-linked glycosylation site
(NPT). Residues highlighted grey are a C-terminal His tag to
facilitate purificaytion via metal affinity chromatography.
TABLE-US-00008 TABLE 8 Mam-pCDM8 (Cohesin-Cohesin-SLAML-AP-6xHis)
or C17. (SEQ ID NO.: 16) ATGGATCCCAAAGGATCCCTTTCCTGGAGAATACTTCTGTTT
CTCTCCCTGGCTTTTGAGTTGAGCTACGGACTCGACGATCTG
GATGCAGTAAGGATTAAAGTGGACACAGTAAATGCAAAACCG
GGAGACACAGTAAGAATACCTGTAAGATTCAGCGGTATACCA
TCCAAGGGAATAGCAAACTGTGACTTTGTATACAGCTATGAC
CCGAATGTACTTGAGATAATAGAGATAAAACCGGGAGAATTG
ATAGTTGACCCGAATCCTGACAAGAGCTTTGATACTGCAGTA
TATCCTGACAGAAAGATAATAGTATTCCTGTTTGCAGAAGAC
AGCGGAACAGGAGCGTATGCAATAACTAAAGACGGAGTATTT
GCTACGATAGTAGCGAAAGTAAAATCCGGAGCACCTAACGGA
CTCAGTGTAATCAAATTTGTAGAAGTAGGCGGATTTGCGAAT
AATGACCTTGTAGAACAGAAGACACAGTTCTTTGACGGTGGA
GTAAATGTTGGAGATACAACAGAACCTGCAACACCTACAACA
CCTGTAACAACACCGACAACAACAGATGATCTGGATGCAGTA
AGGATTAAAGTGGACACAGTAAATGCAAAACCGGGAGACACA
GTAAATATACCTGTAAGATTCAGTGGTATACCATCCAAGGGA
ATAGCAAACTGTGACTTTGTATACAGCTATGACCCGAATGTA
CTTGAGATAATAGAGATAAAACCGGGAGAATTGATAGTTGAC
CCGAATCCTACCAAGAGCTTTGATACTGCAGTATATCCTGAC
AGAAAGATGATAGTATTCCTGTTTGCGGAAGACAGCGGAACA
GGAGCGTATGCAATAACTAAAGACGGAGTATTTGCTACGATA
GTAGCGAAAGTAAAAGAAGGAGCACCTAACGGACTCAGTGTA
ATCAAATTTGTAGAAGTAGGCGGATTTGCGAACAATGACCTT
GTAGAACAGAAGACACAGTTCTTTGACGGTGGAGTAAATGTT
GGAGATACAACAGAACCTGCAACACCTACAACACCTGTAACA
ACACCGACAACAACAGATGATCTGGATGCACTCGAGATCATC
CCAGTTGAGGAGGAGAACCCGGACTTCTGGAACCGCGAGGCA
GCCGAGGCCCTGGGTGCCGCCAAGAAGCTGCAGCCTGCACAG
ACAGCCGCCAAGAACCTCATCATCTTCCTGGGCGATGGGATG
GGGGTGTCTACGGTGACAGCTGCCAGGATCCTAAAAGGGCAG
AAGAAGGACAAACTGGGGCCTGAGTTACCCCTGGCCATGGAC
CGCTTCCCATATGTGGCTCTGTCCAAGACATACAATGTAGAC
AAACATGTGCCAGACAGTGGAGCCACAGCCACGGCCTACCTG
TGCGGGGTCAAGGGCAACTTCCAGACCATTGGCTTGAGTGCA
GCCGCCCGCTTTAACCAGTGCAACACGACACGCGGCAACGAG
GTCATCTCCGTGATGAATCGGGCCAAGAAAGCAGGGAAGTCA
GTGGGAGTGGTAACCACCACACGAGTGCAGCACGCCTCGCCA
GCCGGCACCTACGCCCACACGGTGAACCGCAACTGGTACTCG
GACGCCGACGTGCCTGCCTCGGCCCGCCAGGAGGGGTGCCAG
GACATCGCTACGCAGCTCATCTCCAACATGGACATTGACGTG
ATCCTAGGTGGAGGCCGAAAGTACATGTTTCGCATGGGAACC
CCAGACCCTGAGTACCCAGATGACTACAGCCAAGGTGGGACC
AGGCTGGACGGGAAGAATCTGGTGCAGGAATGGCTGGCGAAG
CGCCAGGGTGCCCGGTACGTGTGGAACCGCACTGAGCTCATG
CAGGCTTCCCTGGACCCGTCTGTGACCCATCTCATGGGTCTC
TTTGAGCCTGGAGACATGAAATACGAGATCCACCGAGACTCC
ACACTGGACCCCTCCCTGATGGAGATGACAGAGGCTGCCCTG
CGCCTGCTGAGCAGGAACCCCCGCGGCTTCTTCCTCTTCGTG
GAGGGTGGTCGCATCGACCATGGTCATCATGAAAGCAGGGCT
TACCGGGCACTGACTGAGACGATCATGTTCGACGACGCCATT
GAGAGGGCGGGCCAGCTCACCAGCGAGGAGGACACGCTGAGC
CTCGTCACTGCCGACCACTCCCACGTCTTCTCCTTCGGAGGC
TACCCCCTGCGAGGGAGCTCCATCTTCGGGCTGGCCCCTGGC
AAGGCCCGGGACAGGAAGGCCTACACGGTCCTCCTATACGGA
AACGGTCCAGGCTATGTGCTCAAGGACGGCGCCCGGCCGGAT
GTTACCGAGAGCGAGAGCGGGAGCCCCGAGTATCGGCAGCAG
TCAGCAGTGCCCCTGGACGAAGAGACCCACGCAGGCGAGGAC
GTGGCGGTGTTCGCGCGCGGCCCGCAGGCGCACCTGGTTCAC
GGCGTGCAGGAGCAGACCTTCATAGCGCACGTCATGGCCTTC
GCCGCCTGCCTGGAGCCCTACACCGCCTGCGACCTGGCGCCC
CCCGCCGGCACCACCCACCATCACCATCACCATTGA (SEQ ID NO.: 17)
LDLDAVRIKVDTVNAKPGDTVRIPVRFSGIPSKGIANCDFVY
SYDPNVLEIIEIKPGELIVDPNPDKSFDTAVYPDRKIIVFLF
AEDSGTGAYAITKDGVFATIVAKVKSGAPNGLSVIKFVEVGG FANNDLVEQKTQFFDGGVNVGD
EPA P PV P DDLDAVRIKVDTVNAKPGDTVNIPVRFSGIPSK
GIANCDFVYSYDPNVLEIIEIKPGELIVDP KSFDTAVYP
DRKMIVFLFAEDSGTGAYAITKDGVFATIVAKVKEGAPNGLS
VIKFVEVGGFANNDLVEQKTQFFDGGVNVGD EPA P PV P
DDLDALEIIPVEEENPDFWNREAAEALGAAKKLQPA
QTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPELPLAM
DRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLS
AAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHAS
PAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDID
VILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLA
KRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRD
STLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESR
AYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFG
GYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARP
DVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLV
HGVQEQTFIAHVMAFAACLEPYTACDLAPPAGTT
[0129] TABLE 9 shows the nucleic acid and amino acid sequences for
Mam-pCDM8(SLAML-Cohesin-hPSA) or C149. DNA (entire coding region)
and amino acid sequence (the predicted secreted product) is shown
below. The cohesin domain is highlighted in yellow and the cohesin
and hPSA joining sequence is underlined. The highly predicted
O-linked glycosylation sites within the linker distal to the
cohesin domains and a single highly predicted N-linked
glycosylation site within the cohesin domain are highlighted in
red.
TABLE-US-00009 TABLE 9 Mam-pCDM8 (SLAML-Cohesin-hPSA) or C149. (SEQ
ID NO.: 18) ATGGATCCCAAAGGATCCCTTTCCTGGAGAATACTTCTGTTTCT
CTCCCTGGCTTTTGAGTTGAGCTACGGACTCGACGATCTGGATG
CAGTAAGGATTAAAGTGGACACAGTAAATGCAAAACCGGGAGAC
ACAGTAAGAATACCTGTAAGATTCAGCGGTATACCATCCAGGGA
ATAGCAAACTGTGACTTTGTATACAGCTATGACCCGAATGTACT
TGAGATAATAGAGATAGAACCGGGAGACATAATAGTTGACCCGA
ATCCTGACAAGAGCTTTGATACTGCAGTATATCCTGACAGAAAG
ATAATAGTATTCCTGTTTGCAGAAGACAGCGGAACAGGAGCGTA
TGCAATAACTAAAGACGGAGTATTTGCTACGATAGTAGCGAAAG
TAAAAGAAGGAGCACCTAACGGACTCAGTGTAATCAAATTTGTA
GAAGTAGGCGGATTTGCGAACAATGACCTTGTAGAACAGAAGAC
ACAGTTCTTTGACGGTGGAGTAAATGTTGGAGATACAACAGAAC
CTGCAACACCTACAACACCTGTAACAACACCGACAACAACAGAT
GATCTGGATGCACTCGAGGCGCCCCTCATCCTGTCTCGGATTGT
GGGAGGCTGGGAGTGCGAGAAGCATTCCCAACCCTGGCAGGTGC
TTGTGGCCTCTCGTGGCAGGGCAGTCTGCGGCGGTGTTCTGGTG
CACCCCCAGTGGGTCCTCACAGCTGCCCACTGCATCAGGAACAA
AAGCGTGATCTTGCTGGGTCGGCACAGCCTGTTTCATCCTGAAG
ACACAGGCCAGGTATTTCAGGTCAGCCACAGCTTCCCACACCCG
CTCTACGATATGAGCCTCCTGAAGAATCGATTCCTCAGGCCAGG
TGATGACTCCAGCCACGACCTCATGCTGCTCCGCCTGTCAGAGC
CTGCCGAGCTCACGGATGCTGTGAAGGTCATGGACCTGCCCACC
CAGGAGCCAGCACTGGGGACCACCTGCTACGCCTCAGGCTGGGG
CAGCATTGAACCAGAGGAGTTCTTGACCCCAAAGAAACTTCAGT
GTGTGGACCTCCATGTTATTTCCAATGACGTGTGCGCGCAAGTT
CACCCTCAGAAGGTGACCAAGTTCATGCTGTGTGCTGGACGCTG
GACAGGGGGCAAAAGCACCTGCTCGGGTGATTCTGGGGGCCCAC
TTGTCTGTAATGGTGTGCTTCAAGGTATCACGTCATGGGGCAGT
GAACCATGTGCCCTGCCCGAAAGGCCTTCCCTGTACACCAAGGT
GGTGCATTACCGGAAGTGGATCAAGGACACCATCGTGGCCAACC CCTGA (SEQ ID NO.: 19)
LDDLDAVRIKVDTVNAKPGDTVRIPVRFSGIPSKGIANCDFVYS YDPNVLEIIEIEPGELIVDPNP
KSFDTAVYPDRKMIVFLFA EDSGTGAYAITEDGVFATIVAKVKSGAPNGLSVIKFVEVGGFAN
NDLVEQKTQFFDGGVNVGD EPA P PV P
DDLDALEAPLILSRIVGGWECEKHSQPWQVLVASRGRA
VCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQV
SHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAV
KVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVIS
NDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQ
GITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
[0130] TABLE 10 shows the nucleic acid and amino acid sequences for
Mam-pCDM8(SLAML-Cohesin-FluHA5-1-6.times. His) or C24. DNA (entire
coding region) and amino acid sequence (the predicted secreted
product) is shown below. The cohesin domain is highlighted in
yellow and the cohesin and Flu HA5-1 joining sequence is
underlined. The highly predicted O-linked glycosylation sites
within the linker distal to the cohesin domains and a single highly
predicted N-linked glycosylation site within the cohesin domain are
highlighted in red. Residues highlighted grey are a C-terminal His
tag to facilitate purification via metal affinity
chromatography.
TABLE-US-00010 TABLE 10 Mam-pCDM8 (SLAML-Cohesin-FluHA5-1-6x-His)
or C24. (SEQ ID NO.: 20) ATGGATCCCAAAGGATCCCTTTCCTGGAGAATACTTCTG
TTTCTCTCCCTGGCTTTTGAGTTGAGCTACGGACTCGAC
GATCTGGATGCAGTAAGGATTAAAGTGGACACAGTAAAT
GCAAAACCGGGAGACACAGTAAGAATACCTGTAAGATTC
AGCGGTATACCATCCAAGGGAATAGCAAACTGTGACTTT
GTATACAGCTATGACCCGAATGTACTTGAGATAATAGAG
ATAGAACCGGGAGACATAATAGTTGACCCGAATCCTGAC
AAGAGCTTTGATACTGCAGTATATCCTGACAGAAAGATA
ATAGTATTCCTGTTTGCAGAAGACAGCGGAACAGGAGCG
TATGCAATAACTAAAGACGGAGTATTTGCTACGATAGTA
GCGAAAGTAAAAGAAGGAGCACCTAACGGACTCAGTGTA
ATCAAATTTGTAGAAGTAGGCGGATTTGCGAACAATGAC
CTTGTAGAACAGAAGACACAGTTCTTTGACGGTGGAGTA
AATGTTGGAGATACAACAGAACCTGCAACACCTACAACA
CCTGTAACAACACCGACAACAACAGATGATCTGGATGCA
CTCGAGGATCAGATTTGCATTGGTTACCATGCAAACAAC
TCGACAGAGCAGGTTGACACAATAATGGAAAAGAACGTT
ACTGTTACACATGCCCAAGACATACTGGAAAAGAAACAC
AACGGGAAGCTCTGCGATCTAGATGGAGTGAAGCCTCTA
ATTTTGAGAGATTGTAGCGTAGCTGGATGGCTCCTCGGA
AACCCAATGTGTGACGAATTCATCAATGTGCCGGAATGG
TCTTACATAGTGGAGAAGGCCAATCCAGTCAATGACCTC
TGTTACCCAGGGGATTTCAATGACTATGAAAAATTGAAA
CACCTATTGAGCAGAATAAACCATTTTGAGAAAATTCAG
ATCATCCCCAAAAGTTCTTGGTCCAGTCATGAAGCCTCA
TTAGGGGTGAGCTCAGCATGTCCATACCAGGGAAAGTCC
TCCTTTTTCAGAAATGTGGTATGGCTTATCAAAAAGAAC
AGTACATACCCAACAATAAAGAGGAGCTACAATAATACC
AACCAAGAAGATCTTTTGGTACTGTGGGGGATTCACCAT
CCTAATGATGCGGCAGAGCAGACAAAGCTCTATCAAAAC
CCAACCACCTATATTTCCGTTGGGACATCAACACTAAAC
CAGAGATTGGTACCAAGAATAGCTACTAGATCCAAAGTA
AACGGGCAAAGTGGAAGGATGGAGTTCTTCTGGACAATT
TTAAAGCCGAATGATGCAATCAACTTCGAGAGTAATGGA
AATTTCATTGCTCCAGAATATGCATACAAAATTGTCAAG
AAAGGGGACTCAACAATTATGAAAAGTGAATTGGAATAT
GGTAACTGCAACACCAAGTGTCAAACTCCAATGGGGGCG
ATAAACTCTAGCATGCCATTCCACAATATACACCCTCTC
ACCATTGGGGAATGCCCCAAATATGTGAAATCAAACAGA
TTAGTCCTTGCGCACCATCACCATCACCATTGA (SEQ ID NO.: 21)
LDDLDAVRIKVDTVNAKPGDTVRIPVRFSGIPSKGIANC DFVYSYDPNVLEIIEIEPGELIVDPNP
KSFDTAVYP DRKMIVFLFAEDSGTGAYAITEDGVFATIVAKVKSGAPN
GLSVIKFVEVGGFANNDLVEQKTQFFDGGVNVGD E PA P PV P DDLDALEDQICIGYHANN
STEQVDTIMEKNVTVTHAQDILEKKHNGKLCDLDGVKPL
ILRDCSVAGWLLGNPMCDEFINVPEWSYIVEKANPVNDL
CYPGDFNDYEKLKHLLSRINHFEKIQIIPKSSWSSHEAS
LGVSSACPYQGKSSFFRNVVWLIKKNSTYPTIKRSYNNT
NQEDLLVLWGIHHPNDAAEQTKLYQNPTTYISVGTSTLN
QRLVPRIATRSKVNGQSGRMEFFWTILKPNDAINFESNG
NFIAPEYAYKIVKKGDSTIMKSELEYGNCNTKCQTPMGA
INSSMPFHNIHPLTIGECPKYVKSNRLVLA .
[0131] Similar to the above mentioned rAb.doc constructs, the
invention embodies the efficient secretion from mammalian cells of
functional cohesin fusion proteins (called herein coh.fusions). It
was not obvious that cohesin domains could be so successfully
secreted while retaining dockerin-binding function. FIG. 5
demonstrates that supernatant containing secreted coh.alkaline
phosphatase (coh.AP) binds specifically to a rAb.doc protein
immobilized on a plastic surface.
[0132] FIGS. 7A and 7B show that the Expression plasmids encoding
secreted alkaline phosphatase (AP) or coh.AP directed secretion of
functional proteins from transfected 293F cells. After 3 days of
culture supernatants were harvested and tested for their ability to
bind 0.25 ug of either rAb.doc (top panel) or rAb (lower panel)
bound to a 96 well micro-titre plate. After 1 hr of incubation the
plates were washed and developed with a chromogenic AP
substrate.
[0133] The invention embodies the application of assembly of
specific protein complexes based on the cohesin.dockerin
interaction. Specific antibody.antigen complexes can also be
assembled using the established interaction of protein A or protein
G IgFc binding domains. The invention embodies unique properties of
the cohesin.dockerin interaction that result in greatly superior
complex formation compared to the e.g., protein G interaction with
IgG. In FIGS. 6 and 7 the interaction of a cohesin.AP (called
Coh.AP) protein is shown to be specific for a rAb.Doc protein.
[0134] FIGS. 8A and 8B shows various dilutions of a supernatant
containing secreted G.AP were incubated for 1 hr in micro-titre
wells containing 0.25 ug of immobilized mIgG2a, mIgG2b, or a
mIgG2b-based rAb.doc. After washing the bound AP activity was
developed using chromogenic AP substrate. The proG.AP did not bind
to the rAb.doc since it was an isotype variant of mIgG2b that did
not interact with the particular protein G domain used in the
proG.AP construct.
[0135] FIG. 8B shows an identical study, but employing dilutions of
a supernatant containing secreted Coh.AP. Coh.AP binds only to
rAb.doc, again demonstrating the specificity of the coh.doc
interaction.
[0136] FIG. 9 demonstrates the vastly superior stability of
preassembled complexes based on coh.doc interaction compared to
proG.IgGFc interaction. FIG. 9 shows the formation of complexes
between a fixed amount of proG.AP or coh.AP or coh2.AP (0.1 ug) and
immobilized mIgG2b or rAb.doc (0.25 ug) were assembled by
incubation for 1 hr in a micro-titre plate. At various times a
20-fold excess of soluble mIgG2b or rAb.doc were added and
incubation continued for various times. Plates were then washed and
bound AP activity accessed by addition of chromogenic AP
substrate.
[0137] This example shows the use of such coh.doc complexes in
settings containing serum (e.g., tissue culture media and in vivo
administration). FIG. 10 demonstrates the vast superiority of
coh.doc complexes compared to proG.IgGFc complexes in such a
setting. Under the conditions used, .about.15 ug/ml Ig was
sufficient to completely displace bound proG.AP, while the coh.AP
remained stably bound to rAb.doc even in the presence of pure serum
(15 mg/ml Ig)
[0138] FIG. 10 shows the formation of complexes between a fixed
amount of proG.AP or coh.AP (0.1 ug) and immobilized mIgG2b or
rAb.doc (0.25 ug) were assembled by incubation for 1 hr in a
micro-titre plate. Various dilutions of human serum were added and
incubation continued for 4 hrs. Plates were then washed and bound
AP activity accessed by addition of chromogenic AP substrate.
[0139] The invention also embodies a particular utility of the
coh.doc interaction that permits a production process that ensures
complete complex formation and that can be concomitant with a
purification process for the coh.fusion protein entity. This
invention is exemplified in FIGS. 11 and 12, which illustrate this
process via sequential capture of rAb.doc from culture supernatant
by protein G affinity chromatography, followed by capture of
coh.antigen from culture supernatant by the proteinG:rAb.doc
column. Elution with low pH then releases pure rAb.doc:coh.antigen.
If there is an excess of coh.antigen over rAb.doc, them full and
complete complex should result. A related embodiment of this
invention would be application to the protein G captured rAb.doc of
excess pure or partially purified coh.fusion protein.
[0140] FIG. 11 shows a gel of reduced vs. non-reduced SDS.PAGE
analysis of rAb.doc:Coh2.AP complexes produced by sequential
application of rAb.doc supernatant and coh.AP supernatant to the
same protein G affinity column. Lanes 2 and 4 show that Coh2.AP
co-purifies with rAb.doc.
[0141] FIG. 12 is a non-reduced SDS.PAGE analysis of
rAb.doc:Coh.Flu HA5-1 complexes produced by sequential application
of rAb.doc supernatant and coh.Flu HA5-1 supernatant to the same
protein G affinity column. Lanes 1 to 4 left to right show that
Coh.Flu HA5-1 co-purifies with rAb.doc.
[0142] A well described feature of cohesin domains is their
compatibility with the standard E. coli bacterial expression
system. The invention embodies the novel use of expression of
dockerin fusion proteins in mammalian secretion systems, and it
also encompasses the formation of coh.doc complexes where the
different components (i.e., coh and doc) are expressed in different
systems. This is a great advantage since it affords the possibility
of using the most favorable expression system for each component.
For example, coh.Flu M1 expression constructs failed to efficiently
direct the synthesis of secreted product from transfected mammalian
cells. However, coh.Flu M1 was very efficiently expressed as a
soluble protein in E. coli. Table 6 shows the sequence of the
coh.Flu M1 used in this example.
[0143] TABLE 11 shows the nucleic and amino acid sequence for E
coli-pET28(Cohesin-FluM1-6.times. His) or C32 is shown below. In
the amino acid sequence the cohesin domain is highlighted in yellow
and the point of fusion between cohesion and influenza A M1 protein
is underlined. Residues highliighted grey are a C-terminal His tag
to facilitate purificaytion via metal affinity chromatography.
TABLE-US-00011 TABLE 11 E coli-pET28 (Cohesin-FluM1-6x-His) or C32.
(SEQ ID NO.: 22) ATGGATCTGGATGCAGTAAGGATTAAAGTGGACACAGTAAATGCAA
AACCGGGAGACACAGTAAATATACCTGTAAGATTCAGTGGTATACC
ATCCAAGGGAATAGCAAACTGTGACTTTGTATACAGCTATGACCCG
AATGTACTTGAGATAATAGAGATAAAACCGGGAGAATTGATAGTTG
ACCCGAATCCTACCAAGAGCTTTGATACTGCAGTATATCCTGACAG
AAAGATGATAGTATTCCTGTTTGCGGAAGACAGCGGAACAGGAGCG
TATGCAATAACTAAAGACGGAGTATTTGCTACGATAGTAGCGAAAG
TAAAAGAAGGAGCACCTAACGGGCTCAGTGTAATCAAATTTGTAGA
AGTAGGCGGATTTGCGAACAATGACCTTGTAGAACAGAAGACACAG
TTCTTTGACGGTGGAGTAAATGTTGGAGATACAACAGAACCTGCAA
CACCTACAACACCTGTAACAACACCGACAACAACAGATGATCTGGA
TGCAGCTAGCCTTCTAACCGAGGTCGAAACGTACGTTCTCTCTATC
ATCCCGTCAGGCCCCCTCAAAGCCGAGATCGCACAGAGACTTGAAG
ATGTCTTTGCAGGGAAGAACACCGATCTTGAGGTTCTCATGGAATG
GCTAAAGACAAGACCAATCCTGTCACCTCTGACTAAGGGGATTTTA
GGATTTGTGTTCACGCTCACCGTGCCCAGTGAGCGGGGACTGCAGC
GTAGACGCTTTGTCCAAAATGCTCTTAATGGGAACGGAGATCCAAA
TAACATGGACAAAGCAGTTAAACTGTATAGGAAGCTTAAGAGGGAG
ATAACATTCCATGGGGCCAAAGAAATAGCACTCAGTTATTCTGCTG
GTGCACTTGCCAGTTGTATGGGCCTCATATACAACAGGATGGGGGC
TGTGACCACTGAAGTGGCATTTGGCCTGGTATGCGCAACCTGTGAA
CAGATTGCTGACTCCCAGCATCGGTCTCATAGGCAAATGGTGACAA
CAACCAATCCACTAATCAGACATGAGAACAGAATGGTTCTAGCCAG
CACTACAGCTAAGGCTATGGAGCAAATGGCTGGATCGAGTGAGCAA
GCAGCAGAGGCCATGGATATTGCTAGTCAGGCCAGGCAAATGGTGC
AGGCGATGAGAACCATTGGGACTCATCCTAGCTCCAGTGCTGGTCT
AAAAGATGATCTTCTTGAAAATTTGCAGGCTTACCAGAAACGGATG
GGGGTGCAGATGCAGCGATTCAAGCTCGAGCACCACCACCACCACC ACTGA (SEQ ID NO.:
23) MDLDAVRIKVDTVNAKPGDTVNIPVRFSGIPSKGIANCDFVYSYDP
NVLEIIEIKPGELIVDPNPTKSFDTAVYPDRKMIVELFAEDSGTGA
YAITKDGVFATIVAKVKEGAPNGLSVIKFVEVGGFANNDLVEQKTQ
FFDGGVNVGDTTEPATPTTPVTTPTTTDDLDAASLLTEVETYVLSI
IPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGIL
GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKRE
ITFEIGAKEIALSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATC
EQIADSQHRSHRQMVTTTNPLIRHENRINVLASTTAKAMEQMAGSS
EQAAEAMDIASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAYQK RMGVQMQRFKLE
[0144] The invention embodies the use of the dockerin.cohesin
interaction to assemble ordered and specific complexes for various
therapeutic or vaccination purposes. An example is the use of
rAb.doc with binding specificity to an internalizing human
Dendritic Cell (DC) receptor complexed with coh.Flu M1 protein.
FIG. 11 demonstrates this utility by an in vitro study. DC cultured
with anti-DC_rAb.doc:coh.Flu M1, then co-cultured with autologous T
cells, directed the expansion of T cells with specific memory of
Flu M1. Equivalent doses of coh.Flu M1 alone had no such effect.
The study shows at least a 50-fold enhancement of Flu M1-specific T
cell expansion via the anti-DC_rAb.doc:coh.Flu M1 compared to
coh.Flu M1 alone.
[0145] FIG. 13 shows that functional anti-DC_rAb.doc:coh.Flu M1
complex was formed by mixing the individual purified components.
Various amounts of the complex, or coh.Flu M1 alone, were incubated
in culture medium with 5E4 human DC (from a HLA201 donor) and 10E5
autologous T cells. After 24 hr, the DC were activated with CD40L
and incubation was continued for an additional 9 days. Cells were
harvested and stained with a PE-labeled Flu M1 peptide GILGFVFTL
(SEQ ID NO.:24) HLA-A2 tetramer and analyzed for the frequency of
antigen-specific CD8+ cells.
[0146] FIG. 14 shows a similar example incorporating the additional
control of coh.Flu M1 complexed to an isotype-matched mAb.doc with
no binding to the human DC. FIG. 12 shows that Anti-DC_rAb directly
linked via an H chain fusion to a peptide fragment spanning the Flu
M1 GILGFVFTL epitope is also effective in eliciting DC targeted
antigen delivery resulting in expansion of Flu M1-specific T cells.
However the Anti-DC_rAb.Flu M1 PEP entity was secreted very poorly
from mammalian cells, likely precluding production of such a
vaccine. This problem illustrates the embodiment of the invention
that allows production issues to be solved by employing expression
systems appropriate for the (in this case) vaccine antigen.
[0147] FIG. 14 shows that Anti-DC_rAb.doc:coh.Flu M1 or
mIgG2b.doc:coh.Flu M1 complexes were formed by mixing the
individual purified components. Various amounts of the complexes,
or coh.Flu M1 alone, were incubated in culture medium with 5E4
human DC (from a HLA201 donor) and 10E5 autologous T cells. After
24 hr, the DC were activated with CD40L and incubation was
continued for an additional 9 days. Cells were harvested and
stained with a PE-labeled Flu M1 peptide GILGFVFTL (SEQ ID NO.:24)
HLA-A2 tetramer and analyzed for the frequency of antigen-specific
CD8+ cells. Concentrations for mIgG2.doc complexes were the same as
those for Anti-DC_rAb complexes.
[0148] FIG. 15 shows CD34+ human DC were sorted into CD1a+ and
CD14+ subtypes and cultured with and without 3 nM Anti-DC_rAb.Flu
M1 PEP or Anti-DC_rAb. Autologous T cells were added after 1 day
and culture continued for a further 8 days. Analysis was as
described above. The CD1a+ cells were very efficient in expanding
Flu MI-specific CD8+ cells only with Anti-DC rAb.Flu M1 PEP
treatment.
[0149] While one type of embodiment of the invention is a vaccine
composed of an Anti-DC-rAb.doc:coh.antigen complex, it is
envisioned that in some cases a preferred DC-targeting vaccine will
be Anti-DC-rAb.antigen where antigen is likely a string of
protective antigens. Identification of such antigens in efficacious
combinations compatible with efficient expression in production
systems is extremely problematic. One embodiment of the invention
affords a method to streamline testing of antigen epitope
combinations for the development of such vaccines. Specifically,
the invention teaches a method to screen likely antigen epitopes
alone and in combinations for efficacy as a prelude to addressing
production of the desired Anti-DC-rAb.antigen. For example, TABLE
13 shows the sequences of exemplative cohesin.peptide constructs
which can be readily expressed via E. coli systems. Using
techniques similar to those described in FIG. 11, diverse
collections of coh.pep proteins can be readily tested for efficacy
as complexes with a single anti-DC_rAb.doc entity. The most
efficacious coh.pep compounds can then be engineered directly as
anti-DC_rAb.peptide fusion proteins. FIG. 16 shows examples of
purified coh.PEP proteins expressed in E. coli.
[0150] TABLE 12 shows the amino acid sequence of the
melanoma-associated antigen gp100. Well known HLA-A201-restricted
dominant peptides are shaded and detailed below the sequence.
Peptide sequences labeled M are variants with enhanced affinity for
HLA-A201. C180 is an E. coli expression construct that encodes the
sequence shown below in which the cohesin domain is shaded blue and
the gp100 peptide is shaded grey. Underlined residues bounding the
peptide are native to gp100. C-terminal His tags are to facilitate
purification via metal affinity chromatography.
[0151] Shown below is the gp100 sequence and the associated
peptides referred to above.
##STR00002##
[0152] The HLA-A0201 Restricted Peptide Sequences are:
TABLE-US-00012 GP100 WT: 154-162: KTWGQYWQV (SEQ ID NO.: 26) GP100
M: 209-217 (2M): IMDQVPFSV; (SEQ ID NO.: 27) 209-217 WT: ITDQVPFSV
(SEQ ID NO.: 28) GP100 M: 280-288 (9V): YLEPGPVTV (SEQ ID NO.: 29)
280-288 WT: YLEPGPVTA (SEQ ID NO.: 30)
[0153] C180 is E. coli-pET28(Cohesin-hgp100-PeptideA-6.times.
His):
##STR00003##
[0154] TABLE 13 shows the amino acid sequence of the melanoma
antigen MART-1. Well known HLA-A201-restricted dominant peptides
are shaded and detailed below the sequence. M peptides show peptide
sequence variants with enhanced affinity for HLA-A201. C181 is an
E. coli expression construct that encodes the sequence shown below
in which the cohesin domain is shaded yellow and the MART-1 peptide
is shaded grey. Underlined residues bounding the peptide are native
to MART-1. C172 and C174 are two constructs directing the
expression of anti-DC_rAb.MART-1 peptide and a matching control
rAb.MART-1 peptide H chain. Only the sequences appended to the
C-terminal residue are shown. C-terminal His tags are to facilitate
purification via metal affinity chromatography.
[0155] MART-1 is:
##STR00004##
[0156] The HLA-A0201 Restricted Peptides Sequences are:
##STR00005##
[0157] C181 is E. coli-pET28(Cohesin-hMART-1-PeptideB-6.times.
His)
##STR00006##
[0158] C186 is E. coli-pET28(Cohesin-Flex-hMART-1-PeptideA-6.times.
His)
##STR00007##
[0159] C172 is
rAB-pIRES2(mAnti-ASGPR.sub.--49C11.sub.--7H-LV-hIgG4H-hMART-1-PeptideA)
[0160] C174 is rAB-pIRES2(hIgG4H-hMART-1-PeptideA)
##STR00008##
[0161] FIG. 16 shows E. coli harboring expression plasmids
directing the synthesis of coh.pep proteins were grown and induced
for specific protein production. Cells were harvested and broken by
sonication. The supernatant fractions were applied purified by
metal affinity chromatography. Analysis was by reducing SDS.PAGE
gel stained by Coomassie Brilliant Blue. The figure shows typical
product coh.pep proteins labeled from left to right.
[0162] This Example shows the successful use of cohesin and
dockerin fusion proteins secreted from mammalian cells. If both
fusion partners are rAbs with different specificities (i.e.,
rAb1.doc and rAb2.coh), then simple mixing results in
rAb1.doc:rAb2.coh which is a bi-specific antibody. Bispecific
antibodies have many potential therapeutic and technical
applications. The invention provides a simple and predictable means
to assemble such entities through the doc:coh interaction.
Alternately, if rAb1.doc:rAb1.coh were assembled such entities
represent controlled cross-linked mAbs with potentially unique
biological properties.
[0163] Cohesin.dockerin modules exist in diverse cellulose
degrading species. While they have sequence similarities, they can
have specificities that do not cross between species. This affords
an opportunity to build novel scaffolds composed of cohesins with
different specificities and use this scaffold to assemble high
order complexes in a spatially and numerically controlled manner.
Others have described the core technology for using this notion for
biotechnology applications (see Fierobe, H.-P., Mechaly, A.,
Tardif, C., Belaich, A., Lamed, R., Shoham, Y., Belaich, J.-P., and
Bayer, E. A. (2001) Design and production of active cellulosome
chimeras: Selective incorporation of dockerin-containing enzymes
into defined functional complexes. J. Biol. Chem. 276,
21257-21261.). The invention embodies the specific use of this
technology for applications related to manufacture of
rAb.(doc:coh.fusion)n complexes where n represents >1 pairings
of doc:coh interactions with unique specificities. Thus, the
invention envisions the assembly (by simple mixing of components)
of spatially ordered complexes between rAb.doc1.doc2.doc3.etc. and
coh1 .fusionA, coh2.fusionB, coh3.fusion3, etc. The coh.fusion
proteins could represent different antigens, or combinations of
antigens and activating agents like cytokines.
[0164] By extension multiple coh:doc specificities could also be
used to make bivalent rAbs with higher order antigen specificities.
Cellulose degrading bacteria and similar organisms also use
cellulose binding domains (CBD) to organize the degradation
machinery. The structure of a CBD from Clostridium thermocellum
shows that the N and C-termini are in close proximity and are not
an integral part of the CBD functional structure. In fact CBD
typically occurs linked to other domains such as coh.CBD.coh in
cipA. The invention encompasses the use of entities such as
coh.CBD.coh to assemble spatially and numerically ordered complexes
mimicking antibodies and multi subunit receptors. For example, a
IgG kappa chain v region fused to doc1 and a IgG H chain V region
linked to doc2 can assemble with coh1.CBD.coh2 to yield
VL.doc1:coh1.CBD.coh2:VH.doc2 to yield an entity with affinity and
binding specificity analogous to the original mAb. Such entities
should be e.g., very useful screening tools for refining mAb
specificities through mutagenesis procedures, particularly since
the VL and VH component could be mutated independently and combined
by mixing in various combinations. As described above, this
technology can be readily extended to multiple controlled coh:V.doc
combinations potentially yielding binding entities with extremely
high specificities and affinities. An extension of this would be
using e.g., coh1.coh2.CBD.coh3 as a template for assembly of
cytoR1.doc+cytoR2.doc+cytoR3.doc (where cytoR represents the
ectodomain of one subunit of a complex cytokine receptor). Such
entities will have utility for blocking cytokine interactions for
therapy and in biotechnology for measuring cytokines in complex
supernatants.
Example 3
Using Cohesin-Dockerin Technology for Immunotoxin Therapy
[0165] Currently 1.2 million Americans develop cancer each year and
about 500,000 die from the disease, because most cancers cannot be
cured once they have metastasized. To develop a new treatment for
metastatic cancer, genetic engineering has been used to modify a
powerful bacterial toxin, Pseudomonas exotoxin A (PE), so that
instead of killing normal cells it selectively kills cancer cells.
PE is a three domain protein composed of 613 amino acids.
Anti-cancer agents are produced by deleting its binding domain (aa
1-252) and replacing it with the Fv fragment of an antibody or with
a growth factor that binds to antigens present on cancer cells.
These agents are termed recombinant immunotoxins (RITs). RITs have
been made that target Ley present on colon, breast, lung and other
epithelial cancers (B3(Fv)-PE38), that target the EGF receptor
overexpressed on glioblastomas (TGF-alpha-PE38), that target mutant
EGF receptors present on glioblastomas (MR-1(Fv)-PE38KDEL), and
that target the IL-2 receptor present on many T and B cell
leukemias and lymphomas LMB-2 or anti-Tac(Fv)-PE38 and that target
CD22 on B cell malignancies and that target BL22 or RFB4(dsFv)-PE38
ovarian cancers and mesotheliomas (SS IP). These agents are
produced in E. coli because large amounts can be readily purified
from this source and because the toxin itself would kill mammalian
cells expressing it. When administered to mice with the appropriate
human cancer xenograft, all these RITs produce complete tumor
regressions. Most of these agents are now in clinical trials in
humans and several have produced complete and partial remissions in
humans with cancer.
[0166] An ideal immunotoxin should be very active so that only
small amounts need to be given to cause tumor regressions, stable
so it remains functional during the 5-10 hours required to reach
the interior of a tumor, and non immunogenic so it can be given
repeatedly. Initially, recombinant immunotoxins contained amino
acids 253-613 of PE (domains II and III). It has been determined
that amino acids 364-395 can be deleted without loss of activity.
Increased stability can be addressed by linking the toxin to a
whole antibody, which are well known to have long half-lives and
the technology in the invention provides this solution.
[0167] While the rAb.Doc:Coh.toxin technology can be applied to
known cancer antigens, it can also be tested to kill intra-tumoral
DC that are suspected to foster escape of the tumor from immune
surveillance. In this latter case, anti-DC toxin therapy could be
doubly advantageous since build up of immunity against the
administered toxin itself should be suppressed (that is because DC
themselves are key to the initiation of this immune response via
uptake and processing of the antigen. In this therapy, the DCs that
uptake the antigen die and cannot mount the anti-toxin
response).
[0168] Frankel (Clinical Cancer Research, 8, 942-944, 2002)
describes issues hindering the wider application of immunotoxins.
These include production problems which often require refolding of
E. coli inclusion body expressed material where misfolding
contaminents are problematic. Also, affinity of the immunotoxin for
its target is often difficult to obtain in sufficient strength. The
technology basis of this invention addresses both these
issues--firstly, we found that cohesin.PE38 fusion protein is
expressed in E. coli as a soluble protein that can be purified in a
fully functional state (with both cohesin and toxin activities in
tact) by simple biochemical means without complex refolding.
Secondly, high affinity monoclonal antibodies against target
antigens can be routinely obtained by one practiced in the art.
What is difficult is engineering the antibody variable regions in a
form that is fused with toxin and fully functional for target
binding. The usual means (e.g., sFv forms) of engineering invarably
lead to significant loss of affinity against the target compared to
the initial monoclonal antibody. The rAb.Doc:Coh.toxin technology
circumvents this issue affording a means to preserve both the high
affinity binding sites of the initial mAb (note that humanization
of mouse mAb V regions while maintaining high and specific binding
activity is routine to one practiced in the art), as well as the
beneficial properties of long half-life and non-antigenicity of a
full recombinant hIgG context.
[0169] Furthermore since the cohesin.toxin is produced
independently, one formulation of the toxin can be conjugated to
any number of separately produced targeting rAb.Doc proteins by
simple mixing of the component prior to injection of the patient.
This greatly simplifies manufacturing as well as research
development time. The technology described in the invention can be
readily applied to any toxin and any rAb specificity.
[0170] Details of the rAb.Doc:Coh.toxin technology. pRB 391 (from
Dr. Pastan) Pastan, Chief of the Laboratory of Molecular Biology,
Division of Basic Sciences. NCl, NIH) was used as a template for
PCR with primers
TABLE-US-00013 PE38-N3
(cacggtcaccgtctccaaagcttccggagctagcGAGGGCGGCAGCCTG GCCGCGCT (SEQ ID
NO.: 39)) and PE38-C3
(GGCCGGCTCCTGCGAAGGGAGCCGGCCGGTCGCGGCCGCTTACTTCAGG
TCCTCGCGCGGCGGTTTGCCG (SEQ ID NO.: 40)).
[0171] Cloning was into the previously established construct C21 or
E. coli-pET28(Cohesin-6.times. His) to generate a fusion protein
encoding Cohesin-PE38 corresponding to the amino acid sequence
shown below (grey residues are cohesin; yellow residues are PE38,
separated by a linker sequence native to the cohesin domain).
##STR00009##
[0172] Expression and purification of recombinant Coh.PE38
protein--E. coli cells from each 1 L fermentation were resuspended
in 25 ml ice-cold 50 mM Tris, 1 mM EDTA pH 8.0 with 0.1 ml of
protease inhibitor Cocktail II (Calbiochem). The cells were
sonicated on ice 2.times.5 min at setting 18 (Fisher Sonic
Dismembrator 60) with a 5 min rest period and then spun at 17,000
r.p.m. (Sorvall SA-600) for 20 min at 4.degree. C. The supernatant
was passed through 1 ml ANX Sepharose column equilibrated in 50 mM
Tris, 1 mM EDTA pH 8.0 and and eluted with a 0-1 M NaCl gradient in
Buffer B. Fractions containing Cohesin.PE38 sere identified by
SDS.PAGE and pooled fractions were further purified by purification
via anti-cohesin mAb affinity chromatography with elution by 0.1 M
glycine pH 2.7.
[0173] Selective killing of human DC by rAb.Doc targeted
Coh.PE38--Human DC were prepared from blood monocytes by culture
for 6 days in with GM-CSF and IL-4. The DCs were then cultured with
either Coh.PE38 alone, anti-DC-SIGN/L 16E7 rAb.Doc alone, anti-DCIR
24A5.Doc alone, or the rAb.Docs together with Coh.PE38 (1.25 ug/ml
of agents were added). After 48 hr the cells were stained with a
reagent (7-AAD) that detects apoptotic cells and analyzed by FACS
scoring forward versus side scatter and 7-AAD fluorescence.
[0174] FIG. 17 shows that the DCIR.Doc rAb alone had no effect upon
the survival of DCs. However, DC-SIGN/L alone has a survival
enhancing effect upon the DC (evidenced both by the scatter
analysis and the 7-AAD staining. FIG. 18 shows that Coh.PE38 alone
slightly increase the number of 7-AAD scored apoptotic cells (from
22.1-29.8%). However, targeting the Coh.PE38 toxin via DCIR.Doc
increased the 7-AAD positive population to 55.3%. The scatter
analysis even more dramatically revealed an almost complete loss of
the population characteristic of viable DC. Targeting the Coh.PE38
toxin via DC-SIGN/L.Doc increased the 7-AAD positive population to
53.7% with a similar loss of the viable DC scatter population.
However, this latter result should be viewed in the context of the
survival effect of the DC-SIGN/L.Doc rAb, meaning that the killing
can be viewed as from 3.1-53.1% 7-AAD positive.
[0175] Using Cohesin-Dockerin Technology to make Multivalent
Antibodies. A Cohesin domain was engineered in-frame with the
C-terminus of a rAb H chain using PCR based on C17
(Mam-pCDM8(Cohesin-Cohesin-SLAML-AP-6.times. His))as template. The
resulting secreted H chain sequence is shown below (the cohesin
domain is highlighted in grey and the C-terminal H chain residue is
in bold):
##STR00010##
[0176] This expression construct was co-transfected with the
appropriate rAb L chain into 293F cells and expression of secreted
rAb was appraised by anti-hIgGFc ELISA at day 3. FIG. 19 shows the
expression of anti-DC-SIGN/L and Anti-DC-ASPGR rAb.Coh were
efficiently secreted.
[0177] Thus both Cohesin and Dockerin domains are readily expressed
as rAb fusion proteins. This property is essential for the use of
(rAb1.Coh:rAb2.Doc) complexes as bivalent antibodies (i.e., having
two different combining specificities in one protein). Bivalent
antibodies have many desirable features suited to industrial,
analytic, and therapeutic applications. They are, however,
difficult to develop and molecular tools used to engineer them
typically adulterate desirable features of high affinity and
specificity inherent to the parent monoclonal antibodies. The
(rAb1.Coh:rAb2.Doc) technology circumvents this obstacle and is,
moreover, extensible to higher (than 2) valency of combining power
by incorporating multiple Cohesin or Dockerin strings with pair
wise specificities as described elsewhere in this application.
Furthermore, this technology can be extended to using, e.g., a
cytokine to provide the additional valency (i.e.,
rAb1.Doc:Coh.cytokine).
[0178] For example, a fusion protein between a Cohesin domain and
IL-21 was engineered as an expression construct and the Coh.IL-21
protein was efficiently secreted from transiently transfected 293F
cells and easily purified by sequential Q Sepharose and
anti-Cohesin affinity chromatography. The sequence of the secreted
product is shown below with the cohesin domain shown in grey and
the IL-21 domain in yellow. This product was fully functional as
determined by it's efficacy in sustaining proliferation of human B
cells.
[0179] Mam-pCDM8(SLAML-Cohesin-hIL-21)
##STR00011##
[0180] Thus rAb.Doc:Coh.IL-21 can deliver concomitant proliferation
and activation signals to a B cell (i.e., if the rAb itself has
activation properties). This notion can be extended to any rAb with
biological properties directed to a particular cell type and any
cytokine with activity directed to the same cell type. FIG. 20
shows the effect of IL-21 and Coh.IL-21 on the proliferation of
human B cells.
[0181] It is contemplated that any embodiment discussed in this
specification can be implemented with respect to any method, kit,
reagent, or composition of the invention, and vice versa.
Furthermore, compositions of the invention can be used to achieve
methods of the invention.
[0182] It will be understood that particular embodiments described
herein are shown by way of illustration and not as limitations of
the invention. The principal features of this invention can be
employed in various embodiments without departing from the scope of
the invention. Those skilled in the art will recognize, or be able
to ascertain using no more than routine experimentation, numerous
equivalents to the specific procedures described herein. Such
equivalents are considered to be within the scope of this invention
and are covered by the claims.
[0183] All publications and patent applications mentioned in the
specification are indicative of the level of skill of those skilled
in the art to which this invention pertains. All publications and
patent applications are herein incorporated by reference to the
same extent as if each individual publication or patent application
was specifically and individually indicated to be incorporated by
reference.
[0184] The use of the word "a" or "an" when used in conjunction
with the term "comprising" in the claims and/or the specification
may mean "one," but it is also consistent with the meaning of "one
or more," "at least one," and "one or more than one." The use of
the term "or" in the claims is used to mean "and/or" unless
explicitly indicated to refer to alternatives only or the
alternatives are mutually exclusive, although the disclosure
supports a definition that refers to only alternatives and
"and/or." Throughout this application, the term "about" is used to
indicate that a value includes the inherent variation of error for
the device, the method being employed to determine the value, or
the variation that exists among the study subjects.
[0185] As used in this specification and claim(s), the words
"comprising" (and any form of comprising, such as "comprise" and
"comprises"), "having" (and any form of having, such as "have" and
"has"), "including" (and any form of including, such as "includes"
and "include") or "containing" (and any form of containing, such as
"contains" and "contain") are inclusive or open-ended and do not
exclude additional, unrecited elements or method steps.
[0186] The term "or combinations thereof" as used herein refers to
all permutations and combinations of the listed items preceding the
term. For example, "A, B, C, or combinations thereof" is intended
to include at least one of: A, B, C, AB, AC, BC, or ABC, and if
order is important in a particular context, also BA, CA, CB, CBA,
BCA, ACB, BAC, or CAB. Continuing with this example, expressly
included are combinations that contain repeats of one or more item
or term, such as BB, AAA, MB, BBC, AAABCCCC, CBBAAA, CABABB, and so
forth. The skilled artisan will understand that typically there is
no limit on the number of items or terms in any combination, unless
otherwise apparent from the context.
[0187] All of the compositions and/or methods disclosed and claimed
herein can be made and executed without undue experimentation in
light of the present disclosure. While the compositions and methods
of this invention have been described in terms of preferred
embodiments, it will be apparent to those of skill in the art that
variations may be applied to the compositions and/or methods and in
the steps or in the sequence of steps of the method described
herein without departing from the concept, spirit and scope of the
invention. All such similar substitutes and modifications apparent
to those skilled in the art are deemed to be within the spirit,
scope and concept of the invention as defined by the appended
claims.
Sequence CWU 1
1
4312299PRTBacteroides cellulosolvens 1Met Gln Ser Pro Arg Leu Lys
Arg Lys Ile Leu Ser Val Ile Leu Ala1 5 10 15Val Cys Tyr Ile Ile Ser
Ser Phe Ser Ile Gln Phe Ala Ala Thr Pro 20 25 30Gln Val Asn Ile Ile
Ile Gly Ser Ala Gln Gly Ile Pro Gly Ser Thr 35 40 45Val Lys Val Pro
Ile Asn Leu Gln Asn Val Pro Glu Ile Gly Ile Asn 50 55 60Asn Cys Asp
Phe Thr Ile Lys Phe Asp Ser Asp Ile Leu Asp Phe Asn65 70 75 80Ser
Val Glu Ala Gly Asp Ile Val Pro Leu Pro Val Ala Ser Phe Ser 85 90
95Ser Asn Asn Ser Lys Asp Ile Ile Lys Phe Leu Phe Ser Asp Ala Thr
100 105 110Gln Gly Asn Met Pro Ile Asn Glu Asn Gly Leu Phe Ala Val
Ile Ser 115 120 125Phe Lys Ile Lys Asp Asn Ala Gln Lys Gly Ile Ser
Asn Ile Lys Val 130 135 140Ser Ser Tyr Gly Ser Phe Ser Gly Met Ser
Gly Lys Glu Met Gln Ser145 150 155 160Leu Ser Pro Thr Phe Phe Ser
Gly Ser Ile Asp Val Ser Asp Val Ser 165 170 175Thr Ser Lys Leu Asp
Val Lys Val Gly Asn Val Glu Gly Ile Ala Gly 180 185 190Thr Glu Val
Asn Val Pro Ile Thr Phe Glu Asn Val Pro Asp Asn Gly 195 200 205Ile
Asn Asn Cys Asn Phe Thr Leu Ser Tyr Asp Ser Asn Ala Leu Glu 210 215
220Phe Leu Thr Thr Glu Ala Gly Asn Ile Ile Pro Leu Ala Ile Ala
Asp225 230 235 240Tyr Ser Ser Tyr Arg Ser Met Glu Gly Lys Ile Lys
Phe Leu Phe Ser 245 250 255Asp Ser Ser Gln Gly Thr Arg Ser Ile Lys
Asn Asp Gly Val Phe Ala 260 265 270Asn Ile Lys Phe Lys Ile Lys Gly
Asn Ala Ile Arg Asp Thr Tyr Arg 275 280 285Ile Asp Leu Ser Glu Leu
Gly Ser Phe Ser Ser Lys Gln Asn Asn Asn 290 295 300Leu Lys Ser Ile
Ala Thr Gln Phe Leu Ser Gly Ser Val Asn Val Lys305 310 315 320Asp
Ile Glu Ser Ser Val Ser Pro Thr Thr Ser Val His Pro Thr Pro 325 330
335Thr Ser Val Pro Pro Thr Pro Thr Lys Ser Ser Pro Gly Asn Lys Met
340 345 350Lys Ile Gln Ile Gly Asp Val Lys Ala Asn Gln Gly Asp Thr
Val Ile 355 360 365Val Pro Ile Thr Phe Asn Glu Val Pro Val Met Gly
Val Asn Asn Cys 370 375 380Asn Phe Thr Leu Ala Tyr Asp Lys Asn Ile
Met Glu Phe Ile Ser Ala385 390 395 400Asp Ala Gly Asp Ile Val Thr
Leu Pro Met Ala Asn Tyr Ser Tyr Asn 405 410 415Met Pro Ser Asp Gly
Leu Val Lys Phe Leu Tyr Asn Asp Gln Ala Gln 420 425 430Gly Ala Met
Ser Ile Lys Glu Asp Gly Thr Phe Ala Asn Val Lys Phe 435 440 445Lys
Ile Lys Gln Ser Ala Ala Phe Gly Lys Tyr Ser Val Gly Ile Lys 450 455
460Ala Ile Gly Ser Ile Ser Ala Leu Ser Asn Ser Lys Leu Ile Pro
Ile465 470 475 480Glu Ser Ile Phe Lys Asp Gly Ser Ile Thr Val Thr
Asn Lys Pro Ile 485 490 495Val Asn Ile Glu Ile Gly Lys Val Lys Val
Lys Ala Gly Asp Lys Ile 500 505 510Lys Val Pro Val Glu Ile Lys Asp
Ile Pro Ser Ile Gly Ile Asn Asn 515 520 525Cys Asn Phe Thr Leu Lys
Tyr Asn Ser Asn Val Leu Lys Tyr Val Ser 530 535 540Asn Glu Ala Gly
Thr Ile Val Pro Ala Pro Leu Ala Asn Leu Ser Ile545 550 555 560Asn
Lys Pro Asp Glu Gly Ile Ile Lys Leu Leu Phe Ser Asp Ala Ser 565 570
575Gln Gly Gly Met Pro Ile Lys Asp Asn Gly Ile Phe Val Asn Leu Glu
580 585 590Phe Gln Ala Val Asn Asp Ala Asn Ile Gly Val Tyr Gly Leu
Glu Leu 595 600 605Asp Thr Ile Gly Ala Phe Ser Gly Ile Ser Ser Ala
Lys Met Thr Ser 610 615 620Ile Glu Pro Gln Phe Asn Asn Gly Ser Ile
Glu Ile Phe Asn Ser Ala625 630 635 640Gln Thr Pro Val Pro Ser Asn
Thr Glu Val Gln Thr Pro Thr Asn Thr 645 650 655Ile Ser Val Thr Pro
Thr Asn Asn Ser Thr Pro Thr Asn Asn Ser Thr 660 665 670Pro Lys Pro
Asn Pro Leu Tyr Asn Leu Asn Val Asn Ile Gly Glu Ile 675 680 685Ser
Gly Glu Ala Gly Gly Val Ile Glu Val Pro Ile Glu Phe Lys Asn 690 695
700Val Pro Asp Phe Gly Ile Asn Asn Cys Asp Phe Ser Val Lys Tyr
Asp705 710 715 720Lys Ser Ile Phe Glu Tyr Val Thr Tyr Glu Ala Gly
Ser Ile Val Lys 725 730 735Asp Ser Ile Val Asn Leu Ala Cys Met Glu
Asn Ser Gly Ile Ile Asn 740 745 750Leu Leu Phe Asn Asp Ala Thr Gln
Ser Ser Ser Pro Ile Lys Asn Asn 755 760 765Gly Val Phe Ala Lys Leu
Lys Phe Lys Ile Asn Ser Asn Ala Ala Ser 770 775 780Gly Thr Tyr Gln
Ile Asn Ala Glu Gly Tyr Gly Lys Phe Ser Gly Asn785 790 795 800Leu
Asn Gly Lys Leu Thr Ser Ile Asn Pro Ile Phe Glu Asn Gly Ile 805 810
815Ile Asn Ile Gly Asn Val Thr Val Lys Pro Thr Ser Thr Pro Ala Asp
820 825 830Ser Ser Thr Ile Thr Pro Thr Ala Thr Pro Thr Ala Thr Pro
Thr Ile 835 840 845Lys Gly Thr Pro Thr Val Thr Pro Ile Tyr Trp Met
Asn Val Leu Ile 850 855 860Gly Asn Met Asn Ala Ala Ile Gly Glu Glu
Val Val Val Pro Ile Glu865 870 875 880Phe Lys Asn Val Pro Pro Phe
Gly Ile Asn Asn Cys Asp Phe Lys Leu 885 890 895Val Tyr Asp Ser Asn
Ala Leu Glu Leu Lys Lys Val Glu Ala Gly Asp 900 905 910Ile Val Pro
Glu Pro Leu Ala Asn Leu Ser Ser Asn Lys Ser Glu Gly 915 920 925Lys
Ile Gln Phe Leu Phe Asn Asp Ala Ser Gln Gly Ser Met Gln Ile 930 935
940Glu Asn Gly Gly Val Phe Ala Lys Ile Thr Phe Lys Val Lys Ser
Thr945 950 955 960Ala Ala Ser Gly Ile Tyr Asn Ile Arg Lys Asp Ser
Val Gly Ser Phe 965 970 975Ser Gly Leu Ile Asp Asn Lys Met Thr Ser
Ile Gly Pro Lys Phe Thr 980 985 990Asp Gly Ser Ile Val Val Gly Thr
Val Thr Pro Thr Ala Thr Ala Thr 995 1000 1005Pro Ser Ala Ile Val
Thr Thr Ile Thr Pro Thr Ala Thr Thr Lys 1010 1015 1020Pro Ile Ala
Thr Pro Thr Ile Lys Gly Thr Pro Thr Ala Thr Pro 1025 1030 1035Met
Tyr Trp Met Asn Val Val Ile Gly Lys Met Asn Ala Glu Val 1040 1045
1050Gly Gly Glu Val Val Val Pro Ile Glu Phe Asn Asn Val Pro Ser
1055 1060 1065Phe Gly Ile Asn Asn Cys Asp Phe Lys Leu Val Tyr Asp
Ala Thr 1070 1075 1080Ala Leu Glu Leu Lys Asn Val Glu Ala Gly Asp
Ile Ile Lys Thr 1085 1090 1095Pro Leu Ala Asn Phe Ser Asn Asn Lys
Ser Glu Glu Gly Lys Ile 1100 1105 1110Ser Phe Leu Phe Asn Asp Ala
Ser Gln Gly Ser Met Gln Ile Glu 1115 1120 1125Asn Gly Gly Val Phe
Ala Lys Ile Thr Phe Lys Val Lys Ser Thr 1130 1135 1140Thr Ala Thr
Gly Val Tyr Asp Leu Arg Lys Asp Leu Val Gly Ser 1145 1150 1155Phe
Ser Gly Leu Lys Asp Asn Lys Met Thr Ser Ile Gly Ala Glu 1160 1165
1170Phe Thr Asn Gly Ser Ile Thr Val Ala Ala Thr Ala Pro Thr Val
1175 1180 1185Thr Pro Thr Val Asn Ala Thr Pro Ser Ala Ala Thr Pro
Thr Val 1190 1195 1200Thr Pro Thr Ala Thr Ala Thr Pro Ser Val Thr
Ile Pro Thr Val 1205 1210 1215Thr Pro Thr Ala Thr Ala Thr Pro Ser
Val Thr Ile Pro Thr Val 1220 1225 1230Thr Pro Thr Ala Thr Ala Thr
Pro Ser Ala Ala Thr Pro Thr Val 1235 1240 1245Thr Pro Thr Ala Thr
Ala Thr Pro Ser Val Thr Ile Pro Thr Val 1250 1255 1260Thr Pro Thr
Val Thr Ala Thr Pro Ser Asp Thr Ile Pro Thr Val 1265 1270 1275Thr
Pro Thr Ala Thr Ala Thr Pro Ser Ala Ile Val Thr Thr Ile 1280 1285
1290Thr Pro Thr Ala Thr Ala Lys Pro Ile Ala Thr Pro Thr Ile Lys
1295 1300 1305Gly Thr Pro Thr Ala Thr Pro Met Tyr Trp Met Asn Val
Val Ile 1310 1315 1320Gly Lys Met Asn Ala Glu Val Gly Gly Glu Val
Val Val Pro Ile 1325 1330 1335Glu Phe Lys Asn Val Pro Ser Phe Gly
Ile Asn Asn Cys Asp Phe 1340 1345 1350Lys Leu Val Tyr Asp Ala Thr
Ala Leu Glu Leu Lys Asn Val Glu 1355 1360 1365Ala Gly Asp Ile Ile
Lys Thr Pro Leu Ala Asn Phe Ser Asn Asn 1370 1375 1380Lys Ser Glu
Glu Gly Lys Ile Ser Phe Leu Phe Asn Asp Ala Ser 1385 1390 1395Gln
Gly Ser Met Gln Ile Glu Asn Gly Gly Val Ser Ala Lys Ile 1400 1405
1410Thr Phe Lys Val Lys Ser Thr Thr Ala Ile Gly Val Tyr Asp Ile
1415 1420 1425Arg Lys Asp Leu Ile Gly Ser Phe Ser Gly Leu Lys Asp
Ser Lys 1430 1435 1440Met Thr Ser Ile Gly Ala Glu Phe Thr Asn Gly
Ser Ile Thr Val 1445 1450 1455Ala Thr Thr Ala Pro Thr Val Thr Pro
Thr Ala Thr Ala Thr Pro 1460 1465 1470Ser Val Thr Ile Pro Thr Val
Thr Pro Thr Ala Thr Ala Thr Pro 1475 1480 1485Gly Thr Ala Thr Pro
Gly Thr Ala Thr Pro Thr Ala Thr Ala Thr 1490 1495 1500Pro Gly Ala
Ala Thr Pro Thr Glu Thr Ala Thr Pro Ser Val Met 1505 1510 1515Ile
Pro Thr Val Thr Pro Thr Ala Thr Ala Thr Pro Thr Ala Thr 1520 1525
1530Ala Thr Pro Thr Val Lys Gly Thr Pro Thr Ile Lys Pro Val Tyr
1535 1540 1545Lys Met Asn Val Val Ile Gly Arg Val Asn Val Val Ala
Gly Glu 1550 1555 1560Glu Val Val Val Pro Val Glu Phe Lys Asn Ile
Pro Ala Ile Gly 1565 1570 1575Val Asn Asn Cys Asn Phe Val Leu Glu
Tyr Asp Ala Asn Val Leu 1580 1585 1590Glu Val Lys Lys Val Asp Ala
Gly Glu Ile Val Pro Asp Ala Leu 1595 1600 1605Ile Asn Phe Gly Ser
Asn Asn Ser Asp Glu Gly Lys Val Tyr Phe 1610 1615 1620Leu Phe Asn
Asp Ala Leu Gln Gly Arg Met Gln Ile Ala Asn Asp 1625 1630 1635Gly
Ile Phe Ala Asn Ile Thr Phe Lys Val Lys Ser Ser Ala Ala 1640 1645
1650Ala Gly Ile Tyr Asn Ile Arg Lys Asp Ser Val Gly Ala Phe Ser
1655 1660 1665Gly Leu Val Asp Lys Leu Val Pro Ile Ser Ala Glu Phe
Thr Asp 1670 1675 1680Gly Ser Ile Ser Val Glu Ser Ala Lys Ser Thr
Pro Thr Ala Thr 1685 1690 1695Ala Thr Gly Thr Asn Val Thr Pro Thr
Val Ala Ala Thr Val Thr 1700 1705 1710Pro Thr Ala Thr Pro Ala Ser
Thr Thr Pro Thr Ala Thr Pro Thr 1715 1720 1725Ala Thr Ser Thr Val
Lys Gly Thr Pro Thr Ala Thr Pro Leu Tyr 1730 1735 1740Ser Met Asn
Val Ile Ile Gly Lys Val Asn Ala Glu Ala Ser Gly 1745 1750 1755Glu
Val Val Val Pro Val Glu Phe Lys Asp Val Pro Ser Ile Gly 1760 1765
1770Ile Asn Asn Cys Asn Phe Ile Leu Glu Tyr Asp Ala Ser Ala Leu
1775 1780 1785Glu Leu Asp Ser Ala Glu Ala Gly Glu Ile Val Pro Val
Pro Leu 1790 1795 1800Gly Asn Phe Ser Ser Asn Asn Lys Asp Glu Gly
Lys Ile Tyr Phe 1805 1810 1815Leu Phe Ser Asp Gly Thr Gln Gly Arg
Met Gln Ile Val Asn Asp 1820 1825 1830Gly Ile Phe Ala Lys Ile Lys
Phe Lys Val Lys Ser Thr Ala Ser 1835 1840 1845Asp Gly Thr Tyr Tyr
Ile Arg Lys Asp Ser Val Gly Ala Phe Ser 1850 1855 1860Gly Leu Ile
Glu Lys Lys Ile Ile Lys Ile Gly Ala Glu Phe Thr 1865 1870 1875Asp
Gly Ser Ile Thr Val Arg Ser Leu Thr Pro Thr Pro Thr Val 1880 1885
1890Thr Pro Asn Val Ala Ser Pro Thr Pro Thr Lys Val Val Ala Glu
1895 1900 1905Pro Thr Ser Asn Gln Pro Ala Gly Pro Gly Pro Ile Thr
Gly Thr 1910 1915 1920Ile Pro Thr Ala Thr Thr Thr Ala Thr Ala Thr
Pro Thr Lys Ala 1925 1930 1935Ser Val Ala Thr Ala Thr Pro Thr Ala
Thr Pro Ile Val Val Val 1940 1945 1950Glu Pro Thr Ile Val Arg Pro
Gly Tyr Asn Lys Asp Ala Asp Leu 1955 1960 1965Ala Val Phe Ile Ser
Ser Asp Lys Ser Arg Tyr Glu Glu Ser Ser 1970 1975 1980Ile Ile Thr
Tyr Ser Ile Glu Tyr Lys Asn Ile Gly Lys Val Asn 1985 1990 1995Ala
Thr Asn Val Lys Ile Ala Ala Gln Ile Pro Lys Phe Thr Lys 2000 2005
2010Val Tyr Asp Ala Ala Lys Gly Ala Val Lys Gly Ser Glu Ile Val
2015 2020 2025Trp Met Ile Gly Asn Leu Ala Val Gly Glu Ser Tyr Thr
Lys Glu 2030 2035 2040Tyr Lys Val Lys Val Asp Ser Leu Thr Lys Ser
Glu Glu Tyr Thr 2045 2050 2055Asp Asn Thr Val Thr Ile Ser Ser Asp
Gln Thr Val Asp Ile Pro 2060 2065 2070Glu Asn Ile Thr Thr Gly Asn
Asp Asp Lys Ser Thr Ile Arg Val 2075 2080 2085Met Leu Tyr Ser Asn
Arg Phe Thr Pro Gly Ser His Ser Ser Tyr 2090 2095 2100Ile Leu Gly
Tyr Lys Asp Lys Thr Phe Lys Pro Lys Gln Asn Val 2105 2110 2115Thr
Arg Ala Glu Val Ala Ala Met Phe Ala Arg Ile Met Gly Leu 2120 2125
2130Thr Val Lys Asp Gly Ala Lys Ser Ser Tyr Lys Asp Val Ser Asn
2135 2140 2145Lys His Trp Ala Leu Lys Tyr Ile Glu Ala Val Thr Lys
Ser Gly 2150 2155 2160Ile Phe Lys Gly Tyr Lys Asp Ser Thr Phe His
Pro Asn Ala Pro 2165 2170 2175Ile Thr Arg Ala Glu Leu Ser Thr Val
Ile Phe Asn Tyr Leu His 2180 2185 2190Leu Asn Asn Ile Ala Pro Ser
Lys Val His Phe Thr Asp Ile Asn 2195 2200 2205Lys His Trp Ala Lys
Asn Tyr Ile Glu Glu Ile Tyr Arg Phe Lys 2210 2215 2220Leu Ile Gln
Gly Tyr Ser Asp Gly Ser Phe Lys Pro Asn Asn Asn 2225 2230 2235Ile
Thr Arg Ala Glu Val Val Thr Met Ile Asn Arg Met Leu Tyr 2240 2245
2250Arg Gly Pro Leu Lys Val Lys Val Gly Ser Phe Pro Asp Val Ser
2255 2260 2265Pro Lys Tyr Trp Ala Tyr Gly Asp Ile Glu Glu Ala Ser
Arg Asn 2270 2275 2280His Lys Tyr Thr Arg Asp Glu Lys Asp Gly Ser
Glu Ile Leu Ile 2285 2290 2295Glu 21653DNAArtificial
SequenceSynthetic oligonucleotide 2atggacctcc tgtgcaagaa catgaagcac
ctgtggttct tcctcctgct ggtggcggct 60cccagatggg tcctgtcccg gctgcagctg
caggagtcgg gcccaggcct gctgaagcct 120tcggtgaccc tgtccctcac
ctgcactgtc tcgggtgact ccgtcgccag tagttcttat 180tactggggct
gggtccgtca gcccccaggg aagggactcg agtggatagg gactatcaat
240tttagtggca atatgtatta tagtccgtcc ctcaggagtc gagtgaccat
gtcggcagac 300atgtccgaga actccttcta tctgaaattg gactctgtga
ccgcagcaga cacggccgtc 360tattattgtg cggcaggaca cctcgttatg
ggatttgggg cccactgggg acagggaaaa 420ctggtctccg tctctccagc
ttccaccaag ggcccatccg tcttccccct ggcgccctgc 480tccaggagca
cctccgagag cacagccgcc ctgggctgcc tggtcaagga ctacttcccc
540gaaccggtga cggtgtcgtg gaactcaggc gccctgacca gcggcgtgca
caccttcccg 600gctgtcctac agtcctcagg actctactcc ctcagcagcg
tggtgaccgt gccctccagc 660agcttgggca cgaagaccta cacctgcaac
gtagatcaca agcccagcaa caccaaggtg 720gacaagagag ttgagtccaa
atatggtccc ccatgcccac cctgcccagc acctgagttc 780gaagggggac
catcagtctt cctgttcccc ccaaaaccca aggacactct catgatctcc
840cggacccctg
aggtcacgtg cgtggtggtg gacgtgagcc aggaagaccc cgaggtccag
900ttcaactggt acgtggatgg cgtggaggtg cataatgcca agacaaagcc
gcgggaggag 960cagttcaaca gcacgtaccg tgtggtcagc gtcctcaccg
tcctgcacca ggactggctg 1020aacggcaagg agtacaagtg caaggtctcc
aacaaaggcc tcccgtcctc catcgagaaa 1080accatctcca aagccaaagg
gcagccccga gagccacagg tgtacaccct gcccccatcc 1140caggaggaga
tgaccaagaa ccaggtcagc ctgacctgcc tggtcaaagg cttctacccc
1200agcgacatcg ccgtggagtg ggagagcaat gggcagccgg agaacaacta
caagaccacg 1260cctcccgtgc tggactccga cggctccttc ttcctctaca
gcaggctaac cgtggacaag 1320agcaggtggc aggaggggaa tgtcttctca
tgctccgtga tgcatgaggc tctgcacaac 1380cactacacac agaagagcct
ctccctgtct ctgggtaaag ctagcaattc tcctcaaaat 1440gaagtactgt
acggagatgt gaatgatgac ggaaaagtaa actccactga cttgactttg
1500ttaaaaagat atgttcttaa agccgtctca actctccctt cttccaaagc
tgaaaagaac 1560gcagatgtaa atcgtgacgg aagagttaat tccagtgatg
tcacaatact ttcaagatat 1620ttgataaggg taatcgagaa attaccaata taa
16533524PRTArtificial SequenceSynthetic peptide. 3Arg Leu Gln Leu
Gln Glu Ser Gly Pro Gly Leu Leu Lys Pro Ser Val1 5 10 15Thr Leu Ser
Leu Thr Cys Thr Val Ser Gly Asp Ser Val Ala Ser Ser 20 25 30Ser Tyr
Tyr Trp Gly Trp Val Arg Gln Pro Pro Gly Lys Gly Leu Glu 35 40 45Trp
Ile Gly Thr Ile Asn Phe Ser Gly Asn Met Tyr Tyr Ser Pro Ser 50 55
60Leu Arg Ser Arg Val Thr Met Ser Ala Asp Met Ser Glu Asn Ser Phe65
70 75 80Tyr Leu Lys Leu Asp Ser Val Thr Ala Ala Asp Thr Ala Val Tyr
Tyr 85 90 95Cys Ala Ala Gly His Leu Val Met Gly Phe Gly Ala His Trp
Gly Gln 100 105 110Gly Lys Leu Val Ser Val Ser Pro Ala Ser Thr Lys
Gly Pro Ser Val 115 120 125Phe Pro Leu Ala Pro Cys Ser Arg Ser Thr
Ser Glu Ser Thr Ala Ala 130 135 140Leu Gly Cys Leu Val Lys Asp Tyr
Phe Pro Glu Pro Val Thr Val Ser145 150 155 160Trp Asn Ser Gly Ala
Leu Thr Ser Gly Val His Thr Phe Pro Ala Val 165 170 175Leu Gln Ser
Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro 180 185 190Ser
Ser Ser Leu Gly Thr Lys Thr Tyr Thr Cys Asn Val Asp His Lys 195 200
205Pro Ser Asn Thr Lys Val Asp Lys Arg Val Glu Ser Lys Tyr Gly Pro
210 215 220Pro Cys Pro Pro Cys Pro Ala Pro Glu Phe Glu Gly Gly Pro
Ser Val225 230 235 240Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu
Met Ile Ser Arg Thr 245 250 255Pro Glu Val Thr Cys Val Val Val Asp
Val Ser Gln Glu Asp Pro Glu 260 265 270Val Gln Phe Asn Trp Tyr Val
Asp Gly Val Glu Val His Asn Ala Lys 275 280 285Thr Lys Pro Arg Glu
Glu Gln Phe Asn Ser Thr Tyr Arg Val Val Ser 290 295 300Val Leu Thr
Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys305 310 315
320Cys Lys Val Ser Asn Lys Gly Leu Pro Ser Ser Ile Glu Lys Thr Ile
325 330 335Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
Leu Pro 340 345 350Pro Ser Gln Glu Glu Met Thr Lys Asn Gln Val Ser
Leu Thr Cys Leu 355 360 365Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
Val Glu Trp Glu Ser Asn 370 375 380Gly Gln Pro Glu Asn Asn Tyr Lys
Thr Thr Pro Pro Val Leu Asp Ser385 390 395 400Asp Gly Ser Phe Phe
Leu Tyr Ser Arg Leu Thr Val Asp Lys Ser Arg 405 410 415Trp Gln Glu
Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu 420 425 430His
Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Leu Gly Lys Ala 435 440
445Ser Asn Ser Pro Gln Asn Glu Val Leu Tyr Gly Asp Val Asn Asp Asp
450 455 460Gly Lys Val Asn Ser Thr Asp Leu Thr Leu Leu Lys Arg Tyr
Val Leu465 470 475 480Lys Ala Val Ser Thr Leu Pro Ser Ser Lys Ala
Glu Lys Asn Ala Asp 485 490 495Val Asn Arg Asp Gly Arg Val Asn Ser
Ser Asp Val Thr Ile Leu Ser 500 505 510Arg Tyr Leu Ile Arg Val Ile
Glu Lys Leu Pro Ile 515 52041635DNAArtificial SequenceSynthetic
oligonucleotide. 4atgaaatgca gctgggtcat cttcttcctg atggcagtgg
ttacaggggt caattcagag 60gttcagctgc agcagtctgg ggctgagctt gtgaggccag
gggccttagt caagttgtcc 120tgcaaagctt ctggcttcaa cattaatgac
tactatatcc actgggtgaa gcagcggcct 180gaacagggcc tggagcggat
tggatggatt gatcctgaca atggtaatac tatatatgac 240ccgaagttcc
agggcaaggc cagtataaca gcagacacat cccccaacac agcctacctg
300cagctcagca gcctgacatc tgaggacact gccgtctatt actgtgctag
aacccgatct 360cctatggtta cgacggggtt tgtttactgg ggccaaggga
ctgtggtcac tgtctctgca 420gccaaaacga agggcccatc cgtcttcccc
ctggcgccct gctccaggag cacctccgag 480agcacagccg ccctgggctg
cctggtcaag gactacttcc ccgaaccggt gacggtgtcg 540tggaactcag
gcgccctgac cagcggcgtg cacaccttcc cggctgtcct acagtcctca
600ggactctact ccctcagcag cgtggtgacc gtgccctcca gcagcttggg
cacgaagacc 660tacacctgca acgtagatca caagcccagc aacaccaagg
tggacaagag agttgagtcc 720aaatatggtc ccccatgccc accctgccca
gcacctgagt tcgaaggggg accatcagtc 780ttcctgttcc ccccaaaacc
caaggacact ctcatgatct cccggacccc tgaggtcacg 840tgcgtggtgg
tggacgtgag ccaggaagac cccgaggtcc agttcaactg gtacgtggat
900ggcgtggagg tgcataatgc caagacraag ccgcgggagg agcagttcaa
cagcacgtac 960cgtgtggtca gcgtcctcac cgtcctgcac caggactggc
tgaacggcaa ggagtacaag 1020tgcaaggtct ccaacaaagg cctcccgtcc
tccatcgaga aaaccatctc caaagccaaa 1080gggcagcccc gagagccaca
ggtgtacacc ctgcccccat cccaggagga gatgaccaag 1140aaccaggtca
gcctgacctg cctggtcaaa ggcttctacc ccagcgacat cgccgtggag
1200tgggagagca atgggcagcc ggagaacaac tacaagacca cgcctcccgt
gctggactcc 1260gacggctcct tcttcctcta cagcaggcta accgtggaca
agagcaggtg gcaggagggg 1320aatgtcttct catgctccgt gatgcatgag
gctctgcaca accactacac acagaagagc 1380ctctccctgt ctctgggtaa
agctagcaat tctcctcaaa atgaagtact gtacggagat 1440gtgaatgatg
acggaaaagt aaactccact gacttgactt tgttaaaaag atatgttctt
1500aaagccgtct caactctccc ttcttccaaa gctgaaaaga acgcagatgt
aaatcgtgac 1560ggaagagtta attccagtga tgtcacaata ctttcaagat
atttgataag ggtaatcgag 1620aaattaccaa tataa 16355525PRTArtificial
SequenceSynthetic peptide. 5Glu Val Gln Leu Gln Gln Ser Gly Ala Glu
Leu Val Arg Pro Gly Ala1 5 10 15Leu Val Lys Leu Ser Cys Lys Ala Ser
Gly Phe Asn Ile Asn Asp Tyr 20 25 30Tyr Ile His Trp Val Lys Gln Arg
Pro Glu Gln Gly Leu Glu Arg Ile 35 40 45Gly Trp Ile Asp Pro Asp Asn
Gly Asn Thr Ile Tyr Asp Pro Lys Phe 50 55 60Gln Gly Lys Ala Ser Ile
Thr Ala Asp Thr Ser Pro Asn Thr Ala Tyr65 70 75 80Leu Gln Leu Ser
Ser Leu Thr Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Thr
Arg Ser Pro Met Val Thr Thr Gly Phe Val Tyr Trp Gly 100 105 110Gln
Gly Thr Val Val Thr Val Ser Ala Ala Lys Thr Lys Gly Pro Ser 115 120
125Val Phe Pro Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser Thr Ala
130 135 140Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val
Thr Val145 150 155 160Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val
His Thr Phe Pro Ala 165 170 175Val Leu Gln Ser Ser Gly Leu Tyr Ser
Leu Ser Ser Val Val Thr Val 180 185 190Pro Ser Ser Ser Leu Gly Thr
Lys Thr Tyr Thr Cys Asn Val Asp His 195 200 205Lys Pro Ser Asn Thr
Lys Val Asp Lys Arg Val Glu Ser Lys Tyr Gly 210 215 220Pro Pro Cys
Pro Pro Cys Pro Ala Pro Glu Phe Glu Gly Gly Pro Ser225 230 235
240Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg
245 250 255Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser Gln Glu
Asp Pro 260 265 270Glu Val Gln Phe Asn Trp Tyr Val Asp Gly Val Glu
Val His Asn Ala 275 280 285Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn
Ser Thr Tyr Arg Val Val 290 295 300Ser Val Leu Thr Val Leu His Gln
Asp Trp Leu Asn Gly Lys Glu Tyr305 310 315 320Lys Cys Lys Val Ser
Asn Lys Gly Leu Pro Ser Ser Ile Glu Lys Thr 325 330 335Ile Ser Lys
Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 340 345 350Pro
Pro Ser Gln Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys 355 360
365Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser
370 375 380Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val
Leu Asp385 390 395 400Ser Asp Gly Ser Phe Phe Leu Tyr Ser Arg Leu
Thr Val Asp Lys Ser 405 410 415Arg Trp Gln Glu Gly Asn Val Phe Ser
Cys Ser Val Met His Glu Ala 420 425 430Leu His Asn His Tyr Thr Gln
Lys Ser Leu Ser Leu Ser Leu Gly Lys 435 440 445Ala Ser Asn Ser Pro
Gln Asn Glu Val Leu Tyr Gly Asp Val Asn Asp 450 455 460Asp Gly Lys
Val Asn Ser Thr Asp Leu Thr Leu Leu Lys Arg Tyr Val465 470 475
480Leu Lys Ala Val Ser Thr Leu Pro Ser Ser Lys Ala Glu Lys Asn Ala
485 490 495Asp Val Asn Arg Asp Gly Arg Val Asn Ser Ser Asp Val Thr
Ile Leu 500 505 510Ser Arg Tyr Leu Ile Arg Val Ile Glu Lys Leu Pro
Ile 515 520 52561638DNAArtificial SequenceSynthetic
oligonucleotide. 6atggacccca aaggctccct ttcctggaga atacttctgt
ttctctccct ggcttttgag 60ttgtcgtacg gagatgtgca gcttcaggag tcaggacctg
acctggtgaa accttctcag 120tcactttcac tcacctgcac tgtcactggc
tactccatca ccagtggtta tagctggcac 180tggatccggc agtttccagg
aaacaaactg gaatggatgg gctacatact cttcagtggt 240agcactaact
acaacccatc tctgaaaagt cgaatctcta tcactcgaga cacatccaag
300aaccagttct tcctgcagtt gaattctgtg actactgagg acacagccac
atatttctgt 360gcaagatcta actatggttc ctttgcttcc tggggccaag
ggactctggt cactgtctct 420gcagccaaaa caaagggccc atccgtcttc
cccctggcgc cctgctccag gagcacctcc 480gagagcacag ccgccctggg
ctgcctggtc aaggactact tccccgaacc ggtgacggtg 540tcgtggaact
caggcgccct gaccagcggc gtgcacacct tcccggctgt cctacagtcc
600tcaggactct actccctcag cagcgtggtg accgtgccct ccagcagctt
gggcacgaag 660acctacacct gcaacgtaga tcacaagccc agcaacacca
aggtggacaa gagagttgag 720tccaaatatg gtcccccatg cccaccctgc
ccagcacctg agttcgaagg gggaccatca 780gtcttcctgt tccccccaaa
acccaaggac actctcatga tctcccggac ccctgaggtc 840acgtgcgtgg
tggtggacgt gagccaggaa gaccccgagg tccagttcaa ctggtacgtg
900gatggcgtgg aggtgcataa tgccaagaca aagccgcggg aggagcagtt
caacagcacg 960taccgtgtgg tcagcgtcct caccgtcctg caccaggact
ggctgaacgg caaggagtac 1020aagtgcaagg tctccaacaa aggcctcccg
tcctccatcg agaaaaccat ctccaaagcc 1080aaagggcagc cccgagagcc
acaggtgtac accctgcccc catcccagga ggagatgacc 1140aagaaccagg
tcagcctgac ctgcctggtc aaaggcttct accccagcga catcgccgtg
1200gagtgggaga gcaatgggca gccggagaac aactacaaga ccacgcctcc
cgtgctggac 1260tccgacggct ccttcttcct ctacagcagg ctaaccgtgg
acaagagcag gtggcaggag 1320gggaatgtct tctcatgctc cgtgatgcat
gaggctctgc acaaccacta cacacagaag 1380agcctctccc tgtctctggg
taaagctagc aattctcctc aaaatgaagt actgtacgga 1440gatgtgaatg
atgacggaaa agtaaactcc actgacttga ctttgttaaa aagatatgtt
1500cttaaagccg tctcaactct cccttcttcc aaagctgaaa agaacgcaga
tgtaaatcgt 1560gacggaagag ttaattccag tgatgtcaca atactttcaa
gatatttgat aagggtaatc 1620gagaaattac caatataa 16387521PRTArtificial
SequenceSynthetic peptide. 7Asp Val Gln Leu Gln Glu Ser Gly Pro Asp
Leu Val Lys Pro Ser Gln1 5 10 15Ser Leu Ser Leu Thr Cys Thr Val Thr
Gly Tyr Ser Ile Thr Ser Gly 20 25 30Tyr Ser Trp His Trp Ile Arg Gln
Phe Pro Gly Asn Lys Leu Glu Trp 35 40 45Met Gly Tyr Ile Leu Phe Ser
Gly Ser Thr Asn Tyr Asn Pro Ser Leu 50 55 60Lys Ser Arg Ile Ser Ile
Thr Arg Asp Thr Ser Lys Asn Gln Phe Phe65 70 75 80Leu Gln Leu Asn
Ser Val Thr Thr Glu Asp Thr Ala Thr Tyr Phe Cys 85 90 95Ala Arg Ser
Asn Tyr Gly Ser Phe Ala Ser Trp Gly Gln Gly Thr Leu 100 105 110Val
Thr Val Ser Ala Ala Lys Thr Lys Gly Pro Ser Val Phe Pro Leu 115 120
125Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser Thr Ala Ala Leu Gly Cys
130 135 140Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp
Asn Ser145 150 155 160Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro
Ala Val Leu Gln Ser 165 170 175Ser Gly Leu Tyr Ser Leu Ser Ser Val
Val Thr Val Pro Ser Ser Ser 180 185 190Leu Gly Thr Lys Thr Tyr Thr
Cys Asn Val Asp His Lys Pro Ser Asn 195 200 205Thr Lys Val Asp Lys
Arg Val Glu Ser Lys Tyr Gly Pro Pro Cys Pro 210 215 220Pro Cys Pro
Ala Pro Glu Phe Glu Gly Gly Pro Ser Val Phe Leu Phe225 230 235
240Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val
245 250 255Thr Cys Val Val Val Asp Val Ser Gln Glu Asp Pro Glu Val
Gln Phe 260 265 270Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala
Lys Thr Lys Pro 275 280 285Arg Glu Glu Gln Phe Asn Ser Thr Tyr Arg
Val Val Ser Val Leu Thr 290 295 300Val Leu His Gln Asp Trp Leu Asn
Gly Lys Glu Tyr Lys Cys Lys Val305 310 315 320Ser Asn Lys Gly Leu
Pro Ser Ser Ile Glu Lys Thr Ile Ser Lys Ala 325 330 335Lys Gly Gln
Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Gln 340 345 350Glu
Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly 355 360
365Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro
370 375 380Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp
Gly Ser385 390 395 400Phe Phe Leu Tyr Ser Arg Leu Thr Val Asp Lys
Ser Arg Trp Gln Glu 405 410 415Gly Asn Val Phe Ser Cys Ser Val Met
His Glu Ala Leu His Asn His 420 425 430Tyr Thr Gln Lys Ser Leu Ser
Leu Ser Leu Gly Lys Ala Ser Asn Ser 435 440 445Pro Gln Asn Glu Val
Leu Tyr Gly Asp Val Asn Asp Asp Gly Lys Val 450 455 460Asn Ser Thr
Asp Leu Thr Leu Leu Lys Arg Tyr Val Leu Lys Ala Val465 470 475
480Ser Thr Leu Pro Ser Ser Lys Ala Glu Lys Asn Ala Asp Val Asn Arg
485 490 495Asp Gly Arg Val Asn Ser Ser Asp Val Thr Ile Leu Ser Arg
Tyr Leu 500 505 510Ile Arg Val Ile Glu Lys Leu Pro Ile 515
52081623DNAArtificial SequenceSynthetic oligonucleotide.
8atggaaaggc actggatctt tctcttcctg ttttcagtaa ctgcaggtgt ccactcccag
60gtccagcttc agcagtctgg ggctgagctg gcaaaacctg gggcctcagt gaagatgtcc
120tgcaaggctt ctggctacac ctttactacc tactggatgc actgggtaaa
acagaggcct 180ggacagggtc tggaatggat tggatacatt aatcctatca
ctggttatac tgagtacaat 240cagaagttca aggacaaggc caccttgact
gcagacaaat cctccagcac agcctacatg 300caactgagca gcctgacatc
tgaggactct gcagtctatt actgtgcaag agagggttta 360agtgctatgg
actattgggg tcagggaacc tcagtcaccg tcacctcagc caaaacaacg
420ggcccatccg tcttccccct ggcgccctgc tccaggagca cctccgagag
cacagccgcc 480ctgggctgcc tggtcaagga ctacttcccc gaaccggtga
cggtgtcgtg gaactcaggc 540gccctgacca gcggcgtgca caccttcccg
gctgtcctac agtcctcagg actctactcc 600ctcagcagcg tggtgaccgt
gccctccagc agcttgggca cgaagaccta cacctgcaac 660gtagatcaca
agcccagcaa caccaaggtg gacaagagag ttgagtccaa atatggtccc
720ccatgcccac cctgcccagc acctgagttc gaagggggac catcagtctt
cctgttcccc 780ccaaaaccca aggacactct catgatctcc cggacccctg
aggtcacgtg cgtggtggtg 840gacgtgagcc aggaagaccc cgaggtccag
ttcaactggt acgtggatgg cgtggaggtg 900cataatgcca agacaaagcc
gcgggaggag cagttcaaca gcacgtaccg tgtggtcagc 960gtcctcaccg
tcctgcacca ggactggctg aacggcaagg agtacaagtg caaggtctcc
1020aacaaaggcc
tcccgtcctc catcgagaaa accatctcca aagccaaagg gcagccccga
1080gagccacagg tgtacaccct gcccccatcc caggaggaga tgaccaagaa
ccaggtcagc 1140ctgacctgcc tggtcaaagg cttctacccc agcgacatcg
ccgtggagtg ggagagcaat 1200gggcagccgg agaacaacta caagaccacg
cctcccgtgc tggactccga cggctccttc 1260ttcctctaca gcaggctaac
cgtggacaag agcaggtggc aggaggggaa tgtcttctca 1320tgctccgtga
tgcatgaggc tctgcacaac cactacacac agaagagcct ctccctgtct
1380ctgggtaaag ctagcaattc tcctcaaaat gaagtactgt acggagatgt
gaatgatgac 1440ggaaaagtaa actccactga cttgactttg ttaaaaagat
atgttcttaa agccgtctca 1500actctccctt cttccaaagc tgaaaagaac
gcagatgtaa atcgtgacgg aagagttaat 1560tccagtgatg tcacaatact
ttcaagatat ttgataaggg taatcgagaa attaccaata 1620taa
16239521PRTArtificial SequenceSynthetic peptide. 9Gln Val Gln Leu
Gln Gln Ser Gly Ala Glu Leu Ala Lys Pro Gly Ala1 5 10 15Ser Val Lys
Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Thr Tyr 20 25 30Trp Met
His Trp Val Lys Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45Gly
Tyr Ile Asn Pro Ile Thr Gly Tyr Thr Glu Tyr Asn Gln Lys Phe 50 55
60Lys Asp Lys Ala Thr Leu Thr Ala Asp Lys Ser Ser Ser Thr Ala Tyr65
70 75 80Met Gln Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr
Cys 85 90 95Ala Arg Glu Gly Leu Ser Ala Met Asp Tyr Trp Gly Gln Gly
Thr Ser 100 105 110Val Thr Val Thr Ser Ala Lys Thr Thr Gly Pro Ser
Val Phe Pro Leu 115 120 125Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser
Thr Ala Ala Leu Gly Cys 130 135 140Leu Val Lys Asp Tyr Phe Pro Glu
Pro Val Thr Val Ser Trp Asn Ser145 150 155 160Gly Ala Leu Thr Ser
Gly Val His Thr Phe Pro Ala Val Leu Gln Ser 165 170 175Ser Gly Leu
Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser 180 185 190Leu
Gly Thr Lys Thr Tyr Thr Cys Asn Val Asp His Lys Pro Ser Asn 195 200
205Thr Lys Val Asp Lys Arg Val Glu Ser Lys Tyr Gly Pro Pro Cys Pro
210 215 220Pro Cys Pro Ala Pro Glu Phe Glu Gly Gly Pro Ser Val Phe
Leu Phe225 230 235 240Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser
Arg Thr Pro Glu Val 245 250 255Thr Cys Val Val Val Asp Val Ser Gln
Glu Asp Pro Glu Val Gln Phe 260 265 270Asn Trp Tyr Val Asp Gly Val
Glu Val His Asn Ala Lys Thr Lys Pro 275 280 285Arg Glu Glu Gln Phe
Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr 290 295 300Val Leu His
Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val305 310 315
320Ser Asn Lys Gly Leu Pro Ser Ser Ile Glu Lys Thr Ile Ser Lys Ala
325 330 335Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro
Ser Gln 340 345 350Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys
Leu Val Lys Gly 355 360 365Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp
Glu Ser Asn Gly Gln Pro 370 375 380Glu Asn Asn Tyr Lys Thr Thr Pro
Pro Val Leu Asp Ser Asp Gly Ser385 390 395 400Phe Phe Leu Tyr Ser
Arg Leu Thr Val Asp Lys Ser Arg Trp Gln Glu 405 410 415Gly Asn Val
Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His 420 425 430Tyr
Thr Gln Lys Ser Leu Ser Leu Ser Leu Gly Lys Ala Ser Asn Ser 435 440
445Pro Gln Asn Glu Val Leu Tyr Gly Asp Val Asn Asp Asp Gly Lys Val
450 455 460Asn Ser Thr Asp Leu Thr Leu Leu Lys Arg Tyr Val Leu Lys
Ala Val465 470 475 480Ser Thr Leu Pro Ser Ser Lys Ala Glu Lys Asn
Ala Asp Val Asn Arg 485 490 495Asp Gly Arg Val Asn Ser Ser Asp Val
Thr Ile Leu Ser Arg Tyr Leu 500 505 510Ile Arg Val Ile Glu Lys Leu
Pro Ile 515 52010732DNAArtificial SequenceSynthetic
oligonucleotide. 10atgcatcgca ccagcatggg catcaagatg gagtcacaga
ttcaggcatt tgtattcgtg 60tttctctggt tgtctggtgt tggcggagac attgtgatga
cccagtctca caaattcatg 120tccacatcag taggagacag ggtcagcgtc
acctgcaagg ccagtcagga tgtgacttct 180gctgtagcct ggtatcaaca
aaaaccaggg caatctccta aactactgat ttactgggca 240tccacccggc
acactggagt ccctgatcgc ttcacaggca gtggatctgg gacagattat
300actctcacca tcagcagtgg gcaggctgaa gacctggcac tttattactg
tcaccaatat 360tatagcgctc ctcggacgtt cggtggaggc accaagctcg
agatcaaacg aactgtggct 420gcaccatctg tcttcatctt cccgccatct
gatgagcagt tgaaatctgg aactgcctct 480gttgtgtgcc tgctgaataa
cttctatccc agagaggcca aagtacagtg gaaggtggat 540aacgccctcc
aatcgggtaa ctcccaggag agtgtcacag agcaggacag caaggacagc
600acctacagcc tcagcagcac cctgacgctg agcaaagcag actacgagaa
acacaaagtc 660tatgcctgcg aagtcaccca tcagggcctg agctcgcccg
tcacaaagag cttcaacagg 720ggagagtgtt ag 73211214PRTArtificial
SequenceSynthetic peptide. 11Asp Ile Val Met Thr Gln Ser His Lys
Phe Met Ser Thr Ser Val Gly1 5 10 15Asp Arg Val Ser Val Thr Cys Lys
Ala Ser Gln Asp Val Thr Ser Ala 20 25 30Val Ala Trp Tyr Gln Gln Lys
Pro Gly Gln Ser Pro Lys Leu Leu Ile 35 40 45Tyr Trp Ala Ser Thr Arg
His Thr Gly Val Pro Asp Arg Phe Thr Gly 50 55 60Ser Gly Ser Gly Thr
Asp Tyr Thr Leu Thr Ile Ser Ser Gly Gln Ala65 70 75 80Glu Asp Leu
Ala Leu Tyr Tyr Cys His Gln Tyr Tyr Ser Ala Pro Arg 85 90 95Thr Phe
Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala Ala 100 105
110Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly
115 120 125Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg
Glu Ala 130 135 140Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser
Gly Asn Ser Gln145 150 155 160Glu Ser Val Thr Glu Gln Asp Ser Lys
Asp Ser Thr Tyr Ser Leu Ser 165 170 175Ser Thr Leu Thr Leu Ser Lys
Ala Asp Tyr Glu Lys His Lys Val Tyr 180 185 190Ala Cys Glu Val Thr
His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser 195 200 205Phe Asn Arg
Gly Glu Cys 210121644DNAArtificial SequenceSynthetic
oligonucleotide. 12atgggatggt catgtatcat cctttttcta gtagcaactg
caactggagt acattcacag 60gtccaactgc agcagcctgg ggctgagctg gtgaggcctg
ggacttcagt gaagttgtcc 120tgcaaggctt ctggttacat ctttaccagc
tactggatgc actgggtaaa gcagaggcct 180ggacaaggcc ttgagtggat
cggactgatt gatccttctg atagttatag taagtacaat 240caaaagttca
agggcaaggc cacattgact gtagacacat cctccagcac agcctacatg
300cagctcagca gcctgacatc tgaggactct gcggtctatt actgtgcaag
aggggagctc 360agtgacttct ggggccaagg caccactctc acagtctcct
cagccaaaac aacaccccca 420tcagtctatc cactggcccc tgggtgtgga
gatacaactg gttcctctgt gactctggga 480tgcctggtca agggctactt
ccctgagtca gtgactgtga cttggaactc tggatccctg 540tccagcagtg
tgcacacctt cccagctctc ctgcagtctg gactctacac tatgagcagc
600tcagtgactg tcccctccag cacctggcca agtcagaccg tcacctgcag
cgttgctcac 660ccagccagca gcaccacggt ggacaaaaaa cttgagccca
gcgggcccat ttcaacaatc 720aacccctgtc ctccatgcaa ggagtgtcac
aaatgcccag ctcctaacct cgagggtgga 780ccatccgtct tcatcttccc
tccaaatatc aaggatgtac tcatgatctc cctgacaccc 840aaggtcacgt
gtgtggtggt ggatgtgagc gaggatgacc cagacgtccg gatcagctgg
900tttgtgaaca acgtggaagt acacacagct cagacacaaa cccatagaga
ggattacaac 960agtactatcc gggtggtcag tgccctcccc atccagcacc
aggactggat gagtggcaag 1020gagttcaaat gcaaggtcaa caacaaagac
ctcccatcac ccatcgagag aaccatctca 1080aaaattaaag ggctagtcag
agctccacaa gtatacatct tgccgccacc agcagagcag 1140ttgtccagga
aagatgtcag tctcacttgc ctggtcgtgg gcttcaaccc tggagacatc
1200agtgtggagt ggaccagcaa tgggcataca gaggagaact acaaggacac
cgcaccagtc 1260ctggactctg acggttctta cttcatatac agcaagctcg
atataaaaac aagcaagtgg 1320gagaaaacag attccttctc atgcaacgtg
agacacgagg gtctgaaaaa ttactacctg 1380aagaagacca tctcccggtc
tccgggtaaa gctagcaatt ctcctcaaaa tgaagtactg 1440tacggagatg
tgaatgatga cggaaaagta aactccactg acttgacttt gttaaaaaga
1500tatgttctta aagccgtctc aactctgcct tcttccaaag ctgaaaagaa
cgcagatgta 1560aatcgtgacg gaagagttaa ttccagtgat gtcacaatac
tttcaagata tttgataagg 1620gtaatcgaga aattaccaat ataa
164413528PRTArtificial SequenceSynthetic peptide. 13Gln Val Gln Leu
Gln Gln Pro Gly Ala Glu Leu Val Arg Pro Gly Thr1 5 10 15Ser Val Lys
Leu Ser Cys Lys Ala Ser Gly Tyr Ile Phe Thr Ser Tyr 20 25 30Trp Met
His Trp Val Lys Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45Gly
Leu Ile Asp Pro Ser Asp Ser Tyr Ser Lys Tyr Asn Gln Lys Phe 50 55
60Lys Gly Lys Ala Thr Leu Thr Val Asp Thr Ser Ser Ser Thr Ala Tyr65
70 75 80Met Gln Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr
Cys 85 90 95Ala Arg Gly Glu Leu Ser Asp Phe Trp Gly Gln Gly Thr Thr
Leu Thr 100 105 110Val Ser Ser Ala Lys Thr Thr Pro Pro Ser Val Tyr
Pro Leu Ala Pro 115 120 125Gly Cys Gly Asp Thr Thr Gly Ser Ser Val
Thr Leu Gly Cys Leu Val 130 135 140Lys Gly Tyr Phe Pro Glu Ser Val
Thr Val Thr Trp Asn Ser Gly Ser145 150 155 160Leu Ser Ser Ser Val
His Thr Phe Pro Ala Leu Leu Gln Ser Gly Leu 165 170 175Tyr Thr Met
Ser Ser Ser Val Thr Val Pro Ser Ser Thr Trp Pro Ser 180 185 190Gln
Thr Val Thr Cys Ser Val Ala His Pro Ala Ser Ser Thr Thr Val 195 200
205Asp Lys Lys Leu Glu Pro Ser Gly Pro Ile Ser Thr Ile Asn Pro Cys
210 215 220Pro Pro Cys Lys Glu Cys His Lys Cys Pro Ala Pro Asn Leu
Glu Gly225 230 235 240Gly Pro Ser Val Phe Ile Phe Pro Pro Asn Ile
Lys Asp Val Leu Met 245 250 255Ile Ser Leu Thr Pro Lys Val Thr Cys
Val Val Val Asp Val Ser Glu 260 265 270Asp Asp Pro Asp Val Arg Ile
Ser Trp Phe Val Asn Asn Val Glu Val 275 280 285His Thr Ala Gln Thr
Gln Thr His Arg Glu Asp Tyr Asn Ser Thr Ile 290 295 300Arg Val Val
Ser Ala Leu Pro Ile Gln His Gln Asp Trp Met Ser Gly305 310 315
320Lys Glu Phe Lys Cys Lys Val Asn Asn Lys Asp Leu Pro Ser Pro Ile
325 330 335Glu Arg Thr Ile Ser Lys Ile Lys Gly Leu Val Arg Ala Pro
Gln Val 340 345 350Tyr Ile Leu Pro Pro Pro Ala Glu Gln Leu Ser Arg
Lys Asp Val Ser 355 360 365Leu Thr Cys Leu Val Val Gly Phe Asn Pro
Gly Asp Ile Ser Val Glu 370 375 380Trp Thr Ser Asn Gly His Thr Glu
Glu Asn Tyr Lys Asp Thr Ala Pro385 390 395 400Val Leu Asp Ser Asp
Gly Ser Tyr Phe Ile Tyr Ser Lys Leu Asp Ile 405 410 415Lys Thr Ser
Lys Trp Glu Lys Thr Asp Ser Phe Ser Cys Asn Val Arg 420 425 430His
Glu Gly Leu Lys Asn Tyr Tyr Leu Lys Lys Thr Ile Ser Arg Ser 435 440
445Pro Gly Lys Ala Ser Asn Ser Pro Gln Asn Glu Val Leu Tyr Gly Asp
450 455 460Val Asn Asp Asp Gly Lys Val Asn Ser Thr Asp Leu Thr Leu
Leu Lys465 470 475 480Arg Tyr Val Leu Lys Ala Val Ser Thr Leu Pro
Ser Ser Lys Ala Glu 485 490 495Lys Asn Ala Asp Val Asn Arg Asp Gly
Arg Val Asn Ser Ser Asp Val 500 505 510Thr Ile Leu Ser Arg Tyr Leu
Ile Arg Val Ile Glu Lys Leu Pro Ile 515 520 525142061DNAArtificial
SequenceSynthetic oligonucleotide. 14atggatccca aaggatccct
ttcctggaga atacttctgt ttctctccct ggcttttgag 60ttgagctacg gactcgacga
tctggatgca gtaaggatta aagtggacac agtaaatgca 120aaaccgggag
acacagtaag aatacctgta agattcagcg gtataccatc caagggaata
180gcaaactgtg actttgtata cagctatgac ccgaatgtac ttgagataat
agagatagaa 240ccgggagaca taatagttga cccgaatcct gacaagagct
ttgatactgc agtatatcct 300gacagaaaga taatagtatt cctgtttgca
gaagacagcg gaacaggagc gtatgcaata 360actaaagacg gagtatttgc
tacgatagta gcgaaagtaa aagaaggagc acctaacgga 420ctcagtgtaa
tcaaatttgt agaagtaggc ggatttgcga acaatgacct tgtagaacag
480aagacacagt tctttgacgg tggagtaaat gttggagata caacagaacc
tgcaacacct 540acaacacctg taacaacacc gacaacaaca gatgatctgg
atgcactcga gatcatccca 600gttgaggagg agaacccgga cttctggaac
cgcgaggcag ccgaggccct gggtgccgcc 660aagaagctgc agcctgcaca
gacagccgcc aagaacctca tcatcttcct gggcgatggg 720atgggggtgt
ctacggtgac agctgccagg atcctaaaag ggcagaagaa ggacaaactg
780gggcctgagt tacccctggc catggaccgc ttcccatatg tggctctgtc
caagacatac 840aatgtagaca aacatgtgcc agacagtgga gccacagcca
cggcctacct gtgcggggtc 900aagggcaact tccagaccat tggcttgagt
gcagccgccc gctttaacca gtgcaacacg 960acacgcggca acgaggtcat
ctccgtgatg aatcgggcca agaaagcagg gaagtcagtg 1020ggagtggtaa
ccaccacacg agtgcagcac gcctcgccag ccggcaccta cgcccacacg
1080gtgaaccgca actggtactc ggacgccgac gtgcctgcct cggcccgcca
ggaggggtgc 1140caggacatcg ctacgcagct catctccaac atggacattg
acgtgatcct aggtggaggc 1200cgaaagtaca tgtttcgcat gggaacccca
gaccctgagt acccagatga ctacagccaa 1260ggtgggacca ggctggacgg
gaagaatctg gtgcaggaat ggctggcgaa gcgccagggt 1320gcccggtacg
tgtggaaccg cactgagctc atgcaggctt ccctggaccc gtctgtgacc
1380catctcatgg gtctctttga gcctggagac atgaaatacg agatccaccg
agactccaca 1440ctggacccct ccctgatgga gatgacagag gctgccctgc
gcctgctgag caggaacccc 1500cgcggcttct tcctcttcgt ggagggtggt
cgcatcgacc atggtcatca tgaaagcagg 1560gcttaccggg cactgactga
gacgatcatg ttcgacgacg ccattgagag ggcgggccag 1620ctcaccagcg
aggaggacac gctgagcctc gtcactgccg accactccca cgtcttctcc
1680ttcggaggct accccctgcg agggagctcc atcttcgggc tggcccctgg
caaggcccgg 1740gacaggaagg cctacacggt cctcctatac ggaaacggtc
caggctatgt gctcaaggac 1800ggcgcccggc cggatgttac cgagagcgag
agcgggagcc ccgagtatcg gcagcagtca 1860gcagtgcccc tggacgaaga
gacccacgca ggcgaggacg tggcggtgtt cgcgcgcggc 1920ccgcaggcgc
acctggttca cggcgtgcag gagcagacct tcatagcgca cgtcatggcc
1980ttcgccgcct gcctggagcc ctacaccgcc tgcgacctgg cgccccccgc
cggcaccacc 2040caccatcacc atcaccattg a 206115662PRTArtificial
SequenceSynthetic peptide. 15Leu Asp Asp Leu Asp Ala Val Arg Ile
Lys Val Asp Thr Val Asn Ala1 5 10 15Lys Pro Gly Asp Thr Val Arg Ile
Pro Val Arg Phe Ser Gly Ile Pro 20 25 30Ser Lys Gly Ile Ala Asn Cys
Asp Phe Val Tyr Ser Tyr Asp Pro Asn 35 40 45Val Leu Glu Ile Ile Glu
Ile Glu Pro Gly Glu Leu Ile Val Asp Pro 50 55 60Asn Pro Thr Lys Ser
Phe Asp Thr Ala Val Tyr Pro Asp Arg Lys Met65 70 75 80Ile Val Phe
Leu Phe Ala Glu Asp Ser Gly Thr Gly Ala Tyr Ala Ile 85 90 95Thr Glu
Asp Gly Val Phe Ala Thr Ile Val Ala Lys Val Lys Ser Gly 100 105
110Ala Pro Asn Gly Leu Ser Val Ile Lys Phe Val Glu Val Gly Gly Phe
115 120 125Ala Asn Asn Asp Leu Val Glu Gln Lys Thr Gln Phe Phe Asp
Gly Gly 130 135 140Val Asn Val Gly Asp Thr Thr Glu Pro Ala Thr Pro
Thr Thr Pro Val145 150 155 160Thr Thr Pro Thr Thr Thr Asp Asp Leu
Asp Ala Leu Glu Ile Ile Pro 165 170 175Val Glu Glu Glu Asn Pro Asp
Phe Trp Asn Arg Glu Ala Ala Glu Ala 180 185 190Leu Gly Ala Ala Lys
Lys Leu Gln Pro Ala Gln Thr Ala Ala Lys Asn 195 200 205Leu Ile Ile
Phe Leu Gly Asp Gly Met Gly Val Ser Thr Val Thr Ala 210 215 220Ala
Arg Ile Leu Lys Gly Gln Lys Lys Asp Lys Leu Gly Pro Glu Leu225 230
235 240Pro Leu Ala Met Asp Arg Phe Pro Tyr Val Ala Leu Ser Lys Thr
Tyr 245 250 255Asn Val Asp Lys His Val Pro Asp Ser Gly Ala Thr Ala
Thr Ala Tyr 260 265 270Leu Cys Gly Val Lys Gly Asn Phe Gln Thr Ile
Gly Leu Ser Ala Ala 275 280 285Ala Arg Phe Asn Gln Cys Asn Thr Thr
Arg Gly Asn Glu Val Ile Ser 290
295 300Val Met Asn Arg Ala Lys Lys Ala Gly Lys Ser Val Gly Val Val
Thr305 310 315 320Thr Thr Arg Val Gln His Ala Ser Pro Ala Gly Thr
Tyr Ala His Thr 325 330 335Val Asn Arg Asn Trp Tyr Ser Asp Ala Asp
Val Pro Ala Ser Ala Arg 340 345 350Gln Glu Gly Cys Gln Asp Ile Ala
Thr Gln Leu Ile Ser Asn Met Asp 355 360 365Ile Asp Val Ile Leu Gly
Gly Gly Arg Lys Tyr Met Phe Arg Met Gly 370 375 380Thr Pro Asp Pro
Glu Tyr Pro Asp Asp Tyr Ser Gln Gly Gly Thr Arg385 390 395 400Leu
Asp Gly Lys Asn Leu Val Gln Glu Trp Leu Ala Lys Arg Gln Gly 405 410
415Ala Arg Tyr Val Trp Asn Arg Thr Glu Leu Met Gln Ala Ser Leu Asp
420 425 430Pro Ser Val Thr His Leu Met Gly Leu Phe Glu Pro Gly Asp
Met Lys 435 440 445Tyr Glu Ile His Arg Asp Ser Thr Leu Asp Pro Ser
Leu Met Glu Met 450 455 460Thr Glu Ala Ala Leu Arg Leu Leu Ser Arg
Asn Pro Arg Gly Phe Phe465 470 475 480Leu Phe Val Glu Gly Gly Arg
Ile Asp His Gly His His Glu Ser Arg 485 490 495Ala Tyr Arg Ala Leu
Thr Glu Thr Ile Met Phe Asp Asp Ala Ile Glu 500 505 510Arg Ala Gly
Gln Leu Thr Ser Glu Glu Asp Thr Leu Ser Leu Val Thr 515 520 525Ala
Asp His Ser His Val Phe Ser Phe Gly Gly Tyr Pro Leu Arg Gly 530 535
540Ser Ser Ile Phe Gly Leu Ala Pro Gly Lys Ala Arg Asp Arg Lys
Ala545 550 555 560Tyr Thr Val Leu Leu Tyr Gly Asn Gly Pro Gly Tyr
Val Leu Lys Asp 565 570 575Gly Ala Arg Pro Asp Val Thr Glu Ser Glu
Ser Gly Ser Pro Glu Tyr 580 585 590Arg Gln Gln Ser Ala Val Pro Leu
Asp Glu Glu Thr His Ala Gly Glu 595 600 605Asp Val Ala Val Phe Ala
Arg Gly Pro Gln Ala His Leu Val His Gly 610 615 620Val Gln Glu Gln
Thr Phe Ile Ala His Val Met Ala Phe Ala Ala Cys625 630 635 640Leu
Glu Pro Tyr Thr Ala Cys Asp Leu Ala Pro Pro Ala Gly Thr Thr 645 650
655His His His His His His 660162556DNAArtificial SequenceSynthetic
oligonucleotide. 16atggatccca aaggatccct ttcctggaga atacttctgt
ttctctccct ggcttttgag 60ttgagctacg gactcgacga tctggatgca gtaaggatta
aagtggacac agtaaatgca 120aaaccgggag acacagtaag aatacctgta
agattcagcg gtataccatc caagggaata 180gcaaactgtg actttgtata
cagctatgac ccgaatgtac ttgagataat agagataaaa 240ccgggagaat
tgatagttga cccgaatcct gacaagagct ttgatactgc agtatatcct
300gacagaaaga taatagtatt cctgtttgca gaagacagcg gaacaggagc
gtatgcaata 360actaaagacg gagtatttgc tacgatagta gcgaaagtaa
aatccggagc acctaacgga 420ctcagtgtaa tcaaatttgt agaagtaggc
ggatttgcga ataatgacct tgtagaacag 480aagacacagt tctttgacgg
tggagtaaat gttggagata caacagaacc tgcaacacct 540acaacacctg
taacaacacc gacaacaaca gatgatctgg atgcagtaag gattaaagtg
600gacacagtaa atgcaaaacc gggagacaca gtaaatatac ctgtaagatt
cagtggtata 660ccatccaagg gaatagcaaa ctgtgacttt gtatacagct
atgacccgaa tgtacttgag 720ataatagaga taaaaccggg agaattgata
gttgacccga atcctaccaa gagctttgat 780actgcagtat atcctgacag
aaagatgata gtattcctgt ttgcggaaga cagcggaaca 840ggagcgtatg
caataactaa agacggagta tttgctacga tagtagcgaa agtaaaagaa
900ggagcaccta acggactcag tgtaatcaaa tttgtagaag taggcggatt
tgcgaacaat 960gaccttgtag aacagaagac acagttcttt gacggtggag
taaatgttgg agatacaaca 1020gaacctgcaa cacctacaac acctgtaaca
acaccgacaa caacagatga tctggatgca 1080ctcgagatca tcccagttga
ggaggagaac ccggacttct ggaaccgcga ggcagccgag 1140gccctgggtg
ccgccaagaa gctgcagcct gcacagacag ccgccaagaa cctcatcatc
1200ttcctgggcg atgggatggg ggtgtctacg gtgacagctg ccaggatcct
aaaagggcag 1260aagaaggaca aactggggcc tgagttaccc ctggccatgg
accgcttccc atatgtggct 1320ctgtccaaga catacaatgt agacaaacat
gtgccagaca gtggagccac agccacggcc 1380tacctgtgcg gggtcaaggg
caacttccag accattggct tgagtgcagc cgcccgcttt 1440aaccagtgca
acacgacacg cggcaacgag gtcatctccg tgatgaatcg ggccaagaaa
1500gcagggaagt cagtgggagt ggtaaccacc acacgagtgc agcacgcctc
gccagccggc 1560acctacgccc acacggtgaa ccgcaactgg tactcggacg
ccgacgtgcc tgcctcggcc 1620cgccaggagg ggtgccagga catcgctacg
cagctcatct ccaacatgga cattgacgtg 1680atcctaggtg gaggccgaaa
gtacatgttt cgcatgggaa ccccagaccc tgagtaccca 1740gatgactaca
gccaaggtgg gaccaggctg gacgggaaga atctggtgca ggaatggctg
1800gcgaagcgcc agggtgcccg gtacgtgtgg aaccgcactg agctcatgca
ggcttccctg 1860gacccgtctg tgacccatct catgggtctc tttgagcctg
gagacatgaa atacgagatc 1920caccgagact ccacactgga cccctccctg
atggagatga cagaggctgc cctgcgcctg 1980ctgagcagga acccccgcgg
cttcttcctc ttcgtggagg gtggtcgcat cgaccatggt 2040catcatgaaa
gcagggctta ccgggcactg actgagacga tcatgttcga cgacgccatt
2100gagagggcgg gccagctcac cagcgaggag gacacgctga gcctcgtcac
tgccgaccac 2160tcccacgtct tctccttcgg aggctacccc ctgcgaggga
gctccatctt cgggctggcc 2220cctggcaagg cccgggacag gaaggcctac
acggtcctcc tatacggaaa cggtccaggc 2280tatgtgctca aggacggcgc
ccggccggat gttaccgaga gcgagagcgg gagccccgag 2340tatcggcagc
agtcagcagt gcccctggac gaagagaccc acgcaggcga ggacgtggcg
2400gtgttcgcgc gcggcccgca ggcgcacctg gttcacggcg tgcaggagca
gaccttcata 2460gcgcacgtca tggccttcgc cgcctgcctg gagccctaca
ccgcctgcga cctggcgccc 2520cccgccggca ccacccacca tcaccatcac cattga
255617826PRTArtificial SequenceSynthetic peptide. 17Leu Asp Leu Asp
Ala Val Arg Ile Lys Val Asp Thr Val Asn Ala Lys1 5 10 15Pro Gly Asp
Thr Val Arg Ile Pro Val Arg Phe Ser Gly Ile Pro Ser 20 25 30Lys Gly
Ile Ala Asn Cys Asp Phe Val Tyr Ser Tyr Asp Pro Asn Val 35 40 45Leu
Glu Ile Ile Glu Ile Lys Pro Gly Glu Leu Ile Val Asp Pro Asn 50 55
60Pro Asp Lys Ser Phe Asp Thr Ala Val Tyr Pro Asp Arg Lys Ile Ile65
70 75 80Val Phe Leu Phe Ala Glu Asp Ser Gly Thr Gly Ala Tyr Ala Ile
Thr 85 90 95Lys Asp Gly Val Phe Ala Thr Ile Val Ala Lys Val Lys Ser
Gly Ala 100 105 110Pro Asn Gly Leu Ser Val Ile Lys Phe Val Glu Val
Gly Gly Phe Ala 115 120 125Asn Asn Asp Leu Val Glu Gln Lys Thr Gln
Phe Phe Asp Gly Gly Val 130 135 140Asn Val Gly Asp Thr Thr Glu Pro
Ala Thr Pro Thr Thr Pro Val Thr145 150 155 160Thr Pro Thr Thr Thr
Asp Asp Leu Asp Ala Val Arg Ile Lys Val Asp 165 170 175Thr Val Asn
Ala Lys Pro Gly Asp Thr Val Asn Ile Pro Val Arg Phe 180 185 190Ser
Gly Ile Pro Ser Lys Gly Ile Ala Asn Cys Asp Phe Val Tyr Ser 195 200
205Tyr Asp Pro Asn Val Leu Glu Ile Ile Glu Ile Lys Pro Gly Glu Leu
210 215 220Ile Val Asp Pro Asn Pro Thr Lys Ser Phe Asp Thr Ala Val
Tyr Pro225 230 235 240Asp Arg Lys Met Ile Val Phe Leu Phe Ala Glu
Asp Ser Gly Thr Gly 245 250 255Ala Tyr Ala Ile Thr Lys Asp Gly Val
Phe Ala Thr Ile Val Ala Lys 260 265 270Val Lys Glu Gly Ala Pro Asn
Gly Leu Ser Val Ile Lys Phe Val Glu 275 280 285Val Gly Gly Phe Ala
Asn Asn Asp Leu Val Glu Gln Lys Thr Gln Phe 290 295 300Phe Asp Gly
Gly Val Asn Val Gly Asp Thr Thr Glu Pro Ala Thr Pro305 310 315
320Thr Thr Pro Val Thr Thr Pro Thr Thr Thr Asp Asp Leu Asp Ala Leu
325 330 335Glu Ile Ile Pro Val Glu Glu Glu Asn Pro Asp Phe Trp Asn
Arg Glu 340 345 350Ala Ala Glu Ala Leu Gly Ala Ala Lys Lys Leu Gln
Pro Ala Gln Thr 355 360 365Ala Ala Lys Asn Leu Ile Ile Phe Leu Gly
Asp Gly Met Gly Val Ser 370 375 380Thr Val Thr Ala Ala Arg Ile Leu
Lys Gly Gln Lys Lys Asp Lys Leu385 390 395 400Gly Pro Glu Leu Pro
Leu Ala Met Asp Arg Phe Pro Tyr Val Ala Leu 405 410 415Ser Lys Thr
Tyr Asn Val Asp Lys His Val Pro Asp Ser Gly Ala Thr 420 425 430Ala
Thr Ala Tyr Leu Cys Gly Val Lys Gly Asn Phe Gln Thr Ile Gly 435 440
445Leu Ser Ala Ala Ala Arg Phe Asn Gln Cys Asn Thr Thr Arg Gly Asn
450 455 460Glu Val Ile Ser Val Met Asn Arg Ala Lys Lys Ala Gly Lys
Ser Val465 470 475 480Gly Val Val Thr Thr Thr Arg Val Gln His Ala
Ser Pro Ala Gly Thr 485 490 495Tyr Ala His Thr Val Asn Arg Asn Trp
Tyr Ser Asp Ala Asp Val Pro 500 505 510Ala Ser Ala Arg Gln Glu Gly
Cys Gln Asp Ile Ala Thr Gln Leu Ile 515 520 525Ser Asn Met Asp Ile
Asp Val Ile Leu Gly Gly Gly Arg Lys Tyr Met 530 535 540Phe Arg Met
Gly Thr Pro Asp Pro Glu Tyr Pro Asp Asp Tyr Ser Gln545 550 555
560Gly Gly Thr Arg Leu Asp Gly Lys Asn Leu Val Gln Glu Trp Leu Ala
565 570 575Lys Arg Gln Gly Ala Arg Tyr Val Trp Asn Arg Thr Glu Leu
Met Gln 580 585 590Ala Ser Leu Asp Pro Ser Val Thr His Leu Met Gly
Leu Phe Glu Pro 595 600 605Gly Asp Met Lys Tyr Glu Ile His Arg Asp
Ser Thr Leu Asp Pro Ser 610 615 620Leu Met Glu Met Thr Glu Ala Ala
Leu Arg Leu Leu Ser Arg Asn Pro625 630 635 640Arg Gly Phe Phe Leu
Phe Val Glu Gly Gly Arg Ile Asp His Gly His 645 650 655His Glu Ser
Arg Ala Tyr Arg Ala Leu Thr Glu Thr Ile Met Phe Asp 660 665 670Asp
Ala Ile Glu Arg Ala Gly Gln Leu Thr Ser Glu Glu Asp Thr Leu 675 680
685Ser Leu Val Thr Ala Asp His Ser His Val Phe Ser Phe Gly Gly Tyr
690 695 700Pro Leu Arg Gly Ser Ser Ile Phe Gly Leu Ala Pro Gly Lys
Ala Arg705 710 715 720Asp Arg Lys Ala Tyr Thr Val Leu Leu Tyr Gly
Asn Gly Pro Gly Tyr 725 730 735Val Leu Lys Asp Gly Ala Arg Pro Asp
Val Thr Glu Ser Glu Ser Gly 740 745 750Ser Pro Glu Tyr Arg Gln Gln
Ser Ala Val Pro Leu Asp Glu Glu Thr 755 760 765His Ala Gly Glu Asp
Val Ala Val Phe Ala Arg Gly Pro Gln Ala His 770 775 780Leu Val His
Gly Val Gln Glu Gln Thr Phe Ile Ala His Val Met Ala785 790 795
800Phe Ala Ala Cys Leu Glu Pro Tyr Thr Ala Cys Asp Leu Ala Pro Pro
805 810 815Ala Gly Thr Thr His His His His His His 820
825181326DNAArtificial SequenceSynthetic oligonucleotide.
18atggatccca aaggatccct ttcctggaga atacttctgt ttctctccct ggcttttgag
60ttgagctacg gactcgacga tctggatgca gtaaggatta aagtggacac agtaaatgca
120aaaccgggag acacagtaag aatacctgta agattcagcg gtataccatc
caagggaata 180gcaaactgtg actttgtata cagctatgac ccgaatgtac
ttgagataat agagatagaa 240ccgggagaca taatagttga cccgaatcct
gacaagagct ttgatactgc agtatatcct 300gacagaaaga taatagtatt
cctgtttgca gaagacagcg gaacaggagc gtatgcaata 360actaaagacg
gagtatttgc tacgatagta gcgaaagtaa aagaaggagc acctaacgga
420ctcagtgtaa tcaaatttgt agaagtaggc ggatttgcga acaatgacct
tgtagaacag 480aagacacagt tctttgacgg tggagtaaat gttggagata
caacagaacc tgcaacacct 540acaacacctg taacaacacc gacaacaaca
gatgatctgg atgcactcga ggcgcccctc 600atcctgtctc ggattgtggg
aggctgggag tgcgagaagc attcccaacc ctggcaggtg 660cttgtggcct
ctcgtggcag ggcagtctgc ggcggtgttc tggtgcaccc ccagtgggtc
720ctcacagctg cccactgcat caggaacaaa agcgtgatct tgctgggtcg
gcacagcctg 780tttcatcctg aagacacagg ccaggtattt caggtcagcc
acagcttccc acacccgctc 840tacgatatga gcctcctgaa gaatcgattc
ctcaggccag gtgatgactc cagccacgac 900ctcatgctgc tccgcctgtc
agagcctgcc gagctcacgg atgctgtgaa ggtcatggac 960ctgcccaccc
aggagccagc actggggacc acctgctacg cctcaggctg gggcagcatt
1020gaaccagagg agttcttgac cccaaagaaa cttcagtgtg tggacctcca
tgttatttcc 1080aatgacgtgt gcgcgcaagt tcaccctcag aaggtgacca
agttcatgct gtgtgctgga 1140cgctggacag ggggcaaaag cacctgctcg
ggtgattctg ggggcccact tgtctgtaat 1200ggtgtgcttc aaggtatcac
gtcatggggc agtgaaccat gtgccctgcc cgaaaggcct 1260tccctgtaca
ccaaggtggt gcattaccgg aagtggatca aggacaccat cgtggccaac 1320ccctga
132619417PRTArtificial SequenceSynthetic peptide. 19Leu Asp Asp Leu
Asp Ala Val Arg Ile Lys Val Asp Thr Val Asn Ala1 5 10 15Lys Pro Gly
Asp Thr Val Arg Ile Pro Val Arg Phe Ser Gly Ile Pro 20 25 30Ser Lys
Gly Ile Ala Asn Cys Asp Phe Val Tyr Ser Tyr Asp Pro Asn 35 40 45Val
Leu Glu Ile Ile Glu Ile Glu Pro Gly Glu Leu Ile Val Asp Pro 50 55
60Asn Pro Thr Lys Ser Phe Asp Thr Ala Val Tyr Pro Asp Arg Lys Met65
70 75 80Ile Val Phe Leu Phe Ala Glu Asp Ser Gly Thr Gly Ala Tyr Ala
Ile 85 90 95Thr Glu Asp Gly Val Phe Ala Thr Ile Val Ala Lys Val Lys
Ser Gly 100 105 110Ala Pro Asn Gly Leu Ser Val Ile Lys Phe Val Glu
Val Gly Gly Phe 115 120 125Ala Asn Asn Asp Leu Val Glu Gln Lys Thr
Gln Phe Phe Asp Gly Gly 130 135 140Val Asn Val Gly Asp Thr Thr Glu
Pro Ala Thr Pro Thr Thr Pro Val145 150 155 160Thr Thr Pro Thr Thr
Thr Asp Asp Leu Asp Ala Leu Glu Ala Pro Leu 165 170 175Ile Leu Ser
Arg Ile Val Gly Gly Trp Glu Cys Glu Lys His Ser Gln 180 185 190Pro
Trp Gln Val Leu Val Ala Ser Arg Gly Arg Ala Val Cys Gly Gly 195 200
205Val Leu Val His Pro Gln Trp Val Leu Thr Ala Ala His Cys Ile Arg
210 215 220Asn Lys Ser Val Ile Leu Leu Gly Arg His Ser Leu Phe His
Pro Glu225 230 235 240Asp Thr Gly Gln Val Phe Gln Val Ser His Ser
Phe Pro His Pro Leu 245 250 255Tyr Asp Met Ser Leu Leu Lys Asn Arg
Phe Leu Arg Pro Gly Asp Asp 260 265 270Ser Ser His Asp Leu Met Leu
Leu Arg Leu Ser Glu Pro Ala Glu Leu 275 280 285Thr Asp Ala Val Lys
Val Met Asp Leu Pro Thr Gln Glu Pro Ala Leu 290 295 300Gly Thr Thr
Cys Tyr Ala Ser Gly Trp Gly Ser Ile Glu Pro Glu Glu305 310 315
320Phe Leu Thr Pro Lys Lys Leu Gln Cys Val Asp Leu His Val Ile Ser
325 330 335Asn Asp Val Cys Ala Gln Val His Pro Gln Lys Val Thr Lys
Phe Met 340 345 350Leu Cys Ala Gly Arg Trp Thr Gly Gly Lys Ser Thr
Cys Ser Gly Asp 355 360 365Ser Gly Gly Pro Leu Val Cys Asn Gly Val
Leu Gln Gly Ile Thr Ser 370 375 380Trp Gly Ser Glu Pro Cys Ala Leu
Pro Glu Arg Pro Ser Leu Tyr Thr385 390 395 400Lys Val Val His Tyr
Arg Lys Trp Ile Lys Asp Thr Ile Val Ala Asn 405 410
415Pro201554DNAArtificial SequenceSynthetic oligonucleotide.
20atggatccca aaggatccct ttcctggaga atacttctgt ttctctccct ggcttttgag
60ttgagctacg gactcgacga tctggatgca gtaaggatta aagtggacac agtaaatgca
120aaaccgggag acacagtaag aatacctgta agattcagcg gtataccatc
caagggaata 180gcaaactgtg actttgtata cagctatgac ccgaatgtac
ttgagataat agagatagaa 240ccgggagaca taatagttga cccgaatcct
gacaagagct ttgatactgc agtatatcct 300gacagaaaga taatagtatt
cctgtttgca gaagacagcg gaacaggagc gtatgcaata 360actaaagacg
gagtatttgc tacgatagta gcgaaagtaa aagaaggagc acctaacgga
420ctcagtgtaa tcaaatttgt agaagtaggc ggatttgcga acaatgacct
tgtagaacag 480aagacacagt tctttgacgg tggagtaaat gttggagata
caacagaacc tgcaacacct 540acaacacctg taacaacacc gacaacaaca
gatgatctgg atgcactcga ggatcagatt 600tgcattggtt accatgcaaa
caactcgaca gagcaggttg acacaataat ggaaaagaac 660gttactgtta
cacatgccca agacatactg gaaaagaaac acaacgggaa gctctgcgat
720ctagatggag tgaagcctct aattttgaga gattgtagcg tagctggatg
gctcctcgga 780aacccaatgt gtgacgaatt catcaatgtg ccggaatggt
cttacatagt ggagaaggcc 840aatccagtca atgacctctg ttacccaggg
gatttcaatg actatgaaaa attgaaacac 900ctattgagca gaataaacca
ttttgagaaa attcagatca tccccaaaag ttcttggtcc 960agtcatgaag
cctcattagg ggtgagctca gcatgtccat accagggaaa gtcctccttt
1020ttcagaaatg tggtatggct tatcaaaaag aacagtacat acccaacaat
aaagaggagc 1080tacaataata ccaaccaaga agatcttttg gtactgtggg
ggattcacca tcctaatgat 1140gcggcagagc agacaaagct ctatcaaaac
ccaaccacct atatttccgt tgggacatca 1200acactaaacc agagattggt
accaagaata gctactagat ccaaagtaaa cgggcaaagt 1260ggaaggatgg
agttcttctg gacaatttta aagccgaatg atgcaatcaa cttcgagagt
1320aatggaaatt tcattgctcc agaatatgca tacaaaattg tcaagaaagg
ggactcaaca 1380attatgaaaa gtgaattgga atatggtaac tgcaacacca
agtgtcaaac tccaatgggg 1440gcgataaact ctagcatgcc attccacaat
atacaccctc tcaccattgg ggaatgcccc 1500aaatatgtga aatcaaacag
attagtcctt gcgcaccatc accatcacca ttga 155421493PRTArtificial
SequenceSynthetic peptide. 21Leu Asp Asp Leu Asp Ala Val Arg Ile
Lys Val Asp Thr Val Asn Ala1 5 10 15Lys Pro Gly Asp Thr Val Arg Ile
Pro Val Arg Phe Ser Gly Ile Pro 20 25 30Ser Lys Gly Ile Ala Asn Cys
Asp Phe Val Tyr Ser Tyr Asp Pro Asn 35 40 45Val Leu Glu Ile Ile Glu
Ile Glu Pro Gly Glu Leu Ile Val Asp Pro 50 55 60Asn Pro Thr Lys Ser
Phe Asp Thr Ala Val Tyr Pro Asp Arg Lys Met65 70 75 80Ile Val Phe
Leu Phe Ala Glu Asp Ser Gly Thr Gly Ala Tyr Ala Ile 85 90 95Thr Glu
Asp Gly Val Phe Ala Thr Ile Val Ala Lys Val Lys Ser Gly 100 105
110Ala Pro Asn Gly Leu Ser Val Ile Lys Phe Val Glu Val Gly Gly Phe
115 120 125Ala Asn Asn Asp Leu Val Glu Gln Lys Thr Gln Phe Phe Asp
Gly Gly 130 135 140Val Asn Val Gly Asp Thr Thr Glu Pro Ala Thr Pro
Thr Thr Pro Val145 150 155 160Thr Thr Pro Thr Thr Thr Asp Asp Leu
Asp Ala Leu Glu Asp Gln Ile 165 170 175Cys Ile Gly Tyr His Ala Asn
Asn Ser Thr Glu Gln Val Asp Thr Ile 180 185 190Met Glu Lys Asn Val
Thr Val Thr His Ala Gln Asp Ile Leu Glu Lys 195 200 205Lys His Asn
Gly Lys Leu Cys Asp Leu Asp Gly Val Lys Pro Leu Ile 210 215 220Leu
Arg Asp Cys Ser Val Ala Gly Trp Leu Leu Gly Asn Pro Met Cys225 230
235 240Asp Glu Phe Ile Asn Val Pro Glu Trp Ser Tyr Ile Val Glu Lys
Ala 245 250 255Asn Pro Val Asn Asp Leu Cys Tyr Pro Gly Asp Phe Asn
Asp Tyr Glu 260 265 270Lys Leu Lys His Leu Leu Ser Arg Ile Asn His
Phe Glu Lys Ile Gln 275 280 285Ile Ile Pro Lys Ser Ser Trp Ser Ser
His Glu Ala Ser Leu Gly Val 290 295 300Ser Ser Ala Cys Pro Tyr Gln
Gly Lys Ser Ser Phe Phe Arg Asn Val305 310 315 320Val Trp Leu Ile
Lys Lys Asn Ser Thr Tyr Pro Thr Ile Lys Arg Ser 325 330 335Tyr Asn
Asn Thr Asn Gln Glu Asp Leu Leu Val Leu Trp Gly Ile His 340 345
350His Pro Asn Asp Ala Ala Glu Gln Thr Lys Leu Tyr Gln Asn Pro Thr
355 360 365Thr Tyr Ile Ser Val Gly Thr Ser Thr Leu Asn Gln Arg Leu
Val Pro 370 375 380Arg Ile Ala Thr Arg Ser Lys Val Asn Gly Gln Ser
Gly Arg Met Glu385 390 395 400Phe Phe Trp Thr Ile Leu Lys Pro Asn
Asp Ala Ile Asn Phe Glu Ser 405 410 415Asn Gly Asn Phe Ile Ala Pro
Glu Tyr Ala Tyr Lys Ile Val Lys Lys 420 425 430Gly Asp Ser Thr Ile
Met Lys Ser Glu Leu Glu Tyr Gly Asn Cys Asn 435 440 445Thr Lys Cys
Gln Thr Pro Met Gly Ala Ile Asn Ser Ser Met Pro Phe 450 455 460His
Asn Ile His Pro Leu Thr Ile Gly Glu Cys Pro Lys Tyr Val Lys465 470
475 480Ser Asn Arg Leu Val Leu Ala His His His His His His 485
490221293DNAArtificial SequenceSynthetic oligonucleotide.
22atggatctgg atgcagtaag gattaaagtg gacacagtaa atgcaaaacc gggagacaca
60gtaaatatac ctgtaagatt cagtggtata ccatccaagg gaatagcaaa ctgtgacttt
120gtatacagct atgacccgaa tgtacttgag ataatagaga taaaaccggg
agaattgata 180gttgacccga atcctaccaa gagctttgat actgcagtat
atcctgacag aaagatgata 240gtattcctgt ttgcggaaga cagcggaaca
ggagcgtatg caataactaa agacggagta 300tttgctacga tagtagcgaa
agtaaaagaa ggagcaccta acgggctcag tgtaatcaaa 360tttgtagaag
taggcggatt tgcgaacaat gaccttgtag aacagaagac acagttcttt
420gacggtggag taaatgttgg agatacaaca gaacctgcaa cacctacaac
acctgtaaca 480acaccgacaa caacagatga tctggatgca gctagccttc
taaccgaggt cgaaacgtac 540gttctctcta tcatcccgtc aggccccctc
aaagccgaga tcgcacagag acttgaagat 600gtctttgcag ggaagaacac
cgatcttgag gttctcatgg aatggctaaa gacaagacca 660atcctgtcac
ctctgactaa ggggatttta ggatttgtgt tcacgctcac cgtgcccagt
720gagcggggac tgcagcgtag acgctttgtc caaaatgctc ttaatgggaa
cggagatcca 780aataacatgg acaaagcagt taaactgtat aggaagctta
agagggagat aacattccat 840ggggccaaag aaatagcact cagttattct
gctggtgcac ttgccagttg tatgggcctc 900atatacaaca ggatgggggc
tgtgaccact gaagtggcat ttggcctggt atgcgcaacc 960tgtgaacaga
ttgctgactc ccagcatcgg tctcataggc aaatggtgac aacaaccaat
1020ccactaatca gacatgagaa cagaatggtt ctagccagca ctacagctaa
ggctatggag 1080caaatggctg gatcgagtga gcaagcagca gaggccatgg
atattgctag tcaggccagg 1140caaatggtgc aggcgatgag aaccattggg
actcatccta gctccagtgc tggtctaaaa 1200gatgatcttc ttgaaaattt
gcaggcttac cagaaacgga tgggggtgca gatgcagcga 1260ttcaagctcg
agcaccacca ccaccaccac tga 129323430PRTArtificial SequenceSynthetic
peptide. 23Met Asp Leu Asp Ala Val Arg Ile Lys Val Asp Thr Val Asn
Ala Lys1 5 10 15Pro Gly Asp Thr Val Asn Ile Pro Val Arg Phe Ser Gly
Ile Pro Ser 20 25 30Lys Gly Ile Ala Asn Cys Asp Phe Val Tyr Ser Tyr
Asp Pro Asn Val 35 40 45Leu Glu Ile Ile Glu Ile Lys Pro Gly Glu Leu
Ile Val Asp Pro Asn 50 55 60Pro Thr Lys Ser Phe Asp Thr Ala Val Tyr
Pro Asp Arg Lys Met Ile65 70 75 80Val Phe Leu Phe Ala Glu Asp Ser
Gly Thr Gly Ala Tyr Ala Ile Thr 85 90 95Lys Asp Gly Val Phe Ala Thr
Ile Val Ala Lys Val Lys Glu Gly Ala 100 105 110Pro Asn Gly Leu Ser
Val Ile Lys Phe Val Glu Val Gly Gly Phe Ala 115 120 125Asn Asn Asp
Leu Val Glu Gln Lys Thr Gln Phe Phe Asp Gly Gly Val 130 135 140Asn
Val Gly Asp Thr Thr Glu Pro Ala Thr Pro Thr Thr Pro Val Thr145 150
155 160Thr Pro Thr Thr Thr Asp Asp Leu Asp Ala Ala Ser Leu Leu Thr
Glu 165 170 175Val Glu Thr Tyr Val Leu Ser Ile Ile Pro Ser Gly Pro
Leu Lys Ala 180 185 190Glu Ile Ala Gln Arg Leu Glu Asp Val Phe Ala
Gly Lys Asn Thr Asp 195 200 205Leu Glu Val Leu Met Glu Trp Leu Lys
Thr Arg Pro Ile Leu Ser Pro 210 215 220Leu Thr Lys Gly Ile Leu Gly
Phe Val Phe Thr Leu Thr Val Pro Ser225 230 235 240Glu Arg Gly Leu
Gln Arg Arg Arg Phe Val Gln Asn Ala Leu Asn Gly 245 250 255Asn Gly
Asp Pro Asn Asn Met Asp Lys Ala Val Lys Leu Tyr Arg Lys 260 265
270Leu Lys Arg Glu Ile Thr Phe His Gly Ala Lys Glu Ile Ala Leu Ser
275 280 285Tyr Ser Ala Gly Ala Leu Ala Ser Cys Met Gly Leu Ile Tyr
Asn Arg 290 295 300Met Gly Ala Val Thr Thr Glu Val Ala Phe Gly Leu
Val Cys Ala Thr305 310 315 320Cys Glu Gln Ile Ala Asp Ser Gln His
Arg Ser His Arg Gln Met Val 325 330 335Thr Thr Thr Asn Pro Leu Ile
Arg His Glu Asn Arg Met Val Leu Ala 340 345 350Ser Thr Thr Ala Lys
Ala Met Glu Gln Met Ala Gly Ser Ser Glu Gln 355 360 365Ala Ala Glu
Ala Met Asp Ile Ala Ser Gln Ala Arg Gln Met Val Gln 370 375 380Ala
Met Arg Thr Ile Gly Thr His Pro Ser Ser Ser Ala Gly Leu Lys385 390
395 400Asp Asp Leu Leu Glu Asn Leu Gln Ala Tyr Gln Lys Arg Met Gly
Val 405 410 415Gln Met Gln Arg Phe Lys Leu Glu His His His His His
His 420 425 430249PRTArtificial SequenceSynthetic peptide. 24Gly
Ile Leu Gly Phe Val Phe Thr Leu1 525661PRTArtificial
SequenceSynthetic peptide. 25Met Asp Leu Val Leu Lys Arg Cys Leu
Leu His Leu Ala Val Ile Gly1 5 10 15Ala Leu Leu Ala Val Gly Ala Thr
Lys Val Pro Arg Asn Gln Asp Trp 20 25 30Leu Gly Val Ser Arg Gln Leu
Arg Thr Lys Ala Trp Asn Arg Gln Leu 35 40 45Tyr Pro Glu Trp Thr Glu
Ala Gln Arg Leu Asp Cys Trp Arg Gly Gly 50 55 60Gln Val Ser Leu Lys
Val Ser Asn Asp Gly Pro Thr Leu Ile Gly Ala65 70 75 80Asn Ala Ser
Phe Ser Ile Ala Leu Asn Phe Pro Gly Ser Gln Lys Val 85 90 95Leu Pro
Asp Gly Gln Val Ile Trp Val Asn Asn Thr Ile Ile Asn Gly 100 105
110Ser Gln Val Trp Gly Gly Gln Pro Val Tyr Pro Gln Glu Thr Asp Asp
115 120 125Ala Cys Ile Phe Pro Asp Gly Gly Pro Cys Pro Ser Gly Ser
Trp Ser 130 135 140Gln Lys Arg Ser Phe Val Tyr Val Trp Lys Thr Trp
Gly Gln Tyr Trp145 150 155 160Gln Val Leu Gly Gly Pro Val Ser Gly
Leu Ser Ile Gly Thr Gly Arg 165 170 175Ala Met Leu Gly Thr His Thr
Met Glu Val Thr Val Tyr His Arg Arg 180 185 190Gly Ser Arg Ser Tyr
Val Pro Leu Ala His Ser Ser Ser Ala Phe Thr 195 200 205Ile Thr Asp
Gln Val Pro Phe Ser Val Ser Val Ser Gln Leu Arg Ala 210 215 220Leu
Asp Gly Gly Asn Lys His Phe Leu Arg Asn Gln Pro Leu Thr Phe225 230
235 240Ala Leu Gln Leu His Asp Pro Ser Gly Tyr Leu Ala Glu Ala Asp
Leu 245 250 255Ser Tyr Thr Trp Asp Phe Gly Asp Ser Ser Gly Thr Leu
Ile Ser Arg 260 265 270Ala Leu Val Val Thr His Thr Tyr Leu Glu Pro
Gly Pro Val Thr Ala 275 280 285Gln Val Val Leu Gln Ala Ala Ile Pro
Leu Thr Ser Cys Gly Ser Ser 290 295 300Pro Val Pro Gly Thr Thr Asp
Gly His Arg Pro Thr Ala Glu Ala Pro305 310 315 320Asn Thr Thr Ala
Gly Gln Val Pro Thr Thr Glu Val Val Gly Thr Thr 325 330 335Pro Gly
Gln Ala Pro Thr Ala Glu Pro Ser Gly Thr Thr Ser Val Gln 340 345
350Val Pro Thr Thr Glu Val Ile Ser Thr Ala Pro Val Gln Met Pro Thr
355 360 365Ala Glu Ser Thr Gly Met Thr Pro Glu Lys Val Pro Val Ser
Glu Val 370 375 380Met Gly Thr Thr Leu Ala Glu Met Ser Thr Pro Glu
Ala Thr Gly Met385 390 395 400Thr Pro Ala Glu Val Ser Ile Val Val
Leu Ser Gly Thr Thr Ala Ala 405 410 415Gln Val Thr Thr Thr Glu Trp
Val Glu Thr Thr Ala Arg Glu Leu Pro 420 425 430Ile Pro Glu Pro Glu
Gly Pro Asp Ala Ser Ser Ile Met Ser Thr Glu 435 440 445Ser Ile Thr
Gly Ser Leu Gly Pro Leu Leu Asp Gly Thr Ala Thr Leu 450 455 460Arg
Leu Val Lys Arg Gln Val Pro Leu Asp Cys Val Leu Tyr Arg Tyr465 470
475 480Gly Ser Phe Ser Val Thr Leu Asp Ile Val Gln Gly Ile Glu Ser
Ala 485 490 495Glu Ile Leu Gln Ala Val Pro Ser Gly Glu Gly Asp Ala
Phe Glu Leu 500 505 510Thr Val Ser Cys Gln Gly Gly Leu Pro Lys Glu
Ala Cys Met Glu Ile 515 520 525Ser Ser Pro Gly Cys Gln Pro Pro Ala
Gln Arg Leu Cys Gln Pro Val 530 535 540Leu Pro Ser Pro Ala Cys Gln
Leu Val Leu His Gln Ile Leu Lys Gly545 550 555 560Gly Ser Gly Thr
Tyr Cys Leu Asn Val Ser Leu Ala Asp Thr Asn Ser 565 570 575Leu Ala
Val Val Ser Thr Gln Leu Ile Met Pro Gly Gln Glu Ala Gly 580 585
590Leu Gly Gln Val Pro Leu Ile Val Gly Ile Leu Leu Val Leu Met Ala
595 600 605Val Val Leu Ala Ser Leu Ile Tyr Arg Arg Arg Leu Met Lys
Gln Asp 610 615 620Phe Ser Val Pro Gln Leu Pro His Ser Ser Ser His
Trp Leu Arg Leu625 630 635 640Pro Arg Ile Phe Cys Ser Cys Pro Ile
Gly Glu Asn Ser Pro Leu Leu 645 650 655Ser Gly Gln Gln Val
660269PRTArtificial SequenceSynthetic peptide. 26Lys Thr Trp Gly
Gln Tyr Trp Gln Val1 5279PRTArtificial SequenceSynthetic peptide.
27Ile Met Asp Gln Val Pro Phe Ser Val1 5289PRTArtificialChemically
synthesized peptide 28Ile Thr Asp Gln Val Pro Phe Ser Val1
5299PRTArtificial SequenceSynthetic peptide. 29Tyr Leu Glu Pro Gly
Pro Val Thr Val1 5309PRTArtificialChemically synthesized peptide
30Tyr Leu Glu Pro Gly Pro Val Thr Ala1 531204PRTArtificial
SequenceSynthetic peptide. 31Met Asp Leu Asp Ala Val Arg Ile Lys
Val Asp Thr Val Asn Ala Lys1 5 10 15Pro Gly Asp Thr Val Asn Ile Pro
Val Arg Phe Ser Gly Ile Pro Ser 20 25 30Lys Gly Ile Ala Asn Cys Asp
Phe Val Tyr Ser Tyr Asp Pro Asn Val 35 40 45Leu Glu Ile Ile Glu Ile
Lys Pro Gly Glu Leu Ile Val Asp Pro Asn 50 55 60Pro Thr Lys Ser Phe
Asp Thr Ala Val Tyr Pro Asp Arg Lys Met Ile65 70 75 80Val Phe Leu
Phe Ala Glu Asp Ser Gly Thr Gly Ala Tyr Ala Ile Thr 85 90 95Lys Asp
Gly Val Phe Ala Thr Ile Val Ala Lys Val Lys Glu Gly Ala 100 105
110Pro Asn Gly Leu Ser Val Ile Lys Phe Val Glu Val Gly Gly Phe Ala
115 120 125Asn Asn Asp Leu Val Glu Gln Lys Thr Gln Phe Phe Asp Gly
Gly Val 130 135 140Asn Val Gly Asp Thr Thr Glu Pro Ala Thr Pro Thr
Thr Pro Val Thr145 150 155 160Thr Pro Thr Thr Thr Asp Asp Leu Asp
Ala Ala Arg Ser Ala Phe Thr 165 170 175Ile Met Asp Gln Val Pro Phe
Ser Val Ser Val Ser Ala Ser Arg Lys 180 185 190Gly Ala Ala Ala Leu
Glu His His His His His His 195 20032118PRTArtificial
SequenceSynthetic peptide. 32Met Pro Arg Glu Asp Ala His Phe Ile
Tyr Gly Tyr Pro Lys Lys Gly1 5 10 15His Gly His Ser Tyr Thr Thr Ala
Glu Glu Ala Ala Gly Ile Gly Ile 20 25 30Leu Thr Val Ile Leu Gly Val
Leu Leu Leu Ile Gly Cys Trp Tyr Cys 35 40 45Arg Arg Arg Asn Gly Tyr
Arg Ala Leu Met Asp Lys Ser Leu His Val 50 55 60Gly Thr Gln Cys Ala
Leu Thr Arg Arg Cys Pro Gln Glu Gly Phe Asp65 70 75 80His Arg Asp
Ser Lys Val Ser Leu Gln Glu Lys Asn Cys Glu Pro Val 85 90 95Val Pro
Asn Ala Pro Pro Ala Tyr Glu Lys Leu Ser Ala Glu Gln Ser 100 105
110Pro Pro Pro Tyr Ser Pro 115339PRTArtificial SequenceSynthetic
peptide. 33Ala Ala Gly Ile Gly Ile Leu Thr Val1 53410PRTArtificial
SequenceSynthetic peptide. 34Glu Ala Ala Gly Ile Gly Ile Leu Thr
Val1 5 103510PRTArtificial SequenceSynthetic peptide. 35Glu Leu Ala
Gly Ile Gly Ile Leu Thr Val1 5 1036204PRTArtificial
SequenceSynthetic peptide. 36Met Asp Leu Asp Ala Val Arg Ile Lys
Val Asp Thr Val Asn Ala Lys1 5 10 15Pro Gly Asp Thr Val Asn Ile Pro
Val Arg Phe Ser Gly Ile Pro Ser 20 25 30Lys Gly Ile Ala Asn Cys Asp
Phe Val Tyr Ser Tyr Asp Pro Asn Val 35 40 45Leu Glu Ile Ile Glu Ile
Lys Pro Gly Glu Leu Ile Val Asp Pro Asn 50 55 60Pro Thr Lys Ser Phe
Asp Thr Ala Val Tyr Pro Asp Arg Lys Met Ile65 70 75 80Val Phe Leu
Phe Ala Glu Asp Ser Gly Thr Gly Ala Tyr Ala Ile Thr 85
90 95Lys Asp Gly Val Phe Ala Thr Ile Val Ala Lys Val Lys Glu Gly
Ala 100 105 110Pro Asn Gly Leu Ser Val Ile Lys Phe Val Glu Val Gly
Gly Phe Ala 115 120 125Asn Asn Asp Leu Val Glu Gln Lys Thr Gln Phe
Phe Asp Gly Gly Val 130 135 140Asn Val Gly Asp Thr Thr Glu Pro Ala
Thr Pro Thr Thr Pro Val Thr145 150 155 160Thr Pro Thr Thr Thr Asp
Asp Leu Asp Ala Ala Arg Thr Ala Glu Glu 165 170 175Leu Ala Gly Ile
Gly Ile Leu Thr Val Ile Leu Gly Ala Ser Arg Lys 180 185 190Gly Ala
Ala Ala Leu Glu His His His His His His 195 20037241PRTArtificial
SequenceSynthetic peptide. 37Met Asp Leu Asp Ala Val Arg Ile Lys
Val Asp Thr Val Asn Ala Lys1 5 10 15Pro Gly Asp Thr Val Asn Ile Pro
Val Arg Phe Ser Gly Ile Pro Ser 20 25 30Lys Gly Ile Ala Asn Cys Asp
Phe Val Tyr Ser Tyr Asp Pro Asn Val 35 40 45Leu Glu Ile Ile Glu Ile
Lys Pro Gly Glu Leu Ile Val Asp Pro Asn 50 55 60Pro Thr Lys Ser Phe
Asp Thr Ala Val Tyr Pro Asp Arg Lys Met Ile65 70 75 80Val Phe Leu
Phe Ala Glu Asp Ser Gly Thr Gly Ala Tyr Ala Ile Thr 85 90 95Lys Asp
Gly Val Phe Ala Thr Ile Val Ala Lys Val Lys Glu Gly Ala 100 105
110Pro Asn Gly Leu Ser Val Ile Lys Phe Val Glu Val Gly Gly Phe Ala
115 120 125Asn Asn Asp Leu Val Glu Gln Lys Thr Gln Phe Phe Asp Gly
Gly Val 130 135 140Asn Val Gly Asp Thr Thr Glu Pro Ala Thr Pro Thr
Thr Pro Val Thr145 150 155 160Thr Pro Thr Thr Thr Asp Asp Leu Asp
Ala Ala Ser Asp Thr Thr Glu 165 170 175Ala Arg His Pro His Pro Pro
Val Thr Thr Pro Thr Thr Asp Arg Lys 180 185 190Gly Thr Thr Ala Glu
Glu Leu Ala Gly Ile Gly Ile Leu Thr Val Ile 195 200 205Leu Gly Gly
Lys Arg Thr Asn Asn Ser Thr Pro Thr Lys Gly Glu Phe 210 215 220Cys
Arg Tyr Pro Ser His Trp Arg Pro Leu Glu His His His His His225 230
235 240His3866PRTArtificial SequenceSynthetic peptide. 38Ala Ser
Asp Thr Thr Glu Ala Arg His Pro His Pro Pro Val Thr Thr1 5 10 15Pro
Thr Thr Thr Asp Arg Lys Gly Thr Thr Ala Glu Glu Leu Ala Gly 20 25
30Ile Gly Ile Leu Thr Val Ile Leu Gly Gly Lys Arg Thr Asn Asn Ser
35 40 45Thr Pro Thr Lys Gly Glu Phe Cys Arg Tyr Pro Ser His Trp Arg
Pro 50 55 60Arg Leu653957DNAArtificial SequenceSynthetic
oligonucleotide. 39cacggtcacc gtctccaaag cttccggagc tagcgagggc
ggcagcctgg ccgcgct 574070DNAArtificial SequenceSynthetic
oligonucleotide. 40ggccggctcc tgcgaaggga gccggccggt cgcggccgct
tacttcaggt cctcgcgcgg 60cggtttgccg 7041518PRTArtificial
SequenceSynthetic peptide. 41Met Asp Leu Asp Ala Val Arg Ile Lys
Val Asp Thr Val Asn Ala Lys1 5 10 15Pro Gly Asp Thr Val Asn Ile Pro
Val Arg Phe Ser Gly Ile Pro Ser 20 25 30Lys Gly Ile Ala Asn Cys Asp
Phe Val Tyr Ser Tyr Asp Pro Asn Val 35 40 45Leu Glu Ile Ile Glu Ile
Lys Pro Gly Glu Leu Ile Val Asp Pro Asn 50 55 60Pro Thr Lys Ser Phe
Asp Thr Ala Val Tyr Pro Asp Arg Lys Met Ile65 70 75 80Val Phe Leu
Phe Ala Glu Asp Ser Gly Thr Gly Ala Tyr Ala Ile Thr 85 90 95Lys Asp
Gly Val Phe Ala Thr Ile Val Ala Lys Val Lys Glu Gly Ala 100 105
110Pro Asn Gly Leu Ser Val Ile Lys Phe Val Glu Val Gly Gly Phe Ala
115 120 125Asn Asn Asp Leu Val Glu Gln Lys Thr Gln Phe Phe Asp Gly
Gly Val 130 135 140Asn Val Gly Asp Thr Thr Glu Pro Ala Thr Pro Thr
Thr Pro Val Thr145 150 155 160Thr Pro Thr Thr Thr Asp Asp Leu Asp
Ala Ala Ser Glu Gly Gly Ser 165 170 175Leu Ala Ala Leu Thr Ala His
Gln Ala Cys His Leu Pro Leu Glu Thr 180 185 190Phe Thr Arg His Arg
Gln Pro Arg Gly Trp Glu Gln Leu Glu Gln Cys 195 200 205Gly Tyr Pro
Val Gln Arg Leu Val Ala Leu Tyr Leu Ala Ala Arg Leu 210 215 220Ser
Trp Asn Gln Val Asp Gln Val Ile Arg Asn Ala Leu Ala Ser Pro225 230
235 240Gly Ser Gly Gly Asp Leu Gly Glu Ala Ile Arg Glu Gln Pro Glu
Gln 245 250 255Ala Arg Leu Ala Leu Thr Leu Ala Ala Ala Glu Ser Glu
Arg Phe Val 260 265 270Arg Gln Gly Thr Gly Asn Asp Glu Ala Gly Ala
Ala Asn Gly Pro Ala 275 280 285Asp Ser Gly Asp Ala Leu Leu Glu Arg
Asn Tyr Pro Thr Gly Ala Glu 290 295 300Phe Leu Gly Asp Gly Gly Asp
Val Ser Phe Ser Thr Arg Gly Thr Gln305 310 315 320Asn Trp Thr Val
Glu Arg Leu Leu Gln Ala His Arg Gln Leu Glu Glu 325 330 335Arg Gly
Tyr Val Phe Val Gly Tyr His Gly Thr Phe Leu Glu Ala Ala 340 345
350Gln Ser Ile Val Phe Gly Gly Val Arg Ala Arg Ser Gln Asp Leu Asp
355 360 365Ala Ile Trp Arg Gly Phe Tyr Ile Ala Gly Asp Pro Ala Leu
Ala Tyr 370 375 380Gly Tyr Ala Gln Asp Gln Glu Pro Asp Ala Arg Gly
Arg Ile Arg Asn385 390 395 400Gly Ala Leu Leu Arg Val Tyr Val Pro
Arg Ser Ser Leu Pro Gly Phe 405 410 415Tyr Arg Thr Ser Leu Thr Leu
Ala Ala Pro Glu Ala Ala Gly Glu Val 420 425 430Glu Arg Leu Ile Gly
His Pro Leu Pro Leu Arg Leu Asp Ala Ile Thr 435 440 445Gly Pro Glu
Glu Glu Gly Gly Arg Leu Glu Thr Ile Leu Gly Trp Pro 450 455 460Leu
Ala Glu Arg Thr Val Val Ile Pro Ser Ala Ile Pro Thr Asp Pro465 470
475 480Arg Asn Val Gly Gly Asp Leu Asp Pro Ser Ser Ile Pro Asp Lys
Glu 485 490 495Gln Ala Ile Ser Ala Leu Pro Asp Tyr Ala Ser Gln Pro
Gly Lys Pro 500 505 510Pro Arg Glu Asp Leu Lys
51542614PRTArtificial SequenceSynthetic peptide. 42Gln Ile Gln Leu
Val Gln Ser Gly Pro Glu Leu Lys Lys Pro Gly Glu1 5 10 15Thr Val Lys
Ile Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Asn Tyr 20 25 30Gly Met
Asn Trp Val Lys Gln Ala Pro Gly Lys Gly Leu Lys Trp Met 35 40 45Gly
Trp Ile Asn Thr Tyr Thr Gly Glu Ser Thr Tyr Ala Asp Asp Phe 50 55
60Lys Gly Arg Phe Ala Phe Ser Leu Glu Thr Ser Ala Ser Thr Ala Tyr65
70 75 80Leu Gln Ile Ser Asn Leu Lys Asn Glu Asp Met Ala Thr Tyr Phe
Cys 85 90 95Ala Arg Gly Asp Phe Arg Tyr Tyr Tyr Phe Asp Tyr Trp Gly
Gln Gly 100 105 110Thr Thr Leu Thr Gly Ser Ser Ala Lys Thr Lys Gly
Pro Ser Val Phe 115 120 125Pro Leu Ala Pro Cys Ser Arg Ser Thr Ser
Glu Ser Thr Ala Ala Leu 130 135 140Gly Cys Leu Val Lys Asp Tyr Phe
Pro Glu Pro Val Thr Val Ser Trp145 150 155 160Asn Ser Gly Ala Leu
Thr Ser Gly Val His Thr Phe Pro Ala Val Leu 165 170 175Gln Ser Ser
Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser 180 185 190Ser
Ser Leu Gly Thr Lys Thr Tyr Thr Cys Asn Val Asp His Lys Pro 195 200
205Ser Asn Thr Lys Val Asp Lys Arg Val Glu Ser Lys Tyr Gly Pro Pro
210 215 220Cys Pro Pro Cys Pro Ala Pro Glu Phe Glu Gly Gly Pro Ser
Val Phe225 230 235 240Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met
Ile Ser Arg Thr Pro 245 250 255Glu Val Thr Cys Val Val Val Asp Val
Ser Gln Glu Asp Pro Glu Val 260 265 270Gln Phe Asn Trp Tyr Val Asp
Gly Val Glu Val His Asn Ala Lys Thr 275 280 285Lys Pro Arg Glu Glu
Gln Phe Asn Ser Thr Tyr Arg Val Val Ser Val 290 295 300Leu Thr Val
Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys305 310 315
320Lys Val Ser Asn Lys Gly Leu Pro Ser Ser Ile Glu Lys Thr Ile Ser
325 330 335Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu
Pro Pro 340 345 350Ser Gln Glu Glu Met Thr Lys Asn Gln Val Ser Leu
Thr Cys Leu Val 355 360 365Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val
Glu Trp Glu Ser Asn Gly 370 375 380Gln Pro Glu Asn Asn Tyr Lys Thr
Thr Pro Pro Val Leu Asp Ser Asp385 390 395 400Gly Ser Phe Phe Leu
Tyr Ser Arg Leu Thr Val Asp Lys Ser Arg Trp 405 410 415Gln Glu Gly
Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His 420 425 430Asn
His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Leu Gly Lys Ala Ser 435 440
445Thr Thr Glu Pro Ala Thr Pro Thr Thr Pro Val Thr Thr Pro Thr Thr
450 455 460Thr Asp Asp Leu Asp Ala Val Arg Ile Lys Val Asp Thr Val
Asn Ala465 470 475 480Lys Pro Gly Asp Thr Val Asn Ile Pro Val Arg
Phe Ser Gly Ile Pro 485 490 495Ser Lys Gly Ile Ala Asn Cys Asp Phe
Val Tyr Ser Tyr Asp Pro Asn 500 505 510Val Leu Glu Ile Ile Glu Ile
Lys Pro Gly Glu Leu Ile Val Asp Pro 515 520 525Asn Pro Thr Lys Ser
Phe Asp Thr Ala Val Tyr Pro Asp Arg Lys Met 530 535 540Ile Val Phe
Leu Phe Ala Glu Asp Ser Gly Thr Gly Ala Tyr Ala Ile545 550 555
560Thr Lys Asp Gly Val Phe Ala Thr Ile Val Ala Lys Val Lys Glu Gly
565 570 575Ala Pro Asn Gly Leu Ser Val Ile Lys Phe Val Glu Val Gly
Gly Phe 580 585 590Ala Asn Asn Asp Leu Val Glu Gln Lys Thr Gln Phe
Phe Asp Gly Gly 595 600 605Val Asn Val Gly Asp Thr
61043308PRTArtificial SequenceSynthetic peptide. 43Leu Asp Asp Leu
Asp Ala Val Arg Ile Lys Val Asp Thr Val Asn Ala1 5 10 15Lys Pro Gly
Asp Thr Val Arg Ile Pro Val Arg Phe Ser Gly Ile Pro 20 25 30Ser Lys
Gly Ile Ala Asn Cys Asp Phe Val Tyr Ser Tyr Asp Pro Asn 35 40 45Val
Leu Glu Ile Ile Glu Ile Glu Pro Gly Asp Ile Ile Val Asp Pro 50 55
60Asn Pro Asp Lys Ser Phe Asp Thr Ala Val Tyr Pro Asp Arg Lys Ile65
70 75 80Ile Val Phe Leu Phe Ala Glu Asp Ser Gly Thr Gly Ala Tyr Ala
Ile 85 90 95Thr Lys Asp Gly Val Phe Ala Thr Ile Val Ala Lys Val Lys
Glu Gly 100 105 110Ala Pro Asn Gly Leu Ser Val Ile Lys Phe Val Glu
Val Gly Gly Phe 115 120 125Ala Asn Asn Asp Leu Val Glu Gln Lys Thr
Gln Phe Phe Asp Gly Gly 130 135 140Val Asn Val Gly Asp Thr Thr Glu
Pro Ala Thr Pro Thr Thr Pro Val145 150 155 160Thr Thr Pro Thr Thr
Thr Asp Asp Leu Asp Ala Leu Glu Ala Asp Gln 165 170 175Gly Gln Asp
Arg His Met Ile Arg Met Arg Gln Leu Ile Asp Ile Val 180 185 190Asp
Gln Leu Lys Asn Tyr Val Asn Asp Leu Val Pro Glu Phe Leu Pro 195 200
205Ala Pro Glu Asp Val Glu Thr Asn Cys Glu Trp Ser Ala Phe Ser Cys
210 215 220Phe Gln Lys Ala Gln Leu Lys Ser Ala Asn Thr Gly Asn Asn
Glu Arg225 230 235 240Ile Ile Asn Val Ser Ile Lys Lys Leu Lys Arg
Lys Pro Pro Ser Thr 245 250 255Asn Ala Gly Arg Arg Gln Lys His Arg
Leu Thr Cys Pro Ser Cys Asp 260 265 270Ser Tyr Glu Lys Lys Pro Pro
Lys Glu Phe Leu Glu Arg Phe Lys Ser 275 280 285Leu Leu Gln Lys Met
Ile His Gln His Leu Ser Ser Arg Thr His Gly 290 295 300Ser Glu Asp
Ser305
* * * * *