U.S. patent application number 11/645361 was filed with the patent office on 2010-10-14 for novel co-stimulatory molecules.
This patent application is currently assigned to Maxygen, Inc.. Invention is credited to Doris Apt, Chia-Chun Chang, Claes Gustafsson, Alexandra Lazetic, Steven R. Leong, Juha Punnonen.
Application Number | 20100261660 11/645361 |
Document ID | / |
Family ID | 33303735 |
Filed Date | 2010-10-14 |
United States Patent
Application |
20100261660 |
Kind Code |
A1 |
Punnonen; Juha ; et
al. |
October 14, 2010 |
Novel co-stimulatory molecules
Abstract
The invention provides polynucleotides and polypeptides encoded
therefrom having advantageous properties, including an ability of
the polypeptides to preferentially bind a CD28 or CTLA-4 receptor
at a level greater or less than the ability of human B7-1 to bind
CD28 or CTLA-4, or to induce or inhibit altered level of T cell
proliferation response greater compared to that generated by human
B7-1. The polypeptides and polynucleotides of the invention are
useful in therapeutic and prophylactic treatment methods, gene
therapy applications, and vaccines.
Inventors: |
Punnonen; Juha; (Belmont,
CA) ; Lazetic; Alexandra; (San Jose, CA) ;
Leong; Steven R.; (Berkeley, CA) ; Chang;
Chia-Chun; (Los Gatos, CA) ; Apt; Doris; (San
Jose, CA) ; Gustafsson; Claes; (Belmont, CA) |
Correspondence
Address: |
MAXYGEN, INC.;INTELLECTUAL PROPERTY DEPARTMENT
515 GALVESTON DRIVE
REDWOOD CITY
CA
94063
US
|
Assignee: |
Maxygen, Inc.
Redwood City
CA
|
Family ID: |
33303735 |
Appl. No.: |
11/645361 |
Filed: |
December 22, 2006 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
10032214 |
Dec 20, 2001 |
7183376 |
|
|
11645361 |
|
|
|
|
09888324 |
Jun 22, 2001 |
7094875 |
|
|
10032214 |
|
|
|
|
PCT/US01/19973 |
Jun 22, 2001 |
|
|
|
09888324 |
|
|
|
|
60213946 |
Jun 23, 2000 |
|
|
|
60241245 |
Oct 17, 2000 |
|
|
|
Current U.S.
Class: |
514/21.2 ;
435/252.3; 435/254.2; 435/320.1; 435/325; 435/419; 435/69.1;
530/350; 530/391.1; 536/23.1 |
Current CPC
Class: |
A61K 38/00 20130101;
A61P 37/00 20180101; C07K 14/70532 20130101; C07K 14/70503
20130101 |
Class at
Publication: |
514/21.2 ;
530/350; 530/391.1; 536/23.1; 435/325; 435/254.2; 435/419;
435/252.3; 435/320.1; 435/69.1 |
International
Class: |
A61K 38/16 20060101
A61K038/16; C07K 14/00 20060101 C07K014/00; C07K 19/00 20060101
C07K019/00; C12N 15/11 20060101 C12N015/11; C12N 5/10 20060101
C12N005/10; C12N 1/19 20060101 C12N001/19; C12N 1/21 20060101
C12N001/21; C12N 15/63 20060101 C12N015/63; C12P 21/00 20060101
C12P021/00; A61P 37/00 20060101 A61P037/00 |
Goverment Interests
STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH AND
DEVELOPMENT
[0002] This work was supported in part by a grant from the Defense
Advanced Research Projects Agency (DARPA) (Grant No.
N65236-98-1-5401). The Government may have certain rights in this
invention.
Claims
1. An isolated or recombinant polypeptide comprising an amino acid
sequence of an extracellular domain, wherein said extracellular
domain amino acid sequence has at least 90% amino acid sequence
identity to an extracellular domain amino acid sequence of at least
one of SEQ ID NOS:48-68, 174-221, 283-285, and 290-293, and is not
a naturally-occurring extracellular domain amino acid sequence, and
wherein said polypeptide has a CD28/CTLA-4 binding affinity ratio
equal to or greater than the CD28/CTLA-4 binding affinity ratio of
human B7-1, or has an ability to induce a T-cell proliferative
response equal to or greater than that of human B7-1.
2.-32. (canceled)
33. The polypeptide of claim 1, wherein the polypeptide comprises a
fusion protein comprising at least one additional amino acid
sequence.
34. The polypeptide of claim 33, wherein the at least one
additional amino acid sequence comprises at least one Ig
polypeptide.
35.-42. (canceled)
43. An isolated or recombinant nucleic acid comprising a
polynucleotide sequence which encodes a polypeptide comprising an
amino acid sequence of an extracellular domain, wherein said
extracellular domain amino acid sequence has at least 90% amino
acid sequence identity to an extracellular domain amino acid
sequence of at least one of SEQ ID NOS:48-68, 174-221, 283-285, and
290-293, and is not a naturally-occurring extracellular domain
amino acid sequence, and wherein said polypeptide has a CD28/CTLA-4
binding affinity ratio equal to or greater than the CD28/CTLA-4
binding affinity ratio of human B7-1 or has an ability to induce a
T cell proliferation response that is equal to or greater than that
induced by human B7-1.
44.-57. (canceled)
58. A cell or vector comprising the nucleic acid of claim 43.
59.-79. (canceled)
80. An isolated or recombinant polypeptide comprising: (1) an amino
acid sequence having at least 95% identity to at least one of SEQ
ID NOS:69-92, 222-252, 286-289, or a subsequence thereof comprising
an extracellular domain, wherein said amino acid sequence (a) is a
non naturally-occurring amino acid sequence, and (b) comprises at
least one of: Gly at position 2; Thr at position 4; Arg at position
5; Gly at position 8; Pro at position 12; Met at position 25; Cys
at position 27; Pro at position 29; Leu at position 31; Arg at
position 40; Leu at position 52; His at position 65; Ser at
position 78; Asp at position 80; Tyr at position 87; Lys at
position 120; Asp at position 122; Lys at position 129; Met at
position 135; Phe at position 150; Ile at position 160; Ala at
position 164; His at position 172; Phe at position 174; Leu at
position 176; Asn at position 178; Asn at position 186; Glu at
position 194; Gly at position 196; Thr at position 199; Ala at
position 210; His at position 212; Arg at position 219; Pro at
position 234; Asn at position 241; Leu at position 244; Thr at
position 250; Ala at position 254; Tyr at position 265; Arg at
position 266; Glu at position 273; Lys at position 275; Ser at
position 276; an amino acid deletion at position 276; or Thr at
position 279, wherein the position number corresponds to that of
the human B7-1 amino acid sequence (SEQ ID NO:278), (2) an amino
acid sequence that differs from a primate B7-1 amino acid sequence
in at least one mutation selected from: Ser 12 Pro; Leu 25 Met; Gly
27 Cys; Ser 29 Pro; Lys 40 Arg; His 52 Leu; Tyr 65 His; Glu 122
Asp; Glu 129 Lys; Thr 135 Met; Thr 164 Ala; Ser 174 Phe; Glu 196
Gly; Ala 199 Thr; Thr 210 Ala; Lys 219 Arg; Thr 234 Pro; Asp 241
Asn; Val 254 Ala; Val 254 Ala; Arg 275 Lys; Arg 276 Ser; or Arg 279
Thr; the mutation being indicated comprising a mutation relative to
human B7-1 with the amino acid sequence shown in SEQ ID NO:278, or
(3) an amino acid sequence, said amino acid sequence having at
least 90% identity to at least one polypeptide sequence of SEQ ID
NOS:263-272, or a subsequence thereof comprising the extracellular
domain, wherein said amino acid sequence is not a
naturally-occurring amino acid sequence, wherein said polypeptide
has a CTLA-4/CD28 binding affinity ratio equal to or greater than
the CTLA-4/CD28 binding affinity ratio of human B7-1 or an ability
to induce a T cell proliferation response that is equal to or less
than that of human B7-1.
81.-117. (canceled)
118. The polypeptide of claim 80, 97, 101, 102, 107, or 113,
wherein the polypeptide comprises a fusion protein comprising at
least one additional amino acid sequence.
119. The polypeptide of claim 118, wherein the at least one
additional amino acid sequence comprises at least one Ig
polypeptide.
120.-127. (canceled)
128. An isolated or recombinant nucleic acid comprising a
polynucleotide sequence which (1) encodes a polypeptide comprising
an amino acid sequence haying., at least 95% identity to at least
one of SEQ ID NOS:69-92, 222-252, 286-289, or a subsequence thereof
comprising an extracellular domain, wherein said amino acid
sequence (a) is a non naturally-occurring amino acid sequence, and
(b) comprises at least one of: Gly at position 2; Thr at position
4; Arg at position 5; Gly at position 8; Pro at position 12; Met at
position 25; Cys at position 27; Pro at position 29; Leu at
position 31; Arg at position 40; Leu at position 52; His at
position 65; Ser at position 78; Asp at position 80; Tyr at
position 87; Lys at position 120; Asp at position 122; Lys at
position 129; Met at position 135; Phe at position 150; Ile at
position 160; Ala at position 164; His at position 172; Phe at
position 174; Leu at position 176; Asn at position 178; Asn at
position 186; Glu at position 194; Gly at position 196; Thr at
position 199; Ala at position 210; His at position 212; Arg at
position 219; Pro at position 234; Asn at position 241; Leu at
position 244; Thr at position 250; Ala at position 254; Tyr at
position 265; Arg at position 266; Glu at position 273; Lys at
position 275; Ser at position 276; an amino acid deletion at
position 276; and Thr at position 279, wherein the number of the
amino acid position corresponds to that of the human B7-1 amino
acid sequence (SEQ ID NO:278), or (2) encodes a polypeptide
comprising an amino acid sequence, said amino acid sequence having
at least 75% identity to at least one polypeptide sequence of SEQ
ID NOS:263-272, or a subsequence thereof comprising the
extracellular domain, wherein said amino acid sequence is a non
naturally-occurring sequence, and wherein said polypeptide has a
CTLA-4/CD28 binding affinity ratio about equal to or greater than
the CTLA-4/CD28 binding affinity ratio of human B7-1 and/or an
ability to induce a T cell proliferation response that is equal to
or greater than that induced by human B7-1.
129.-173. (canceled)
174. A method of producing a polypeptide, the method comprising:
(a) introducing into a population of cells a nucleic acid of claim
43, the nucleic acid operatively linked to a regulatory sequence
effective to produce the encoded polypeptide; (b) culturing the
cells in a culture medium to produce the polypeptide; and (c)
isolating the polypeptide from the cells or from the culture
medium.
175.-178. (canceled)
179. A method of modifying T-cell proliferation, the method
comprising: contacting a population of T cells with a polypeptide
of claim 1, thereby modifying proliferation of the T cells.
180.-181. (canceled)
182. A method of treating an autoimmune disorder or medical
condition in a subject, the method comprising: administering to the
subject an effective amount of the polypeptide of claim 1.
183.-320. (canceled)
321. A cell or vector comprising the nucleic acid of claim 128.
322. A method of producing a polypeptide, the method comprising:
(a) introducing into a population of cells a nucleic acid of claim
128, the nucleic acid operatively linked to a regulatory sequence
effective to produce the encoded polypeptide; (b) culturing the
cells in a culture medium to produce the polypeptide; and (c)
isolating the polypeptide from the cells or from the culture
medium.
323. A method of modifying T-cell proliferation, the method
comprising: contacting a population of T cells with a polypeptide
of claim 80, thereby modifying proliferation of the T cells.
324. A method of treating an autoimmune disorder or medical
condition in a subject, the method comprising: administering to the
subject an effective amount of the polypeptide of claim 80.
Description
CROSS-REFERENCES TO RELATED APPLICATIONS
[0001] This application is a continuation-in-part application of
U.S. patent application Ser. No. 09/888,324, filed Jun. 22, 2001
and International Patent Application Serial No. PCT/US01/19973,
which claim priority to and benefit of U.S. Provisional Patent
Application Ser. Nos. 60/213,946, filed on Jun. 23, 2000, and
60/241,245, filed on Oct. 17, 2000, the disclosure of each of which
is incorporated herein by reference in its entirety for all
purposes.
COPYRIGHT NOTIFICATION
[0003] Pursuant to 37 C.F.R. 1.71(e), Applicants note that a
portion of this disclosure contains material which is subject to
copyright protection. The copyright owner has no objection to the
facsimile reproduction by anyone of the patent document or patent
disclosure, as it appears in the Patent and Trademark Office patent
file or records, but otherwise reserves all copyright rights
whatsoever.
FIELD OF THE INVENTION
[0004] The present invention relates generally to polynucleotides
and polypeptides encoded therefrom, as wells as vectors, cells,
antibodies, and methods for using and producing the polynucleotides
and polypeptides.
BACKGROUND OF THE INVENTION
[0005] T cells are a crucial component of the immune system. Not
only is T cell activation required for all specific immune
responses against infectious agents, but T cells also play an
important role in tumor immunity and in autoimmune and allergic
diseases. T cell activation is initiated when T cells recognize
their specific antigen (Ag) in the context of major
histocompatibility complex (MHC) molecules. T cell activation is
well known by those of ordinary skill in the art and is
characterized by such things as, e.g., cytokine synthesis,
induction of various activation markers such as CD25 (interleukin-2
(IL-2) receptor), etc. CD4+ T cells recognize their immunogenic
peptides in the context of MHC class II molecules, whereas CD8+ T
cells recognize their immunogenic peptides in the context of MHC
class I molecules. For induction of T cell activation, cytokine
synthesis or effector function, a second signal, mediated through
CD28, is required. Two ligands for CD28 are B7-1 (CD80) and B7-2
(CD86). B7-1 and B7-2 are termed co-stimulatory molecules and are
typically expressed on professional antigen-presenting cells
(APCs). In addition to binding the CD28 receptor, B7-1 and B7-2
also bind the CTLA-4 (CD152) receptor on T cells.
[0006] B7 molecules mediate both positive and negative signals to T
cells by binding to CD28 and CTLA-4 (CD152) molecules on T cells.
CTLA-4 is a negative regulator of the immune system. In general,
wild-type (WT) B7-1, e.g., human B7-1, preferentially binds CTLA-4
more strongly than it binds CD28. Typically, wild-type B7-1, e.g.,
human B7-1, binds CTLA-4 with about 100 times greater affinity than
it binds CD28. Binding of B7-1 or B7-2 to CTLA-4 suppresses
activation of T cells, resulting in reduced T cell proliferation
and cytokine production (see, e.g., Walunas, T. L. et al. (1994)
Immunity 1(5):405-413; Alegre, M. L. et al. (1998) J Immunol
161(7):3347-3356). Interaction between B7-1 or B7-2 and CTLA-4
expressed on T cells down-regulates T cell responses and raises
thresholds required for activation by CD28. Blockade of
CTLA-4/ligand interactions can also augment in vivo tumor immunity
(Leach, D. et al. (1996) Science 271:1734-1736). Consequently, CD28
and CTLA-4 play a pivotal role in the regulation of T cell
activation and both are essential for proper functioning of the
immune system. For example, CD28 deficient mice are severely
immunodeficient and show poor antigen specific T cell responses,
while CTLA-4 deficient mice die of lymphoproliferative disease,
show T cell expansion mediated by CD28 signaling and have a lack of
down-regulation of T cell receptor signaling. Upon ligation by the
co-stimulatory molecules B7-1 or B7-2, CD28 mediates a
co-stimulatory signal that synergizes with T cell receptor
signaling to induce, e.g., proliferation, cytokine production and
effector functions by both CD4+ and CD8+ T cells
(proliferation/activation). Ligation of CTLA-4 with B7-1 (CD80) or
B7-2 (CD86), however, dampens the CD80 or CD86 activating signal
through CD28, resulting in down-regulation of T cell activation.
CD28 ligation reduces the inhibition mediated through the CTLA-4
signaling. CTLA-4 ligation mediates tolerance and anergy.
[0007] CD28 and CTLA-4 are both involved in the generation of an
immune response to genetic vaccinations (e.g., nucleic acid
vaccinations (NAV), DNA vaccinations, and viral vectors). CD28
deficient mice are unable to mount T cell or antibody responses
against Beta-galactosidase (Beta-gal) when immunized with a plasmid
encoding the Beta-gal gene, and CTLA-4 ligation suppresses the
antibody response to Beta-gal in immunized wild-type mice
(Horspool, J. et al. (1998), J Immunol 160:2706-2714). Expression
of B7-1 on human myeloma cells (Wendtner, C. et al. (1997) Gene
Therapy 4(7):726-735), murine mammary tumors (Martin-Fontecha, A.
et al. (2000) J Immunol 164(2):698-704) or murine sarcoma (Indrova
et al. (1998) Intl J One 12(2):387-390) enhances anti-tumor
immunity. Furthermore, transfection of human APCs with retroviral
vectors encoding B7-1 and tumor antigens induces a stronger
cytotoxic T-lymphocyte (CTL) response than transfection with
similar vectors encoding the tumor antigens alone (Zajac, P. et al.
(1998) Cancer Res 58(20):4567-4571). Anti-viral responses are also
modulated by co-stimulatory molecules. For example, DNA vaccination
of chimpanzees and mice with HIV antigens in conjunction with B7-2
augmented anti-viral responses (Kim, J. et al. (1998) Vaccine
16(19):1828-1835; Tsuji et al. (1997) Eur J Immunol
27(3):782-787).
[0008] The binding properties of B7-1 and B7-2 have limited their
usefulness in clinical applications. The present invention
addresses needs for molecules having varied abilities to
preferentially bind to and/or signal through either CD28 or CTLA-4
receptor and methods of using such molecules for selected and
differential manipulation of T cell responses in vitro, ex vivo,
and in vivo methods. Such molecules would be of beneficial use in a
variety of applications, including, e.g., therapeutic and
prophylactic treatments and vaccinations. The present invention
fulfills these and other needs.
SUMMARY OF THE INVENTION
[0009] In one aspect, the present invention provides novel
co-stimulatory molecules (abbreviated as "NCSM") molecules,
including polypeptides and proteins, related fusion polypeptide or
fusion protein molecules, or functional equivalents thereof,
homologues, and fragments of said polypeptide and protein molecules
or equivalents, analogs, or derivatives thereof, and vectors,
cells, and compositions comprising such NCSM molecules. The
invention also provides nucleic acids encoding any of these
polypeptides, proteins, fragments or variants thereof. In addition,
the invention provides vectors, cells, and compositions comprising
such nucleic acids, and uses of such NCSM polypeptides and NCSM
nucleic acids; and other features are apparent upon further
review.
[0010] Generally speaking, a "co-stimulatory molecule" refers to a
molecule that acts in association or conjunction with, or is
involved with, a second molecule or with respect to an immune
response in a co-stimulatory pathway. In one aspect, a
co-stimulatory molecule may be an immunomodulatory molecule that
acts in association or conjunction with, or is involved with,
another molecule to stimulate or enhance an immune response. In
another aspect, a co-stimulatory molecule is immunomodulatory
molecule that acts in association or conjunction with, or is
involved with, another molecule to inhibit or suppress an immune
response. A "co-stimulatory molecule" need not act simultaneously
with or by the same mechanism as the second molecule. The term
"NCSM" in reference to a molecule is not intended to limit the
molecule to only those molecules that have positive co-stimulatory
properties (e.g., that stimulate or augment T cell proliferation).
In the initial recombination procedures described below, libraries
of recombinant molecules were generated by recombining nucleotide
sequences of parental co-stimulatory molecules (CSM) as discussed
herein. As shown by the data and analyses presented herein, novel
recombinant molecules having a variety of properties were
identified and selected. For example, polypeptide and nucleic acid
molecules that enhance an immune response, such as by inducing T
cell activation or proliferation (e.g., agonists), and molecules
that down-regulate or inhibit an immune response, such as by
inhibiting T cell activation or proliferation (e.g., antagonists)
were identified and selected. Further, molecules that
preferentially bind and/or signal through either or both the CD28
and CTLA-4 receptors were identified and selected. Thus, the term
"NCSM" refers to a co-stimulatory molecule and is not limited to
molecules having the co-stimulatory properties of the parent
sequences, but is intended to refer collectively to all
polypeptides of the invention, and nucleic acids encoding them, and
other embodiments as described herein, unless specifically noted
otherwise.
[0011] The term "NCSM" also includes variants, mutants,
derivatives, and fragments of: 1) B7-1 and B7-2 polypeptides and
nucleic acids, and 2) B7-1 and B7-2 polypeptides and nucleic acids
of the Artiodactyla family (including, e.g., bovine B7-1 and B7-2),
including all such polypeptide variants (and nucleic acids encoding
such polypeptide variants) that exhibit properties similar or
equivalent to the properties of the CD28BPs or CTLA-4BPs described
herein. For example, the term includes B7-1, B7-2, and Artiodactyla
(e.g., bovine) B7-1 and B7-2 polypeptide variants (and nucleic
acids encoding such polypeptide variants) of the invention, wherein
such polypeptide variants have a CD28/CTLA-4 binding affinity ratio
about equal to, equal to, or greater than the CD28/CTLA-4 binding
affinity ratio of hB7-1 or hB7-2 and/or an ability to induce a
T-cell proliferation, and/or a T-cell activation response about
equal to, equal to, or greater than that of hB7-1. The term "NCSM"
also is intended to include B7-1, B7-2, and Artiodactyla (e.g.,
bovine) B7-1 and B7-2 polypeptide variants (and nucleic acids
encoding such polypeptide variants), wherein such polypeptide
variants have a CTLA-4/CD28 binding affinity ratio about equal to
or greater than the CTLA-4/CD28 binding affinity ratio of hB7-1 or
hB7-2, and/or an ability to induce a T-cell proliferation and/or
T-cell activation response about equal to or less than that of
hB7-1 or hB7-2.
[0012] In one aspect, the invention includes isolated or
recombinant NCSM polypeptides, variants, homologues, derivatives,
analogs, and fragments thereof. The invention includes recombinant
NCSM polypeptides having varied abilities to preferentially bind to
and/or signal through CD28 and/or CTLA-4 receptor and provide for
selected and differential manipulation of T cell responses in
vitro, ex vivo, and in vivo. The invention also includes isolated
or recombinant NCSM nucleic acids, variants, homologues,
derivatives, analogs, and fragments thereof that encode
polypeptides having varied abilities and uses described above. Such
NCSM polypeptide and polynucleotides are useful in a variety of
applications, including e.g., therapeutic and prophylactic
treatment methods, vaccinations, and diagnostic assays described
below. The invention also provides NCSM polypeptides, and
polynucleotide encoding such polypeptides, that strongly or
preferentially bind at least one of CD28 or CTLA-4, but do not
effectuate signaling; such molecules are useful in methods as
potential antagonists of endogenous molecules, such as e.g.,
endogenous co-stimulatory molecules. Further, the invention
provides NCSM polypeptides, and polynucleotides encoding them,
having improved or altered receptor/ligand binding affinities and
methods of using such molecules, including in pharmaceutical,
prophylactic, therapeutic, vaccine, and diagnostic
applications.
[0013] In one aspect, the invention provides an isolated or
recombinant polypeptide comprising an amino acid sequence of an,
said extracellular domain (ECD) amino acid sequence having at least
about 75% amino acid sequence identity to an extracellular domain
amino acid sequence of, or the full-length sequence of, at least
one of SEQ ID NOS:48-68, 174-221, 283-285, and 290-293, and is not
a naturally-occurring extracellular domain amino acid sequence, and
wherein said polypeptide has a CD28/CTLA-4 binding affinity ratio
about equal to or greater than the CD28/CTLA-4 binding affinity
ratio of human B7-1 and/or has an ability to induce a T-cell
proliferation and/or T-cell activation response about equal to or
greater than that of hB7-1. Some such polypeptides induce T-cell
proliferation or T-cell activation or both T-cell proliferation and
T-cell activation. In some embodiments, the T cell activation or
proliferation response is at least about equal to or greater than
that cause by WT hB7-1.
[0014] Some such polypeptides of the invention may comprise an
amino acid sequence having 75% identity to a full-length
polypeptide sequence of SEQ ID NOS:48-68, 174-221, 283-285, and
290-293. Such polypeptides may be expressed on the surface of a
cell membrane (e.g., following transfection of the cell with a
nucleic acid that encodes said polypeptide) or associated with or
bound to a cell membrane, or form an integral membrane protein
(e.g., by further comprising a transmembrane domain amino acid
sequence). Through such expression, such polypeptides typically
become integral membrane proteins. Preferably, such cell-expressed
polypeptides, membrane-associated, or membrane-bound polypeptides,
have an ability to induce a T cell proliferation response that is
equal to or greater than that induced by hB7-1.
[0015] Other such polypeptides modulate T-cell activation, but do
not induce proliferation of purified T-cells activated by soluble
anti-CD3 mAbs.
[0016] In one embodiment, the isolated or recombinant polypeptide
comprises an ECD that has at least about 90% amino acid sequence
identity to an ECD or the full-length sequence of at least one of
SEQ ID NOS:48-68, 174-221, 283-285, and 290-293. In another
embodiment, the ECD amino acid sequence comprises an amino acid
subsequence of at least one of SEQ ID NOS:48-68, 174-221, 283-285,
and 290-293.
[0017] Some such isolated or recombinant polypeptides are soluble
(e.g., not cell membrane-bound or membrane-associated or forming an
integral part of a cell membrane). The invention includes monomeric
and multimeric (or aggregated) forms of such soluble polypeptides.
A soluble monomer comprises one soluble polypeptide of the
invention (e.g., one soluble NCSM-ECD), while a soluble multimer or
soluble aggregate comprises at least two soluble polypeptides of
the invention (e.g., two soluble ECDs). The multimer or aggregate
may be formed by cross-linking or other means to link polypeptide
sequences. Such polypeptides may comprise a fusion protein
comprising at least one additional amino acid sequence, such as an
Ig polypeptide. Some such soluble polypeptides, in the presence of
a population of activated T cells, have an ability to induce a T
cell proliferation response, in the presence of a population of
activated T cells, that is less than the T cell proliferation
response induced by a soluble human B7-1 polypeptide in the
presence of a population of activated T cells.
[0018] Some such isolated or recombinant polypeptides further
comprise at least one of a signal peptide domain, transmembrane
domain (TMD), and/or cytoplasmic domain(CD), including, e.g.,
wherein such domain is a WT, variant, or mutant domain of a
co-stimulatory polypeptide, including, e.g., a recombinant domain
derived from a mammalian B7-1 or B7-2. In one embodiment, the
isolated or recombinant polypeptide comprises an amino acid
subsequence, including any of a signal peptide, TMD, or CD of any
of SEQ ID NOS:48-68, 174-221, 283-285, and 290-293. Nucleic acids
encoding such polypeptides and domains are also provided.
[0019] In another aspect, the invention provides an isolated or
recombinant polypeptide, which polypeptide comprises a
non-naturally-occurring amino acid sequence encoded by a nucleic
acid comprising a polynucleotide sequence selected from the group
of: (a) a polynucleotide sequence selected from SEQ ID NOS:1-21 and
95-142, or a complementary polynucleotide sequence thereof; (b) a
polynucleotide sequence encoding a polypeptide selected from SEQ ID
NOS:48-68, 174-221, 283-285, and 290-293, or a complementary
polynucleotide sequence thereof; (c) a polynucleotide sequence
which, but for the degeneracy of the genetic code, hybridizes under
at least stringent or highly stringent conditions over
substantially the entire length of polynucleotide sequence (a) or
(b); (d) a polynucleotide sequence comprising all or a nucleotide
fragment of (a), (b), or (c), wherein the nucleotide fragment
encodes a polypeptide having a CD28/CTLA-4 binding affinity ratio
about equal to or greater than the CD28/CTLA-4 binding affinity
ratio of human B7-1, and/or has an ability to induce a T-cell
proliferation and/or T-cell activation response about equal to or
greater than that of hB7-1; (e) a polynucleotide sequence encoding
a polypeptide, the polypeptide comprising an amino acid sequence
which is substantially identical over at least about 150 contiguous
amino acid residues of any one of SEQ ID NOS:48-68, 174-221,
283-285, and 290-293; and (f) a polynucleotide sequence encoding a
polypeptide that has a CD28/CTLA-4 binding affinity ratio about
equal to or greater than the CD28/CTLA-4 binding affinity ratio of
human B7-1, and/or has an ability to induce T-cell proliferation or
activation or both that is about equal to or greater than that
induced by hB7-1, which polynucleotide sequence has at least about
70% amino acid sequence identity to at least one polynucleotide
sequence of (a), (b), (c), or (d).
[0020] Also provided is an isolated or recombinant polypeptide
comprising an amino acid sequence according to the formula:
MGHTM-X6-W-X8-SLPPK-X14-PCL-X18-X19-X20-QLLVLT-X27-LFYFCSGITPKSVTKRVKETVM-
LSCDY-X55-TSTE-X60-LTSLRIYW-X69-KDSKMVLAILPGKVQVWPEYKNRTITDMNDN-X101-RIVI--
X106-ALR-X110-SD-X113-GTYTCV-X120-QKP-X124-LKGAYKLEHL-X135-SVRLMIRADFPVP-X-
149-X150-X151-DLGNPSPNIRRLICS-X167-X168-X169-GFPRPHL-X177-WLENGEELNATNTT-X-
192-SQDP-X197-T-X199-LYMISSEL-X208-FNVTNN-X215-SI-X218-CLIKYGEL-X227-VSQIF-
PWSKPKQEPPIDQLPF-X249-VIIPVSGALVL-X261-A-X263-VLY-X267-X268-ACRH-X273-ARWK-
RTRRNEETVGTERLSPIYLGSAQSSG (SEQ ID NO:284), or a subsequence
thereof comprising an extracellular domain, wherein position X6 is
Lys or Glu; position X8 is Arg or Gly; position X14 is Arg or Cys;
position X18 is Trp or Arg; position X19 is Pro or Leu; position
X20 is Ser or Pro; position X27 is Asp or Gly; position X55 is Asn
or Ser; position X60 is Glu or Lys; position X69 is Gln or Arg;
position X101 is Pro or Leu; position X106 is Leu or Gln; position
X110 is Pro or Leu; position X113 is Lys or Ser; position X120 is
Val or Ile; position X124 is Val or Asp; position X135 is Thr or
Ala; position X149 is Thr, Ser, or del; position X150 is He or del;
position X151 is Asn or Thr; position X167 is Thr or del; position
X169 is Ser or del; position X169 is Gly or del; position X177 is
Cys or Tyr; position X192 is Val or Leu; position X197 is Gly or
Glu; position X199 is Glu or Lys; position X208 is Gly or Asp;
position X215 is His or Arg; position X218 is Ala or Val; position
X227 is Ser or Leu; position X249 is Trp, Leu, or Arg; position
X261 is Ala or Thr; position X263 is Val, Ala, or Ile; position
X267 is Arg or Cys; position X268 is Pro or Leu; and position X273
is Gly or Val. Typically, the ECD comprises at least about amino
acids 35 to 244 or amino acids 35 to 255 of SEQ ID NO:284. Some
such polypeptides have a CD28/CTLA-4 binding affinity ratio about
equal to or greater than the CD28/CTLA-4 binding affinity ratio of
human B7-1, and/or has an ability to induce T-cell proliferation or
activation or both that is about equal to or greater than that
induced by hB7-1.
[0021] In yet another aspect, the invention provides an isolated or
recombinant polypeptide comprising a subsequence of an amino acid
sequence set forth in any of SEQ ID NOS:48-68, 174-182, 184-221,
283-285, and 290-293, wherein the subsequence is the extracellular
domain of said amino acid sequence.
[0022] A soluble form of an NCSM polypeptide or a human B7-1
polypeptide typically comprises a polypeptide, comprising at least
one ECD, which is not expressed on the surface of a cell, is not
embedded in a cell membrane, and/or is not associated with a lipid
bilayer. Such soluble polypeptides may contain a TD or a fragment
thereof such that the polypeptide remains soluble (e.g., is not
embedded membrane as an integral membrane protein or associated
with a lipid bilayer). Such soluble polypeptides may also include
one or more additional amino acid sequences, such as an Fc portion
of an Ig (e.g., IgG). Such soluble polypeptide may comprise an ECD
monomer, ECD-Ig fusion protein monomer, ECD multimer or aggregate,
or ECD-Ig fusion protein multimer or aggregate (see data and
discussion below).
[0023] Also provided are isolated or recombinant polypeptides, each
of which comprise an amino acid sequence of an extracellular
domain, wherein said extracellular domain amino acid sequence has
at least about 75% amino acid sequence identity to an extracellular
domain amino acid sequence of at least one of SEQ ID NOS:48-68,
174-221, 283-285, and 290-293, and is not a naturally-occurring
extracellular domain amino acid sequence, wherein such polypeptide,
in the presence of activated T cells, has an ability to
down-regulate or inhibit a T cell proliferation response compared
to the response caused by soluble hB7-1 (e.g., hB7-1-ECD or
hB7-1-ECD-Ig) in the presence of activated T cells. The polypeptide
can be either a soluble ECD monomer or a soluble ECD-Ig fusion
protein. Such polypeptides may comprise a fusion protein comprising
at least one additional polypeptide, such as, e.g., an Ig
polypeptide.
[0024] The invention also includes each nucleic acid comprising a
polynucleotide sequence (including degenerate sequences) that
encodes each such isolated or recombinant polypeptide comprising a
soluble polypeptide as described above, and a complementary
polynucleotide sequence thereof. Polynucleotide sequences that, but
for the degeneracy of the genetic code, hybridizes under at least
stringent conditions over substantially the entire length of each
such nucleic acid are also included.
[0025] The invention further provides isolated or recombinant
polypeptides comprising an amino acid sequence having at least
about 95% amino acid sequence identity to a full-length sequence of
at least one of SEQ ID NOS:69-92, 222-252, 286-289, or to a
subsequence thereof comprising the extracellular domain, wherein
said sequence (a) is a non naturally-occurring sequence, and (b)
comprises at least one of: Gly at position 2; Thr at position 4;
Arg at position 5; Gly at position 8; Pro at position 12; Met at
position 25; Cys at position 27; Pro at position 29; Leu at
position 31; Arg at position 40; Leu at position 52; His at
position 65; Ser at position 78; Asp at position 80; Tyr at
position 87; Lys at position 120; Asp at position 122; Lys at
position 129; Met at position 135; Phe at position 150; He at
position 160; Ala at position 164; His at position 172; Phe at
position 174; Leu at position 176; Asn at position 178; Asn at
position 186; Glu at position 194; Gly at position 196; Thr at
position 199; Ala at position 210; His at position 212; Arg at
position 219; Pro at position 234; Asn at position 241; Leu at
position 244; Thr at position 250; Ala at position 254; Tyr at
position 265; Arg at position 266; Glu at position 273; Lys at
position 275; Ser at position 276; an amino acid deletion at
position 276; or Thr at position 279, wherein the position number
corresponds to that of the human B7-1 amino acid sequence (SEQ ID
NO:278), wherein said polypeptide has a CTLA-4/CD28 binding
affinity ratio about equal to or greater than the CTLA-4/CD28
binding affinity ratio of human B7-1, and/or an ability to induce a
T-cell proliferation or T-cell activation response about equal to
or less than that of hB7-1. A subsequence comprises signal peptide,
EDC, TMD, or CD. Each such polypeptide may further comprise at
least one additional amino acid sequence, including, e.g., a
sequence corresponding to a signal peptide, TMD, ECD, or CD.
[0026] In another aspect, the invention provides isolated or
recombinant polypeptides, each comprising an amino acid sequence
that differs from the amino acid sequence of a primate B7-1,
wherein the difference between the amino acid sequence of the
polypeptide and the amino acid sequence of the primate B7-1
comprises a different amino acid at least one amino acid residue
position selected from the group consisting of 12, 25, 27, 29, 40,
52, 65, 122, 129, 135, 164, 174, 196, 199, 210, 219, 234, 241, 254,
275, 276, and 279, wherein the amino acid residue positions
correspond to the amino acid residue positions in the amino acid
sequence of human B7-1 of SEQ ID NO:278. For some such
polypeptides, the different amino acid comprises at least one of:
Pro at position 12; Met at position 25; Cys at position 27; Pro at
position 29; Arg at position 40; Leu at position 52; His at
position 65; Asp at position 122; Lys at position 129; Met at
position 135; Ala at position 164; Phe at position 174; Gly at
position 196; Thr at position 199; Ala at position 210; Arg at
position 219; Pro at position 234; Asn at position 241; Ala at
position 254; Lys at position 275; Ser at position 276; or Thr at
position 279. Preferably, for some such polypeptides, the different
amino acid is His at position 65.
[0027] In another aspect, the invention provides isolated or
recombinant polypeptides comprising an amino acid sequence that
differs from a primate B7-1 sequence in at least one mutation
selected from: Ser 12 Pro; Leu 25 Met; Gly 27 Cys; Ser 29 Pro; Lys
40 Arg; His 52 Leu; Tyr 65 His; Glu 122 Asp; Glu 129 Lys; Thr 135
Met; Thr 164 Ala; Ser 174 Phe; Glu 196 Gly; Ala 199 Thr; Thr 210
Ala; Lys 219 Arg; Thr 234 Pro; Asp 241 Asn; Val 254 Ala; Arg 275
Lys; Arg 276 Ser; or Arg 279 Thr; the mutation being indicated
relative to human B7-1 with the amino acid sequence shown in SEQ ID
NO:278, wherein said sequence does not occur in nature, and wherein
said polypeptide has a CTLA-4/CD28 binding affinity ratio about
equal to or greater than the CTLA-4/CD28 binding affinity ratio of
human B7-1, and/or an ability to induce a T-cell proliferation
and/or T-cell activation response about equal to or less than that
of hB7-1.
[0028] Also included are isolated or recombinant polypeptides
comprising an amino acid sequence having at least about 75%
sequence identity to at least one of SEQ ID NOS:263-272, or a
subsequence thereof comprising the extracellular domain, where the
amino acid sequence is not naturally-occurring, and the polypeptide
has a CTLA-4/CD28 binding affinity ratio about equal to or greater
than the CTLA-4/CD28 binding affinity ratio of human B7-1, and/or
an ability to induce a T-cell proliferation and/or activation
response about equal to or less than that of hB7-1.
[0029] In yet another aspect, the invention includes an isolated or
recombinant polypeptides which comprises a non naturally-occurring
amino acid sequence encoded by a nucleic acid comprising a
polynucleotide sequence selected from: (a) a polynucleotide
sequence selected from SEQ ID NOS:22-45, 143-173, 253-262, or a
complementary polynucleotide sequence thereof; (b) a polynucleotide
sequence encoding a polypeptide selected from SEQ ID NOS:69-92,
222-247, 263-272, 286-289, or a complementary polynucleotide
sequence thereof; (c) a polynucleotide sequence which, but for the
degeneracy of the genetic code, hybridizes under highly stringent
conditions over substantially the entire length of polynucleotide
sequence (a) or (b); (d) a polynucleotide sequence comprising all
or a fragment of (a), (b), or (c), wherein the fragment encodes a
polypeptide having a CTLA-4/CD28 binding affinity ratio about equal
to or greater than the CTLA-4/CD28 binding affinity ratio of human
B7-1, or an ability to induce a T-cell proliferation or activation
response about equal to or less than that of hB7-1; (e) a
polynucleotide sequence encoding a polypeptide, the polypeptide
comprising an amino acid sequence which is substantially identical
over at least about 150 contiguous amino acid residues of any one
of SEQ ID NOS:69-92, 222-247, 263-272, 286-289, and (f) a
polynucleotide sequence encoding a polypeptide that has a
CTLA-4/CD28 binding affinity ratio about equal to or greater than
the CTLA-4/CD28 binding affinity ratio of human B7-1 or an ability
to induce a T-cell proliferation or activation response about equal
to or less than that of hB7-1, which polynucleotide sequence has at
least about 70% identity to at least one polynucleotide sequence of
(a), (b), (c), or (d).
[0030] The invention also includes an isolated or recombinant
polypeptide comprising an amino acid sequence according to the
formula:
[0031]
MGHTRRQGTSP-X12-KCPYLKFFQLLV-X25-ACL-X29-HLCSGVIHVT-X40-EVKEVATLSCG-
LNVSVEELAQTRIHWQKEKKMVLTM
MSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKY-X122-KDAFKR-X129-HLAEVMLSVK-
ADFPTPSITDFEIPPSNIRREICS-X164-SGGFPEPHLFWLENGEELNALNTTVSQDPET-X196-LYTVSSK-
LDFNM TANHSFMCLI-X219-YGHLRVNQTFNWNTPKQEHFP-X241-NLLPSWA
ITLISANGIFVICCLTYRFAPRCRERKSNETLRRESVCPV (SEQ ID NO:287), or a
subsequence thereof comprising the extracellular domain, wherein
position X12 is Ser or Pro; position X25 is Leu or Met; position
X29 is Ser or Pro; position X40 is Lys or Arg; position X122 is Glu
or Asp; position X129 is Glu or Lys; position X164 is Thr or Ala;
position X196 is Glu or Gly; position X219 is Lys or Arg; position
X241 is Asp or Asn. Some such polypeptides have a CTLA-4/CD28
binding affinity ratio about equal to or greater than the
CTLA-4/CD28 binding affinity ratio of hB7-1, and/or ability to
induce T-cell proliferation or activation or both about equal to or
less than that induced by hB7-1.
[0032] The invention also provides an isolated or recombinant
polypeptide comprising a subsequence of an amino acid sequence set
forth in any of SEQ ID NOS:69-92, 222-247, 263-272, and 286-289,
wherein the subsequence is the extracellular domain or full-length
sequence of such amino acid sequence. Furthermore, the invention
includes the full-length polypeptide sequence and one or more
subsequences thereof, e.g., signal peptide, extracellular domain
(ECD), transmembrane domain (TMD), and/or cytoplasmic domain (CD)
of any of SEQ ID NOS:66, 81, 85, 86, 88, 90, 91, 285, 288, 289,
291, and 294, and nucleic acid sequences encoding any of these
amino acid sequences.
[0033] The invention provides isolated or recombinant nucleic acids
comprising a polynucleotide sequence selected from: (a) a
polynucleotide sequence selected from SEQ ID NOS:1-21 and 95-142,
or a complementary polynucleotide sequence thereof; (b) a
polynucleotide sequence encoding a polypeptide selected from SEQ ID
NOS:48-68, 174-221, 283-285, and 290-293, or a complementary
polynucleotide sequence thereof; (c) a polynucleotide sequence
which, but for codon degeneracy, hybridizes under at least
stringent or highly stringent conditions over substantially the
entire length of polynucleotide sequence (a) or (b); and (d) a
polynucleotide sequence comprising all or a nucleotide fragment of
(a), (b), or (c), wherein the fragment encodes a polypeptide having
a CD28/CTLA-4 binding affinity ratio about equal to or greater than
the CD28/CTLA-4 binding affinity ratio of human B7-1, or an ability
to induce a T-cell proliferation or activation response about equal
to or greater than that of hB7-1. In some such nucleic acids, the
polynucleotide sequence of (d) encodes a nucleotide fragment of (a)
or (b) that encodes an ECD having a CD28/CTLA-4 binding affinity
ratio or an ability to induce a T-cell proliferation or activation
response about equal to or greater than that of hB7-1.
[0034] The invention also includes isolated or recombinant nucleic
acids comprising a polynucleotide sequence encoding a polypeptide,
wherein the encoded polypeptide comprises an amino acid sequence
which is (a) substantially identical over at least about 150 or 200
contiguous amino acid residues of any one of SEQ ID NOS:48-68,
174-221, 283-285, and 290-293 and (b) is a non naturally-occurring
sequence.
[0035] In addition, the invention includes isolated or recombinant
nucleic acids comprising a nucleotide sequence coding for a
polypeptide comprising the amino acid sequence set forth in any of
SEQ ID NOS:48-68, 174-221, 283-285, and 290-293, or a subsequence
thereof, wherein the subsequence comprises at least one of: the
signal sequence, extracellular domain, or transmembrane domain of
said polypeptide, and the cytoplasmic domain of said polypeptide,
and wherein the amino acid sequence or subsequence is a non
naturally-occurring sequence. Similarly, fragments of the above
nucleotides that encode a polypeptide that has a substantially
equivalent or equivalent binding activity of a NCSM polypeptide
molecule, produces a substantially equivalent or equivalent
NCSM-polypeptide-mediated immune response, e.g., induction or
inhibition of T cell activation or proliferation, or cytokine
production are a feature.
[0036] Also provided is an isolated or recombinant nucleic acid
comprising a polynucleotide sequence selected from: (a) a
polynucleotide sequence selected from SEQ ID NOS:22-45, 143-173, or
a complementary polynucleotide sequence thereof; (b) a
polynucleotide sequence encoding a polypeptide selected from SEQ ID
NOS:69-92, 222-247, 286-289, or a complementary polynucleotide
sequence thereof; (c) a polynucleotide sequence which, but for the
degeneracy of the genetic code, hybridizes under highly stringent
conditions over substantially the entire length of polynucleotide
sequence (a) or (b); and (d) a polynucleotide sequence comprising
all or a fragment of (a), (b), or (c); wherein (c) or (d) encodes a
polypeptide having a non naturally-occurring sequence comprising at
least one of:
[0037] Gly at position 2; Thr at position 4; Arg at position 5; Gly
at position 8; Pro at position 12; Met at position 25; Cys at
position 27; Pro at position 29; Leu at position 31; Arg at
position 40; Leu at position 52; His at position 65; Ser at
position 78; Asp at position 80; Tyr at position 87; Lys at
position 120; Asp at position 122; Lys at position 129; Met at
position 135; Phe at position 150; Ile at position 160; Ala at
position 164; His at position 172; Phe at position 174; Leu at
position 176; Asn at position 178; Asn at position 186; Glu at
position 194; Gly at position 196; Thr at position 199; Ala at
position 210; His at position 212; Arg at position 219; Pro at
position 234; Asn at position 241; Leu at position 244; Thr at
position 250; Ala at position 254; Tyr at position 265; Arg at
position 266; Glu at position 273; Lys at position 275; Ser at
position 276; an amino acid deletion at position 276; and Thr at
position 279, wherein the position number corresponds to that of
the human B7-1 amino acid sequence (SEQ ID NO:278), and wherein
said polypeptide has a CTLA-4/CD28 binding affinity ratio about
equal to or greater than the CTLA-4/CD28 binding affinity ratio of
human B7-1.
[0038] The invention further provides an isolated or recombinant
nucleic acid comprising a polynucleotide sequence selected from:
(a) a polynucleotide sequence selected from SEQ ID NOS:253-262, or
a complementary polynucleotide sequence thereof; (b) a
polynucleotide sequence encoding a polypeptide selected from SEQ ID
NOS:263-272, or a complementary polynucleotide sequence thereof;
(c) a polynucleotide sequence which, but for codon degeneracy,
hybridizes under highly stringent conditions over substantially the
entire length of polynucleotide sequence (a) or (b) and encodes a
polypeptide having a non naturally-occurring sequence; and (d) a
polynucleotide sequence comprising all or a fragment of (a), (b),
or (c), wherein the fragment encodes a polypeptide having (i) a non
naturally-occurring sequence and (ii) a CTLA-4/CD28 binding
affinity ratio about equal to or greater than the CTLA-4/CD28
binding affinity ratio of human B7-1, or an ability to induce a
T-cell proliferation or activation response about equal to or less
than that of hB7-1.
[0039] The invention also includes an isolated or recombinant
nucleic acid comprising a polynucleotide sequence encoding a
polypeptide that comprises an amino acid sequence which is
substantially identical over at least about 150 contiguous amino
acid residues of any one of SEQ ID NOS:69-92, 222-247, 263-272, and
286-289.
[0040] The invention also provides an isolated or recombinant
nucleic acid comprising a nucleotide sequence coding for a
polypeptide comprising the amino acid sequence set forth in any of
SEQ ID NOS:69-92, 222-247, 263-272, and 286-289, or a subsequence
thereof, wherein the subsequence comprises at least one of the
signal sequence, ECD, transmembrane domain, and cytoplasmic domain
of said polypeptide, and the amino acid sequence or subsequence is
a non naturally-occurring sequence.
[0041] In another aspect, the invention provides an isolated or
recombinant nucleic acid encoding a polypeptide that has a
CTLA-4/CD28 binding affinity ratio about equal to or greater than
the CTLA-4/CD28 binding affinity ratio of human B7-1, or an ability
to induce a T-cell proliferation and/or activation response about
equal to or greater than that of hB7-1, produced by mutating or
recombining at least one nucleic acids described above. Also
included is an isolated or recombinant polypeptide comprising an
amino acid sequence having the formula:
[0042]
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPK-SVTKRVKETVM-X50-SCDY-X55-X56-
-STEELTSLRIYWQKDSKMVL
AILPGKVQVWPEYKNRTITD-MNDNPRIVILALRLSD-X113-GTYTCV-X120-QK-X123-X124-X125--
X126-G-X128-X129-X130-X131-EHL-X135-SV-X138-L-X140-IRADFPVPSITDIGHPAPNVK
RIRCSASG-X170-FPEPRLAWMEDGEEL-NAVNTTV-X193-X194-X195-LDTELYSVSSELD-X209-N-
-X211-TNNHSIVCLIKYGELSVSQIFPWSKPK
QEPPIDQLPFWVI-X252-X253-VSGALVLTAVVLYCLACRHVAR (SEQ ID NO:290), or
a subsequence thereof comprising the extracellular domain, wherein
position X50 is Leu or Pro; position X55 is Asn or Ser; position
X56 is Ala or Thr; position X113 is Ser or Lys; position X120 is
Ile or Val; position X123 is Pro or deleted; position X124 is Val,
Asn, or Asp; position X125 is Leu or Glu; position X126 is Lys or
Asn; position X128 is Ala or Ser; position X129 is Tyr or Phe;
position X130 is Lys or Arg; position X131 is Leu or Arg; position
X135 is Ala or Thr; position X138 is Arg or Thr; position X140 is
Met or Ser; position X170 is Asp or Gly; position X193 is Asp or is
deleted; position X194 is Gln or is deleted; position X195 is Asp
or is deleted; position X211 is Val or Ala; position X252 is Ile or
Val; and position X253 is Leu or Pro. The polypeptide may comprise
a sequence of any of SEQ ID NOS:59, 62, 180, 184, 188, 195, 196,
200, 201, 204, 211, 213, 219, and 291. Some such polypeptides have
a CD28/CTLA-4 binding affinity ratio about equal to or greater than
that of hB7-1, and/or an ability to induce T-cell proliferation
and/or activation about equal to or greater than that induced by
hB7-1.
[0043] Another feature of the invention is an isolated or
recombinant polypeptide comprising an amino acid sequence according
to the formula:
[0044] MGHTMKWG-X9-LPPKRPCLWLSQLLVLTGLFYFCSG-X35-TPKSVTKRV
KETVMLSCDY-X55-TSTEELTSLRIYWQKDSKMVLAILPGKVQVW
PEYKNRTITDMNDNPRIVILALR-X110-SDSGTYTCVIQKP-X124-LKGAYKLEHL-X135-SVRLMDRAD-
FPVPTINDLGNPSPNIRRLICSTSGGFPRPBLYWLENG-X183-ELNATNTT-X192-SQDPETKLYMISSELD-
FN-X211-TSN-X215-X216-X217-LCLVKYGDLTVSQ-X231-FYWQESKPTPSANQHLTWTIBPVSAFGI-
SVIIAVI LTCLTCRNAAIRRQRRENEV-X288-M-X290-SCSQSP (SEQ ID NO:292), or
a subsequence thereof comprising the extracellular domain, wherein
position X9 is Thr or Ser; position X35 is He or Thr; position X55
is Asn or Ser; position X110 is Led or Pro; position X124 is Asp or
Val; position X135 is Thr or Ala; position X183 is Lys or Glu;
position X192 is Leu or Val; position X211 is Met or Thr; position
X215 is His or is deleted; position X216 is Ser or is deleted;
position X217 is Phe or is deleted; position X231 is Thr or Ser;
position X288 is Lys or Glu; position X290 is Glu or Gln, and
wherein said amino acid sequence is a non naturally-occurring
sequence. Some such polypeptides have a CD28/CTLA-4 binding
affinity ratio about equal to or greater than that of hB7-1, and/or
an ability to induce T-cell proliferation and/or activation about
equal to or greater than that induced by hB7-1.
[0045] The invention includes an isolated or recombinant
polypeptide comprising the amino acid sequence of SEQ ID NO:93 or
SEQ ID NO:94, or a subsequence thereof, wherein the subsequence
comprises at least one of the signal sequence, ECD, transmembrane
domain, and cytoplasmic domain of said polypeptide. Also provided
is an isolated or recombinant nucleic acid comprising a
polynucleotide sequence selected from: (a) a polynucleotide
sequence selected from SEQ ID NO:46 or SEQ ID NO:47, or a
complementary polynucleotide sequence thereof; (b) a polynucleotide
sequence encoding a polypeptide selected from SEQ ID NO:93, SEQ ID
NO:94, or a complementary polynucleotide sequence thereof; (c) a
polynucleotide sequence encoding a subsequence of a polypeptide
selected from SEQ ID NO:93, SEQ ID NO:94, or a complementary
polynucleotide sequence thereof, wherein the subsequence comprises
at least one of: the signal sequence, extracellular domain,
transmembrane domain, and cytoplasmic domain of the
polypeptide.
[0046] In another aspect, the invention provides a polypeptide
which is specifically bound by a polyclonal antisera raised against
at least one antigen, the antigen comprising the polypeptide
sequence selected from any of SEQ ID NOS:48-94, 174-252, 263-272,
283-293, or a fragment thereof, wherein the antisera is subtracted
with one or more (and optionally all) polypeptides encoded by one
or more of the sequences set forth at GenBank Nucleotide Accession
Nos: A92749, A92750, AA983817, AB026121, AB030650, AB030651,
AB038153, AF010465, AF065893, AF065894, AF065895, AF065896,
AF079519, AF106824, AF106825, AF106828, AF106829, AF106830,
AF106831, AF106832, AF106833, AF106834, AF203442, AF203443,
AF216747, AF257653, AH004645, AH008762, AX000904, AX000905, D49843,
L12586, L12587, M27533, M83073, M83074, M83075, M83077, NM005191,
S74541, S74540, S74695, S74696, U05593, U10925, U19833, U19840,
U26832, U33063, U33208, U57755, U88622, X60958, Y08823, and Y09950.
Some such polypeptides have a CTLA-4/CD28 binding affinity ratio
about equal to or greater than the CTLA-4/CD28 binding affinity
ratio of human B7-1, and/or an ability to induce a T-cell
proliferation or T-cell activation response about equal to or
greater than that of hB7-1.
[0047] The invention further includes an antibody or antisera
produced by administering any NCSM polypeptide described above to a
mammal, which antibody specifically binds at least one antigen, the
antigen comprising a polypeptide comprising at least one amino acid
sequence of any of SEQ ID NOS:48-94, 174-252, 263-272, and 283-293,
which antibody does not specifically bind to a polypeptide encoded
by at least one (optionally all) of the sequences at GenBank
Nucleotide Accession Nos: A92749, A92750, AA983817, AB026121,
AB030650, AB030651, AB038153, AF010465, AF065893, AF065894,
AF065895, AF065896, AF079519, AF106824, AF106825, AF106828,
AF106829, AF106830, AF106831, AF106832, AF106833, AF106834,
AF203442, AF203443, AF216747, AF257653, AH004645, AH008762,
AX000904, AX000905, D49843, L12586, L12587, M27533, M83073, M83074,
M83075, M83077, NM005191, S74541, S74540, S74695, S74696, U05593,
U10925, U19833, U19840, U26832, U33063, U33208, U57755, U88622,
X60958, Y08823, and Y09950.
[0048] The invention provides an antibody or antisera which
specifically binds a polypeptide which comprises any sequence
selected from any of SEQ ID NOS:48-94, 174-252, 263-272, and
283-293, wherein the antibody or antisera does not specifically
bind to at least one (optionally all) polypeptide encoded by at
least one of GenBank Nucleotide Accession Nos: A92749, A92750,
AA983817, AB026121, AB030650, AB030651, AB038153, AF010465,
AF065893, AF065894, AF065895, AF065896, AF079519, AF106824,
AF106825, AF106828, AF106829, AF106830, AF106831, AF106832,
AF106833, AF106834, AF203442, AF203443, AF216747, AF257653,
AH004645, AH008762, AX000904, AX000905, D49843, L12586, L12587,
M27533, M83073, M83074, M83075, M83077, NM005191, S74541, S74540,
S74695, S74696, U05593, U10925, U19833, U19840, U26832, U33063,
U33208, U57755, U88622, X60958, Y08823, and Y09950. The antibodies
are, e.g., polyclonal, monoclonal, chimeric, humanized, single
chain, Fab fragments, fragments produced by an Fab expression
library, or the like.
[0049] In another aspect, the invention provides a nucleic acid
which comprises a unique subsequence in a nucleic acid selected
from SEQ ID NOS:1-47, 95-173, and 253-262, wherein the unique
subsequence is unique as compared to at least one (optionally all)
nucleic acid corresponding to any of GenBank Nucleotide Accession
Nos.: A92749, A92750, AA983817, AB026121, AB030650, AB030651,
AB038153, AF010465, AF065893, AF065894, AF065895, AF065896,
AF079519, AF106824, AF106825, AF106828, AF106829, AF106830,
AF106831, AF106832, AF106833, AF106834, AF203442, AF203443,
AF216747, AF257653, AH004645, AH008762, AX000904, AX000905, D49843,
L12586, L12587, M27533, M83073, M83074, M83075, M83077, NM005191,
S74541, S74540, S74695, S74696, U05593, U10925, U19833, U19840,
U26832, U33063, U33208, U57755, U88622, X60958, Y08823, and Y09950.
The invention also includes a polypeptide which comprises a unique
subsequence in a polypeptide selected from: SEQ ID NOS:48-94,
174-252, 263-272, and 283-293, wherein the unique subsequence is
unique as compared to at least one (optionally all) polypeptide
encoded by any of GenBank Nucleotide Accession Nos. shown
above.
[0050] The invention includes a target nucleic acid which, but for
nucleotide codon degeneracy, hybridizes under stringent conditions
to a unique coding oligonucleotide that encodes a unique
subsequence in a polypeptide selected from SEQ ID NOS:48-94,
174-252, 263-272, and 283-293, wherein the unique subsequence is
unique as compared to at least one (optionally all) polypeptide
encoded by any of GenBank Nucleot. Access. Nos.: A92749, A92750,
AA983817, AB026121, AB030650, AB030651, AB038153, AF010465,
AF065893, AF065894, AF065895, AF065896, AF079519, AF106824,
AF106825, AF106828, AF106829, AF106830, AF106831, AF106832,
AF106833, AF106834, AF203442, AF203443, AF216747, AF257653,
AH004645, AH008762, AX000904, AX000905, D49843, L12586, L12587,
M27533, M83073, M83074, M83075, M83077, NM005191, S74541, S74540,
S74695, S74696, U05593, U10925, U19833, U19840, U26832, U33063,
U33208, U57755, U88622, X60958, Y08823, and Y09950.
[0051] The invention also includes compositions comprising any
polypeptide and/or polynucleotide described herein in an excipient,
preferably a pharmaceutically acceptable excipient. In one aspect,
the invention provides compositions comprising an isolated or
recombinant NCSM polypeptide comprising the amino acid sequence SEQ
ID NOS:48-68, 174-221, 283-285, 290-293, or a costimulatory
fragment thereof, wherein said costimulatory fragment has a
CD28/CTLA-4 binding affinity ratio about equal to or greater than
the CD28/CTLA-4 binding affinity ratio of human B7-1, or an ability
to induce a T-cell proliferation or activation response about equal
to or greater than that of hB7-1, and a carrier or excipient.
Compositions comprising an isolated or recombinant NCSM polypeptide
comprising the amino acid sequence of SEQ ID NOS:69-92, 222-247,
263-272, 286-289, or a costimulatory fragment thereof, wherein said
costimulatory fragment has a CTLA-4/CD28 binding affinity ratio
about equal to or greater than the CTLA-4/CD28 binding affinity
ratio of human B7-1, or an ability to induce a T-cell proliferation
or activation response about equal to or less than that of hB7-1,
and a carrier are also a feature of the invention.
[0052] Also included are isolated or recombinant polypeptides, each
comprising an amino acid sequence corresponding to an extracellular
domain, wherein said amino acid sequence has at least about 92%,
93%, 94%, 95% or more amino acid sequence identity to the amino
acid sequence corresponding to the extracellular domain of SEQ ID
NO:66, and wherein said polypeptide has a CD28/CTLA-4 binding
affinity ratio greater than the CD28/CTLA-4 binding affinity ratio
of human B7-1. Some such polypeptides may further comprise at least
one further amino acid sequence corresponding to a signal peptide,
transmembrane domain or a cytoplasmic domain.
[0053] The invention also includes isolated or recombinant
polypeptide variants, each of which comprises an amino acid
sequence that differs from the amino acid sequence of a primate
B7-1, wherein the difference between the amino acid sequence of the
variant and the amino acid sequence of the primate B7-1 comprises a
different amino acid at position 65 other than alanine, wherein the
position corresponds to the position in the amino acid sequence of
human B7-1 of SEQ ID NO:278. The different amino acid may comprise
His, Arg, Lys, Pro, Phe, or Trp, and the primate B7-1 may be hB7-1.
Some such polypeptide variants have a CTLA-4/CD28 binding affinity
ratio greater than that or hB7-1 or an ability to induce a T cell
proliferation response less than that of hB7-1.
[0054] The invention also includes an isolated or recombinant
nucleic acid comprising a polynucleotide sequence encoding a
polypeptide, where the polypeptide comprises an amino acid sequence
which is substantially identical over at least 175 contiguous amino
acids of any one of those NCSM polypeptide sequences listed. In
various embodiments, the encoded polypeptide comprises at least
about 100, 150, 170, 180, 190, 200, 201, 202, 203, 204, 205, 206,
207, 208, 209, 210, 220, 225, 230, 240, 250, 260, 265, 270, 275, or
285 or more contiguous amino acid residues or substantially
identical variants of any one of the polypeptide sequences listed,
or encoded by any nucleic acid listed. These polypeptides can exist
separately or as components of one of more fusion proteins.
[0055] The invention also includes a cell comprising any nucleic
acid described herein, or which expresses any polypeptide or
nucleic acid noted herein. In one embodiment, the cell expresses a
polypeptide encoded by the nucleic acids herein.
[0056] The invention also includes a vector comprising any nucleic
acid of the invention. The vector can comprise a plasmid, a cosmid,
a phage, or a virus or a virus-like particle (VLP) (or virus
fragment); the vector can be, e.g., an expression vector, a cloning
vector, a packaging vector, an integration vector, or the like. The
invention also includes a cell transduced by the vector. The
invention also includes compositions comprising any nucleic acid
described herein, and an excipient, preferably a pharmaceutically
acceptable excipient. Cells and transgenic animals that include any
polypeptide or nucleic acid herein, e.g., produced by transduction
of the vector, are also a feature of the invention.
[0057] The invention also includes compositions produced by
digesting one or more of the nucleic acids described herein with a
restriction endonuclease, an RNAse, or a DNAse; and, compositions
produced by incubating one or more nucleic acids described herein
in the presence of deoxyribonucleotide triphosphates and a nucleic
acid polymerase, e.g., a thermostable polymerase.
[0058] The invention also includes compositions comprising two or
more nucleic acids described herein. The composition may comprise a
library of nucleic acids, where the library contains at least 5,
10, 20 or 50 or more nucleic acids.
[0059] In another aspect, the invention includes an isolated or
recombinant polypeptide encoded by any nucleic acid described
herein. In one embodiment, the polypeptide may comprise a sequence
selected from any of SEQ ID NOS:48-94, 174-252, 263-272, and
283-293. These sequences and fragments thereof can be present
separately or as components of larger proteins such as fusion
proteins.
[0060] Any polypeptide described herein optionally can effect or
alter an immune response, e.g., either induce or inhibit
proliferation or activation of T cells. In other embodiments, any
polypeptide described above can bind preferentially either CD28 or
CTLA-4 or both CD28 and CTLA-4 as described herein. In other
embodiments, any polypeptide described herein optionally can
enhance or limit cytokine production as described herein.
Nucleotides encoding any such polypeptides having these properties
are also a feature of the invention.
[0061] In one class of embodiments, any polypeptide described
herein may further include a secretion signal or localization
signal sequence, e.g., a signal sequence, an organelle targeting
sequence, a membrane localization sequence, and the like. Any
polypeptide described herein may further include a sequence that
facilitates purification, e.g., an epitope tag (such as, e.g., a
FLAG epitope), a polyhistidine tag, a GST fusion, and the like. The
polypeptide optionally includes a methionine at the N-terminus. Any
polypeptide described herein optionally includes one or more
modified amino acids, such as a glycosylated amino acid, a
PEG-ylated amino acid, a farnesylated amino acid, an acetylated
amino acid, a biotinylated amino acid, a carboxylated amino acid, a
phosphorylated amino acid, an acylated amino acid, or the like. Any
polypeptide described herein further may be incorporated into a
fusion protein, e.g., a fusion with an immunoglobulin (Ig)
sequence.
[0062] Methods for producing the polypeptides of the invention are
also included. One such method comprises introducing into a
population of cells any NCSM nucleic acid described herein, which
is operatively linked to a regulatory sequence effective to produce
the encoded polypeptide, culturing the cells in a culture medium to
produce the polypeptide, and isolating the polypeptide from the
cells or from the culture medium. Another such method comprises
introducing into a population of cells a recombinant expression
vector comprising any NCSM nucleic acid described herein;
administering the expression vector into a mammal; and isolating
the polypeptide from the mammal or from a byproduct of the
mammal.
[0063] The invention also includes a method of treating an
autoimmune or allergic disorder in a subject in need of such
treatment by administering to the subject an effective amount of
any NCSM polypeptide (or polynucleotide or expression vector
encoding such polypeptide) described herein. In various
embodiments, the autoimmune disorder may be multiple sclerosis,
rheumatoid arthritis, lupus erythematosus, type I diabetes,
psoriasis and the like.
[0064] The invention also includes a method of enhancing or
reducing an immune response in a subject, such as either by
inducing or inhibiting T cell proliferation or activation, by
administration of at least one NCSM polypeptide and/or NCSM
polynucleotide described herein to a population of cells. The
population of cells to which the nucleic acid or polypeptide is
administered can be in vivo, ex vivo, or in vitro (e.g., cultured
cells). The invention includes a method of inducing, modifying, or
inhibiting T-cell proliferation, the method comprising contacting a
population of T cells with a polypeptide of the invention, thereby
inducing, modifying, or inhibiting, respectively, proliferation of
the T cells (relative to the response generated by WT hB7-1).
Polypeptides that induce such T cell proliferation include CD28BP
polypeptides; polypeptides that inhibit T cell proliferation
include the CTLA-4BP polypeptides and B7-1 and B7-2 polypeptide
variants discussed herein.
[0065] The invention also includes, in a method of treating a
disorder or medical condition treatable by administration of NCSM
polypeptides (or fragments thereof) or NCSM polynucleotides (or
fragments thereof) to a subject, an improvement comprising
administering to the subject an effective amount of a polypeptide
and/or nucleic acid (or fragments thereof) described herein. The
disorder, disease, or medical condition treatable by administration
of NCSM polypeptides and/or nucleic acids (or fragments thereof,
including soluble NCSMs and fusion proteins and vectors encoding
them) may be, but is not limited to, e.g., chronic disease,
autoimmune disorder, multiple sclerosis, rheumatoid arthritis,
lupus erythematosus, type I diabetes, psoriasis, AIDS or
AIDS-related complexes, allogeneic or xenogeneic grafts or
transplants, a variety of cancers, viral and/or bacterial
infections, or the like.
[0066] Also included is a method of therapeutic or prophylactic
treatment of a disease or disorder in a subject in need of such
treatment, comprising administering to the subject any NCSM
polypeptide described herein and an immunogen specific for said
disease or disorder, wherein the combined amount of polypeptide and
immunogen is effective to prophylactically or therapeutically treat
said disease or disorder.
[0067] In yet another aspect, the invention includes a method of
enhancing, diminishing, modifying, or potentiating an immune
response in a subject, comprising: directly administering to the
subject a polynucleotide comprising any NCSM nucleic acid sequence
described herein, operably linked to a promoter sequence that
controls the expression of said nucleic acid sequence, said
polynucleotide being present in an amount sufficient that uptake of
said polynucleotide into one or more cells of the subject occurs
and sufficient expression of said nucleic acid sequence results to
produce an amount of a polypeptide effective to enhance, diminish,
or modify an immune response.
[0068] In another aspect, the invention provides a method of
modulating or altering a T-cell response specific to an antigen in
a subject, the method comprising administering to the subject at
least one polynucleotide sequence encoding a polypeptide comprising
any of SEQ ID NOS:48-94, 174-252, 263-272 and 283-293 or fragment
thereof, and a polynucleotide sequence encoding the antigen or
antigenic fragment thereof, wherein each of the at least one
polynucleotide sequences is expressed in the subject in an amount
effective to modulate or alter a T cell response.
[0069] The invention also includes a method of modulating or
altering an immune response in a subject, the method comprising
introducing into cells of a tumor of the subject at least one
polynucleotide sequence encoding a polypeptide comprising any of
SEQ ID NOS:48-94, 174-252, 263-272 and 283-293 or fragment thereof,
wherein the polypeptide or fragment thereof interacts with or binds
to a T cell receptor when expressed in a subject, and wherein the
at least one polynucleotide sequence is operably linked to a
promoter for expression in the subject and is present in an amount
sufficient that when expressed is effective to modulate or alter a
T cell response.
[0070] In addition, the invention includes a vector comprising at
least one polynucleotide sequence encoding a polypeptide comprising
any of SEQ ID NOS:48-94, 174-252, 263-272 and 283-293 or fragment
thereof, wherein the polypeptide or fragment thereof interacts with
or binds to a T cell receptor when expressed in a subject, wherein
the at least one polynucleotide sequence is operably linked to a
promoter for expression in the subject and is present in an amount
sufficient that when expressed is effective to modulate or alter a
T cell response.
[0071] In another aspect, the invention provides vector comprising
at least one polynucleotide sequence encoding a polypeptide
comprising any of SEQ ID NOS:48-94, 174-252, 263-272 and 283-293 or
fragment thereof, and a polynucleotide sequence encoding the
antigen or antigenic fragment thereof, wherein the NCSM polypeptide
or fragment thereof interacts with or binds to a T cell receptor
when expressed in a subject, and wherein each of the at least one
polynucleotide sequences is operably linked to a promoter for
expression in the subject and is present in an amount sufficient
that when expressed is effective to modulate or alter a T cell
response.
[0072] In general, nucleic acids and proteins derived by mutation,
recursive sequence recombination (RSR) or other alterations of the
sequences herein are a feature of the invention. Similarly, those
produced by recombination, including recursive sequence
recombination, are a feature of the invention. Mutation and
recombination methods using the nucleic acids described herein are
a feature of the invention. For example, one method of the
invention includes recombining one or more nucleic acids described
herein with one or more additional nucleic acids (including, but
not limited to those noted herein), the additional nucleic acid
encoding a NCSM polypeptide, co-stimulatory homologue or
subsequence thereof. The recombining steps are optionally performed
in vivo, ex vivo, or in vitro. Also included in the invention are a
recombinant nucleic acid produced by this method, a cell containing
the recombinant nucleic acid, a nucleic acid library produced by
this method comprising recombinant polynucleotides, and a
population of cells containing the library comprising recombinant
polynucleotides.
[0073] The invention also includes a method of designing or
identifying agonists and antagonists of CD28 and CTLA-4 (which
either enhance or inhibit signaling through CD28 or CTLA-4) based
on the 3-dimensional structure of the polypeptides of the invention
(e.g., SEQ ID NOS:48-94, 174-252, 263-272, and 283-293).
[0074] The invention also includes soluble polypeptides and
proteins (including fusion polypeptides and proteins) and nucleic
acids encoding such soluble polypeptides and proteins. The
invention also includes the use of such polypeptides and proteins
as therapeutics, prophylactics, and diagnostics in therapeutic
treatment and/or prevention of a variety of diseases and
conditions. Soluble polypeptides and proteins (and nucleic acids
encoding them) include, e.g., extracellular domain (ECD) amino acid
sequences of each NCSM (e.g., each CTLA-4 binding protein and CD28
binding protein) described herein (or fragments thereof) and
nucleic acids encoding same, as well as constructs comprising,
e.g., each of said ECD, or fragments thereof, with an Ig
polypeptide sequence (or fragment or variant thereof) (and
nucleotide sequences encoding same) as fusion proteins. Some such
soluble polypeptides and proteins exhibit a CD28/CTLA-4 binding
affinity ratio that is greater than that of hB7-1 and/or have an
ability to induce a T cell proliferation response, in the presence
of activated T cells, that is less than that induced by soluble
hB7-1 polypeptide in the presence of activate T cells.
[0075] In another aspect, the invention provides a computer or
computer readable medium comprising a database comprising a
sequence record comprising one or more character strings
corresponding to a nucleic acid or protein sequence selected from
any of SEQ ID NOS:1-272 and 283-293. The invention further includes
an integrated system comprising a computer or computer readable
medium comprising a database comprising one or more sequence
records, each comprising one or more character strings
corresponding to a nucleic acid or protein sequence selected from
any of SEQ ID NOS:1-272 and 283-293, the integrated system further
comprising a user input interface allowing a user to selectively
view one or more sequence records. Also provided are methods of
using a computer system to present information pertaining to at
least one of a plurality of sequence records stored in a database,
said sequence records each comprising one or more character strings
corresponding to any of SEQ ID NOS:1-272 and 283-293.
[0076] These and other objects and features of the invention will
become more fully apparent when the following detailed description
is read in conjunction with the accompanying figures.
BRIEF DESCRIPTION OF THE FIGURES
[0077] FIG. 1A is a schematic representation of the following
exemplary interactions: 1) interactions between a T cell receptor
(TCR) and antigenic peptide presented in the groove of a major
histocompatibility complex (MHC) molecule, and 2) interactions
between a recombinant CD28BP polypeptide of the invention expressed
on the surface of an antigen-presenting cell (APC) and a CD28
receptor on a T cell. FIG. 1B is a schematic representation of
exemplary interactions: 1) between a TCR and antigenic peptide
presented in the groove of a MHC molecule, and 2) between a
recombinant CTL BP polypeptide of the invention expressed on the
surface of an APC and a CTLA-4 receptor on a T cell. The
representation illustrates the principle by which recombinant
polypeptides of the invention which preferentially bind the CD28 or
CTLA-4 receptor effectuate enhanced or suppressed T cell
activation.
[0078] FIGS. 2A-2H depict an alignment of a naturally-occurring
(i.e., wild-type) human B7-1 polypeptide sequence (SEQ ID NO:278)
and exemplary CD28BP polypeptide sequences of the invention (SEQ ID
NOS:48-68, SEQ ID NOS:174-221, and SEQ ID NO:283). The predicted
boundaries between the signal peptide region, extracellular domain
(ECD), transmembrane domain (TMD), and cytoplasmic domain (CD),
based on corresponding boundaries in the hB7-1 sequence are shown
at the top. SEQ ID NO:283 represents a "consensus sequence" of
these aligned CD28BP sequences. The arrow positioned between the
amino acid residues equivalent to amino acid residues 34-35 of SEQ
ID NO:278, indicates the predicted boundary between the signal
peptide region and the mature polypeptide region based on
comparison with the hB7-1 sequence.
[0079] FIGS. 3A-3H illustrate an alignment of a naturally-occurring
(i.e., wild-type) hB7-1 polypeptide sequence (SEQ ID NO: 278) and
exemplary CTLA-4BP polypeptide sequences of the invention (SEQ ID
NOS: 69-73, SEQ ID NOS:74-92, SEQ ID NO:222-252, and SEQ ID
NO:286). The predicted boundaries between the signal peptide
sequence, ECD, TMD, and CD, based on corresponding boundaries in
the hB7-1 sequence are shown at the top.
[0080] SEQ ID NO:286 represents a "consensus sequence" of these
aligned CTLA-4BP sequences of the invention. Alignments shown in
FIGS. 2A-2H and 3A-3H were prepared using the CLUSTALW multiple
sequence alignment program, a part of the Vector NTI version 6
sequence analysis software package (Informax, Bethesda, Md.).
CLUSTALW initially performs multiple pairwise comparisons between
groups of sequences and then assembles the pairwise alignments into
a multiple alignment based on homology. For the initial pairwise
alignments, Gap Open and Gap Extension penalties were 10 and 0.1,
respectively. For the multiple alignments, Gap Open penalty was 10,
and the Gap Extension penalty was 0.05. The BLOSUM62 matrix was the
protein weight matrix.
[0081] FIGS. 4A-4D presents graphs illustrating competitive FACS
binding profiles of hB7-1, clone CD28BP-15, clone CTLA-4BP
5.times.4-12c, and vector control for each of soluble CD28-Ig
receptor and soluble CTLA-4-Ig receptor.
[0082] FIG. 5 presents graphs depicting competitive FACS binding
profiles of seventeen Round 2 CD28BP clones for each of soluble
CD28-Ig receptor and soluble CTLA-4-Ig receptor.
[0083] FIG. 6A is a schematic representation of an exemplary
competitive FACS binding profile for a CTLA-4BP clone for soluble
CD28-Ig receptor and soluble CTLA-4-Ig receptor. FIG. 6B is a
schematic representation of an exemplary competitive FACS binding
profile for a CD284BP clone for soluble CD28-Ig receptor and
soluble CTLA-4-Ig receptor.
[0084] FIGS. 7A-7H are graphs showing competitive FACS binding
profiles of WT human B7-1 (CD80), five CTLA-4BP clones, and HEK 293
cells (control) for soluble CD28-Ig receptor and soluble CTLA-4-Ig
receptor.
[0085] FIGS. 8A-8B present schematic representations of the amino
acid sequences of CD28BP-12 and CTLA-4BP 5.times.4-12c and the
genealogy of these sequences.
[0086] FIGS. 9A-9F are graphs depicting the mean fluorescence
intensities generated by the binding of labeled soluble ligand
sCD28-Ig and labeled soluble ligand sCTLA4-Ig to clones CD28BP-15
and CTLA-4BP 5.times.4-12c. FIGS. 9G-9H provide graphs illustrating
histograms from the staining of stable 293 transfectants expressing
CTLA-4BP 5.times.4-12c (gray histograms), hB7-1 (gray histograms)
and negative control transfectants (open histograms) with
anti-hB7-1 monoclonal antibodies (mAbs) with expression levels
analyzed by flow cytometry.
[0087] FIG. 10 shows a graph depicting T cell proliferation
response, as measured by .sup.3H thymidine incorporation, resulting
from the co-culturing of cells transfected with one of seventeen
CD28BP clones, human B7-1 (CD80), or an empty control vector
cultured with anti-CD3 mAbs.
[0088] FIGS. 11A-11C present graphs illustrating improved
co-stimulation of purified human T cells observed co-culturing
irradiated 293 cells transiently (A) or stably (B) transfected with
clone CD28BP-15, hB7-1, or a control vector with purified T cells
and anti-CD3 mAbs. FIG. 11C shows a graph depicting levels of
IFN-gamma produced by co-culturing irradiated stable transfectants
expressing CD28BP or hB7-1 or negative control cells transfected
with an "empty" vector with purified human T cells.
[0089] FIG. 12 shows a graph depicting T cell proliferation
response, as measured by .sup.3H thymidine incorporation, resulting
from the co-culturing of cells transfected with one of nineteen
CTLA-4BP clones, WT human B7-1 (CD80), or an empty control vector
cultured with soluble anti-CD3 mAbs.
[0090] FIGS. 13A-13D show graphs illustrating the effects of cells
transfected with clone CTLA-4 BP 5.times.4-12C, hB7-1 or a control
vector cultured on T cell proliferation induced by co-culturing the
transfectants with purified T cells in the presence of soluble
anti-CD3 mAbs and on cytokine synthesis in mixed lymphocyte
reaction assay.
[0091] FIGS. 14A-14B are schematic representations of exemplary
soluble forms of human B7-1 molecules. Expression plasmids were
constructed by juxtaposing the nucleotide sequence encoding a
signal sequence and extracellular domain (ECD) (or ECD fragment) of
WT hB7-1 with a nucleotide sequence encoding E epitope and/or His
Tag or human Ig Fc domain to create a IgG fusion protein. FIG. 14A
shows a representation of a fusion protein expressed by one such
plasmid comprising a soluble WT human B7-1-ECD, including a signal
sequence peptide (amino acid residues 1-34), ECD (amino acid
residues 35-242), and E-epitope tag (amino acid residues 243-259)
and His-tag (amino acid residues 260-268). Numbering coincides with
the ATG or Met. The amino acid residues positioned at the beginning
and end of an exemplary ECD amino acid sequence are shown. FIG. 14B
is an illustration of a fusion protein expressed by one such
plasmid comprising a soluble WT hB7-1-ECD-Ig fusion protein,
including the signal domain (amino acid residues 1-34), ECD domain
(amino acid residues 35-242), Factor Xa (IGER), valine-threonine
(VT) or (BsetII) glycine-valine-threonine (GVT) linker, and hinge
CH2--CH3 (constant/heavy) region of the Fc domain of IgG1 (e.g.,
GenBank Access. No. P01857 or X70421) (showing the initial amino
acid residues corresponding to nucleic acid sequence shown at
GenBank Accession No. X70421). The amino acid residues positioned
at the beginning and end of an exemplary ECD amino acid sequence
are shown. Optionally, other Ig molecules, or Ig Fc fragments
thereof, can used to construct NCSM-Ig fusion proteins. Similar
expression plasmids were constructed by substituting a nucleotide
sequence encoding a NCSM polypeptide of the invention for the
sequence encoding the hB7-1 ECD domain, and fusion proteins
comprising NCSM-ECD sequences were generated from such plasmids. A
nucleotide sequence encoding truncated ECD domain of hB7-1 or a
NCSM polypeptide can also be substituted. The signal sequence may
be the WT hB7-1 signal sequence or a recombinant signal sequence
from a recombinant NCSM polynucleotide. The B7-1- or NCSM-ECD-Ig
fusion protein may include Factor Xa cleavage site.
[0092] FIG. 15 illustrates an example of a pNCSMsECD plasmid
expression vector comprising a nucleotide sequence encoding a
soluble extracellular domain of a NCSM polypeptide of the invention
with an E-epitope tag and/or histidine tag.
[0093] FIG. 16 is a photographic representation of a sodium
dodecylsulfate polyacrylamide gel electrophoresis (SDS-PAGE)
analysis of various soluble forms of WT B7-1 (ECD and fusion
protein and delta Cys mutant) and clone CD28BP-15. Molecular weight
standards are shown on the left for comparison: myosin (185 kDa);
phosphorylase B (98 kDa); glutamic dehydrogenase (52 kDa); carbonic
anhydrase (31 kDa); myoglobin (19 kDa); and lysozyme (11 kDa).
[0094] FIG. 17 illustrates an example of a phB7-1ECD-Ig plasmid
expression vector comprising a nucleotide sequence encoding a
soluble extracellular domain of a human B&-1/IgG1 Fc domain
fusion protein. A nucleotide sequence encoding the extracellular
domain of a NCSM polypeptide (or fragment thereof) can be
substituted for the human B7-1-ECD sequence.
[0095] FIG. 18 is a photographic representation of an SDS-PAGE gel
analysis of affinity purified CD28BP-15 ECD-Ig, CTLA-4BP
5.times.4-12C ECD-Ig, and WT human B7-1 ECD-Ig fusion proteins.
Molecular weight standards are shown on the left.
[0096] FIG. 19 is a photograph of a Western blot analysis.
[0097] FIGS. 20A and 20E are graphs depicting T cell proliferation
responses (measured via .sup.3H thymidine uptake (counts per minute
(CPM)) generated by co-culturing various crosslinked (multimeric)
soluble NCSM-ECD fusion proteins and hB7-1-ECD fusion proteins with
purified T cells in the presence of soluble anti-CD3 mAbs. FIG. 20B
is a graph depicting T cell proliferation responses generated by
co-culturing various non-crosslinked soluble NCSM-ECD with
peripheral blood mononuclear cells (PBMCs). FIGS. 20C and 20D are
graphs depicting T cell proliferation responses induced by
co-culturing various non-crosslinked soluble NCSM-ECDs with PBMC
and phytohemagglutinin (PHA). FIG. 20F is a graph depicting
proliferation of T cells, measuring .sup.3H thymidine uptake in a
mixed lymphocyte reaction.
[0098] FIG. 21 illustrates an exemplary pMaxVax10.1 plasmid
expression vector.
[0099] FIG. 22A illustrates an exemplary pMaxVax10.1 plasmid
expression vector that comprises a nucleotide sequence encoding a
CD28BP polypeptide. FIG. 22B illustrates a bicistronic pMaxVax10.1
plasmid expression vector that comprises a nucleotide sequence
encoding a CD28BP polypeptide and a nucleotide sequence encoding
the cancer antigen EpCam/KSA. Positions of various components of
the vectors, including the promoter(s), kanamycin resistant gene,
ColE1 replication of origin, BGH poly A adenylation sequences and
restriction sites are shown.
[0100] FIGS. 23A-23B are histograms depicting the binding of
full-length hB7-1-Tyr65His variant, CTLA-4BP 5.times.4-12c (gray
histogram), and hB7-1 (gray histogram) to either soluble CD28-Ig or
CTLA-4-Ig.
[0101] FIG. 24 shows a T cell proliferation assay (.sup.3H
thymidine uptake measured in counts per minute) using 293 HEK cells
transfected with pCDNA or with a nucleic acid sequence encoding
full-length hB7-1 (SEQ ID NO:278), hB7-1-Tyr65His polypeptide
variant, full-length CTLA-4BP 5.times.4-12c (SEQ ID NO:39) (clone
12c), or full-length CD28BP-15 (SEQ ID NO:19); 293 cells alone
(with no DNA) were also assayed for their ability to induce human
T-cell proliferation.
[0102] FIGS. 25A-25C are graphs depicting T cell proliferation
responses generated by co-culturing PBMCs, tetanus toxoid (antigen)
and increasing concentrations of soluble proteins of
non-crosslinked CD28BP-15-ECD-Ig, CD28BP-15-ECD, WT huB7.1-ECD-Ig,
WT huB7.1-ECD, commercial CTLA-4-Ig receptor/ligand (R&D
Systems), and control human IgG antibody.
DETAILED DESCRIPTION OF THE INVENTION
[0103] The expression of B7-1 has been shown to be an important
mechanism of immune responses in mammals, including humans. It is
believed that at least two signals are required for activation of T
cells by antigen-bearing target cells: 1) an antigen-specific
signal, delivered through the T cell receptor (TCR); and 2) an
antigen-independent or co-stimulatory signal that leads to the
production of lymphokine products (Hodge et al. (1994) Cancer Res.
54:5552-5555). B7-1, which is typically expressed on
antigen-presenting cells (APC), has been determined to be a ligand
for two T cell surface antigen receptors: CD28 and CTLA-4. Both
receptors are present on T cells, although they are expressed at
different times and in different amounts. T cell activation is a
prerequisite for all specific immune responses. However, if only
one T cell activation signal is received by a T cell, activation
will likely not occur, and anergy may result. For example, many
tumor cells do not express B7-1. Consequently, even when a tumor
cell expresses a potential rejection antigen, it is not likely that
it will be able to activate an antitumor T cell response. Id. For T
cell activation and enhanced immune response, an additional
antigen-independent signal, such as from B7-1, is believed
necessary.
[0104] The human CD28 receptor and human CTLA-4 receptor are
naturally activated in human cells by B7-1. In some studies, the
reported binding affinities of CTLA-4 and CD28 to WT hB7-1 were
found to be about 0.2-0.4.times.10.sup.-6M and about
4.times.10.sup.-6 M, respectively (van der Merwe et al. (1997) J.
Exp. Med. 185:393; Ikemizu et al. (2000) Immunity 12:51). However,
different studies have reported different binding affinities.
[0105] The amino acid sequence of full-length WT hB7-1 comprises
288 amino acids (GenBank Protein Access. No. P33681) (SEQ ID
NO:278). The signal peptide of WT hB7-1 (which is cleaved in the
secreted form) typically comprises amino acid residues 1-34, the
extracellular domain (ECD) comprises amino acid residues 35-242,
the transmembrane domain comprises amino acid residues 243-263, and
the cytoplasmic domain comprises amino acid residues 264-288. The
mature form of hB7-1, which has a total of 254 amino acids,
comprises amino acid residues 35-288 (the full-length sequence
without the signal peptide), and begins with the amino acid
sequence: valine-isoleucine-histidine-valine. If desired, the amino
acids of the mature form can be numbered beginning with the Val of
the Val-Ile-His-Val sequence, designating Val as the first residue
(e.g., the ECD comprises amino acid residues numbered 1-208). In
another aspect, the ECD of hB7-1 comprises amino acid residues
1-208, the transmembrane domain comprises amino acid residues
209-235, and the cytoplasmic domain comprises amino acid residues
236-254 of the full-length mature hB7-1 sequence when numbered
beginning with the Val of the Val-Ile-His-Val sequence of the
mature sequence as described above. See, e.g., U.S. Pat. No.
6,071,716. There are eight possible glycosylation sites
(Asn-X-Ser/Thr) in hB7-1 ECD. The transmembrane domain includes at
least 3 cysteine residues that may be involved in binding to other
polypeptides or lipid derivatization. Id.
[0106] In yet another aspect, for hB7-1, the ECD comprises amino
acid residues 35-251, the TMD comprises amino acid residues
252-267, and the CD comprises amino acid residues 268-288. From the
full-length NCSM polypeptides set forth herein, the subsequences
corresponding to the signal peptide, ECD, TMD, and CD of the NCSM
polypeptide, respectively, can be determined as described in
greater detail below by, e.g., alignment of the NCSM amino acid
sequence with hB7-1 amino acid sequence or by using known methods
to predict the location and/or cleavage sites of such sequences
(e.g., methods to predict signal peptide cleavage sites, computer
program to determine, e.g., regions of hydrophobicity corresponding
to the amino acid residues of a TMD, etc.). According to one study,
the nucleic acid sequence of WT hB7-1 comprises 1491 base pairs and
is set forth in U.S. Pat. No. 6,071,716 (see SEQ ID NO:1 therein).
An alignment of the hB7-1 nucleic acid sequence with its
corresponding full-length amino acid sequence is also shown in U.S.
Pat. No. 6,071,716 (see SEQ ID NO:1 therein).
[0107] Using the nucleotide sequences of human B7-1 and other
selected mammalian B7-1 molecules, we generated recombination
nucleotides encoding recombinant chimeric co-stimulatory peptides
molecules having altered properties as compared those of WT hB7.
This embodiment and others are described in detail below. FIG. 1
illustrates an interaction between an NCSM molecule of the
invention, as expressed of an APC cell, and corresponding receptor,
expressed on a T cell.
DEFINITIONS
[0108] Unless otherwise defined herein or below in the remainder of
the specification, all technical and scientific terms used herein
have the same meaning as commonly understood by those of ordinary
skill in the art to which the invention belongs.
[0109] A "polynucleotide sequence" is a nucleic acid which
comprises a polymer of nucleic acid residues or nucleotides
(A,C,T,U,G, etc. or naturally occurring or artificial nucleotide
analogues), or a character string representing a nucleic acid,
depending on context. Either the given nucleic acid or the
complementary nucleic acid can be determined from any specified
polynucleotide sequence.
[0110] A "polypeptide sequence" is a polymer of amino acids (a
protein, polypeptide, etc., comprising amino acid residues) or a
character string representing an amino acid polymer, depending on
context. Given the degeneracy of the genetic code, one or more
nucleic acids, or the complementary nucleic acids thereof, that
encode a specific polypeptide sequence can be determined from the
polypeptide sequence.
[0111] A nucleic acid, protein, peptide, polypeptide, or other
component is "isolated" when it is partially or completely
separated from components with which it is normally associated
(other peptides, polypeptides, proteins (including complexes, e.g.,
polymerases and ribosomes which may accompany a native sequence),
nucleic acids, cells, synthetic reagents, cellular contaminants,
cellular components, etc.), e.g., such as from other components
with which it is normally associated in the cell from which it was
originally derived. A nucleic acid, polypeptide, or other component
is isolated when it is partially or completely recovered or
separated from other components of its natural environment such
that it is the predominant species present in a composition,
mixture, or collection of components (i.e., on a molar basis it is
more abundant than any other individual species in the
composition). In preferred embodiments, the preparation consists of
more than about 70% or 75%, typically more than about 80%, or
preferably more than about 90% of the isolated species.
[0112] In one aspect, a "substantially pure" or "isolated" nucleic
acid (e.g., RNA or DNA), polypeptide, protein, or composition also
means where the object species (e.g., nucleic acid or polypeptide)
comprises at least about 50, 60, or 70 percent by weight (on a
molar basis) of all macromolecular species present. A substantially
pure or isolated composition can also comprise at least about 80,
90, or 95 percent by weight of all macromolecular species present
in the composition. An isolated object species can also be purified
to essential homogeneity (contaminant species cannot be detected in
the composition by conventional detection methods) wherein the
composition consists essentially of derivatives of a single
macromolecular species. The term "purified" generally denotes that
a nucleic acid, polypeptide, or protein gives rise to essentially
one band in an electrophoretic gel. It typically means that the
nucleic acid, polypeptide, or protein is at least about 50% pure,
60% pure, 70% pure, 75% pure, more preferably at least about 85%
pure, and most preferably at least about 99% pure.
[0113] The term "isolated nucleic acid" may refer to a nucleic acid
(e.g., DNA or RNA) that is not immediately contiguous with both of
the coding sequences with which it is immediately contiguous (i.e.,
one at the 5' and one at the 3' end) in the naturally occurring
genome of the organism from which the nucleic acid of the invention
is derived. Thus, this term includes, e.g., a cDNA or a genomic DNA
fragment produced by polymerase chain reaction (PCR) or restriction
endonuclease treatment, whether such cDNA or genomic DNA fragment
is incorporated into a vector, integrated into the genome of the
same or a different species than the organism, including, e.g., a
virus, from which it was originally derived, linked to an
additional coding sequence to form a hybrid gene encoding a
chimeric polypeptide, or independent of any other DNA sequences.
The DNA may be double-stranded or single-stranded, sense or
antisense.
[0114] The term "recombinant" when used with reference, e.g., to a
cell, nucleotide, vector, protein, or polypeptide typically
indicates that the cell, nucleotide, or vector has been modified by
the introduction of a heterologous (or foreign) nucleic acid or the
alteration of a native nucleic acid, or that the protein or
polypeptide has been modified by the introduction of a heterologous
amino acid, or that the cell is derived from a cell so modified.
Recombinant cells express nucleic acid sequences (e.g., genes) that
are not found in the native (non-recombinant) form of the cell or
express native nucleic acid sequences (e.g., genes) that would be
abnormally expressed under-expressed, or not expressed at all. The
term "recombinant" when used with reference to a cell indicates
that the cell replicates a heterologous nucleic acid, or expresses
a peptide or protein encoded by a heterologous nucleic acid.
Recombinant cells can contain genes that are not found within the
native (non-recombinant) form of the cell. Recombinant cells can
also contain genes found in the native form of the cell wherein the
genes are modified and re-introduced into the cell by artificial
means. The term also encompasses cells that contain a nucleic acid
endogenous to the cell that has been modified without removing the
nucleic acid from the cell; such modifications include those
obtained by gene replacement, site-specific mutation, and related
techniques.
[0115] A "recombinant polynucleotide" or a "recombinant
polypeptide" is a non-naturally occurring polynucleotide or
polypeptide that includes nucleic acid or amino acid sequences,
respectively, from more than one source nucleic acid or
polypeptide, which source nucleic acid or polypeptide can be a
naturally occurring nucleic acid or polypeptide, or can itself have
been subjected to mutagenesis or other type of modification. A
nucleic acid or polypeptide may be deemed "recombinant" when it is
artificial or engineered, or derived from an artificial or
engineered polypeptide or nucleic acid. A recombinant nucleic acid
(e.g., DNA or RNA) can be made by the combination (e.g., artificial
combination) of at least two segments of sequence that are not
typically included together, not typically associated with one
another, or are otherwise typically separated from one another. A
recombinant nucleic acid can comprise a nucleic acid molecule
formed by the joining together or combination of nucleic acid
segments from different sources and/or artificially synthesized. A
"recombinant polypeptide" (or "recombinant protein") often refers
to a polypeptide (or protein) that results from a cloned or
recombinant nucleic acid or gene. The source polynucleotides or
polypeptides from which the different nucleic acid or amino acid
sequences are derived are sometimes homologous (i.e., have, or
encode a polypeptide that encodes, the same or a similar structure
and/or function), and are often from different isolates, serotypes,
strains, species, of organism or from different disease states, for
example.
[0116] The term "recombinantly produced" refers to an artificial
combination usually accomplished by either chemical synthesis
means, recursive sequence recombination of nucleic acid segments or
other diversity generation methods (such as, e.g., shuffling) of
nucleotides, or manipulation of isolated segments of nucleic acids,
e.g., by genetic engineering techniques known to those of ordinary
skill in the art. "Recombinantly expressed" typically refers to
techniques for the production of a recombinant nucleic acid in
vitro and transfer of the recombinant nucleic acid into cells in
vivo, in vitro, or ex vivo where it may be expressed or
propagated.
[0117] A "recombinant expression cassette" or simply an "expression
cassette" is a nucleic acid construct, generated recombinantly or
synthetically, with nucleic acid elements that are capable of
effecting expression of a structural gene in hosts compatible with
such sequences. Expression cassettes include at least promoters and
optionally, transcription termination signals. Typically, the
recombinant expression cassette includes a nucleic acid to be
transcribed (e.g., a nucleic acid encoding a desired polypeptide),
and a promoter. Additional factors necessary or helpful in
effecting expression may also be used as described herein. For
example, an expression cassette can also include nucleotide
sequences that encode a signal sequence that directs secretion of
an expressed protein from the host cell. Transcription termination
signals, enhancers, and other nucleic acid sequences that influence
gene expression, can also be included in an expression
cassette.
[0118] By "immune response" is intended an alteration of an
organism's or subject's immune system in response to an
immunomodulatory agent, immunogen, or antigen that may include, but
is not limited to, antibody production, induction of cell-mediated
immunity, complement activation, development of immunological
tolerance, inhibition of an immune response, or breaking of
immunological tolerance. An "immunomodulatory agent" or
"immunomodulatory molecule" modulates an immune response. An
"immunogen" refers generally to a substance capable of provoking or
altering an immune response, and includes, but is not limited to,
e.g., immunogenic proteins, polypeptides, and peptides; antigens
and antigenic peptide fragments thereof; and nucleic acids having
immunogenic properties or encoding, e.g., polypeptides having such
properties.
[0119] An "immunogen" refers to a substance capable of provoking an
immune response, and includes, e.g., antigens, autoantigens that
play a role in induction of autoimmune diseases, and
tumor-associated antigens expressed on cancer cells. An immune
response generally refers to the development of a cellular or
antibody-mediated response to an agent, such as an antigen or
fragment thereof or nucleic acid encoding such agent. In some
instances, such a response comprises a production of at least one
or a combination of CTLs, B cells, or various classes of T cells
that are directed specifically to antigen-presenting cells
expressing the antigen of interest.
[0120] By "modulation" or "modulating" an immune response of a
subject is intended that the immune response of the subject is
altered. For example, "modulation" or "modulating" an immune
response of a subject means, e.g., that the immune response is
stimulated, invoked, decreased, increased, enhanced, or otherwise
altered. The immunological response may be skewed or shifted from
Th1 to Th2 or vice versa to optimize protection and reduce unwanted
side effects of the immunological response. An immunomodulatory
agent or molecule modulates an immune response. An immunomodulatory
agent has an immunomodulatory activity. A modulated immune response
of a subject to whom an immunomodulatory agent is administered
differs from the immune response of an untreated subject to whom
the immunomodulatory has not been administered by 0.1%, 0.5%, 1%,
5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, or more.
Modulation of an immune response in a subject can be assessed by
means known to those skilled in the art, including those described
below.
[0121] "Tolerance" refers to a state of diminished or lack of
immunological responsiveness. Tolerance typically defines an absent
or diminished or lessened capacity of a subject to mount an immune
response against a given antigen, usually the result of, e.g.,
contact between the subject and a target antigen under
non-immunizing conditions.
[0122] "Anergy" refers to a state of diminished reactivity to one
or more antigens. For example, anergy state is often characterized
by diminished T cell responses, e.g., proliferation or IL-2
production, when specific T cells are restimulated under otherwise
stimulatory conditions.
[0123] An "antigen" refers to a substance that is capable of
inducing an immune response (e.g., humoral and/or cell-mediated) in
a host, including, but not limited to, eliciting the formation of
antibodies in a host, or generating a specific population of
lymphocytes reactive with that substance. Antigens are typically
macromolecules (e.g., proteins and polysaccharides) that are
foreign to the host.
[0124] A "subsequence" or "fragment" is any portion of an entire
sequence, up to and including the complete sequence. Thus, a
"subsequence" refers to a sequence of nucleic acids or amino acids
that comprises a part of a longer sequence of nucleic acids (e.g.,
polynucleotide) or amino acids (e.g., polypeptide)
respectively.
[0125] An "adjuvant" refers to a substance that enhances an immune
response, including, for example, but not limited to, an antigen's
immune-stimulating properties or the pharmacological effect(s) of a
compound or drug. An adjuvant may non-specifically enhance an
immune response, e.g., the immune response to an antigen. "Freund's
Complete Adjuvant," for example, is an emulsion of oil and water
containing an immunogen, an emulsifying agent and mycobacteria.
Another example, "Freund's incomplete adjuvant," is the same, but
without mycobacteria. An adjuvant may comprise oils, emulsifiers,
killed bacteria, aluminum hydroxide, or calcium phosphate (e.g., in
gel form), or combinations thereof. An adjuvant may be administered
into a subject (e.g., via injection intramuscularly or
subcutaneously) in an amount sufficient to produce antibodies.
[0126] Numbering of a given amino acid polymer or nucleotide
polymer "corresponds to numbering" of a selected amino acid polymer
or nucleic acid polymer when the position of any given polymer
component (e.g., amino acid residue, nucleotide residue) is
designated by reference to the same or an equivalent residue
position in the selected amino acid or nucleotide polymer, rather
than by the actual position of the component in the given polymer.
Thus, for example, the numbering of a given amino acid position in
a given polypeptide sequence corresponds to the same or equivalent
amino acid position in a selected polypeptide sequence used as a
reference sequence.
[0127] A vector is a component or composition for facilitating cell
transduction or transfection by a selected nucleic acid, or
expression of the nucleic acid in the cell. Vectors include, e.g.,
plasmids, cosmids, viruses, YACs, bacteria, poly-lysine, etc. An
"expression vector" is a nucleic acid construct or sequence,
generated recombinantly or synthetically, with a series of specific
nucleic acid elements that permit transcription of a particular
nucleic acid in a host cell. The expression vector can be part of a
plasmid, virus, or nucleic acid fragment. The expression vector
typically includes a nucleic acid to be transcribed operably linked
to a promoter. The nucleic acid to be transcribed is typically
under the direction or control of the promoter.
[0128] "Substantially the entire length of a polynucleotide
sequence" or "substantially the entire length of a polypeptide
sequence" refers to at least about 50%, generally at least about
60%, 70%, or 75%, usually at least about 80%, or typically at least
about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or
more of a length of a polynucleotide sequence or polypeptide
sequence.
[0129] "Naturally occurring" as applied to an object refers to the
fact that the object can be found in nature as distinct from being
artificially produced by man. A polypeptide or polynucleotide
sequence that is present in an organism (including viruses,
bacteria, protozoa, insects, plants or mammalian tissue) that can
be isolated from a source in nature and which has not been
intentionally modified by man in the laboratory is naturally
occurring. Non-naturally occurring as applied to an object means
that the object is not naturally-occurring--i.e., the object cannot
be found in nature as distinct from being artificially produced by
man.
[0130] The term "immunoassay" includes an assay that uses an
antibody or immunogen to bind or specifically bind an antigen. The
immunoassay is typically characterized by the use of specific
binding properties of a particular antibody to isolate, target,
and/or quantify the antigen.
[0131] The term "homology" generally refers to the degree of
similarity between two or more structures. The term "homologous
sequences" refers to regions in macromolecules that have a similar
order of monomers. When used in relation to nucleic acid sequences,
the term "homology" refers to the degree of similarity between two
or more nucleic acid sequences (e.g., genes) or fragments thereof.
Typically, the degree of similarity between two or more nucleic
acid sequences refers to the degree of similarity of the
composition, order, or arrangement of two or more nucleotide bases
(or other genotypic feature) of the two or more nucleic acid
sequences. The term "homologous nucleic acids" generally refers to
nucleic acids comprising nucleotide sequences having a degree of
similarity in nucleotide base composition, arrangement, or order.
The two or more nucleic acids may be of the same or different
species or group. The term "percent homology" when used in relation
to nucleic acid sequences, refers generally to a percent degree of
similarity between the nucleotide sequences of two or more nucleic
acids.
[0132] When used in relation to polypeptide (or protein) sequences,
the term "homology" refers to the degree of similarity between two
or more polypeptide (or protein) sequences (e.g., genes) or
fragments thereof. Typically, the degree of similarity between two
or more polypeptide (or protein) sequences refers to the degree of
similarity of the composition, order, or arrangement of two or more
amino acid of the two or more polypeptides (or proteins). The two
or more polypeptides (or proteins) may be of the same or different
species or group. The term "percent homology" when used in relation
to polypeptide (or protein) sequences, refers generally to a
percent degree of similarity between the amino acid sequences of
two or more polypeptide (or protein) sequences. The term
"homologous polypeptides" or "homologous proteins" generally refers
to polypeptides or proteins, respectively, that have amino acid
sequences and functions that are similar. Such homologous
polypeptides or proteins may be related by having amino acid
sequences and functions that are similar, but are derived or
evolved from different or the same species using the techniques
described herein.
[0133] The term "subject" as used herein includes, but is not
limited to, an organism; a mammal, including, e.g., a human,
non-human primate (e.g., baboon, orangutan, monkey), mouse, pig,
cow, goat, cat, rabbit, rat, guinea pig, hamster, horse, monkey,
sheep, or other non-human mammal; a non-mammal, including, e.g., a
non-mammalian vertebrate, such as a bird (e.g., a chicken or duck)
or a fish, and a non-mammalian invertebrate.
[0134] The term "pharmaceutical composition" means a composition
suitable for pharmaceutical use in a subject, including an animal
or human. A pharmaceutical composition generally comprises an
effective amount of an active agent and a carrier, including, e.g.,
a pharmaceutically acceptable carrier.
[0135] The term "effective amount" means a dosage or amount
sufficient to produce a desired result. The desired result may
comprise an objective or subjective improvement in the recipient of
the dosage or amount.
[0136] A "prophylactic treatment" is a treatment administered to a
subject who does not display signs or symptoms of a disease,
pathology, or medical disorder, or displays only early signs or
symptoms of a disease, pathology, or disorder, such that treatment
is administered for the purpose of diminishing, preventing, or
decreasing the risk of developing the disease, pathology, or
medical disorder. A prophylactic treatment functions as a
preventative treatment against a disease or disorder. A
"prophylactic activity" is an activity of an agent, such as a
nucleic acid, vector, gene, polypeptide, protein, substance, or
composition thereof that, when administered to a subject who does
not display signs or symptoms of pathology, disease or disorder, or
who displays only early signs or symptoms of pathology, disease, or
disorder, diminishes, prevents, or decreases the risk of the
subject developing a pathology, disease, or disorder. A
"prophylactically useful" agent or compound (e.g., nucleic acid or
polypeptide) refers to an agent or compound that is useful in
diminishing, preventing, treating, or decreasing development of
pathology, disease or disorder.
[0137] A "therapeutic treatment" is a treatment administered to a
subject who displays symptoms or signs of pathology, disease, or
disorder, in which treatment is administered to the subject for the
purpose of diminishing or eliminating those signs or symptoms of
pathology, disease, or disorder. A "therapeutic activity" is an
activity of an agent, such as a nucleic acid, vector, gene,
polypeptide, protein, substance, or composition thereof, that
eliminates or diminishes signs or symptoms of pathology, disease or
disorder, when administered to a subject suffering from such signs
or symptoms. A "therapeutically useful" agent or compound (e.g.,
nucleic acid or polypeptide) indicates that an agent or compound is
useful in diminishing, treating, or eliminating such signs or
symptoms of a pathology, disease or disorder.
[0138] The term "gene" broadly refers to any segment of DNA
associated with a biological function. Genes include coding
sequences and/or regulatory sequences required for their
expression. Genes also include non-expressed DNA nucleic acid
segments that, e.g., form recognition sequences for other proteins
(e.g., promoter, enhancer, or other regulatory regions). Genes can
be obtained from a variety of sources, including cloning from a
source of interest or synthesizing from known or predicted sequence
information, and may include sequences designed to have desired
parameters.
[0139] Generally, the nomenclature used hereafter and the
laboratory procedures in cell culture, molecular genetics,
molecular biology, nucleic acid chemistry, and protein chemistry
described below are those well known and commonly employed by those
of ordinary skill in the art. Standard techniques, such as
described in Sambrook et al., Molecular Cloning--A Laboratory
Manual (2nd Ed.), Vols. 1-3, Cold Spring Harbor Laboratory, Cold
Spring Harbor, N.Y., 1989 (hereinafter "Sambrook") and Current
Protocols in Molecular Biology, F. M. Ausubel et al., eds., Current
Protocols, a joint venture between Greene Publishing Associates,
Inc. and John Wiley & Sons, Inc. (1994, supplemented through
1999) (hereinafter "Ausubel"), are used for recombinant nucleic
acid methods, nucleic acid synthesis, cell culture methods, and
transgene incorporation, e.g., electroporation, injection, gene
gun, impressing through the skin, and lipofection. Generally,
oligonucleotide synthesis and purification steps are performed
according to specifications. The techniques and procedures are
generally performed according to conventional methods in the art
and various general references which are provided throughout this
document. The procedures therein are believed to be well known to
those of ordinary skill in the art and are provided for the
convenience of the reader.
[0140] As used herein, an "antibody" refers to a protein comprising
one or more polypeptides substantially or partially encoded by
immunoglobulin genes or fragments of immunoglobulin genes. The term
antibody is used to mean whole antibodies and binding fragments
thereof. The recognized immunoglobulin genes include the kappa,
lambda, alpha, gamma, delta, epsilon and mu constant region genes,
as well as myriad immunoglobulin variable region genes. Light
chains are classified as either kappa or lambda. Heavy chains are
classified as gamma, mu, alpha, delta, or epsilon, which in turn
define the immunoglobulin classes, IgG, IgM, IgA, IgD and IgE,
respectively. A typical immunoglobulin (e.g., antibody) structural
unit comprises a tetramer. Each tetramer is composed of two
identical pairs of polypeptide chains, each pair having one "light"
(about 25 KDa) and one "heavy" chain (about 50-70 KDa). The
N-terminus of each chain defines a variable region of about 100 to
110 or more amino acids primarily responsible for antigen
recognition. The terms variable light chain (VL) and variable heavy
chain (VH) refer to these light and heavy chains, respectively.
[0141] Antibodies exist as intact immunoglobulins or as a number of
well characterized fragments produced by digestion with various
peptidases. Thus, for example, pepsin digests an antibody below the
disulfide linkages in the hinge region to produce F(ab)'2, a dimer
of Fab which itself is a light chain joined to VH-CH1 by a
disulfide bond. The F(ab)'2 may be reduced under mild conditions to
break the disulfide linkage in the hinge region thereby converting
the (Fab').sub.2 dimer into an Fab' monomer. The Fab' monomer is
essentially an Fab with part of the hinge region. The Fc portion of
the antibody molecule corresponds largely to the constant region of
the immunoglobulin heavy chain, and is responsible for the
antibody's effector function (see, Fundamental Immunology, W. E.
Paul, ed., Raven Press, N.Y. (1993), for a more detailed
description of other antibody fragments). While various antibody
fragments are defined in terms of the digestion of an intact
antibody, one of skill will appreciate that such Fab' fragments may
be synthesized de novo either chemically or by utilizing
recombinant DNA methodology. Thus, the term antibody, as used
herein also includes antibody fragments either produced by the
modification of whole antibodies or synthesized de novo using
recombinant DNA methodologies.
[0142] Antibodies also include single-armed composite monoclonal
antibodies, single chain antibodies, including single chain Fv
(sFv) antibodies in which a variable heavy and a variable light
chain are joined together (directly or through a peptide linker) to
form a continuous polypeptide, as well as diabodies, tribodies, and
tetrabodies (Pack et al. (1995) J Mol Biol 246:28; Biotechnol
11:1271; and Biochemistry 31:1579). The antibodies are, e.g.,
polyclonal, monoclonal, chimeric, humanized, single chain, Fab
fragments, fragments produced by an Fab expression library, or the
like.
[0143] The term "epitope" means a protein determinant capable of
specific binding to an antibody. Epitopes usually consist of
chemically active surface groupings of molecules such as amino
acids or sugar side chains and usually have specific three
dimensional structural characteristics, as well as specific charge
characteristics. Conformational and nonconformational epitopes are
distinguished in that the binding to the former but not the latter
is lost in the presence of denaturing solvents.
[0144] An "antigen-binding fragment" of an antibody is a peptide or
polypeptide fragment of the antibody that binds an antigen. An
antigen-binding site is formed by those amino acids of the antibody
that contribute to, are involved in, or affect the binding of the
antigen. See Scott, T. A. and Mercer, E. I., Concise Encyclopedia:
Biochemistry and Molecular Biology (de Gruyter, 3d ed. 1997), and
Watson, J. D. et al., Recombinant DNA (2d ed. 1992) [hereinafter
"Watson, Recombinant DNA"], each of which is incorporated herein by
reference in its entirety for all purposes.
[0145] The term "screening" describes, in general, a process that
identifies optimal molecules of the present invention, such as,
e.g., the NCSM polypeptide and proteins, fragments and homologues
thereof, and related fusion polypeptides and proteins including the
same, nucleic acids encoding all such molecules. Several properties
of these respective molecules can be used in selection and
screening, for example, an ability of a respective molecule to bind
to a receptor, to alter an immune response, e.g., induce or inhibit
a desired immune response, in a test system or an in vitro, ex vivo
or in vivo application (e.g., induce or inhibit a T cell
proliferation response in conjunction with costimulation of T cell
receptor/CD3 (by, e.g., an antigen or anti-CD3 antibody)), onto
bind a first receptor with equal, greater, or less binding affinity
relative to a second receptor compared to the binding affinity of a
control molecule (e.g., a wild-type B7-1 or co-stimulatory
molecule) for the first and second receptors, as measured by the
respective molecule's first receptor/second receptor binding
affinity ratio (or its reciprocal), compared to the control
molecule's first receptor/second receptor binding affinity ratio.
In the case of antigens, several properties of the antigen can be
used in selection and screening including antigen expression,
folding, stability, immunogenicity and presence of epitopes from
several related antigens. Selection is a form of screening in which
identification and physical separation are achieved simultaneously
by expression of a selection marker, which, in some genetic
circumstances, allows cells expressing the marker to survive while
other cells die (or vice versa). Screening markers include, for
example, luciferase, beta-galactosidase and green fluorescent
protein, and the like. Selection markers include drug and toxin
resistance genes, and the like. Because of limitations in studying
primary immune responses in vitro, in vivo or ex vivo studies are
particularly useful screening methods. In these studies, genetic
vaccines or expression vectors that include sequences encoding one
or more respective NCSM polypeptides, are first introduced to test
animals, and the immune responses are subsequently studied by
analyzing protective immune responses or by studying the quality or
strength of the induced immune response using lymphoid cells
derived from the immunized animal. Alternatively, the NCSM
polypeptide itself or a soluble form thereof (e.g., the ECD of the
polypeptide or a fragment thereof alone or in a fusion protein) is
introduced to the test animal. Although spontaneous selection can
and does occur in the course of natural evolution, in the present
methods selection is performed by man.
[0146] A "specific binding affinity" between two molecules, e.g., a
ligand and a receptor, means a preferential binding of one molecule
for another in a mixture of molecules. The binding of the molecules
is typically considered specific if the binding affinity is about
1.times.10.sup.2M.sup.-1 to about 1.times.10.sup.7 M.sup.-1 (i.e.,
about 10.sup.-7 M) or greater.
[0147] An "binding affinity ratio" refers to a relative ratio of
the binding affinity of a molecule of interest (e.g., a recombinant
ligand, such as a NSCM polypeptide) for a first molecule (e.g., a
first receptor, such as CD28 receptor) to the binding affinity of
the same molecule of interest to a second molecule (e.g., a second
receptor, such as CTLA-4 receptor). In one aspect, the relative
binding affinity ratio may be determined by visual inspection, such
as by, e.g., examining a FACS binding profile that displays the
binding affinity profile of the molecule of interest to both
receptors, and evaluating the degree of relative binding of the
molecule of interest to each of the first and second receptors. The
results of this determination can be compared with a similar
examination and evaluation of a FACS binding affinity profile
displaying the binding affinity of a control molecule (e.g.,
wild-type ligand, such as a WT human, primate, or mammalian B7-1)
to both receptors, wherein the degree of relative binding of the
control molecule to each of the receptors is evaluated. These and
other procedures described below can be used to determine a
CD28/CTLA-4 binding affinity ratio for a CD28BP polypeptide of the
present invention and a CTLA-4/CD28 binding affinity ratio for a
CTLA-4BP polypeptide of the present invention. Alternatively, a
binding affinity ratio can be determined by making a ratio between
a quantitative measurement of the binding affinity of the molecule
of interest (e.g., ligand) for the first receptor and a
quantitative measurement of the binding affinity of the molecule of
interest for the second receptor using known procedures for
measuring binding affinities. For example, known methods for
measuring the binding affinity of human (or other mammalian) B7-1
for each of CD28 and CTLA-4 receptors can be used.
[0148] An "exogenous" nucleic acid," "exogenous DNA segment,"
"heterologous sequence," or "heterologous nucleic acid," as used
herein, is one that originates from a source foreign to the
particular host cell, or, if from the same source, is modified from
its original form. Thus, a heterologous gene in a host cell
includes a gene that is endogenous to the particular host cell, but
has been modified. Modification of a heterologous sequence in the
applications described herein typically occurs through the use of
recursive sequence recombination. The terms refer to a DNA segment
which is foreign or heterologous to the cell, or homologous to the
cell but in a position within the host cell nucleic acid in which
the element is not ordinarily found. Exogenous DNA segments are
expressed to yield exogenous polypeptides.
[0149] The term "nucleic acid" refers to deoxyribonucleotides or
ribonucleotides and polymers thereof in either single- or
double-stranded form. Unless specifically limited, the term
encompasses nucleic acids containing known analogues of natural
nucleotides which have similar binding properties as the reference
nucleic acid and are metabolized in a manner similar to naturally
occurring nucleotides. Unless otherwise indicated, a particular
nucleic acid sequence also implicitly encompasses conservatively
modified variants thereof (e.g., degenerate codon substitutions)
and complementary sequences and as well as the sequence explicitly
indicated. Specifically, degenerate codon substitutions may be
achieved by generating sequences in which the third position of one
or more selected (or all) codons is substituted with mixed-base
and/or deoxyinosine residues (Batzer et al. (1991) Nucleic Acid Res
19:5081; Ohtsuka et al. (1985) J Biol Chem 260:2605-2608; Cassol et
al. (1992); Rossolini et al. (1994) Mol Cell Probes 8:91-98). The
term nucleic acid is used interchangeably with gene, cDNA, and mRNA
encoded by a gene.
[0150] "Nucleic acid derived from a gene" refers to a nucleic acid
for whose synthesis the gene, or a subsequence thereof, has
ultimately served as a template. Thus, an mRNA, a cDNA reverse
transcribed from an mRNA, an RNA transcribed from that cDNA, a DNA
amplified from the cDNA, an RNA transcribed from the amplified DNA,
etc., are all derived from the gene and detection of such derived
products is indicative of the presence and/or abundance of the
original gene and/or gene transcript in a sample.
[0151] A nucleic acid is "operably linked" with another nucleic
acid sequence when it is placed into a functional relationship with
another nucleic acid sequence. For instance, a promoter or enhancer
is operably linked to a coding sequence if it increases the
transcription of the coding sequence. Operably linked means that
the DNA sequences being linked are typically contiguous and, where
necessary to join two protein coding regions, contiguous and in
reading frame. However, since enhancers generally function when
separated from the promoter by several kilobases and intronic
sequences may be of variable lengths, some polynucleotide elements
may be operably linked but not contiguous.
[0152] The term "cytokine" includes, for example, interleukins,
interferons, chemokines, hematopoietic growth factors, tumor
necrosis factors and transforming growth factors. In general these
are small molecular weight proteins that regulate maturation,
activation, proliferation, and differentiation of cells of the
immune system.
[0153] A "variant" of a polypeptide is a polypeptide that differs
in one or more amino acid residues from a parent or reference
polypeptide, usually in at least about 1, 2, 3, 4, 5, 6, 7, 8, 9,
10, 11, 12, 13, 14, or 15 amino acid or more residues.
[0154] A "variant" of a nucleic acid is a nucleic acid that differs
in one or more nucleic acid residues from a parent or reference
nucleic acid, usually in at least about 1, 2, 3, 4, 5, 6, 7, 8, 9,
10, 11, 12, 13, 14, 15, 17, 20, 21, 24, 27, 30, 33, 36, 39, 40, 45,
50 or more nucleic acid residues.
[0155] Various additional terms are defined or otherwise
characterized herein.
Polynucleotides of the Invention
[0156] NCSM Polynucleotide Sequences
[0157] The invention provides isolated or recombinant NCSM
polypeptides and fragments thereof, and isolated or recombinant
polynucleotides encoding said polypeptides and fragments thereof.
The term "NCSM polynucleotide" is intended throughout to include
nucleic acid fragments, homologues, and variants of the
polynucleotide sequences specifically disclosed herein unless
otherwise noted.
[0158] In one aspect, the polynucleotides and polypeptides of the
invention were made in two rounds of recursive sequence
recombination using DNA recombination methods and formats described
below. In preparation, prior to the rounds, cDNAs encoding, e.g.,
primate (rhesus monkey, baboon, and orangutan), cow, cat, and
rabbit, B7-1 related sequences were cloned from their respective
species, either from cell lines or peripheral blood. The cDNAs of
the invention encoding baboon B7-1 and orangutan B7-1 are examples
of previously unknown WT B7-1 polynucleotides. Baboon and orangutan
B7-1 have CD28 and CTLA-4 binding properties and T cell
proliferation properties similar to those of hB7-1 (data not
shown). The polynucleotide sequences encoding baboon (SEQ ID NO:46)
and orangutan (SEQ ID NO:47) B7-1, corresponding baboon B7-1 (SEQ
ID NO:93) and orangutan (SEQ ID NO:94) B7-1 polypeptides, and
homologues, fragments (e.g., ECD), fusion proteins thereof, are
aspects of the invention.
[0159] In Round 1, the cDNAs encoding human, primate, cow, cat, and
rabbit B7-1 were recursively recombined to form libraries
comprising two or more recombinant polynucleotides. Other methods
for obtaining libraries of recombinant polynucleotides (including
NCSM polynucleotides) and/or for obtaining diversity in nucleic
acids used as the substrates for recursive sequence recombination
are also described infra. The libraries of Round 1 were initially
screened via three methods. An initial screening sorted the pooled
recombined clones based on preferential binding ability to soluble
CD28 and CTLA-4 receptor fusion proteins. A second screening
selected individual clones based on the ability to bind to either
CD28 or CTLA-4. A third screening tested the individual clones from
the second screen based on the ability to induce or inhibit T cell
proliferation in conjunction with costimulation of T cell
receptor/CD3 (by, e.g., an antigen or anti-CD3 Ab). Exemplary NCSM
nucleic acids from Round 1 encoding NCSM polypeptides having a
preferential or similar binding to CD28 relative to CTLA-4,
designated as CD28 binding proteins ("CD28BP"), as compared to the
binding of WT hB7-1 to CD28 relative to CTLA-4, and/or having an
ability to induce proliferation of T cells with T cell receptor
co-engagement (e.g., in conjunction with stimulation of T cell
receptor by, e.g., an antigen or anti-CD3 Ab) are shown in SEQ ID
NOS:1-4, which encode NCSM polypeptides identified herein as SEQ ID
NOS:48-51. Exemplary NCSM nucleic acids from Round 1 encoding NCSM
polypeptides having a preferential or similar binding to CTLA-4
relative to CD28, designated as CTLA-4 binding proteins
("CTLA-4BP"), as compared to the binding of WT hB7-1 to CTLA-4
relative to CD28, and/or having an ability to inhibit proliferation
of T cells with T cell receptor co-engagement (e.g., in conjunction
with stimulation of T cell receptor by, e.g., an antigen or
anti-CD3 mAb) are shown in SEQ ID NOS:22-26, which encode NCSM
polypeptides identified herein as SEQ ID NOS:69-73.
[0160] Exemplary clones from Round 1 were further recombined in
Round 2 to form recombinant polynucleotide libraries. Similar
screenings were done as in Round 1 for the polynucleotide clones
produced in Round 2. Exemplary recursively recombined NCSM nucleic
acids encoding NCSM polypeptides having a preferential or similar
binding to CD28 relative to CTLA-4 as compared to the binding of WT
hB7-1 to CD28 relative to CTLA-4 (e.g., CD28BP polypeptides),
and/or having an ability to induce proliferation of T cells in
conjunction with stimulation of T cell receptor in SEQ ID NOS:5-21
and SEQ ID NOS:95-142, which encode NCSM polypeptides identified
herein as SEQ ID NOS:52-68, SEQ ID NOS:174-221. Additional
identified recombinant CD28BP polypeptides that were identified
include SEQ ID NOS:283-285 and 289-293.
[0161] Exemplary nucleic acids from Round 2 encoding NCSM
polypeptides having preferential binding to CTLA-4 relative to CD28
as compared to the binding of WT hB7-1 to CTLA-4 relative to CD28
(e.g., CTLA-4BP polypeptides), and/or having an ability to inhibit
proliferation of T cells in conjunction with stimulation of T cell
receptor are described in SEQ ID NOS:27-45 and SEQ ID NOS:143-262,
which encode NCSM polypeptides identified herein as SEQ ID
NOS:74-92 and SEQ ID NOS:222-252, and 263-272. Additional
recombinant CTLA-4BP polypeptides that were identified include SEQ
ID NOS: 286-288.
[0162] The term "preferential binding" in reference to an ability
of an NCSM polypeptide of the invention to bind or specifically
bind a CD28 receptor and/or CTLA-4 receptor typically refers to a
preferential ability of the NCSM polypeptide to bind one or both of
these two receptors (or to bind one such receptor relative to the
other) as compared to the ability of a WT B7-1 (e.g., human,
primate, or mammalian B7-1) to bind one or both of these two
receptors (or to bind one such receptor relative to the other). A
ligand's preferential binding to a receptor typically refers to a
greater, enhanced, or improved binding of the ligand to the
receptor as compared to the binding of a control molecule to the
receptor.
[0163] The ratio of the relative binding affinity of each CD28BP
polypeptide for CD28 and CTLA-4 was determined and defined as the
CD28/CTLA-4 binding affinity ratio. A ratio of the relative binding
affinity of WT hB7-1 for CD28 and CTLA-4 was also determined for
comparison. The CD28/CTLA-4 binding affinity ratios of the CD28BP
polypeptides were each found to be at least about equal to or
greater than the CD28/CTLA-4 binding affinity ratio of WT hB7-1.
The ratio of the relative binding affinity of each CTLA-4BP
polypeptide for CD28 and CTLA-4 was also determined (i.e.,
CTLA-4/CD28 binding affinity ratio). A ratio of the relative
binding affinity of WT hB7-1 for each of CTLA-4 and CD28 was also
determined. The CTLA-4/CD28 binding affinity ratios of the CTLA-4BP
polypeptides were each found to be at least about equal to or
greater than the CTLA-4/CD28 binding affinity ratio of WT
hB7-1.
[0164] Assays for detecting the production of specific cytokines
were also performed, as described in detail below, to identify NCSM
polynucleotides of the invention encoding NCSM polypeptides of the
invention.
[0165] The cloned WT cow B7-1 (SEQ ID NO:280) and WT rabbit B7-1
(SEQ ID NO:281) polypeptides also worked in the binding and T cell
functional assays described herein. Both cow and rabbit B7-1
polypeptides induced a T cell response in human T cells. The
relative CD28/CTLA-4 binding affinity ratio of WT cow B7-1
polypeptide was found to be significantly greater than that of WT
hB7-1. The relative CD28/CTLA-4 binding affinity ratio of WT rabbit
B7-1 polypeptide was found to be greater than that of WT hB7-1
(data not shown).
[0166] While NCSM polynucleotides of the present invention were
identified principally using the cell-based proliferation assays,
receptor binding assays, and cytokine production assays described
supra and infra, other assays that rely on alternative means of
detection are equally suitable. For example, induction of other
visual markers by receptor binding can be favorably employed.
Similarly, direct binding to a receptor, e.g., by Biacore plasmon
resonance, can be utilized. Other specific cytokine assays well
known in the art and used for analysis of B7-1 molecules can also
be utilized.
[0167] Soluble NCSM peptide constructs, including, e.g.,
extracellular domains of NCSM polypeptides, or fragments or
subsequences thereof, alone or fused to immunoglobulin (Ig)
polypeptide sequences, were also made and analyzed for receptor
binding, ability to enhance or reduce an immune response, e.g.,
inhibit or augment T cell proliferation and/or activation, and
ability to produce specific cytokine or alter or augment their
levels. Nucleotide coding sequences for these soluble NCSM peptides
constructs were determined. As described in detail below, such
soluble NCSM polypeptides are useful in a variety of therapeutic,
prophylactic, and/or diagnostic applications and methods.
[0168] The NCSM polynucleotides of the present invention that
encode NCSM polypeptides are useful in a variety of applications
discussed in greater detail below. For example, NCSM
polynucleotides can be incorporated into expression vectors useful
for gene therapy, DNA vaccination, and immunotherapy. Such vectors
comprising NCSM polynucleotides encoding NCSM polypeptides are
useful in clinical and medical applications in which it is
desirable to provide specific proliferation/activation or
anti-proliferation/inactivation of T cells that have encountered
their specific antigen. Such vectors comprising NCSM
polynucleotides of the invention are also useful in applications
designed to break or avoid tolerance (e.g., vaccine or T cell
adjuvants, treatment of malignant diseases and treatment of chronic
infectious diseases), as where an enhanced immune response is
desirable, or applications designed to induce tolerance (e.g.,
autoimmunity, severe allergy/asthma and organ transplantation), as
where a decreased immune response is desirable.
[0169] CD28BP Polynucleotides
[0170] The invention provides nucleic acids that encode NCSM
polypeptides and fragments thereof, wherein such polypeptides and
fragments thereof bind either or both of CD28 or CTLA-4 receptor
and/or modulates a T cell response. The binding of molecules can
generally be considered specific if the binding affinity is about
1.times.10.sup.2M.sup.-1 to about 1.times.10.sup.7M.sup.-1 (i.e.,
about 10.sup.-2-about 10.sup.-7 M) or greater. A "CD28 binding
protein" or "CD28 binding polypeptide" ("CD28BP") refers generally
to a protein or polypeptide, or fragment or subsequence thereof
(such as, e.g., an ECD or trunECD), that binds to or associates
with a CD28 receptor. A "CTLA-4 binding protein" or "CTLA-4 binding
polypeptide" ("CTLA-4BP") refers generally to a protein or
polypeptide, or fragment or subsequence thereof (such as, e.g., an
ECD or trunECD), that binds to or associates with a CTLA-4
receptor. A CD28BP polynucleotide is a nucleic acid sequence that
encodes a CD28BP amino acid sequence. A CTLA-4BP polynucleotide is
a nucleic acid sequence that encodes a CTLA-4BP amino acid
sequence. Some such CD28BP polypeptides (or nucleic acid encoding
them) exhibit an ability to induce a T cell proliferation or
activation response about equal to or greater than that of hB7-1.
Some such CTLA-4BPs (or nucleic acids encoding them) exhibit an
ability to induce a T cell proliferation or activation response
about equal to or less than that of hB7-1.
[0171] In one aspect, the invention provides isolated or
recombinant nucleic acids that each comprise a polynucleotide
sequence selected from: (a) a polynucleotide sequence selected from
SEQ ID NOS:1-21 and 95-142, or a complementary polynucleotide
sequence thereof; (b) a polynucleotide sequence encoding a
polypeptide selected from SEQ ID NOS:48-68, 174-221, 283-285, and
290-293, or a complementary polynucleotide sequence thereof; (c) a
polynucleotide sequence which, but for codon degeneracy, hybridizes
under at least stringent or highly stringent conditions over
substantially the entire length of polynucleotide sequence (a) or
(b); and (d) a polynucleotide sequence comprising all or a fragment
of (a), (b), or (c), wherein the fragment encodes a polypeptide
having a CD28/CTLA-4 binding affinity ratio about equal to or
greater than the CD28/CTLA-4 binding affinity ratio of human B7-1
and/or an ability to induce a T cell proliferation or activation
response about equal to or greater than that of hB7-1.
[0172] Also provided are isolated or recombinant nucleic acids,
each comprising a nucleotide sequence selected from the group of:
(a) a nucleotide sequence that encodes an extracellular domain
(ECD), said nucleotide sequence comprising an ECD coding
subsequence of a polynucleotide sequence selected from the group of
SEQ ID NOS:1-21 and 95-142, or a complementary nucleotide sequence
thereof; (b) a nucleotide sequence encoding an ECD, said ECD
comprising an amino acid subsequence of a polypeptide sequence
selected from the group of SEQ ID NOS:48-68, 174-221, 283-285, and
290-293, or a complementary nucleotide sequence thereof; and (c) a
nucleotide sequence that, but for the degeneracy of the genetic
code, hybridizes under at least stringent conditions over
substantially the entire length of polynucleotide sequence (a) or
(b), wherein said nucleotide sequence encodes a polypeptide that
has a CD28/CTLA-4 binding affinity ratio about equal to or greater
than that of hB7-1 and/or an ability to induce a T cell
proliferation response equal to or greater than that induced by
human B7-1. Typically, the nucleotide sequence of (c) hybridizes
under at least stringent conditions over substantially the entire
length of polynucleotide sequence (a) and encodes a polypeptide
that has a CD28/CTLA-4 binding affinity ratio greater than that of
hB7-1.
[0173] Some such nucleic acids further comprise at least a second
nucleotide sequence that encodes a signal peptide, said second
nucleotide sequence selected from the group of: (a) a nucleotide
sequence comprising a signal peptide coding subsequence of a
polynucleotide sequence selected from the group of SEQ ID NOS:1-21
and 95-142, or a complementary nucleotide sequence thereof; (b) a
nucleotide sequence encoding a signal peptide, which comprises an
amino acid subsequence of a polypeptide sequence selected from the
group of SEQ ID NOS:48-68, 174-221, 283-285, and 290-293, or a
complementary nucleotide sequence thereof; (c) a nucleotide
sequence that, but for the degeneracy of the genetic code,
hybridizes under at least stringent conditions over substantially
the entire length of polynucleotide sequence (a) or (b), wherein
said nucleotide sequence encodes a polypeptide that has a
CD28/CTLA-4 binding affinity ratio about equal to or greater than
that of hB7-1; and (d) a nucleotide sequence encoding a signal
peptide of a B7-1 polypeptide. In some aspects, the nucleotide
sequence of (c) hybridizes under at least stringent conditions over
substantially the entire length of polynucleotide sequence (a) and
encodes a polypeptide that has a CD28/CTLA-4 binding affinity ratio
greater than that of hB7-1 and/or an ability to induce a T cell
proliferation response about equal to or greater than that induced
by human B7-1.
[0174] Some such nucleic acids further comprising at least a third
nucleotide sequence encoding a transmembrane domain selected from
the group of: (a) a nucleotide sequence comprising a TMD coding
subsequence of a polynucleotide sequence selected from the group of
SEQ ID NOS:1-21 and 95-142, or a complementary nucleotide sequence
thereof; (b) a nucleotide sequence encoding a TMD, which comprises
an amino acid subsequence of a polypeptide sequence selected from
the group of SEQ ID NOS:48-68, 174-221, 283-285, and 290-293, or a
complementary nucleotide sequence thereof; (c) a nucleotide
sequence that, but for the degeneracy of the genetic code,
hybridizes under at least stringent conditions over substantially
the entire length of polynucleotide sequence (a) or (b), wherein
said nucleotide sequence encodes a polypeptide that has a
CD28/CTLA-4 binding affinity ratio about equal to or greater than
that of hB7-1; and (d) a nucleotide sequence that encodes a TMD of
a B7-1 polypeptide. Some polypeptides further comprise at least a
fourth nucleotide sequence encoding a cytoplasmic domain selected
from the group of: (a) a nucleotide sequence comprising a CD coding
subsequence of a polynucleotide sequence selected from the group of
SEQ ID NOS:1-21 and 95-142, or a complementary nucleotide sequence
thereof; (b) a nucleotide sequence encoding a CD, which CD
comprises an amino acid subsequence of a polypeptide sequence
selected from the group of SEQ ID NOS:48-68, 174-221, 283-285, and
290-293, or a complementary nucleotide sequence thereof; (c) a
nucleotide sequence that, but for the degeneracy of the genetic
code, hybridizes under at least stringent conditions over
substantially the entire length of polynucleotide sequence (a) or
(b), wherein said nucleotide sequence encodes a polypeptide that
has a CD28/CTLA-4 binding affinity ratio about equal to or greater
than that of hB7-1; and (d) a nucleotide sequence that encodes a CD
of a B7-1 polypeptide.
[0175] In another aspect, the invention provides isolated or
recombinant nucleic acids that each comprises a polynucleotide
sequence encoding a polypeptide, wherein the encoded polypeptide
comprises an amino acid sequence which is (a) substantially
identical over at least about 100 contiguous amino acid residues of
any one of SEQ ID NOS:48-68, 174-221, 283-285, and 290-293 and (b)
is a non naturally-occurring sequence. In some instances, the
encoded polypeptide is substantially identical over at least about
150 or about 200 contiguous amino acid residues of any one of SEQ
ID NOS:48-68, 174-221, 283-285, and 290-293.
[0176] In yet another aspect, the invention provides isolated or
recombinant nucleic acids that each comprise a nucleotide sequence
coding for a polypeptide comprising the amino acid sequence set
forth in any of SEQ ID NOS:48-68, 174-221, 283-285, and 290-293, or
a subsequence thereof, wherein the subsequence comprises at least
one of the signal sequence, ECD, transmembrane domain, and
cytoplasmic domain of the polypeptide, and wherein the amino acid
sequence or subsequence is a non naturally-occurring sequence.
[0177] For some such isolated or recombinant polypeptides, the
polypeptide comprises an ECD amino acid sequence encoded by an ECD
coding nucleotide sequence, and the ECD coding nucleotide sequence
comprises a nucleotide sequence that, but for codon degeneracy,
hybridizes under at least stringent conditions over substantially
the entire length of the ECD coding nucleotide sequence of a
polynucleotide sequence selected from any of SEQ ID NOS:1-21 and
95-142 or the nucleotide coding sequence that encodes the ECD of a
polypeptide selected from any of SEQ ID NOS:48-68, 174-221,
283-285, and 290-293. Some such isolated or recombinant
polypeptides further comprises a signal peptide amino acid sequence
encoded by a signal peptide coding nucleotide sequence. The signal
peptide coding nucleotide sequence selected from the group of: (a)
a nucleotide sequence of a polynucleotide sequence selected from
any of SEQ ID NOS:1-21 and 95-142, wherein said nucleotide sequence
encodes a signal peptide; (b) a nucleotide sequence that encodes
the signal peptide of a polypeptide selected from any of SEQ ID
NOS:48-68, 174-221, 283-285, and 290-293; and (c) a nucleotide
sequence which, but for codon degeneracy, hybridizes under at least
stringent conditions over substantially the entire length of a
nucleotide sequence (a) or (b).
[0178] Some such isolated or recombinant polypeptides further
comprise a transmembrane domain (TMD) amino acid sequence encoded
by a TMD nucleotide sequence selected from the group of: (a) a
nucleotide sequence of a polynucleotide sequence selected from any
of SEQ ID NOS:1-21 and 95-142, wherein said nucleotide sequence
encodes a TMD polypeptide; (b) a nucleotide sequence that encodes
the TMD of a polypeptide selected from any of SEQ ID NOS:48-68,
174-221, 283-285, and 290-293; and (c) a nucleotide sequence which,
but for codon degeneracy, hybridizes under at least stringent or
highly stringent conditions over substantially the entire length of
a nucleotide sequence (a) or (b).
[0179] Some such isolated or recombinant polypeptides further
comprise a cytoplasmic domain (CD) amino acid sequence encoded by a
CD nucleotide sequence selected from the group of: (a) a nucleotide
sequence of a polynucleotide sequence selected from any of SEQ ID
NOS:1-21 and 95-142, wherein said nucleotide sequence encodes a CD
polypeptide; (b) a nucleotide sequence that encodes the CD of a
polypeptide selected from any of SEQ ID NOS:48-68, 174-221,
283-285, and 290-293; and (c) a nucleotide sequence which, but for
codon degeneracy, hybridizes under at least stringent or highly
stringent conditions over substantially the entire length of a
nucleotide sequence (a) or (b).
[0180] For some of the CD28BP nucleic acids described above, the
polypeptide encoded by the nucleic acid has one of more of the
following properties: 1) a CD28/CTLA-4 binding affinity ratio equal
to, about equal to, or greater than the CD28/CTLA-4 binding
affinity ratio of human B7-1; 2) either an equal or an enhanced
binding affinity for CD28 as compared to a binding affinity of a
wild type co-stimulatory molecule for CD28; 3) a decreased or a
lowered binding affinity for CTLA-4 as compared to a binding
affinity of a wild type co-stimulatory molecule for CTLA-4; induces
T-cell proliferation or T-cell activation or both; or 4) modulates
T-cell activation, but does not induce proliferation of purified
T-cells activated by soluble anti-CD3 mAbs.
[0181] In another embodiment, the invention provides isolated or
recombinant nucleic acids each comprising a nucleotide sequence
selected from the group of: (a) a nucleotide sequence that encodes
an extracellular domain (ECD), said nucleotide sequence comprising
an ECD coding subsequence of a polynucleotide sequence selected
from the group of SEQ ID NOS:1-21 and 95-142, or a complementary
nucleotide sequence thereof; (b) a nucleotide sequence encoding an
ECD, said ECD comprising an amino acid subsequence of a polypeptide
sequence selected from the group of SEQ ID NOS:48-68, 174-221,
283-285, and 290-293, or a complementary nucleotide sequence
thereof; and (c) a nucleotide sequence that, but for codon
degeneracy, hybridizes under at least stringent conditions over
substantially the entire length of polynucleotide sequence (a) or
(b), wherein said nucleotide sequence encodes a polypeptide that
has a CD28/CTLA-4 binding affinity ratio about equal to or greater
than the CD28/CTLA-4 binding affinity ratio of human B7-1 or an
ability to induce a T cell proliferation response about equal to or
greater than that induced by hB7-1.
[0182] For some such isolated or recombinant nucleic acids, the
nucleotide sequence of (c) hybridizes under at least stringent
conditions over substantially the entire length of polynucleotide
sequence (a) and encodes a polypeptide that has a CD28/CTLA-4
binding affinity ratio greater than the CD28/CTLA-4 binding
affinity ratio of human B7-1 or induces a T cell proliferation
response greater than that induced by hB7-1. Some such isolated or
recombinant nucleic acids further comprise at least a second
nucleotide sequence that encodes a signal peptide, wherein said
second nucleotide sequence is selected from the group of: (a) a
nucleotide sequence comprising a signal peptide coding subsequence
of a polynucleotide sequence selected from the group of SEQ ID
NOS:1-21 and 95-142, or a complementary nucleotide sequence
thereof; (b) a nucleotide sequence encoding a signal peptide, said
signal peptide comprising an amino acid subsequence of a
polypeptide sequence selected from the group of SEQ ID NOS:48-68,
174-221, 283-285, and 290-293, or a complementary nucleotide
sequence thereof; (c) a nucleotide sequence that, but for codon
degeneracy, hybridizes under at least stringent conditions over
substantially the entire length of polynucleotide sequence (a) or
(b), wherein said nucleotide sequence encodes a polypeptide that
has a CD28/CTLA-4 binding affinity ratio about equal to or greater
than that of hB7-1, or an ability to induce a T cell proliferation
or activation response about equal to or greater than that induced
by hB7-1; and (d) a nucleotide sequence encoding a signal peptide
of a B7-1 polypeptide.
[0183] For some such isolated or recombinant nucleic acids, the
nucleotide sequence of (c) hybridizes, but for codon degeneracy,
under at least stringent conditions over substantially the entire
length of polynucleotide sequence (a) and encodes a polypeptide
that has a CD28/CTLA-4 binding affinity ratio greater than that of
hB7-1 or an ability to induce a T cell proliferation response about
equal to or greater than that induced by hB7-1. Some such nucleic
acids further comprise at least a third nucleotide sequence
encoding a transmembrane domain selected from the group of: (a) a
nucleotide sequence comprising a transmembrane domain coding
subsequence of a polynucleotide sequence selected from the group of
SEQ ID NOS:1-21 and 95-142, or a complementary nucleotide sequence
thereof; (b) a nucleotide sequence encoding a transmembrane domain,
said transmembrane domain comprising an amino acid subsequence of a
polypeptide sequence selected from the group of SEQ ID NOS:48-68,
174-221, 283-285, and 290-293, or a complementary nucleotide
sequence thereof; (c) a nucleotide sequence that hybridizes, but
for the degeneracy of the genetic code, under at least stringent
conditions over substantially the entire length of polynucleotide
sequence (a) or (b), wherein said nucleotide, sequence encodes a
polypeptide that has a CD28/CTLA-4 binding affinity ratio about
equal to or greater than that of hB7-1; and (d) a nucleotide
sequence that encodes a transmembrane domain of a B7-1
polypeptide.
[0184] Further, some such nucleic acids further comprise at least a
fourth nucleotide sequence encoding a cytoplasmic domain selected
from the group of: (a) a nucleotide sequence comprising a
cytoplasmic domain coding subsequence of a polynucleotide sequence
selected from the group of SEQ ID NOS:1-21 and 95-142, or a
complementary nucleotide sequence thereof; (b) a nucleotide
sequence encoding a cytoplasmic domain, said cytoplasmic domain
comprising an amino acid subsequence of a polypeptide sequence
selected from the group of SEQ ID NOS:48-68, 174-221, 283-285, and
290-293, or a complementary nucleotide sequence thereof; (c) a
nucleotide sequence that, but for codon degeneracy, hybridizes
under at least stringent conditions over substantially the entire
length of polynucleotide sequence (a) or (b), wherein said
nucleotide sequence encodes a polypeptide that has a CD28/CTLA-4
binding affinity ratio about equal to or greater than that ratio of
human B7-1; and (d) a nucleotide sequence that encodes a
cytoplasmic domain of a B7-1 polypeptide.
[0185] CTLA-4BP Polynucleotides
[0186] The invention includes isolated or recombinant nucleic acids
that each comprise a polynucleotide sequence selected from: (a) a
polynucleotide sequence selected from SEQ ID NOS:22-45, 143-173, or
a complementary polynucleotide sequence thereof; (b) a
polynucleotide sequence encoding a polypeptide selected from SEQ ID
NOS:69-92, 222-247, 286-289, or a complementary polynucleotide
sequence thereof; (c) a polynucleotide sequence which, but for
codon degeneracy, hybridizes under at least stringent or highly
stringent conditions over substantially the entire full-length
length of polynucleotide sequence (a) or (b); and (d) a
polynucleotide sequence comprising all or a fragment of (a), (b),
or (c); wherein (c) or (d) encodes a polypeptide having a
naturally-occurring or non naturally-occurring sequence comprising
at least one of: Gly at position 2; Thr at position 4; Arg at
position 5; Gly at position 8; Pro at position 12; Met at position
25; Cys at position 27; Pro at position 29; Leu at position 31; Arg
at position 40; Leu at position 52; His at position 65; Ser at
position 78; Asp at position 80; Tyr at position 87; Lys at
position 120; Asp at position 122; Lys at position 129; Met at
position 135; Phe at position 150; Ile at position 160; Ala at
position 164; His at position 172; Phe at position 174; Leu at
position 176; Asn at position 178; Asn at position 186; Glu at
position 194; Gly at position 196; Thr at position 199; Ala at
position 210; His at position 212; Arg at position 219; Pro at
position 234; Asn at position 241; Leu at position 244; Thr at
position 250; Ala at position 254; Tyr at position 265; Arg at
position 266; Glu at position 273; Lys at position 275; Ser at
position 276; an amino acid deletion at position 276; and Thr at
position 279, wherein the position number corresponds to that of
the human B7-1 amino acid sequence (SEQ ID NO:278), and wherein
said polypeptide has a CTLA-4/CD28 binding affinity ratio about
equal to, equal to or greater than the CTLA-4/CD28 binding affinity
ratio of human B7-1.
[0187] In another aspect, the invention provides isolated or
recombinant nucleic acids that comprise a polynucleotide sequence
selected from: (a) a polynucleotide sequence selected from SEQ ID
NOS:253-262, or a complementary polynucleotide sequence thereof;
(b) a polynucleotide sequence encoding a polypeptide selected from
SEQ ID NOS:263-272, or a complementary polynucleotide sequence
thereof; (c) a polynucleotide sequence which, but for codon
degeneracy, hybridizes under highly stringent conditions over
substantially the entire length of polynucleotide sequence (a) or
(b) and encodes a polypeptide having a non naturally-occurring
sequence; and (d) a polynucleotide sequence comprising all or a
fragment of (a), (b), or (c), wherein the fragment encodes a
polypeptide having (i) a naturally-occurring or non
naturally-occurring sequence and (ii) a CTLA-4/CD28 binding
affinity ratio about equal to or greater than that of human
B7-1.
[0188] In another aspect, the invention provides isolated or
recombinant nucleic acids comprising a polynucleotide sequence
encoding a polypeptide, the encoded polypeptide comprising an amino
acid sequence which is substantially identical over at least about
125, 150, 175, 200, 225, 250, or more contiguous amino acid
residues of any one of SEQ ID NOS:69-92, 222-247, 263-272, and
28.6-289.
[0189] The invention also provides isolated or recombinant nucleic
acids that each comprise a nucleotide sequence coding for a
polypeptide comprising the amino acid sequence set forth in any of
SEQ ID NOS:69-92, 222-247, 263-272, and 286-289, or a subsequence
thereof, wherein the subsequence comprises at least one of: the
signal sequence, extracellular domain, transmembrane domain, and
cytoplasmic domain of said polypeptide, and wherein the amino acid
sequence or subsequence is a non naturally-occurring sequence.
[0190] For some such CTLA-4BP nucleic acids described above, a
polypeptide encoded therefrom has a CTLA-4/CD28 binding affinity
ratio about equal to, equal to or greater than the CTLA-4/CD28
binding affinity ratio of human B7-1. Furthermore, the polypeptide
encoded by some such CTLA-4BP nucleic acids has either a same
binding affinity or an enhanced binding affinity for CD28 as
compared to a binding affinity of a wild type co-stimulatory
molecule for CD28. Some such encoded polypeptides have a decreased
or a lowered binding affinity for CTLA-4 as compared to a binding
affinity of a wild type co-stimulatory molecule for CTLA-4 (e.g., a
mammalian B7-1, such as hB7-1). Some such encoded polypeptides
inhibit either or both T-cell proliferation or T-cell activation.
Some such encoded polypeptides modulate T-cell activation, but do
not induce proliferation of purified T-cells activated by soluble
anti-CD3 mAbs.
[0191] In addition, the invention provides novel isolated or
recombinant nucleic acids corresponding to baboon and orangutan
B7-1. Such sequences comprise a polynucleotide sequence selected
from: (a) a polynucleotide sequence selected from SEQ ID NO:46, SEQ
ID NO:47, or a complementary polynucleotide sequence thereof; (b) a
polynucleotide sequence encoding a polypeptide selected from SEQ
NO:93, SEQ ID NO:94, or a complementary polynucleotide sequence
thereof; (c) a polynucleotide sequence encoding a subsequence of a
polypeptide selected from SEQ ID NO:93, SEQ ID NO:94, or a
complementary polynucleotide sequence thereof, wherein the
subsequence comprises at least one of: the signal sequence,
extracellular domain, transmembrane domain, and the cytoplasmic
domain of said polypeptide. Included are polypeptide fragments
(e.g., 100, 150, 200, or 250 amino acids) and nucleotides encoding
such fragments, having CD28 and/or CTLA-4 binding properties
similar or about equal to those of hB7-1 and/or an ability to
induce T cell proliferation or activation response similar or about
equal to that of hB7-1.
[0192] Additional Aspects
[0193] The invention also includes RNA sequences that correspond to
each of the NCSM DNA sequences of the invention. For example,
included is an RNA sequence comprising the NCSM DNA sequence of any
of SEQ ID NOS:1-47, 95-173, and 253-262, wherein a uracil residue
is substituted for each thymidine residue in said DNA sequence, and
a complementary sequence of each such RNA sequence. Also included
is a RNA sequence comprising a nucleotide sequence comprising at
least one of an ECD coding sequence, TMD coding sequence, CD coding
nucleotide sequence, and/or signal peptide coding nucleotide
sequence of DNA sequence of any of SEQ ID NOS:1-47, 95-173, and
253-262, wherein a uracil residue is substituted for each thymidine
residue in said DNA sequence, and complementary sequences of such
RNA sequence. The DNA subsequence of SEQ ID NOS:1-47, 95-173, and
253-262, that encodes each of the ECD, TMD, CD, and signal peptide
are readily determined by alignment with the DNA sequence of hB7-1
(see, e.g., FIGS. 2 and 3). The invention further provides a virus
comprising a nucleic acid or polynucleotide (RNA or DNA) of the
invention.
[0194] Any of the CD28BP and CTLA-4BP nucleic acids described above
may acid encode a fusion protein comprising at least one additional
amino acid sequence. The at least one additional amino acid
sequence comprises an Ig polypeptide. The polypeptide may comprise
a human IgG polypeptide or Fc domain of an IgG polypeptide, and may
comprise an Fc hinge, a CH2 domain, and a CH3 domain. Exemplary
IgG1 polypeptides and their sequences are shown in the Examples
below.
[0195] A polypeptide encoded by any of the CD28BP and CTLA-4BP
nucleic acids described above may comprise at least one of a signal
sequence, a precursor peptide, and an epitope tag sequence or
Histidine tag.
[0196] In another aspect, the invention provides cells comprising
one or more of the CD28BP or CTLA-4BP nucleic acids described
above. Such cells may express one or more polypeptides encoded by
the nucleic acids of the invention.
[0197] The invention also provides vectors comprising any of the
CTLA-4BP or CD28BP nucleic acids described above. Such vectors may
comprise a plasmid, a cosmid, a phage, a virus, or a fragment of a
virus. Such vectors may comprise an expression vector, and, if
desired, the CD28BP or CTLA-4BP nucleic acid is operably linked to
a promoter, including those discussed herein and below.
[0198] Such a vector may be a bicistronic vector, comprising in
addition to a nucleotide sequence encoding a CD28BP or CTLA-4BP, a
nucleotide sequence encoding a transgene, such as an antigen,
marker, or other co-stimulatory molecule, or cytokine (e.g.,
GM-CSF, IL-12, or IL-2). Such vector may also be tricistronic or of
higher order, comprising a further (third) nucleotide acid
sequence. For example, the vector may comprise nucleotide sequences
encoding an NCSM polypeptide (e.g., CD28BP or CTLA-4BP), antigen,
and cytokine, such as IL-12. In one embodiment, the antigen is a
cancer antigen, such as EpCam (or mutant or variant polypeptide
thereof) or another cancer antigen described below, or viral
antigen. In such expression vector, the nucleic acid may be
operably linked to first promoter and the polynucleotide sequence
encoding the antigen may operably linked to a second promoter. Each
promoter can comprise any promoter described below. In one aspect,
one or both promoters in the expression vector that includes a
CD28BP or CTLA-4BP polypeptide-encoding nucleotide sequence is a
CMV promoter or variant thereof. The vector may further comprise a
bovine growth hormone (BGH) poly adenylation sequence or SV40 polyA
sequence.
[0199] A preferred "backbone" expression vector is that shown in
FIG. 21; the expression vector components shown in this backbone
vector may be used with any NCSM nucleic acid sequence. Other
expression vector elements that can be employed and other vector
types and formats are described in detail below. A preferred
expression vector that includes a CD28BP or CTLA-4BP
polypeptide-encoding nucleotide sequence is shown in FIG. 22A. The
components of a preferred bicistronic expression vector that
includes a CD28BP polypeptide-encoding nucleotide sequence, such as
that encoding clone CD28BP-15, and a nucleic acid sequence encoding
EpCam are shown in FIG. 23A.
[0200] The invention also provides host cells comprising any of the
vectors that comprise nucleotide sequences encoding any CD28BP or
CTLA-4BP described herein.
[0201] Furthermore, in another aspect, the invention provides
compositions comprising an excipient or carrier and at least one of
any of the CD28BP or CTLA-4BP nucleic acids, or vectors, cells, or
host comprising such nucleic acids. Such composition may be
pharmaceutical compositions, and the excipient or carrier may be a
pharmaceutically acceptable excipient or carrier.
[0202] The invention also includes compositions comprising two or
more NCSM polynucleotides of the invention or fragments thereof
(e.g., as substrates for recombination). The composition can
comprise a library of recombinant nucleic acids, where the library
contains at least 2, at least 3, at least 5, at least 10, at least
20, at least 50, or at least 100 or more nucleic acids described
above. The nucleic acids are optionally cloned into expression
vectors, providing expression libraries.
[0203] The NCSM polynucleotides of the invention and fragments
thereof, as well as vectors comprising such polynucleotides, may be
employed for therapeutic or prophylactic uses in combination with a
suitable carrier, such as a pharmaceutical carrier. Such
compositions comprise a therapeutically and/or prophylactically
effective amount of the compound, and a pharmaceutically acceptable
carrier or excipient. Such a carrier or excipient includes, but is
not limited to, saline, buffered saline, dextrose, water, glycerol,
ethanol, and combinations thereof. The formulation should suit the
mode of administration. Methods of administering nucleic acids,
polypeptides, and proteins are well known in the art, and are
further discussed below.
[0204] The invention also includes compositions produced by
digesting one or more of any of the NCSM nucleic acids described
above with a restriction endonuclease, an RNAse, or a DNAse (e.g.,
as is performed in certain of the recombination formats noted
above); and compositions produced by fragmenting or shearing one or
more NCSM polynucleotides of the invention by mechanical means
(e.g., sonication, vortexing, and the like), which can also be used
to provide substrates for recombination in the methods described
herein. The invention also provides compositions produced by
cleaving at least one of any of the CD28BP or CTLA-4BP nucleic
acids described above. The cleaving may comprise mechanical,
chemical, or enzymatic cleavage, and the enzymatic cleavage may
comprise cleavage with a restriction endonuclease, an RNAse, or a
DNAse.
[0205] Also included in the invention are compositions produced by
a process comprising incubating one or more of the fragmented
nucleic acid sets in the presence of ribonucleotide or
deoxyribonucleotide triphosphates and a nucleic acid polymerase.
This resulting composition forms a recombination mixture for many
of the recombination formats noted above. The nucleic acid
polymerase may be an RNA polymerase, a DNA polymerase, or an
RNA-directed DNA polymerase (e.g., a "reverse transcriptase"); the
polymerase can be, e.g., a thermostable DNA polymerase (e.g., VENT,
TAQ, or the like).
[0206] Similarly, compositions comprising sets of oligonucleotides
corresponding to more than one NCSM nucleic acids of the invention
are useful as recombination substrates and are a feature of the
invention. For convenience, these fragmented, sheared, or
oligonucleotide synthesized mixtures are referred to as fragmented
nucleic acid sets.
[0207] In one aspect, the invention provides an isolated or
recombinant nucleic acid encoding a polypeptide that has a
CTLA-4/CD28 binding affinity ratio about equal to or greater than
the CTLA-4/CD28 binding affinity ratio of hB7-1, produced by
mutating or recombining at least one CTLA-4BP nucleic acid
described above. In another aspect, the invention provides an
isolated or recombinant nucleic acid encoding a polypeptide that
has a CD28/CTLA-4 binding affinity ratio about equal to or greater
than the CD28/CTLA-4 binding affinity ratio of hB7-1, produced by
mutating or recombining at least one CD28BP nucleic acid described
above.
[0208] The invention also provides a chimeric or recombinant
polynucleotide that encodes a polypeptide having a CD28/CTLA-4
binding affinity ratio about equal to or greater than the
CD28/CTLA-4 binding affinity ratio of hB7-1. In some aspects, such
encoded polypeptide is a mammalian B7-1 variant. In some aspects,
such polypeptide comprises an amino acid sequence comprising one or
more amino acid subsequences corresponding to amino acid
subsequences of wild-type cow B7-1, baboon B7-1, rabbit B7-1, and
human B7-1 polypeptides. In some aspects, such polypeptide exhibits
an ability to induce a T cell proliferation or activation response
of T cells (e.g., stimulated by anti-CD3 Abs or antigen) greater
than that of cow B7-1, rabbit B7-1 or human B7-1. Chimeric or
recombinant polypeptides encoded therefrom are also an aspect of
the invention (see, e.g., FIG. 8B).
[0209] In addition, the invention includes a chimeric or
recombinant polynucleotide that encodes a polypeptide having a
CTLA-4/CD28 binding affinity ratio about equal to or greater than
that of hB7-1. In some aspects, such encoded polypeptide is a
mammalian B7-1 variant. In some aspects, such polypeptide comprises
an amino acid sequence comprising one or more amino acid
subsequences corresponding to amino acid subsequences of wild-type
rhesus B7-1, baboon B7-1, human B7-1, orangutan B7-1, and cow B7-1
polypeptides. In some aspects, such polypeptide exhibits an ability
to suppress or inhibit a T cell proliferation or activation
response (e.g., of T cells stimulated by anti-CD3 Abs or antigen)
relative to that induced human B7-1. Chimeric or recombinant
polypeptides encoded therefrom are also an aspect of the invention
(see, e.g., FIG. 8A).
[0210] Making Polynucleotides
[0211] NCSM polynucleotides, oligonucleotides, and nucleic acid
fragments of the invention can be prepared by standard solid-phase
methods, according to known synthetic methods. Typically, fragments
of up to about 100 bases are individually synthesized, then joined
(e.g., by enzymatic or chemical ligation methods, or polymerase
mediated recombination methods) to form essentially any desired
continuous sequence. For example, the NCSM polynucleotides and
oligonucleotides of the invention can be prepared by chemical
synthesis using, e.g., classical phosphoramidite method described
by, e.g., Beaucage et al. (1981) Tetrahedron Letters 22:1859-69, or
the method described by Matthes et al. (1984) EMBO J. 3:801-05,
e.g., as is typically practiced in automated synthetic methods.
According to the phosphoramidite method, oligonucleotides are
synthesized, e.g., in an automatic DNA synthesizer, purified,
annealed, ligated and cloned into appropriate vectors.
[0212] In addition, essentially any nucleic acid can be custom
ordered from any of a variety of commercial sources, such as The
Midland Certified Reagent Company (mcrc@oligos.com), The Great
American Gene Company (http://www.genco.com), ExpressGen Inc.
(www.expressgen.com), Operon Technologies Inc. (Alameda, Calif.)
and many others. Similarly, peptides and antibodies can be custom
ordered from any of a variety of sources, e.g., PeptidoGenic
(pkim@ccnet.com), HTI Bio-products, Inc. (http://www.htibio.com),
BMA Biomedicals Ltd. (U.K.), Bio.Synthesis, Inc., and many
others.
[0213] Certain NCSM polynucleotides of the invention may also be
obtained by screening cDNA libraries (e.g., libraries generated by
recombining homologous nucleic acids as in typical recursive
sequence recombination methods) using oligonucleotide probes that
can hybridize to or PCR-amplify polynucleotides which encode the
NCSM polypeptides and fragments of those polypeptides. Procedures
for screening and isolating cDNA clones are well-known to those of
skill in the art. Such techniques are described in, e.g., Berger
and Kimmel, Guide to Molecular Cloning Techniques, Methods in
Enzymol. Vol. 152, Acad. Press, Inc., San Diego, Calif. ("Berger");
Sambrook, supra, and Current Protocols in Molecular Biology,
Ausubel, supra. Some NCSM polynucleotides of the invention can be
obtained by altering a naturally occurring backbone, e.g., by
mutagenesis, recursive sequence recombination (e.g., shuffling), or
oligonucleotide recombination. In other cases, such polynucleotides
can be made in silico or through oligonucleotide recombination
methods as described in the references cited herein.
[0214] As described in more detail herein, the NCSM polynucleotides
of the invention include polynucleotide sequences that encode NCSM
polypeptide sequences and fragments thereof (including all forms of
soluble NCSM polypeptides and fusion proteins), polynucleotide
sequences complementary to these polynucleotide sequences and
fragments thereof, polynucleotides that hybridize under at least
stringent conditions to NCSM sequences defined herein, novel
fragments of coding sequences and complementary sequences thereof,
and variants, analogs, and homologue derivatives of all of the
above. A coding sequence refers to a nucleotide sequence encodes a
particular polypeptide or domain, region, or fragment of said
polypeptide. A coding sequence may code for a NCSM polypeptide or
fragment thereof having a functional property, such as a an ability
to bind a receptor, induce or suppress T cell proliferation in
conjunction with stimulation of T cell receptor (by, e.g., an
antigen or anti-CD3 Ab), or induce or stimulate a cytokine response
as described herein. The polynucleotides of the invention can be in
the form of RNA or in the form of DNA, and include mRNA, cRNA,
synthetic RNA and DNA, and cDNA. The polynucleotides can be
double-stranded or single-stranded, and if single-stranded, can be
the coding strand or the non-coding (anti-sense, complementary)
strand. The NCSM polynucleotides optionally include the coding
sequence of a NCSM polypeptide (i) in isolation, (ii) in
combination with one or more additional coding sequences, so as to
encode, e.g., a fusion protein, a pre-protein, a prepro-protein, or
the like, (iii) in combination with non-coding sequences, such as
introns, control elements, such as a promoter (e.g., naturally
occurring or recombinant or shuffled promoter), a terminator
element, or 5' and/or 3' untranslated regions effective for
expression of the coding sequence in a suitable host, and/or (iv)
in a vector, cell, or host environment in which NCSM coding
sequence is a heterologous gene. The NCSM polynucleotides include
the respective coding sequences of components of a NCSM
polypeptide, including, e.g., the coding sequence for each of the
signal peptide, ECD, transmembrane domain, cytoplasmic domain,
mature region, and fragments thereof, and variants, analogs, and
homologue derivatives thereof. Polynucleotide sequences can also be
found in combination with typical compositional formulations of
nucleic acids, including in the presence of carriers, buffers,
adjuvants, excipients, and the like, as are known to those of
ordinary skill in the art. NCSM nucleotide fragments typically
comprise at least about 500 nucleotide bases, usually at least
about 600, 650, or 700 bases, and often 750 or more bases. The
nucleotide fragments, variants, analogs, and homologue derivatives
of NCSM polynucleotides may have hybridize under highly stringent
conditions to a NCSM polynucleotide or homologue sequence described
herein and/or encode amino acid sequences having at least one of
the properties of receptor binding, ability to alter an immune
response via, e.g., T cell activation/proliferation, and cytokine
production of NCSM polypeptides described herein.
[0215] Using Polynucleotides
[0216] The NCSM polynucleotides and fragments, variants, and
homologues thereof of the invention have a variety of uses in, for
example, recombinant production (i.e., expression) of the NCSM
polypeptides of the invention typically through expression of a
plasmid expression vector comprising a sequence encoding a NCSM
polypeptide or fragment thereof (e.g., ECD domain); as
therapeutics; as prophylactics; as diagnostic tools; as immunogens;
as adjuvants; as diagnostic probes for the presence of
complementary or partially complementary nucleic acids (including
for detection of natural B7-1 or related co-stimulatory molecule
coding nucleic acids) as substrates for further reactions, e.g.,
recursive sequence recombination reactions or mutation reactions to
produce new and/or improved homologues, and the like. Such NCSM
polynucleotides and fragments, variants, and homologues thereof of
the invention can be administered to a subject by any one of the
delivery routes described below (including, but not limited to,
e.g., intramuscularly, intradermally, subdermally, subcutaneously,
orally, intraperitoneally, intrathecally, intravenously, mucosally,
systemically, parenterally, via inhalation, or placed within a
cavity of the body (including, e.g., during surgery)).
Expression of Polypeptides from Polynucleotides
[0217] In accordance with the present invention, NCSM
polynucleotide sequences which encode novel full-length or mature
NCSM polypeptides or proteins, fragments, variants or homologues
thereof, related fusion polypeptides or proteins, or functional
equivalents thereof, collectively referred to herein, e.g., as
"NCSM" molecules, are used in recombinant DNA molecules that direct
the expression of the NCSM polypeptides in appropriate host cells.
Due to the inherent degeneracy of the genetic code, other nucleic
acid sequences that encode substantially the same or a functionally
equivalent amino acid sequence are also used to synthesize, clone
and express the NCSM polypeptides.
[0218] Modified Coding Sequences
[0219] As will be understood by those of ordinary skill in the art,
it can be advantageous to modify a coding sequence to enhance its
expression in a particular host. The genetic code is redundant with
64 possible codons, but most organisms preferentially use a subset
of these codons. The codons that are utilized most often in a
species are called optimal codons, and those not utilized very
often are classified as rare or low-usage codons (see, e.g., Zhang,
S. P. et al. (1991) Gene 105:61-72). Codons can be substituted to
reflect the preferred codon usage of the host, a process called
"codon optimization" or "controlling for species codon-bias."
[0220] Optimized coding sequence containing codons preferred by a
particular prokaryotic or eukaryotic host (see, e.g., Murray, E. et
al. (1989) Nuc Acids Res 17:477-508) can be prepared, for example,
to increase the rate of translation or to produce recombinant RNA
transcripts having desirable properties, such as a longer
half-life, as compared with transcripts produced from a
non-optimized sequence. Translation stop codons can also be
modified to reflect host preference. For example, preferred stop
codons for S. cerevisiae and mammals are UAA and UGA respectively.
The preferred stop codon for monocotyledonous plants is UGA,
whereas insects and E. coli prefer to use UAA as the stop codon
(Dalphin, M. E. et al. (1996) Nuc Acids Res 24:216-218).
[0221] The polynucleotide sequences of the present invention can be
engineered in order to alter an NCSM coding sequence of the
invention for a variety of reasons, including but not limited to,
alterations which modify the cloning, processing and/or expression
of the gene product. For example, alterations may be introduced
using techniques which are well known in the art, e.g.,
site-directed mutagenesis, to insert new restriction sites, to
alter glycosylation and/or pegylation patterns, to change codon
preference, to introduce splice sites, etc. Further details
regarding silent and conservative substitutions are provided
below.
[0222] Vectors, Promoters, and Expression Systems
[0223] The present invention also includes recombinant constructs
comprising one or more of the nucleic acid sequences as broadly
described above. The constructs comprise a vector, such as, a
plasmid, a cosmid, a phage, a virus, a virus-like particle, a
bacterial artificial chromosome (BAC), a yeast artificial
chromosome (YAC), and the like, into which a nucleic acid sequence
of the invention (e.g., one which encodes a NCSM polypeptide or
fragment thereof) has been inserted, in a forward or reverse
orientation. In a preferred aspect of this embodiment, the
construct further comprises regulatory sequences, including, for
example, a promoter, operably linked to the nucleic acid sequence.
Large numbers of suitable vectors and promoters are known to those
of skill in the art, and are commercially available.
[0224] General texts that describe molecular biological techniques
useful herein, including the use of vectors, promoters and many
other relevant topics, include Berger, supra; Sambrook (1989),
supra, and Ausubel, supra. Examples of techniques sufficient to
direct persons of skill through in vitro amplification methods,
including the polymerase chain reaction (PCR) the ligase chain
reaction (LCR), Q.beta.-replicase amplification and other RNA
polymerase mediated techniques (e.g., NASBA), e.g., for the
production of the homologous nucleic acids of the invention are
found in Berger, Sambrook, and Ausubel, all supra, as well as
Mullis et al. (1987) U.S. Pat. No. 4,683,202; PCR Protocols: A
Guide to Methods and Applications (Innis et al., eds.) Academic
Press Inc. San Diego, Calif. (1990) ("Innis"); Arnheim &
Levinson (Oct. 1, 1990) C&EN 36-47; The Journal Of NIH Research
(1991) 3:81-94; (Kwoh et al. (1989) Proc Natl Acad Sci USA
86:1173-1177; Guatelli et al. (1990) Proc Natl Acad Sci USA
87:1874-1878; Lomeli et al. (1989) J Clin Chem 35:1826-1831;
Landegren et al. (1988) Science 241:1077-1080; Van Brunt (1990)
Biotechnology 8:291-294; Wu and Wallace (1989) Gene 4:560-569;
Barringer et al. (1990) Gene 89:117-122, and Sooknanan and Malek
(1995) Biotechnology 13:563-564. Improved methods of cloning in
vitro amplified nucleic acids are described in Wallace et al., U.S.
Pat. No. 5,426,039. Improved methods of amplifying large nucleic
acids by PCR are summarized in Cheng et al. (1994) Nature
369:684-685 and the references therein, in which PCR amplicons of
up to 40 kilobases (kb) are generated. One of skill will appreciate
that essentially any RNA can be converted into a double stranded
DNA suitable for restriction digestion, PCR expansion and
sequencing using reverse transcriptase and a polymerase. See
Ausubel, Sambrook and Berger, all supra.
[0225] The present invention also provides host cells that are
transduced with vectors of the invention, and the production of
polypeptides of the invention by recombinant techniques. Host cells
are genetically engineered (e.g., transduced, transformed or
transfected) with the vectors of this invention, which may be, for
example, a cloning vector or an expression vector. The vector may
be, for example, in the form of a plasmid, a viral particle, a
phage, etc. The engineered host cells can be cultured in
conventional nutrient media modified as appropriate for activating
promoters, selecting transformants, or amplifying the NCSM gene.
The culture conditions, such as temperature, pH, and the like, are
those previously used with the host cell selected for expression,
and will be apparent to those skilled in the art and in the
references cited herein, including, e.g., Freshney (1994) Culture
of Animal Cells, a Manual of Basic Technique, third edition,
Wiley-Liss, New York and the references cited therein.
[0226] The NCSM polypeptides of the invention can also be produced
in non-animal cells such as plants, yeast, fungi, bacteria and the
like. In addition to Sambrook, Berger and Ausubel, details
regarding cell culture are found in, e.g., Payne et al. (1992)
Plant Cell and Tissue Culture in Liquid Systems John Wiley &
Sons, Inc. New York, N.Y.; Gamborg and Phillips (eds.) (1995) Plant
Cell, Tissue and Organ Culture; Fundamental Methods Springer Lab
Manual, Springer-Verlag (Berlin Heidelberg N.Y.); Atlas & Parks
(eds.) The Handbook of Microbiological Media (1993) CRC Press, Boca
Raton, Fla.
[0227] The polynucleotides of the present invention and fragments
and variants thereof, which encode the NCSM polypeptide molecules,
may be included in any one of a variety of expression vectors for
expressing a polypeptide. Such vectors include chromosomal,
nonchromosomal and synthetic DNA sequences, e.g., derivatives of
SV40, bacterial plasmids, phage DNA, baculovirus, yeast plasmids,
vectors derived from combinations of plasmids and phage DNA, viral
DNA such as vaccinia, adenovirus, fowl pox virus, pseudorabies,
adeno-associated virus, retroviruses and many others. Any vector
that transduces genetic material into a cell, and, if replication
is desired, which is replicable and viable in the relevant host can
be used.
[0228] The nucleic acid sequence in the expression vector is
operatively linked to an appropriate transcription control sequence
(promoter) to direct mRNA synthesis. Examples of such promoters
include: LTR or SV40 promoter, E. coli lac or trp promoter, phage
lambda P.sub.L promoter, CMV promoter, and other promoters known to
control expression of genes in prokaryotic or eukaryotic cells or
their viruses. The expression vector also contains a ribosome
binding site for translation initiation, and a transcription
terminator. The vector optionally includes appropriate sequences
for amplifying expression, e.g., an enhancer. In addition, the
expression vectors optionally comprise one or more selectable
marker genes to provide a phenotypic trait for selection of
transformed host cells, such as dihydrofolate reductase or neomycin
resistance for eukaryotic cell culture, or such as tetracycline or
ampicillin resistance in E. coli.
[0229] The vector containing the appropriate DNA sequence encoding
a NCSM polypeptide, as well as an appropriate promoter or control
sequence, may be employed to transform an appropriate host to
permit the host to express the protein. Examples of appropriate
expression hosts include: bacterial cells, such as E. coli,
Streptomyces, and Salmonella typhimurium; fungal cells, such as
Saccharomyces cerevisiae, Pichia pastoris, and Neurospora crassa;
insect cells such as Drosophila and Spodoptera frugiperda;
mammalian cells such as CHO, COS, BHK, HEK 293 or Bowes melanoma;
plant cells, etc.
[0230] It is understood that not all cells or cell lines need to be
capable of producing fully functional NCSM polypeptides or
fragments thereof; for example, antigenic fragments of NCSM
polypeptide may be produced in a bacterial or other expression
system. The invention is not limited by the host cells
employed.
[0231] In bacterial systems, a number of expression vectors may be
selected depending upon the use intended for the NCSM polypeptide
or fragment thereof. For example, when large quantities of a NCSM
polypeptide or fragments thereof are needed for the induction of
antibodies, vectors which direct high level expression of fusion
proteins that are readily purified may be desirable. Such vectors
include, but are not limited to, multifunctional E. coli cloning
and expression vectors such as BLUESCRIPT (Stratagene), in which
NCSM nucleotide coding sequence may be ligated into the vector
in-frame with sequences for the amino-terminal Met and the
subsequent 7 residues of beta-galactosidase so that a hybrid
protein is produced; pIN vectors (Van Heeke & Schuster (1989) J
Biol Chem 264:5503-5509); pET vectors (Novagen, Madison Wis.); and
the like.
[0232] Similarly, in the yeast Saccharomyces cerevisiae a number of
vectors containing constitutive or inducible promoters such as
alpha factor, alcohol oxidase and PGH may be used for production of
the NCSM polypeptides of the invention. For reviews, see Ausubel,
supra, Berger, supra, and Grant et al. (1987) Methods in Enzymology
153:516-544.
[0233] In mammalian host cells, a number of expression systems,
such as viral-based systems, may be utilized. In cases where an
adenovirus is used as an expression vector, a coding sequence is
optionally ligated into an adenovirus transcription/translation
complex consisting of the late promoter and tripartite leader
sequence. Insertion in a nonessential E1 or E3 region of the viral
genome results in a viable virus capable of expressing NCSM
molecule in infected host cells (Logan and Shenk (1984) Proc Natl
Acad Sci USA 81:3655-3659). In addition, transcription enhancers,
such as the rous sarcoma virus (RSV) enhancer, are used to increase
expression in mammalian host cells. Host cells, media, expression
systems, and methods of production include those known for cloning
and expression of various mammalian B7-1s (e.g., hB7-1 and mouse
B7-1).
[0234] Promoters for use with NCSM polynucleotide sequences of the
present invention include recombinant, mutated, or recursively
recombined (e.g., shuffled) promoters, including optimized
recombinant CMV promoters, as described in copending, commonly
assigned PCT Application Serial No. US01/20123, entitled "Novel
Chimeric Promoters," filed Jun. 21, 2001 as LJAQ Attorney Docket
No. 02-031910PC, incorporated herein by reference in its entirety
for all purposes. Such promoters can be employed in expression
vectors comprising nucleotide sequences encoding, e.g., NCSM
polypeptides, soluble NSCM-ECD polypeptides, or NCSM-ECD-Ig fusion
proteins, or WT hB7-1, or fragments of any of these.
[0235] In some embodiments, a recombinant or shuffled promoter
having an optimized expression for a particular use with NCSM
molecules is utilized. For example, in some therapeutic and/or
prophylactic methods or applications, where a lower level
expression of a CD28BP or CTLA-4BP is desired (than is typically
obtained with a CMV promoter, such as a WT human CMV promoter), at
least one recombinant or chimeric CMV promoter nucleotide sequence
that is optimized to provide for reduced or suppressed expression
levels of the NCSM and/or one or more associated antigens is used.
Such promoter(s) is operably linked in an expression vector to
either or both the NCSM polynucleotide and/or one or more
associated antigens (e.g., cancer antigen, such as EpCam/KSA or
mutant, variant or derivative of EpCam/KSA). In other embodiments,
one or more recombinant, mutant, or chimeric CMV promoters
optimized for the particular application can be used, where
differential expression between a NCSM polypeptide and at least one
associated antigen in one or more vectors is desired (e.g., where
it is desirable to express varying amounts of various NCSM
polypeptide molecules or co-stimulatory molecules, since their
respective concentrations influence or affect one another, and/or
where it is desirable to express a comparably higher level of at
least one antigen for effective treatment). For example, in some
applications, a low expression level of a NCSM polypeptide and a
relatively higher expression level of antigen is desired, since it
may be particularly useful for successful therapeutic or
prophylactic treatment of a particular condition or disease.
[0236] Additional Expression Elements
[0237] Specific initiation signals can aid in efficient translation
of a NCSM polynucleotide coding sequence and/or fragments thereof.
These signals can include, e.g., the ATG initiation codon and
adjacent sequences. In cases where a NCSM coding sequence, its
initiation codon and upstream sequences are inserted into the
appropriate expression vector, no additional translational control
signals may be needed. However, in cases where only coding sequence
(e.g., a mature protein coding sequence), or a portion thereof, is
inserted, exogenous nucleic acid transcriptional control signals
including the ATG initiation codon must be provided. Furthermore,
the initiation codon must be in the correct reading frame to ensure
transcription of the entire insert. Exogenous transcriptional
elements and initiation codons can be of various origins, both
natural and synthetic. The efficiency of expression can enhanced by
the inclusion of enhancers appropriate to the cell system in use
(see, e.g., Scharf D. et al. (1994) Results Probl Cell Differ
20:125-62; and Bittner et al. (1987) Methods in Enzymol
153:516-544).
[0238] Secretion/Localization Sequences
[0239] Polynucleotides of the invention encoding NCSM polypeptides
and fragments thereof can also be fused, for example, in-frame to
nucleic acid encoding a secretion/localization sequence, to target
polypeptide expression to a desired cellular compartment, membrane,
or organelle, or to direct polypeptide secretion to the periplasmic
space or into the cell culture media. Such sequences are known to
those of skill, and include secretion leader or signal peptides,
organelle targeting sequences (e.g., nuclear localization
sequences, ER retention signals, mitochondrial transit sequences,
chloroplast transit sequences), membrane localization/anchor
sequences (e.g., stop transfer sequences, GPI anchor sequences),
and the like.
[0240] Expression Hosts
[0241] In a further embodiment, the present invention relates to
host cells containing any of the above-described nucleic acids,
vectors, or other constructs of the invention. The host cell can be
a eukaryotic cell, such as a mammalian cell, a yeast cell, or a
plant cell, or the host cell can be a prokaryotic cell, such as a
bacterial cell. Introduction of the construct into the host cell
can be effected by calcium phosphate transfection, DEAE-Dextran
mediated transfection, electroporation, gene or vaccine gun,
injection, or other common techniques (see, e.g., Davis, L.,
Dibner, M., and Battey, I. (1986) Basic Methods in Molecular
Biology) for in vivo, ex vivo or in vitro methods.
[0242] A host cell strain is optionally chosen for its ability to
modulate the expression of the inserted sequences or to process the
expressed protein in the desired fashion. Such modifications of the
protein include, but are not limited to, acetylation,
carboxylation, pegylation, glycosylation, phosphorylation,
lipidation and acylation. Post-translational processing which
cleaves a "pre" or a "prepro" form of the protein may also be
important for correct insertion, folding and/or function. Different
host cells such as E. coli, Bacillus sp., yeast or mammalian cells
such as CHO, HeLa, BHK, MDCK, HEK 293, WI38, etc. have specific
cellular machinery and characteristic mechanisms for such
post-translational activities and may be chosen to ensure the
correct modification and processing of the introduced foreign
protein.
[0243] For long-term, high-yield production of recombinant
proteins, stable expression can be used. For example, cell lines
which stably express a polypeptide of the invention are transduced
using expression vectors which contain viral origins of replication
or endogenous expression elements and a selectable marker gene.
Following the introduction of the vector, cells may be allowed to
grow for 1-2 days in an enriched media before they are switched to
selective media. The purpose of the selectable marker is to confer
resistance to selection, and its presence allows growth and
recovery of cells which successfully express the introduced
sequences. For example, resistant clumps of stably transformed
cells can be proliferated using tissue culture techniques
appropriate to the cell type.
[0244] Host cells transformed with a nucleotide sequence encoding a
NCSM polypeptide or fragments thereof of the invention are
optionally cultured under conditions suitable for the expression
and recovery of the encoded protein from cell culture. The protein
or fragment thereof produced by a recombinant cell may be secreted,
membrane-bound, or contained intracellularly, depending on the
sequence and/or the vector used. As will be understood by those of
skill in the art, expression vectors containing polynucleotides
encoding mature NCSM polypeptides of the invention can be designed
with signal sequences which direct secretion of the mature
polypeptides through a prokaryotic or eukaryotic cell membrane.
[0245] The present invention also includes at least one NCSM
polynucleotide consensus sequence derived from a comparison of two
or more NCSM polynucleotide sequences described herein (including,
e.g., a polynucleotide encoding a CD28BP or CTLA-4BP of the
invention or fragment (e.g., ECD or trunECD) thereof). The present
invention also includes at least one NCSM polynucleotide consensus
sequence derived from a comparison of two or more NCSM
polynucleotide sequences described herein. A NCSM polynucleotide
consensus sequence as used herein means a normaturally-occurring or
recombinant NCSM polynucleotide sequence that predominantly
includes those nucleic acid residues that are common to all NCSM
polynucleotides of the present invention described herein and that
includes, at one or more of those positions wherein there is no
nucleic acid residue common to all subtypes, a nucleic acid residue
that predominantly occurs at that position and in no event includes
any nucleic acid residue which is not extant in that position in at
least one NCSM polynucleotide of the invention.
[0246] Additional Sequences
[0247] The NCSM polypeptide-encoding polynucleotides of the present
invention optionally comprise a coding sequence or fragment thereof
fused in-frame to a marker sequence which, e.g., facilitates
purification of the encoded polypeptide. Such purification
facilitating domains include, but are not limited to, metal
chelating peptides such as histidine-tryptophan modules that allow
purification on immobilized metals, a sequence which binds
glutathione (e.g., GST), a hemagglutinin (HA) tag (corresponding to
an epitope derived from the influenza hemagglutinin protein;
Wilson, I. et al. (1984) Cell 37:767), maltose binding protein
sequences, the FLAG epitope utilized in the FLAGS
extension/affinity purification system (Immunex Corp, Seattle,
Wash.), and the like. The inclusion of a protease-cleavable
polypeptide linker sequence between the purification domain and the
NCSM sequence is useful to facilitate purification.
[0248] For example, one expression vector possible to use in the
compositions and methods described herein provides for expression
of a fusion protein comprising a polypeptide of the invention fused
to a polyhistidine region separated by an enterokinase cleavage
site. The histidine residues facilitate purification on IMIAC
(immobilized metal ion affinity chromatography, as described in
Porath et al. (1992) Protein Expression and Purification 3:263-281)
while the enterokinase cleavage site provides a method for
separating the NCSM polypeptide from the fusion protein. pGEX
vectors (Promega; Madison, Wis.) are optionally used to express
foreign polypeptides as fusion proteins with glutathione
S-transferase (GST). In general, such fusion proteins are soluble
and can easily be purified from lysed cells by adsorption to
ligand-agarose beads (e.g., glutathione-agarose in the case of
GST-fusions) followed by elution in the presence of free
ligand.
[0249] An additional construction in the compositions and methods
described herein provides for soluble proteins, and their encoding
nucleic acids, comprising NCSM polypeptides (or one or more
fragments thereof), e.g., as described herein fused to an Ig
molecule, e.g., human IgG Fc ("fragment crystallizable," or
fragment complement binding) hinge, CH2 domain and CH3 domain (and
nucleotide sequences encoding them). Fc is the portion of the
antibody responsible for binding to antibody receptors on cells and
the C1q component of complement. Also included are soluble forms of
the NCSM polypeptides that comprise secreted forms of the NSCM
polypeptides, as produced by chemical synthesis or, e.g., by
introducing a plasmid encoding a secreted form of the NCSM
polypeptide into a eukaryotic cell. These expressed or secreted
soluble NCSM polypeptides or fragments thereof, as well as the
soluble NCSM fusion proteins (e.g., NCSM-ECD-Ig fusion proteins or
NCSM-truncated-ECD-Ig fusion proteins) or fragments thereof and
their encoding nucleic acids are optionally useful as prophylactic
and/or therapeutic drugs or as diagnostic tools (see also, e.g.,
Challita-Eid, P. et al. (1998) J Immunol 160:3419-3426;
Sturmhoefel, K. et al. (1999) Cancer Res 59:4964-4972).
[0250] Polypeptide Production and Recovery
[0251] Following transduction of a suitable host strain and growth
of the host strain to an appropriate cell density, the selected
promoter is induced by appropriate means (e.g., temperature shift
or chemical induction) and cells are cultured for an additional
period. Cells are typically harvested by centrifugation, disrupted
by physical or chemical means, and the resulting crude extract
retained for further purification. Eukaryotic or microbial cells
employed in expression of the NCSM proteins can be disrupted by any
convenient method, including freeze-thaw cycling, sonication,
mechanical disruption, or use of cell lysing agents, or other
methods, which are well know to those skilled in the art.
[0252] As noted, many references are available for the culture and
production of many cells, including cells of bacterial, plant,
animal (especially mammalian) and archebacterial origin. See, e.g.,
Sambrook, Ausubel, and Berger (all supra), as well as Freshney
(1994) Culture of Animal Cells, a Manual of Basic Technique, third
edition, Wiley-Liss, New York and the references cited therein;
Doyle and Griffiths (1997) Mammalian Cell Culture: Essential
Techniques John Wiley and Sons, NY; Humason (1979) Animal Tissue
Techniques, fourth edition W.H. Freeman and Company; and
Ricciardelli et al. (1989) In vitro Cell Dev Biol 25:1016-1024. For
plant cell culture and regeneration see, e.g., Payne et al. (1992)
Plant Cell and Tissue Culture in Liquid Systems John Wiley &
Sons, Inc. New York, N.Y.; Gamborg and Phillips (eds.) (1995) Plant
Cell, Tissue and Organ Culture; Fundamental Methods Springer Lab
Manual, Springer-Verlag (Berlin Heidelberg New York) and Plant
Molecular Biology (1993) R.R.D. Croy (ed.) Bios Scientific
Publishers, Oxford, U.K. ISBN 0 12 198370 6. Cell culture media in
general are set forth in Atlas and Parks (eds.) The Handbook of
Microbiological Media (1993) CRC Press, Boca Raton, Fla. Additional
information for cell culture is found in available commercial
literature such as the Life Science Research Cell Culture Catalogue
(1998) from Sigma-Aldrich, Inc (St Louis, Mo.) ("Sigma-LSRCCC")
and, e.g., the Plant Culture Catalogue and supplement (1997) also
from Sigma-Aldrich, Inc (St Louis, Mo.) ("Sigma-PCCS").
[0253] Polypeptides of the invention can be recovered and purified
from recombinant cell cultures by any of a number of methods well
known in the art, including ammonium sulfate or ethanol
precipitation, acid extraction, anion or cation exchange
chromatography, phosphocellulose chromatography, hydrophobic
interaction chromatography, affinity chromatography (e.g., using
any of the tagging systems noted herein), hydroxylapatite
chromatography, and lectin chromatography. Protein refolding steps
can be used, as desired, in completing configuration of the mature
NCSM protein or fragments thereof. Finally, high performance liquid
chromatography (HPLC) can be employed in the final purification
steps. In addition to the references noted, supra, a variety of
purification methods are well known in the art, including, e.g.,
those set forth in Sandana (1997) Bioseparation of Proteins,
Academic Press, Inc.; Bollag et al. (1996) Protein Methods,
2.sup.nd Edition Wiley-Liss, NY; Walker (1996) The Protein
Protocols Handbook Humana Press, NJ; Harris and Angal (1990)
Protein Purification Applications: A Practical Approach IRL Press
at Oxford, Oxford, England; Harris and Angal Protein Purification
Methods: A Practical Approach IRL Press at Oxford, Oxford, England;
Scopes (1993) Protein Purification Principles and Practice 3.sup.rd
Edition Springer Verlag, NY; Janson and Ryden (1998) Protein
Purification: Principles, High Resolution Methods and Applications,
Second Edition Wiley-VCH, NY; and Walker (1998) Protein Protocols
on CD-ROM Humana Press, NJ.
[0254] In Vitro Expression Systems
[0255] Cell-free transcription/translation systems can also be
employed to produce NCSM polypeptides or fragments thereof using
DNAs or RNAs of the present invention or fragments thereof. Several
such systems are commercially available. A general guide to in
vitro transcription and translation protocols is found in Tymms
(1995) In vitro Transcription and Translation Protocols: Methods in
Molecular Biology Volume 37, Garland Publishing, NY.
[0256] Modified Amino Acids
[0257] Polypeptides of the invention may contain one or more
modified amino acids. The presence of modified amino acids may be
advantageous in, for example, (a) increasing polypeptide serum
half-life, (b) reducing polypeptide antigenicity, or (c) increasing
polypeptide storage stability. Amino acid(s) are modified, for
example, co-translationally or post-translationally during
recombinant production (e.g., N-linked glycosylation at N-X-S/T
motifs during expression in mammalian cells) or modified by
synthetic means.
[0258] Non-limiting examples of a modified amino acid include a
glycosylated amino acid, a sulfated amino acid, a prenlyated (e.g.,
farnesylated, geranylgeranylated) amino acid, an acetylated amino
acid, an acylated amino acid, a PEG-ylated amino acid, a
biotinylated amino acid, a carboxylated amino acid, a
phosphorylated amino acid, and the like. References adequate to
guide one of skill in the modification of amino acids are replete
throughout the literature. Example protocols are found in Walker
(1998) Protein Protocols on CD-ROM Humana Press, Towata, N.J.
[0259] In Vivo Uses and Applications
[0260] Polynucleotides or fragments thereof that encode a NCSM
polypeptide of the invention, or complements of the polynucleotides
(e.g., antisense or ribozyme molecules), are optionally
administered to a cell to accomplish a therapeutically useful
process or to express a therapeutically useful product. These in
vivo applications, including gene therapy, include a multitude of
techniques by which gene expression may be altered in cells. Such
methods include, for instance, the introduction of genes for
expression of, e.g., therapeutically and/or prophylactically useful
polypeptides, such as the NCSM polypeptides of the present
invention or fragments thereof.
[0261] In Vivo Polypeptide Expression
[0262] Polynucleotides encoding NCSM polypeptides of the invention
and fragments thereof are particularly useful for in vivo
therapeutic applications, using techniques well known to those
skilled in the art. For example, cultured cells are engineered ex
vivo with at least one NCSM polynucleotide (DNA or RNA) and/or
other polynucleotide sequences encoding, e.g., at least one of an
antigen, cytokine, other co-stimulatory molecule, adjuvant, etc.,
and the like, with the engineered cells then being returned to the
patient. Cells may also be engineered in vivo for expression of one
or more polypeptides in vivo. including NCSM polypeptides and/or
antigenic peptides.
[0263] A number of viral vectors suitable for organismal in vivo
transduction and expression are known. Such vectors include
retroviral vectors (see, e.g., Miller, Curr Top Microbiol Immunol
(1992) 158:1-24; Salmons and Gunzburg (1993) Human Gene Therapy
4:129-141; Miller et al. (1994) Methods in Enzymology 217:581-599)
and adeno-associated vectors (reviewed in Carter (1992) Curr
Opinion Biotech 3:533-539; Muzcyzka (1992) Curr Top Microbiol
Immunol. 158:97-129). Other viral vectors that are used include
adenoviral vectors, herpes viral vectors and Sindbis viral vectors,
as generally described in, e.g., Jolly (1994) Cancer Gene Therapy
1:51-64; Latchman (1994) Molec Biotechnol 2:179-195; and Johanning
et al. (1995) Nucl Acids Res 23:1495-1501.
[0264] In one aspect, a pox virus vector can be used. The pox viral
vector is transfected with a polynucleotide sequence encoding of
the NCSM polypeptides (or fragments thereof) of the invention, such
as a CD28BP polypeptide, and is useful in prophylactic, therapeutic
and diagnostic applications where enhancement of an immune
response, such as increased or improved T cell proliferation or
activation (or inhibition of an immune response, such as inhibition
of T cell proliferation, if, e.g., a polynucleotide encoding a
CTAL4-BP polypeptide is used) is desired. See viral vectors
discussed in, e.g., Berencsi et al., J Infect Dis
(2001)183(8):1171-9; Rosenwirth et al., Vaccine 2001 Feb. 8;
19(13-14):1661-70; Kittlesen et al., J Immunol (2000)
164(8):4204-11; Brown et al. Gene Ther 2000 7(19):1680-9;
Kanesa-thasan et al., Vaccine (2000) 19(4-5):483-91; Sten (2000)
Drug 60(2):249-71. Compositions comprising such vectors and an
acceptable excipient are also a feature of the invention.
[0265] Gene therapy and genetic vaccines provide methods for
combating chronic infectious diseases (e.g., HIV infection, viral
hepatitis), as well as non-infectious diseases including cancer and
some forms of congenital defects such as enzyme deficiencies, and
such methods can be employed with NCSM polynucleotides of the
invention, including, e.g., vectors and cells comprising such
polynucleotides. Several approaches for introducing nucleic acids
and vectors into cells in vivo, ex vivo and in vitro have been used
and can be employed with NCSM polynucleotides encoding NCSM
polypeptides and fragments thereof (including, e.g., ECD domains
and fusion proteins), and vectors comprising NCSM sequences. These
approaches include liposome based gene delivery (Debs and Zhu
(1993) WO 93/24640 and U.S. Pat. No. 5,641,662; Mannino and
Gould-Fogerite (1988) BioTechniques 6(7):682-691; Rose, U.S. Pat.
No. 5,279,833; Brigham (1991) WO 91/06309; and Feigner et al.
(1987) Proc Natl Acad Sci USA 84:7413-7414; Brigham et al. (1989)
Am J Med Sci 298:278-281; Nabel et al. (1990) Science
249:1285-1288; Hazinski et al. (1991) Am J Resp Cell Molec Biol
4:206-209; and Wang and Huang (1987) Proc Natl Acad Sci USA
84:7851-7855); adenoviral vector mediated gene delivery, e.g., to
treat cancer (see, e.g., Chen et al. (1994) Proc Natl Acad Sci USA
91:3054-3057; Tong et al. (1996) Gynecol Oncol 61:175-179; Clayman
et al. (1995) Cancer Res. 5:1-6; O'Malley et al. (1995) Cancer Res
55:1080-1085; Hwang et al. (1995) Am J Respir Cell Mol Biol
13:7-16; Haddada et al. (1995) Curr Top Microbiol Immunol. 1995
(Pt. 3):297-306; Addison et al. (1995) Proc Natl Acad Sci USA
92:8522-8526; Colak et al. (1995) Brain Res 691:76-82; Crystal
(1995) Science 270:404-410; Elshami et al. (1996) Human Gene Ther
7:141-148; Vincent et al. (1996) J Neurosurg 85:648-654), and many
others. Replication-defective retroviral vectors harboring
therapeutic polynucleotide sequence as part of the retroviral
genome have also been used, particularly with regard to simple MuLV
vectors. See, e.g., Miller et al. (1990) Mol Cell Biol 10:4239
(1990); Kolberg (1992) J NIH Res 4:43, and Cornetta et al. (1991)
Hum Gene Ther 2:215). Nucleic acid transport coupled to
ligand-specific, cation-based transport systems (Wu and Wu (1988) J
Biol Chem, 263:14621-14624) has also been used Naked DNA expression
vectors have also been described (Nabel et al. (1990), supra);
Wolff et al. (1990) Science, 247:1465-1468). In general, these
approaches can be adapted to the invention by incorporating nucleic
acids encoding the NCSM polypeptides or fragments thereof herein
into the appropriate vectors.
[0266] General texts which describe gene therapy protocols, which
can be adapted to the present invention by introducing the nucleic
acids of the invention into patients, include, e.g., Robbins (1996)
Gene Therapy Protocols, Humana Press, NJ, and Joyner (1993) Gene
Targeting: A Practical Approach, IRL Press, Oxford, England.
[0267] Antisense Technology
[0268] In addition to expression of the NCSM nucleic acids of the
invention as gene replacement nucleic acids, the nucleic acids are
also useful for sense and anti-sense suppression of expression,
e.g., to down-regulate expression of a nucleic acid of the
invention, once, or when, expression of the nucleic acid is
no-longer desired in the cell. Similarly, the nucleic acids of the
invention, or subsequences or anti-sense sequences thereof, can
also be used to block expression of naturally occurring homologous
nucleic acids. A variety of sense and anti-sense technologies are
known in the art, e.g., as set forth in Lichtenstein and Nellen
(1997) Antisense Technology: A Practical Approach IRL Press at
Oxford University, Oxford, England, and in Agrawal (1996) Antisense
Therapeutics Humana Press, NJ, and the references cited
therein.
[0269] Use as Probes
[0270] Also contemplated are uses of polynucleotides, also referred
to herein as oligonucleotides, typically having at least 12 bases,
preferably at least 15, more preferably at least 20, at least 30,
or at least 50 or more bases, which hybridize under highly
stringent conditions to a NCSM polynucleotide, variant or homologue
sequence described herein or fragments thereof. The polynucleotides
may be used as probes, primers, sense and antisense agents, and the
like, according to methods as noted supra.
Sequence Variations
[0271] Silent Variations
[0272] Because of the degeneracy of the genetic code, a large
number of functionally identical nucleic acids encode any given
polypeptide. For instance, inspection of the codon table (Table 1)
shows that codons AGA, AGG, CGA, CGC, CGG, and CGU all encode the
amino acid arginine. Thus, at every position in a nucleic acid
sequence where an arginine is specified by a codon, the codon can
be altered to any of the corresponding codons described above
without altering the encoded polypeptide. Such nucleic acid
variations are "silent variations" are one species of
"conservatively modified variations." It is understood that U in an
RNA sequence corresponds to T in a DNA sequence.
TABLE-US-00001 TABLE 1 Codon Table Amino acids Codon Alanine Ala A
GCA GCC GCG GCU Cysteine Cys C UGC UGU Aspartic acid Asp D GAC GAU
Glutamic acid Glu E GAA GAG Phenylalanine Phe F UUC UUU Glycine Gly
G GGA GGC GGG GGU Histidine His H CAC CAU Isoleucine Ile I AUA AUC
AUU Lysine Lys K AAA AAG Leucine Leu L UUA UUG CUA CUC CUG CUU
Methionine Met M AUG Asparagine Asn N AAC AAU Proline Pro P CCA CCC
CCG CCU Glutamine Gln Q CAA CAG Arginine Arg R AGA AGG CGA CGC CGG
CGU Serine Ser S AGC AGU UCA UCC UCG UCU Threonine Thr T ACA ACC
ACG ACU Valine Val V GUA GUC GUG GUU Tryptophan Trp W UGG Tyrosine
Tyr Y UAC UAU
[0273] It will thus be appreciated by those skilled in the art that
due to the degeneracy of the genetic code, a multitude of nucleic
acids sequences encoding NCSM polypeptides of the invention may be
produced, some of which may bear minimal sequence homology to the
nucleic acid sequences explicitly disclosed herein. Using, as an
example, the nucleic acid sequence corresponding to nucleotides
1-15 of SEQ ID NO:1, ATG GGT CAC ACA ATG, a silent variation of
this sequence includes ATG GGA CAT ACG ATG, both of which sequences
encode the amino acid sequence MGHTM, which corresponds to amino
acids 1-5 of SEQ ID NO:48.
[0274] One of ordinary skill in the art will recognize that each
codon in a nucleic acid (except AUG and UGC, which are ordinarily
the only codon for methionine and tryptophan, respectively) can be
modified by standard techniques to encode a functionally identical
polypeptide. Accordingly, each silent variation of a nucleic acid
which encodes a polypeptide is implicit in any described sequence.
The invention also provides each and every possible variation of a
nucleic acid sequence encoding a NCSM polypeptide of the invention
that can be made by selecting combinations based on possible codon
choices. These combinations are made in accordance with the
standard triplet genetic code (codon) (e.g., as set forth in Table
1), as applied to the nucleic acid sequence encoding a polypeptide
of the invention or fragment thereof. All such variations of every
nucleic acid herein are specifically provided and described by
consideration of the sequence in combination with the genetic code.
One of skill is fully able to generate any silent substitution of
the sequences listed herein. For example, the invention includes
polynucleotides comprising one or more silent variations of any
polynucleotide sequence selected from SEQ ID NOS:1-21 and 95-142,
or complementary polynucleotides thereof. Also included are
polynucleotides comprising one or more silent variations of a
nucleotide segment or fragment of any polynucleotide sequence
selected from SEQ ID NOS:1-21 and 95-142, or complementary
polynucleotides thereof, wherein such nucleotide segment or
fragment comprises a nucleotide sequence that encodes a signal
peptide and/or extracellular domain of an NCSM polypeptide or a
nucleotide sequence that encodes an extracellular domain of an NCSM
polypeptide. In one such aspect, for example, polynucleotides
comprising one or more silent variations of a nucleotide segment or
fragment comprising nucleic acid residues 1-102 (encoding a signal
peptide) and/or 103-729 (encoding extracellular domain) of any of
SEQ ID NOS:1-21 and 95-142 are provided. Also provided are
polynucleotides comprising one or more silent variations of any
polynucleotide sequence encoding a polypeptide selected from SEQ ID
NOS:48-68, 174,221,283-295, 290-293, or complementary
polynucleotide thereof, and nucleotide segments fragments thereof,
including those encoding an NCSM signal peptide and/or
extracellular domain. Also provided are polypeptides encoded by all
such polynucleotides of the invention comprising one or more silent
variations.
[0275] Conservative Variations
[0276] "Conservatively modified variations," or simply
"conservative variations," of a particular nucleic acid sequence
refer to those nucleic acid sequences that encode identical or
essentially identical amino acid sequences, or, where the nucleic
acid does not encode an amino acid sequence, to essentially
identical sequences. One of skill will recognize that individual
substitutions, deletions or additions which alter, add or delete a
single amino acid or a small percentage of amino acids (typically
less than 5%, more typically less than 4%, 2% or 1%) in an encoded
sequence of the invention are "conservatively modified variations"
where the alterations result in the deletion, addition, and/or
substitution of an amino acid with a chemically similar amino
acid.
[0277] Conservative substitution tables providing functionally
similar amino acids are well known in the art. Table 2 sets forth
six exemplary groups that contain amino acids that are
"conservative substitutions" for one another.
TABLE-US-00002 TABLE 2 Conservative Substitution Groups 1 Alanine
(A) Serine (S) Threonine (T) 2 Aspartic acid (D) Glutamic acid (E)
3 Asparagine (N) Glutamine (Q) 4 Arginine (R) Lysine (K) 5
Isoleucine (I) Leucine (L) Methionine (M) Valine (V) 6
Phenylalanine (F) Tyrosine (Y) Tryptophan (W)
[0278] Additional groups of amino acids can also be formulated. For
example, amino acids can be grouped by similar function or chemical
structure or composition (e.g., acidic, basic, aliphatic, aromatic,
sulfur-containing). For example, an aliphatic grouping may
comprise: Glycine (G), Alanine, Valine, Leucine, Isoleucine. Other
groups containing amino acids that are conservative substitutions
for one another include: Aromatic: Phenylalanine (F), Tyrosine (Y),
Tryptophan (W); Sulfur-containing: Methionine (M), Cysteine (C);
Basic: Arginine (R), Lysine (K), Histidine (H); Acidic: Aspartic
acid (D), Glutamic acid (E), Asparagine (N), Glutamine (Q). See
also Creighton (1984) Proteins, W.H. Freeman and Company, for
additional groupings of amino acids.
[0279] Thus, "conservatively substituted variations" of a
polypeptide sequence of the present invention include substitutions
of a small percentage, typically less than 5%, more typically less
than 4%, 3%, 2%, or 1%, of the amino acids of the sequence, with a
conservatively selected amino acid of the same conservative
substitution group.
[0280] For example, a conservatively substituted variation of the
polypeptide identified herein as SEQ ID NO:48 may contain
"conservative substitutions," according to the six groups defined
above, in up to 15 residues (i.e., 5% of the amino acids) in the
296 amino acid polypeptide. Listing of a polypeptide or protein
sequence herein, in conjunction with the above substitution table,
provides an express listing of all conservatively substituted
polypeptide or protein sequences.
[0281] In a further example, if four conservative substitutions
were localized in the region corresponding to amino acids 69-94 of
SEQ ID NO:48, examples of conservatively substituted variations of
this region, QKDSK MVLAI LPGKV QVWPE YKNRTI, would include:
[0282] NKDSK MVVAI LPGKV QVFPE YKNKTI and
[0283] QKDAK MVLAI LPGRV QMWPE YKQRTI and the like, where
conservative substitutions listed in Table 2 (in the above example,
conservative substitutions are underlined).
[0284] The addition of one or more nucleic acids or sequences that
do not alter the encoded activity of a nucleic acid molecule of the
invention, such as the addition of a non-functional sequence, is a
conservative variation of the basic nucleic acid molecule, and the
addition of one or more amino acid residues that do not alter the
activity of a polypeptide of the invention is a conservative
variation of the basic polypeptide. Both such types of additions
are features of the invention.
[0285] One of skill will appreciate that many conservative
variations of the nucleic acid sequence constructs that are
disclosed yield a functionally identical construct. For example, as
discussed above, owing to the degeneracy of the genetic code,
"silent substitutions" (i.e., substitutions in a nucleic acid
sequence which do not result in an alteration in an encoded
polypeptide) are an implied feature of every nucleic acid sequence
that encodes an amino acid. Similarly, "conservative amino acid
substitutions," in one or a few amino acids in an amino acid
sequence are substituted with different amino acids with highly
similar properties, are also readily identified as being highly
similar to a disclosed construct. Such conservative variations of
each disclosed sequence are a feature of the present invention.
[0286] In one aspect, the invention includes polynucleotides
comprising one or more conservative variations of any polypeptide
selected from SEQ ID NOS:48-68, 174-221, 283-285, and 290-293. Also
included are polypeptides comprising one or more conservative
variations of a polypeptide segment or fragment of any polypeptide
sequence selected from SEQ ID NOS:48-68, 174-221, 283-285, and
290-293, wherein such polypeptide segment or fragment comprises an
amino acid sequence comprising a signal peptide and/or ECD of an
NCSM polypeptide or an amino acid sequence comprising an ECD of an
NCSM polypeptide. In one such aspect, polypeptides comprising at
least one conservative variation of a polypeptide segment or
fragment comprising amino acid residues 1-34 (encoding a signal
peptide) and/or 35-243 (encoding an ECD) of any of SEQ ID NOS:
48-68, 174-221, 283-285, and 290-293 are provided. Also provided
are polypeptides comprising at least one conservative variation of
any polypeptide sequence encoded by a polynucleotide sequence
selected from SEQ ID NOS:1-21 and 95-142, or complementary
polynucleotide thereof, and nucleotide segments fragments thereof,
including those encoding an NCSM signal peptide and/or ECD. Also
provided are polynucleotides encoded by all such polynucleotides of
the invention comprising one or more conservative variations.
[0287] Nucleic Acid Hybridization
[0288] Nucleic acids "hybridize" when they associate, typically in
solution. Nucleic acids hybridize due to a variety of well
characterized physico-chemical forces, such as hydrogen bonding,
solvent exclusion, base stacking and the like. An extensive guide
to the hybridization of nucleic acids is found in Tijssen (1993)
Laboratory Techniques in Biochemistry and Molecular
Biology--Hybridization with Nucleic Acid Probes, part I, chapter 2,
"Overview of principles of hybridization and the strategy of
nucleic acid probe assays," (Elsevier, N.Y.) (hereinafter
"Tjissen"), as well as in Ausubel, supra, Hames and Higgins (1995)
Gene Probes 1, IRL Press at Oxford University Press, Oxford,
England (Hames and Higgins 1) and Hames and Higgins (1995) Gene
Probes 2, IRL Press at Oxford University. Press, Oxford, England
(Hames and Higgins 2) provide details on the synthesis, labeling,
detection and quantification of DNA and RNA, including
oligonucleotides.
[0289] An indication that two nucleic acid sequences are
substantially identical is that the two molecules hybridize to each
other under at least stringent conditions. The phrase "hybridizing
specifically to," refers to the binding, duplexing, or hybridizing
of a molecule only to a particular nucleotide sequence under
stringent conditions when that sequence is present in a complex
mixture (e.g., total cellular) DNA or RNA. "Bind(s) substantially"
refers to complementary hybridization between a probe nucleic acid
and a target nucleic acid and embraces minor mismatches that can be
accommodated by reducing the stringency of the hybridization media
to achieve the desired detection of the target polynucleotide
sequence.
[0290] "Stringent hybridization wash conditions" and "stringent
hybridization conditions" in the context of nucleic acid
hybridization experiments, such as Southern and northern
hybridizations, are sequence dependent, and are different under
different environmental parameters. An extensive guide to
hybridization of nucleic acids is found in Tijssen (1993), supra,
and in Hames and Higgins 1 and Hames and Higgins 2, supra.
[0291] For purposes of the present invention, generally, "highly
stringent" hybridization and wash conditions are selected to be
about 5.degree. C. (or less) lower than the thermal melting point
(T.sub.m) for the specific sequence at a defined ionic strength and
pH (as noted below, highly stringent conditions can also be
referred to in comparative terms). The T.sub.m is the temperature
(under defined ionic strength and pH) at which 50% of the test
sequence hybridizes to a perfectly matched probe. In other words,
the T.sub.m indicates the temperature at which the nucleic acid
duplex is 50% denatured under the given conditions and its
represents a direct measure of the stability of the nucleic acid
hybrid. Thus, the T.sub.m corresponds to the temperature
corresponding to the midpoint in transition from helix to random
coil; it depends on length, nucleotide composition, and ionic
strength for long stretches of nucleotides. Typically, under
"stringent conditions," a probe will hybridize to its target
subsequence, but to no other sequences. "Very stringent conditions"
are selected to be equal to the T.sub.m for a particular probe.
[0292] After hybridization, unhybridized nucleic acid material can
be removed by a series of washes, the stringency of which can be
adjusted depending upon the desired results. Low stringency washing
conditions (e.g., using higher salt and lower temperature) increase
sensitivity, but can product nonspecific hybridization signals and
high background signals. Higher stringency conditions (e.g., using
lower salt and higher temperature that is closer to the
hybridization temperature) lowers the background signal, typically
with only the specific signal remaining. See, Rapley, R. and
Walker, J. M. eds., Molecular Biomethods Handbook (Humana Press,
Inc. 1998) (hereinafter "Rapley and Walker"), which is incorporated
herein by reference in its entirety for all purposes.
[0293] The T.sub.m of a DNA-DNA duplex can be estimated using
equation (1):
T.sub.m (.degree. C.)=81.5.degree. C.+16.6 (log.sub.10M)+0.41 (%
G+C)-0.72 (% f)-500/n,
[0294] where M is the molarity of the monovalent cations (usually
Na+), (% G+C) is the percentage of guanosine (G) and cystosine (C)
nucleotides, (% f) is the percentage of formalize and n is the
number of nucleotide bases (i.e., length) of the hybrid. See,
Rapley and Walker, supra.
[0295] The T.sub.m of an RNA-DNA duplex can be estimated using
equation (2):
T.sub.m (.degree. C.)=79.8.degree. C.+18.5 (log.sub.10M)+0.58 (%
G+C)-11.8(% G+C).sup.2-0.56(% f)-820/n,
[0296] where M is the molarity of the monovalent cations (usually
Na+), (% G+C) is the percentage of guanosine (G) and cystosine (C)
nucleotides, (% f) is the percentage of formamide and n is the
number of nucleotide bases (i.e., length) of the hybrid. Id.
Equations 1 and 2 above are typically accurate only for hybrid
duplexes longer than about 100-200 nucleotides. Id.
[0297] The Tm of nucleic acid sequences shorter than 50 nucleotides
can be calculated as follows:
T.sub.m (.degree. C.)=4(G+C)+2(A+T), where A (adenine), C, T
(thymine), and G
are the numbers of the corresponding nucleotides.
[0298] An example of stringent hybridization conditions for
hybridization of complementary nucleic acids which have more than
100 complementary residues on a filter in a Southern or northern
blot is 50% formalin (or formamide) with 1 mg of heparin at
42.degree. C., with the hybridization being carried out overnight.
An example of stringent wash conditions is a 0.2.times.SSC wash at
65.degree. C. for 15 minutes (see Sambrook, supra, for a
description of SSC buffer). Often, the high stringency wash is
preceded by a low stringency wash to remove background probe
signal. An example low stringency wash is 2.times.SSC at 40.degree.
C. for 15 minutes. An example of highly stringent wash conditions
is 0.15M NaCl at 72.degree. C. for about 15 minutes. An example
medium stringency wash for a duplex of, e.g., more than 100
nucleotides, is 1.times.SSC at 45.degree. C. for 15 minutes. An
example low stringency wash for a duplex of, e.g., more than 100
nucleotides, is 4-6.times.SSC at 40.degree. C. for 15 minutes. For
short probes (e.g., about 10 to 50 nucleotides), stringent
conditions typically involve salt concentrations of less than about
1.0 M Na ion, typically about 0.01 to 1.0 M Na ion concentration
(or other salts) at pH 7.0 to 8.3, and the temperature is typically
at least about 30.degree. C. Stringent conditions can also be
achieved with the addition of destabilizing agents such as
formamide.
[0299] In general, a signal to noise ratio of 2.times. or
2.5.times.-5.times. (or higher) than that observed for an unrelated
probe in the particular hybridization assay indicates detection of
a specific hybridization. Detection of at least stringent
hybridization between two sequences in the context of the present
invention indicates relatively strong structural similarity or
homology to, e.g., the nucleic acids of the present invention
provided in the sequence listings herein.
[0300] As noted, "highly stringent" conditions are selected to be
about 5.degree. C. or less lower than the thermal melting point
(T.sub.m) for the specific sequence at a defined ionic strength and
pH. Target sequences that are closely related or identical to the
nucleotide sequence of interest (e.g., "probe") can be identified
under highly stringency conditions. Lower stringency conditions are
appropriate for sequences that are less complementary. See, e.g.,
Rapley and Walker; Sambrook, all supra.
[0301] Comparative hybridization can be used to identify nucleic
acids of the invention, and this comparative hybridization method
is a preferred method of distinguishing nucleic acids of the
invention. Detection of highly stringent hybridization between two
nucleotide sequences in the context of the present invention
indicates relatively strong structural similarity/homology to,
e.g., the nucleic acids provided in the sequence listing herein.
Highly stringent hybridization between two nucleotide sequences
demonstrates a degree of similarity or homology of structure,
nucleotide base composition, arrangement or order that is greater
than that detected by stringent hybridization conditions. In
particular, detection of highly stringent hybridization in the
context of the present invention indicates strong structural
similarity or structural homology (e.g., nucleotide structure, base
composition, arrangement or order) to, e.g., the nucleic acids
provided in the sequence listings herein. For example, it is
desirable to identify test nucleic acids which hybridize to the
exemplar nucleic acids herein under stringent conditions.
[0302] Thus, one measure of stringent hybridization is the ability
to hybridize to one of the listed nucleic acids of the invention
(e.g., nucleic acid sequences SEQ ID NOS:1-47, 95-173, and 253-262,
and complementary polynucleotide sequences thereof) under highly
stringent conditions (or very stringent conditions, or ultra-high
stringency hybridization conditions, or ultra-ultra high stringency
hybridization conditions). Stringent hybridization (including,
e.g., highly stringent, ultra-high stringency, or ultra-ultra high
stringency hybridization conditions) and wash conditions can easily
be determined empirically for any test nucleic acid.
[0303] For example, in determining highly stringent hybridization
and wash conditions, the hybridization and wash conditions are
gradually increased (e.g., by increasing temperature, decreasing
salt concentration, increasing detergent concentration and/or
increasing the concentration of organic solvents, such as formalin,
in the hybridization or wash), until a selected set of criteria are
met. For example, the hybridization and wash conditions are
gradually increased until a probe comprising one or more nucleic
acid sequences selected from SEQ ID NOS:1-47, 95-173, and 253-262,
and complementary polynucleotide sequences thereof, binds to a
perfectly matched complementary target (again, a nucleic acid
comprising one or more nucleic acid sequences selected from SEQ ID
NOS:1-47, 95-173, and 253-262, and complementary polynucleotide
sequences thereof), with a signal to noise ratio that is at least
2.5.times., and optionally 5.times. or more as high as that
observed for hybridization of the probe to an unmatched target. In
this case, the unmatched target is a nucleic acid corresponding to,
e.g., a known B7-1 or related known co-stimulatory homologue or the
like, e.g., a B7-1 nucleic acid (other than those in the
accompanying sequence listing) present in a public database such as
GenBank.TM. at the time of filing of the subject application.
Examples of such unmatched target nucleic acids include, e.g., the
following: A92749, A92750, AA983817, AB026121, AB030650, AB030651,
AB038153, AF010465, AF065893, AF065894, AF065895, AF065896,
AF079519, AF106824, AF106825, AF106828, AF106829, AF106830,
AF106831, AF106832, AF106833, AF106834, AF203442, AF203443,
AF216747, AF257653, AH004645, AH008762, AX000904, AX000905, D49843,
L12586, L12587, M27533, M83073, M83074, M83075, M83077, NM005191,
S74541, S74540, S74695, S74696, U05593, U10925, U19833, U19840,
U26832, U33063, U33208, U57755, U88622, X60958, Y08823, and Y09950,
where the numbers correspond to GenBank accession numbers.
Additional such sequences can be identified in GenBank by one of
ordinary skill in the art.
[0304] A test nucleic acid is said to specifically hybridize to a
probe nucleic acid when it hybridizes at least 1/2 as well to the
probe as to the perfectly matched complementary target, i.e., with
a signal to noise ratio at least 1/2 as high as hybridization of
the probe to the target under conditions in which the perfectly
matched probe binds to the perfectly matched complementary target
with a signal to noise ratio that is at least about
2.5.times.-10.times., typically 5.times.-10.times. as high as that
observed for hybridization to any of the unmatched target nucleic
acids such as, A92749, A92750, AA983817, AB026121, AB030650,
AB030651, AB038153, AF010465, AF065893, AF065894, AF065895,
AF065896, AF079519, AF106824, AF106825, AF106828, AF106829,
AF106830, AF106831, AF106832, AF106833, AF106834, AF203442,
AF203443, AF216747, AF257653, AH004645, AH008762, AX000904,
AX000905, D49843, L12586, L12587, M27533, M83073, M83074, M83075,
M83077, NM005191, S74541, S74540, S74695, S74696, U05593, U10925,
U19833, U19840, U26832, U33063, U33208, U57755, U88622, X60958,
Y08823, and Y09950 (where the numbers correspond to GenBank
accession numbers), or, e.g., other similar known B7-1 or related
co-stimulatory sequences or the like presented in GenBank. In one
aspect, the invention provides a target nucleic acid that, but for
the degeneracy of the genetic code, hybridizes under stringent
conditions to a unique coding oligonucleotide that encodes a unique
subsequence in a polypeptide selected from SEQ ID NOS:48-94,
174-252, 263-272, and 283-293, where the unique subsequence is
unique compared to a polypeptide encoded by any of above GenBank
Nucleotide Access Nos. For some such nucleic acids, the stringent
conditions are selected such that a perfectly complementary
oligonucleotide to the coding oligonucleotide hybridizes to the
coding oligonucleotide with at least about a 5.times.higher signal
to noise ratio than for hybridization of the perfectly
complementary oligonucleotide to a control nucleic acid
corresponding to any of GenBank Nucleotide Accession Nos. set forth
above.
[0305] Ultra high-stringency hybridization and wash conditions are
those in which the stringency of hybridization and wash conditions
are increased until the signal to noise ratio for binding of the
probe to the perfectly matched complementary target nucleic acid is
at least 10.times. as high as that observed for hybridization to
any of the unmatched target nucleic acids, such as, A92749, A92750,
AA983817, AB026121, AB030650, AB030651, AB038153, AF010465,
AF065893, AF065894, AF065895, AF065896, AF079519, AF106824,
AF106825, AF106828, AF106829, AF106830, AF106831, AF106832,
AF106833, AF106834, AF203442, AF203443, AF216747, AF257653,
AH004645, AH008762, AX000904, AX000905, D49843, L12586, L12587,
M27533, M83073, M83074, M83075, M83077, NM005191, S74541, S74540,
S74695, S74696, U05593, U10925, U19833, U19840, U26832, U33063,
U33208, U57755, U88622, X60958, Y08823, and Y09950 (where the
numbers correspond to GenBank accession numbers), or, e.g., to
other similar known B7-1 or co-stimulatory molecule sequences or
the like presented in GenBank. A target nucleic acid which
hybridizes to a probe under such conditions, with a signal to noise
ratio of at least 1/2 that of the perfectly matched complementary
target nucleic acid is said to bind to the probe under ultra-high
stringency conditions.
[0306] Similarly, even higher levels of stringency can be
determined by gradually increasing the hybridization and/or wash
conditions of the relevant hybridization assay. For example, those
in which the stringency of hybridization and wash conditions are
increased until the signal to noise ratio for binding of the probe
to the perfectly matched complementary target nucleic acid is at
least 10.times., 20.times., 50.times., 100.times., or 500.times. or
more as high as that observed for hybridization to any of the
unmatched target nucleic acids, such as those represented by:
A92749, A92750, AA983817, AB026121, AB030650, AB030651, AB038153,
AF010465, AF065893, AF065894, AF065895, AF065896, AF079519,
AF106824, AF106825, AF106828, AF106829, AF106830, AF106831,
AF106832, AF106833, AF106834, AF203442, AF203443, AF216747,
AF257653, AH004645, AH008762, AX000904, AX000905, D49843, L12586,
L12587, M27533, M83073, M83074, M83075, M83077, NM005191, S74541,
S74540, S74695, S74696, U05593, U10925, U19833, U19840, U26832,
U33063, U33208, U57755, U88622, X60958, Y08823, and Y09950 (where
the numbers correspond to GenBank accession numbers), or, e.g.,
other similar B7-1 or co-stimulatory sequences or the like
presented in GenBank can be identified. A target nucleic acid which
hybridizes to a probe under such conditions, with a signal to noise
ratio of at least 1/2 that of the perfectly matched complementary
target nucleic acid is said to bind to the probe under
ultra-ultra-high stringency conditions.
[0307] Target nucleic acids which hybridize to the nucleic acids
represented by SEQ ID NOS:1-47, 95-173, and 253-262 under high,
ultra-high and ultra-ultra high stringency conditions are a feature
of the invention. Examples of such nucleic acids include those with
one or a few silent or conservative nucleic acid substitutions as
compared to a given nucleic acid sequence.
[0308] Nucleic acids that do not hybridize to each other under
stringent conditions are still substantially identical if the
polypeptides that they encode are substantially identical. This
occurs, e.g., when a copy of a nucleic acid is created using the
maximum codon degeneracy permitted by the genetic code, or when
antisera generated against one or more of SEQ ID NOS:48-94,
174-252, 263-272, and 283-293, which has been subtracted using the
polypeptides encoded by known or existing B7-1 or similar or
related co-stimulatory sequences or the like, including, e.g.,
those encoded by the following: A92749, A92750, AA983817, AB026121,
AB030650, AB030651, AB038153, AF010465, AF065893, AF065894,
AF065895, AF065896, AF079519, AF106824, AF106825, AF106828,
AF106829, AF106830, AF106831, AF106832, AF106833, AF106834,
AF203442, AF203443, AF216747, AF257653, AH004645, AH008762,
AX000904, AX000905, D49843, L12586, L12587, M27533, M83073, M83074,
M83075, M83077, NM005191, S74541, S74540, S74695, S74696, U05593,
U10925, U19833, U19840, U26832, U33063, U33208, U57755, U88622,
X60958, Y08823, and Y09950 (where the numbers correspond to GenBank
accession numbers), or, e.g., other similar B7-1, co-stimulatory
sequences, or the like presented in, e.g., GenBank. Further details
on immunological identification of polypeptides of the invention
are found below. Additionally, for distinguishing between duplexes
with sequences of less than about 100 nucleotides, a TMAC1
hybridization procedure known to those of skill in the art can be
used. See, e.g., Sorg, U. et al. 1 Nucleic Acids Res. (Sep. 11,
1991) 19(17), incorporated herein by reference in its entirety for
all purposes.
[0309] In one aspect, the invention provides a nucleic acid which
comprises a unique subsequence in a nucleic acid selected from any
of SEQ ID NOS:1-47, 95-173, and 253-262. The unique subsequence is
unique as compared to a nucleic acid corresponding to any of, e.g.,
A92749, A92750, AA983817, AB026121, AB030650, AB030651, AB038153,
AF010465, AF065893, AF065894, AF065895, AF065896, AF079519,
AF106824, AF106825, AF106828, AF106829, AF106830, AF106831,
AF106832, AF106833, AF106834, AF203442, AF203443, AF216747,
AF257653, AH004645, AH008762, AX000904, AX000905, D49843, L12586,
L12587, M27533, M83073, M83074, M83075, M83077, NM005191, S74541,
S74540, S74695, S74696, U05593, U10925, U19833, U19840, U26832,
U33063, U33208, U57755, U88622, X60958, Y08823, and Y09950 (where
the numbers correspond to GenBank accession numbers), or, e.g.,
other similar B7-1 or co-stimulatory sequences or the like
presented in GenBank. Such unique subsequences can be determined by
aligning any of SEQ ID NOS:1-47, 95-173, and 253-262 against the
complete set of nucleic acids, e.g., those corresponding to, e.g.,
A92749, A92750, AA983817, AB026121, AB030650, AB030651, AB038153,
AF010465, AF065893, AF065894, AF065895, AF065896, AF079519,
AF106824, AF106825, AF106828, AF106829, AF106830, AF106831,
AF106832, AF106833, AF106834, AF203442, AF203443, AF216747,
AF257653, AH004645, AH008762, AX000904, AX000905, D49843, L12586,
L12587, M27533, M83073, M83074, M83075, M83077, NM005191, S74541,
S74540, S74695, S74696, U05593, U10925, U19833, U19840, U26832,
U33063, U33208, U57755, U88622, X60958, Y08823, and Y09950, or
other sequences available, e.g., in a public database, at the
filing date of the subject application. Alignment can be performed
using the BLAST algorithm set to default parameters. Any unique
subsequence is useful, e.g., as a probe to identify the nucleic
acids of the invention.
[0310] Similarly, the invention includes a polypeptide which
comprises a unique amino acid subsequence in a polypeptide selected
from any of SEQ ID NOS:48-94, 174-252, 263-272, and 283-293. Here,
the unique subsequence is unique as compared to a polypeptide or
amino acid sequence corresponding to, e.g., any of A92749, A92750,
AA983817, AB026121, AB030650, AB030651, AB038153, AF010465,
AF065893, AF065894, AF065895, AF065896, AF079519, AF106824,
AF106825, AF106828, AF106829, AF106830, AF106831, AF106832,
AF106833, AF106834, AF203442, AF203443, AF216747, AF257653,
AH004645, AH008762, AX000904, AX000905, D49843, L12586, L12587,
M27533, M83073, M83074, M83075, M83077, NM005191, S74541, S74540,
S74695, S74696, U05593, U10925, U19833, U19840, U26832, U33063,
U33208, U57755, U88622, X60958, Y08823, and Y09950 (where the
numbers correspond to GenBank accession numbers). Here again, the
polypeptide is aligned against the existing polypeptides (the
control polypeptides). Note that where the sequence corresponds to
a non-translated sequence such as a pseudo-gene, the corresponding
polypeptide is generated simply by in silico translation of the
nucleic acid sequence into an amino acid sequence, where the
reading frame is selected to correspond to the reading frame of
homologous NCSM nucleic acids. Such polypeptides are optionally
made by synthetic or recombinant approaches, or can even be ordered
from companies specializing in polypeptide production.
[0311] In addition, the present invention provides a target nucleic
acid which, but for codon degeneracy, hybridizes under at least
stringent or highly stringent conditions (or conditions of greater
stringency) to a unique coding oligonucleotide which encodes a
unique subsequence in a polypeptide selected from any of SEQ ID
NOS:48-94, 174-252, 263-272, and 283-293, wherein the unique
subsequence is unique as compared to a an amino acid subsequence of
a known B7-1 or related co-stimulatory polypeptide sequence or the
like shown in GenBank or to a polypeptide corresponding to any of
the control polypeptides. Unique sequences are determined as noted
above.
[0312] In one example, the stringent conditions are selected such
that a perfectly complementary oligonucleotide to the coding
oligonucleotide hybridizes to the coding oligonucleotide with at
least about a 5-10.times. higher signal to noise ratio than for
hybridization of the perfectly complementary oligonucleotide to a
control nucleic acid corresponding to any of the control
polypeptides. Conditions can be selected such that higher ratios of
signal to noise are observed in the particular assay that is used,
e.g., about 15.times., 20.times., 30.times., 50.times. or more. In
this example, the target nucleic acid hybridizes to the unique
coding oligonucleotide with at least a 2.times.higher signal to
noise ratio as compared to hybridization of the control nucleic
acid to the coding oligonucleotide. Again, higher signal to noise
ratios can be selected, e.g., about 2.5.times., about 5.times.,
about 10.times., about 20.times., about 30.times., about 50.times.
or more. The particular signal depends on the label used in the
relevant assay, e.g., a fluorescent label, colorimetric label,
radio active label, or the like.
[0313] In another aspect, the invention provides a polypeptide
comprising a unique subsequence in a polypeptide selected from any
of SEQ. ID NOS:48-94, 174-252, 263-272, and 283-293, wherein the
unique subsequence is unique as compared to a polypeptide sequence
corresponding to a known B7-1, co-stimulatory polypeptide or the
like, such as, e.g., a B7-1 or co-stimulatory polypeptide sequence
present in GenBank.
[0314] Percent Sequence Identity--Sequence Similarity
[0315] The degree to which one nucleic acid is similar to another
provides an indication of whether there is an evolutionary
relationship between the two or more nucleic acids. In particular,
where a high level of sequence identity is observed, it is inferred
that the nucleic acids are derived from a common ancestor (i.e.,
that the nucleic acids are homologous). In addition, sequence
similarity implies similar structural and functional properties for
the two or more nucleic acids and the sequences they encode.
Accordingly, in the context of the present invention, sequences
which have a similar sequence to any given exemplar sequence are a
feature of the present invention. In particular, sequences that
have share percent sequence identities as defined below are a
feature of the invention.
[0316] A variety of methods of determining sequence relationships
can be used, including manual alignment and computer assisted
sequence alignment and analysis. This later approach is a preferred
approach in the present invention, due to the increased throughput
afforded by computer-assisted methods. A variety of computer
programs for performing sequence alignment are available, or can be
produced by one of skill.
[0317] As noted above, the sequences of the nucleic acids and
polypeptides (and fragments thereof) employed in the subject
invention need not be identical, but can be substantially identical
(or substantially similar), to the corresponding sequence of a NCSM
polypeptide or nucleic acid molecule (or fragment thereof) or
related molecule. For example, the polypeptides can be subject to
various changes, such as one or more amino acid or nucleic acid
insertions, deletions, and substitutions, either conservative or
non-conservative, including where, e.g., such changes might provide
for certain advantages in their use, e.g., in their therapeutic or
prophylactic use or administration or diagnostic application. The
nucleic acids can also be subject to various changes, such as one
or more substitutions of one or more nucleic acids in one or more
codons such that a particular codon encodes the same or a different
amino acid, resulting in either a conservative or non-conservative
substitution, or one or more deletions of one or more nucleic acids
in the sequence. The nucleic acids can also be modified to include
one or more codons that provide for optimum expression in an
expression system (e.g., mammalian cell or mammalian expression
system), while, if desired, said one or more codons still encode
the same amino acid(s). Such nucleic acid changes might provide for
certain advantages in their therapeutic or prophylactic use or
administration, or diagnostic application. The nucleic acids and
polypeptides can be modified in a number of ways so long as they
comprise a sequence substantially identical (as defined below) to a
sequence in a respective NCSM nucleic acid or polypeptide
molecule.
[0318] Alignment and comparison of relatively short amino acid
sequences (less than about 30 residues) is typically
straightforward. Comparison of longer sequences can require more
sophisticated methods to achieve optimal alignment of two
sequences. Optimal alignment of sequences for aligning a comparison
window can be conducted by the local homology algorithm of Smith
and Waterman (1981) Adv Appl Math 2:482, by the homology alignment
algorithm of Needleman and Wunsch (1970) J Mol Biol 48:443, by the
search for similarity method of Pearson and Lipman (1988) Proc Natl
Acad Sci USA 85:2444, by computerized implementations of these
algorithms (GAP, BESTFIT, FASTA and TFASTA in the Wisconsin
Genetics Software Package Release 7.0, Genetics Computer Group, 575
Science Dr., Madison, Wis.; and BLAST, see, e.g., Altschul et al.
(1977) Nuc Acids Res 25:3389-3402 and Altschul et al. (1990) J Mol
Biol 215:403-410), or by inspection, with the best alignment (i.e.,
resulting in the highest percentage of sequence similarity or
sequence identity over the comparison window) generated by the
various methods being selected.
[0319] The term "identical" or percent "identity," in the context
of two or more nucleic acid or polypeptide sequences, refers to two
or more sequences or subsequences that are the same or have a
specified percentage of amino acid residues or nucleotides that are
the same, when compared and aligned for maximum correspondence, as
measured using one of the following sequence comparison algorithms
or by visual inspection.
[0320] The term "sequence identity" or "percent identity" ("%
identity") means that two polynucleotide or polypeptide sequences
are identical (i.e., on a nucleotide-by-nucleotide basis or amino
acid-by-amino acid basis, respectively) over a window of
comparison. The term "percentage of sequence identity" (or "percent
sequence identity" or simply "percent identity" or "% identity") or
"percentage of sequence similarity" (or "percent sequence
similarity" or simply "percent similarity") is calculated by
comparing two optimally aligned polynucleotide or polypeptide
sequences over the window of comparison, determining the number of
positions at which the identical residues occur in both sequences
to yield the number of matched positions, dividing the number of
matched positions by the total number of positions in the window of
comparison (i.e., the window size), and multiplying the result by
100 to yield the percentage of sequence identity (or percentage of
sequence similarity). Thus, for example, with regard to polypeptide
sequences, the term sequence identity means that two polypeptide
sequences are identical (on an amino acid-by-amino acid basis) over
a window of comparison, and a percentage of amino acid residue
sequence identity (or percentage of amino acid residue sequence
similarity), can be calculated. For sequence comparison, typically
one sequence acts as a reference sequence to which test sequences
are compared. When using a sequence comparison algorithm, test and
reference sequences are input into a computer, subsequence
coordinates are designated, if necessary, and sequence algorithm
program parameters are designated. The sequence comparison
algorithm then calculates the percent sequence identity for the
test sequence(s) relative to the reference sequence, based on the
designated program parameters. Maximum correspondence can be
determined by using one of the sequence algorithms described herein
(or other algorithms available to those of ordinary skill in the
art) or by visual inspection.
[0321] The phrase "substantially identical" or "substantial
identity" in the context of two nucleic acids or polypeptides,
refers to two or more sequences or subsequences that have at least
about 50%, 60%, 70%, 75%, preferably 80% or 85%, more preferably
90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5%, or more
nucleotide or amino acid residue % identity, respectively, when
compared and aligned for maximum correspondence, as measured using
one of the following sequence comparison algorithms or by visual
inspection. In certain embodiments, the substantial identity exists
over a region of amino acid sequences that is at least about 50
residues in length, preferably over a region of at least about 100
residues in length, and more preferably the sequences are
substantially identical over at least about 150, 200, or 250 amino
acid residues. In certain aspects, substantial identity exists over
a region of nucleic acid sequences of at least about 500 residues,
preferably over a region of at least about 600 residues in length,
and more preferably the sequences are substantially identical over
at least about 700, 800, or 850 nucleic acid residues. In some
aspects, the amino acid or nucleic acid sequences are substantially
identical over the entire length of the corresponding coding
region.
[0322] As applied to polypeptides and peptides, the term
"substantial identity" typically means that two polypeptide or
peptide sequences, when optimally aligned, such as by the programs
GAP or BESTFIT using default gap weights (described in detail
below) or by visual inspection, share at least about 60% or 70%,
often at least 75%, preferably at least about 80% or 85%, more
preferably at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
98%, 99%, or 99.5% or more percent amino acid residue sequence
identity or sequence similarity. Similarly, as applied in the
context of two nucleic acids, the term substantial identity or
substantial similarity means that the two nucleic acid sequences,
when optimally aligned, such as by the programs BLAST, GAP or
BESTFIT using default gap weights (described in detail below) or by
visual inspection, share at least about 60 percent, 70 percent, or
80 percent sequence identity or sequence similarity, preferably at
least about 90 percent amino acid residue sequence identity or
sequence similarity, more preferably at least about 95 percent
sequence identity or sequence similarity, or more (including, e.g.,
about 90, 91, 92, 93, 94, 95, 96, 97, 98, 98.5, 99, 99.5, or more
percent nucleotide sequence identity or sequence similarity).
[0323] In one aspect, the present invention provides nucleic acids
encoding NCSM amino acid molecules (e.g., full-length polypeptide,
signal peptide, ECD, cytoplasmic domain, transmembrane domain,
mature region, or other fragment) having at least about 60%, 70%,
75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 98.5%,
99%, 99.5% or more percent sequence identity or sequence similarity
with the nucleic acid of any of SEQ ID NOS:1-47, 95-173, and
253-262 or a fragment thereof, including, e.g., one or more of a
signal peptide, ECD, cytoplasmic domain, transmembrane domain, or
mature region or any combination thereof. Some such encoded
polypeptides have the CD28BP or CTLA-4BP properties described
herein.
[0324] In another aspect, the present invention provides NCSM
polypeptides (e.g., full-length NCSM polypeptide, signal peptide,
ECD, cytoplasmic domain, transmembrane domain, mature region, or
other fragment), and fusion proteins comprising said polypeptides,
having at least about 50%, 60%, 70%, 75%, 80%, 85%, 90%, 91%, 92%,
93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more percent sequence
identity or sequence similarity with the polypeptide of any of SEQ
ID NOS:48-94, 174-252, 263-272, and 283-293 or a fragment thereof,
including, e.g., one or more of a signal peptide, ECD, cytoplasmic
domain, transmembrane domain, or mature region or any combination
thereof. Such fragments of SEQ ID NOS:69-92, 222-272, and 286-288
may have at least one CTLA4BP property described herein, such as,
e.g., an ability to inhibit T cell proliferation or activation in
conjunction with stimulation of T cell receptor (e.g., by antigen
or anti-CD3 Ab) and/or a CTLA-4/CD28 binding affinity ratio about
equal to or greater than that of hB7-1. Such fragments of SEQ ID
NOS:48-68, 174-221, 283-285, and 289-293 may have at least one
CD28BP property described herein, such as, e.g., an ability to
induce T cell proliferation or activation in conjunction with
stimulation of T cell receptor (e.g., by antigen or anti-CD3 Ab)
and/or a CD28/CTLA-4 binding affinity ratio about equal to or
greater than that of hB7-1. Such fragments of SEQ ID NOS:93-94 may
have an ability to induce T cell proliferation or activation in
conjunction with stimulation of T cell receptor (by, e.g., an
antigen) and/or a CD28/CTLA-4 binding affinity ratio approximately
equal to that of a primate, such as hB7-1.
[0325] In yet another aspect, the present invention provides NCSM
homologue polypeptides that are substantially identical or
substantially similar over at least about 150, 180, 170, 190, 200,
210, 225, 230, 240, 250, 275, or 285 or more contiguous amino acids
of at least one of SEQ ID NOS:69-92, 222-272, and 286-288; some
such polypeptides may have an ability to inhibit T cell
proliferation or activation and/or a CTLA-4/CD28 binding affinity
ratio about equal to or greater than that of hB7-1 as described
herein.
[0326] In yet another aspect, the present invention provides NCSM
homologue polypeptides that are substantially identical or
substantially similar over at least about 150, 180, 170, 190, 200,
210, 225, 230, 240, 250, 275, or 285 or more contiguous amino acids
of at least one of SEQ ID NOS:48-68, 174-221, 283-285, and 289-293;
some such polypeptides may have an ability to induce T cell
proliferation or activation in conjunction with stimulation of T
cell receptor (e.g., by antigen or anti-CD3 Ab) and/or a
CD28/CTLA-4 binding affinity ratio about equal to or greater than
that of hB7-1.
[0327] NCSM homologue polypeptides that are substantially identical
or substantially similar over at least about 150, 180, 170, 190,
200, 210, 225, 230, 240, 250, 275, or 285 or more contiguous amino
acids of at least one of SEQ ID NOS:93-94; some such polypeptides
may have an ability to induce T cell proliferation or activation in
conjunction with stimulation of T cell receptor (by, e.g., anti-CD3
Ab or antigen) and/or a CD28/CTLA-4 binding affinity ratio about
equal to that of a primate, such as hB7-1.
[0328] A feature of the invention is a NCSM polypeptide comprising
at least 175 contiguous amino acids of any one of SEQ ID NOS:48-94,
174-252, 263-272, and 283-293. In other embodiments, the
polypeptide comprises about 175, 200, 210, 225, 275, or more
contiguous amino acid residues of any one of SEQ ID NOS:48-94,
174-252, 263-272, and 283-293. In other embodiments, the
polypeptide is at least about 280 amino acids, and still more
preferably at least about 285 amino acids in length.
[0329] Alternatively, parameters are set such that one or more
sequences of the invention are identified by alignment to a query
sequence selected from among SEQ ID NOS:49-94, 174-252, 263-272 and
283-293, while sequences corresponding to unrelated polypeptides,
e.g., those encoded by known nucleic acid sequences represented by
GenBank accession numbers (e.g., known B7-1 sequences) are not
identified.
[0330] Preferably, residue positions that are not identical differ
by conservative amino acid substitutions. Conservative amino acid
substitution refers to the interchange-ability of residues having
similar side chains. For example, a group of amino acids having
aliphatic side chains is glycine, alanine, valine, leucine, and
isoleucine; a group of amino acids having aliphatic-hydroxyl side
chains is serine and threonine; a group of amino acids having
amide-containing side chains is asparagine and glutamine; a group
of amino acids having aromatic side chains is phenylalanine,
tyrosine, and tryptophan; a group of amino acids having basic side
chains is lysine, arginine, and histidine; and a group of amino
acids having sulfur-containing side chains is cysteine and
methionine. Preferred conservative amino acids substitution groups
are: valine-leucine-isoleucine, phenylalanine-tyrosine,
arginine-lysine-histidine, lysine-arginine, alanine-valine, and
asparagine-glutamine.
[0331] Alignment and comparison of relatively short amino acid
sequences (less than about 30 residues) is typically
straightforward. Comparison of longer sequences can require more
sophisticated methods to achieve optimal alignment of two
sequences.
[0332] Optimal alignment of sequences for aligning a comparison
window can be conducted by the local homology algorithm of Smith
and Waterman (1981) Adv Appl Math 2:482, by the homology alignment
algorithm of Needleman and Wunsch (1970) J Mol Biol 48:443, by the
search for similarity method of Pearson and Lipman (1988) Proc Natl
Acad Sci USA 85:2444, by computerized implementations of these
algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin
Genetics Software Package Release 7.0, Genetics Computer Group, 575
Science Dr., Madison, Wis.), or by inspection, with the best
alignment (i.e., resulting in the highest percentage of sequence
similarity over the comparison window) generated by the various
methods being selected.
[0333] A preferred example of an algorithm that is suitable for
determining percent sequence identity (percent identity) and
sequence similarity is the FASTA algorithm, which is described in
Pearson, W.R. & Lipman, D. J. (1988) Proc Natl Acad Sci USA
85:2444. See also, W. R. Pearson (1996) Methods Enzymology
266:227-258. Preferred parameters used in a FASTA alignment of DNA
sequences to calculate percent identity are optimized, BL50 Matrix
15: -5, k-tuple=2; joining penalty=40, optimization=28; gap penalty
-12, gap length penalty=-2; and width=16.
[0334] Other preferred examples of algorithm that are suitable for
determining percent sequence identity and sequence similarity are
the BLAST and BLAST 2.0 algorithms, which are described in Altschul
et al. (1997) Nuc Acids Res 25:3389-3402 and Altschul et al. (1990)
J Mol Biol 215:403-410, respectively. BLAST and BLAST 2.0 are used,
with the parameters described herein, to determine percent sequence
identity for the nucleic acids and proteins of the invention.
Software for performing BLAST analyses is publicly available
through the National Center for Biotechnology Information (http:
//www.ncbi.nlm.nih.gov/). This algorithm involves first identifying
high scoring sequence pairs (HSPs) by identifying short words of
length W in the query sequence, which either match or satisfy some
positive-valued threshold score T when aligned with a word of the
same length in a database sequence. T is referred to as the
neighborhood word score threshold (Altschul et al., supra). These
initial neighborhood word hits act as seeds for initiating searches
to find longer HSPs containing them. The word hits are extended in
both directions along each sequence for as far as the cumulative
alignment score can be increased. Cumulative scores are calculated
using, for nucleotide sequences, the parameters M (reward score for
a pair of matching residues; always >0) and N (penalty score for
mismatching residues; always <0). For amino acid sequences, a
scoring matrix is used to calculate the cumulative score. Extension
of the word hits in each direction are halted when: the cumulative
alignment score falls off by the quantity X from its maximum
achieved value; the cumulative score goes to zero or below, due to
the accumulation of one or more negative-scoring residue
alignments; or the end of either sequence is reached. The BLAST
algorithm parameters W, T, and X determine the sensitivity, and
speed of the alignment. The BLASTN program (for nucleotide
sequences) uses as defaults a wordlength (W) of 11, an expectation
(E) of 10, M=5, N=-4 and a comparison of both strands. For amino
acid sequences, the BLASTP program (e.g., BLASTP 2.0.14;
Jun-29-2000) uses as defaults a wordlength of 3, and expectation
(E) of 10, and the BLOSUM62 scoring matrix (see, Henikoff &
Henikoff (1989) Proc Natl Acad Sci USA 89:10915) uses alignments
(B) of 50, expectation (E) of 10, M=5, N=-4, and a comparison of
both strands. Again, as with other suitable algorithms, the
stringency of comparison can be increased until the program
identifies only sequences that are more closely related to those in
the sequence listings herein (i.e., SEQ ID NOS:1-47, 95-173, and
253-262 or, alternatively, SEQ ID NOS:48-94, 174-252, 263-272, and
283-293, rather than sequences that are more closely related to
other similar sequences such as, e.g., those nucleic acid sequences
represented by GenBank accession numbers set forth herein, and or
other similar molecules found in, e.g., GenBank. In other words,
the stringency of comparison of the algorithms can be increased so
that all known prior art (e.g., those represented by GenBank
accession numbers shown herein, or other similar molecules found
in, e.g., GenBank) is excluded.
[0335] The BLAST algorithm also performs a statistical analysis of
the similarity or identity between two sequences (see, e.g., Karlin
& Altschul (1993) Proc Natl Acad Sci USA 90:5873-5787). One
measure of similarity provided by this algorithm is the smallest
sum probability (P(N)), which provides an indication of the
probability by which a match between two nucleotide or amino acid
sequences would occur by chance. For example, a nucleic acid is
considered similar to a reference sequence if the smallest sum
probability in a comparison of the test nucleic acid to the
reference nucleic acid is less than about 0.2, more preferably less
than about 0.01, and most preferably less than about 0.001.
[0336] Another example of a useful algorithm is PILEUP. PILEUP
creates a multiple sequence alignment from a group of related
sequences using progressive, pairwise alignments to show
relationship and percent sequence identity or percent sequence
similarity. It also plots a tree or dendogram showing the
clustering relationships used to create the alignment. PILEUP uses
a simplification of the progressive alignment method of Feng &
Doolittle (1987) J Mol Evol 35:351-360. The method used is similar
to the method described by Higgins & Sharp (1989) CABIOS
5:151-153. The program can align up to 300 sequences, each of a
maximum length of 5,000 nucleotides or amino acids. The multiple
alignment procedure begins with the pairwise alignment of the two
most similar sequences, producing a cluster of two aligned
sequences. This cluster is then aligned to the next most related
sequence or cluster of aligned sequences. Two clusters of sequences
are aligned by a simple extension of the pairwise alignment of two
individual sequences. The final alignment is achieved by a series
of progressive, pairwise alignments. The program is run by
designating specific sequences and their amino acid or nucleotide
coordinates for regions of sequence comparison and by designating
the program parameters. Using PILEUP, a reference sequence is
compared to other test sequences to determine the percent sequence
identity (or percent sequence similarity) relationship using the
following parameters: default gap weight (3.00), default gap length
weight (0.10), and weighted end gaps. PILEUP can be obtained from
the GCG sequence analysis software package, e.g., version 7.0
(Devereaux et al. (1984) Nuc Acids Res 12:387-395).
[0337] Another preferred example of an algorithm that is suitable
for multiple DNA and amino acid sequence alignments is the CLUSTALW
program (Thompson, J. D. et al. (1994) Nuc Acids Res 22:4673-4680).
CLUSTALW performs multiple pairwise comparisons between groups of
sequences and assembles them into a multiple alignment based on
homology. Gap open and Gap extension penalties were 10 and 0.05
respectively. For amino acid alignments, the BLOSUM algorithm can
be used as a protein weight matrix (Henikoff and Henikoff (1992)
Proc Natl Acad Sci USA 89:10915-10919). Another example of an
algorithm suitable for multiple DNA and amino acid sequence
alignments is the Jotun Hein method, Hein (1990), from within the
MegaLine.TM. DNASTAR package (MegaLine.TM. Version 4.03,
manufactured by DNASTAR, Inc.) used according to the manufacturer's
instructions and default values specified in the program.
[0338] It will be understood by one of ordinary skill in the art,
that the above discussion of search and alignment algorithms also
applies to identification and evaluation of polynucleotide
sequences, with the substitution of query sequences comprising
nucleotide sequences, and where appropriate, selection of nucleic
acid databases.
Substrates and Formats for Sequence Recombination
[0339] The polynucleotides of the invention and fragments thereof
are optionally used as substrates for any of a variety of
recombination and recursive sequence recombination reactions, in
addition to their use in standard cloning methods as set forth in,
e.g., Ausubel, Berger and Sambrook, e.g., to produce additional
NCSM polynucleotides or fragments thereof that encode polypeptides
and fragments thereof having with desired properties. A variety of
such reactions are known, including those developed by the
inventors and their co-workers.
[0340] DNA recombination is a method for generating and identifying
new NCSM molecules, e.g., including those with altered relative
binding capacities to either or both of the CD28 and CTLA-4
receptors (as compared to, e.g., hB7-1) and altered functional
activities, including, e.g., altered capacities to induce or
inhibit T cell activation and/or differentiation, induce or inhibit
cytokine production, and/or promote or inhibit anergy and/or
tolerance as described herein.
[0341] A variety of diversity generating protocols for generating
and identifying NCSM molecules having one of more of the properties
described herein are available and described in the art. The
procedures can be used separately, and/or in combination to produce
one or more NCSM variants of a nucleic acid or set of nucleic
acids, as well variants of encoded proteins. Individually and
collectively, these procedures provide robust, widely applicable
ways of generating diversified nucleic acids and sets of nucleic
acids (including, e.g., nucleic acid libraries) useful, e.g., for
the engineering or rapid evolution of nucleic acids, proteins,
pathways, cells and/or organisms with new and/or improved
characteristics. While distinctions and classifications are made in
the course of the ensuing discussion for clarity, it will be
appreciated that the techniques are often not mutually exclusive.
Indeed, the various methods can be used singly or in combination,
in parallel or in series, to access diverse sequence variants.
[0342] The result of any of the diversity generating procedures
described herein can be the generation of one or more nucleic
acids, which can be selected or screened for nucleic acids with or
which confer desirable properties, or that encode proteins with or
which confer desirable properties. Following diversification by one
or more of the methods herein, or otherwise available to one of
skill, any nucleic acids that are generated or produced can be
selected for a desired activity or property, e.g. ability to induce
or inhibit T cell proliferation or activation, cytokine production,
alter binding affinity to one or more of CD28 or CTLA-4 receptors.
This can include identifying any activity that can be detected, for
example, in an automated or automatable format, by any of the
assays in the art and/or the assays of the invention discussed here
and/or in the Example section below. A variety of related (or even
unrelated) properties can be evaluated, in serial or in parallel,
at the discretion of the practitioner.
[0343] Descriptions of a variety of diversity generating procedures
for generating modified nucleic acid sequences that encode NCSM
polypeptides as described herein are found in the following
publications and the references cited therein: Soong, N. et al.
(2000) "Molecular breeding of viruses" Nat Genet. 25(4):436-439;
Stemmer, et al. (1999) "Molecular breeding of viruses for targeting
and other clinical properties" Tumor Targeting 4:1-4; Ness et al.
(1999) "DNA Shuffling of subgenomic sequences of subtilisin" Nature
Biotechnology 17:893-896; Chang et al. (1999) "Evolution of a
cytokine using DNA family shuffling" Nature Biotechnology
17:793-797; Minshull and Stemmer (1999) "Protein evolution by
molecular breeding" Current Opinion in Chemical Biology 3:284-290;
Christians et al. (1999) "Directed evolution of thymidine kinase
for AZT phosphorylation using DNA family shuffling" Nature
Biotechnology 17:259-264; Crameri et al. (1998) "DNA shuffling of a
family of genes from diverse species accelerates directed
evolution" Nature 391:288-291; Crameri et al. (1997) "Molecular
evolution of an arsenate detoxification pathway by DNA shuffling,"
Nature Biotechnology 15:436-438; Zhang et al. (1997) "Directed
evolution of an effective fucosidase from a galactosidase by DNA
shuffling and screening" Proc. Natl. Acad. Sci. USA 94:4504-4509;
Patten et al. (1997) "Applications of DNA Shuffling to
Pharmaceuticals and Vaccines" Current Opinion in Biotechnology
8:724-733; Crameri et al. (1996) "Construction and evolution of
antibody-phage libraries by DNA shuffling" Nature Medicine
2:100-103; Crameri et al. (1996) "Improved green fluorescent
protein by molecular evolution using DNA shuffling" Nature
Biotechnology 14:315-319; Gates et al. (1996) "Affinity selective
isolation of ligands from peptide libraries through display on a
lac repressor `headpiece dimer`" Journal of Molecular Biology
255:373-386; Stemmer (1996) "Sexual PCR and Assembly PCR" In: The
Encyclopedia of Molecular Biology. VCH Publishers, New York. pp.
447-457; Crameri and Stemmer (1995) "Combinatorial multiple
cassette mutagenesis creates all the permutations of mutant and
wildtype cassettes" BioTechniques 18:194-195; Stemmer et al.,
(1995) "Single-step assembly of a gene and entire plasmid form
large numbers of oligodeoxy-ribonucleotides" Gene, 164:49-53;
Stemmer (1995) "The Evolution of Molecular Computation" Science
270: 1510; Stemmer (1995) "Searching Sequence Space" Bio/Technology
13:549-553; Stemmer (1994) "Rapid evolution of a protein in vitro
by DNA shuffling" Nature 370:389-391; and Stemmer (1994) "DNA
shuffling by random fragmentation and reassembly: In vitro
recombination for molecular evolution." Proc. Natl. Acad. Sci. USA
91:10747-10751.
[0344] The term "shuffling" is used herein to indicate
recombination between non-identical sequences, in some embodiments
shuffling may include crossover via homologous recombination or via
non-homologous recombination, such as via cre/lox and/or flp/frt
systems. Shuffling can be carried out by employing a variety of
different formats, including for example, in vitro and in vivo
shuffling formats, in silico shuffling formats, shuffling formats
that utilize either double-stranded or single-stranded templates,
primer based shuffling formats, nucleic acid fragmentation-based
shuffling formats, and oligonucleotide-mediated shuffling formats,
all of which are based on recombination events between
non-identical sequences and are described in more detail or
referenced herein below, as well as other similar
recombination-based formats.
[0345] Mutational methods of generating diversity include, for
example, site-directed mutagenesis (Ling et al. (1997) "Approaches
to DNA mutagenesis: an overview" Anal Biochem. 254(2): 157-178;
Dale et al. (1996) "Oligonucleotide-directed random mutagenesis
using the phosphorothioate method" Methods Mol. Biol. 57:369-374;
Smith (1985) "In vitro mutagenesis" Ann. Rev. Genet. 19:423-462;
Botstein & Shortie (1985) "Strategies and applications of in
vitro mutagenesis" Science 229:1193-1201; Carter (1986)
"Site-directed mutagenesis" Biochem. J. 237:1-7; and Kunkel (1987)
"The efficiency of oligonucleotide directed mutagenesis" in Nucleic
Acids & Molecular Biology (Eckstein, F. and Lilley, D. M. J.
eds., Springer Verlag, Berlin)); mutagenesis using uracil
containing templates (Kunkel (1985) "Rapid and efficient
site-specific mutagenesis without phenotypic selection" Proc. Natl.
Acad. Sci. USA 82:488-492; Kunkel et al. (1987) "Rapid and
efficient site-specific mutagenesis without phenotypic selection"
Methods in Enzymol. 154, 367-382; and Bass et al. (1988) "Mutant
Tip repressors with new DNA-binding specificities" Science
242:240-245); oligonucleotide-directed mutagenesis (Methods in
Enzymol. 100: 468-500 (1983); Methods in Enzymol. 154: 329-350
(1987); Zoller & Smith (1982) "Oligonucleotide-directed
mutagenesis using M13-derived vectors: an efficient and general
procedure for the production of point mutations in any DNA
fragment" Nucleic Acids Res. 10:6487-6500; Zoller & Smith
(1983) "Oligonucleotide-directed mutagenesis of DNA fragments
cloned into M13 vectors" Methods in Enzymol. 100:468-500; and
Zoller & Smith (1987) "Oligonucleotide-directed mutagenesis: a
simple method using two oligonucleotide primers and a
single-stranded DNA template" Methods in Enzymol. 154:329-350);
phosphorothioate-modified DNA mutagenesis (Taylor et al. (1985)
"The use of phosphorothioate-modified DNA in restriction enzyme
reactions to prepare nicked DNA" Nucl. Acids Res. 13: 8749-8764;
Taylor et al. (1985) "The rapid generation of
oligonucleotide-directed mutations at high frequency using
phosphorothioate-modified DNA" Nucl. Acids Res. 13: 8765-8787
(1985); Nakamaye & Eckstein (1986) "Inhibition of restriction
endonuclease Nci I cleavage by phosphorothioate groups and its
application to oligonucleotide-directed mutagenesis" Nucl. Acids
Res. 14: 9679-9698; Sayers et al. (1988) "Y-T Exonucleases in
phosphorothioate-based oligonucleotide-directed mutagenesis" Nucl.
Acids Res. 16:791-802; and Sayers et al. (1988) "Strand specific
cleavage of phosphorothioate-containing DNA by reaction with
restriction endonucleases in the presence of ethidium bromide"
Nucl. Acids Res. 16: 803-814); mutagenesis using gapped duplex DNA
(Kramer et al. (1984) "The gapped duplex DNA approach to
oligonucleotide-directed mutation construction" Nucl. Acids Res.
12: 9441-9456; Kramer & Fritz (1987) Methods in Enzymol.
"Oligonucleotide-directed construction of mutations via gapped
duplex DNA" 154:350-367; Kramer et al. (1988) "Improved enzymatic
in vitro reactions in the gapped duplex DNA approach to
oligonucleotide-directed construction of mutations" Nucl. Acids
Res. 16: 7207; and Fritz et al. (1988) "Oligonucleotide-directed
construction of mutations: a gapped duplex DNA procedure without
enzymatic reactions in vitro" Nucl. Acids Res. 16: 6987-6999).
[0346] Additional suitable methods include point mismatch repair
(Kramer et al. (1984) "Point. Mismatch Repair" Cell 38:879-887),
mutagenesis using repair-deficient host strains (Carter et al.
(1985) "Improved oligonucleotide site-directed mutagenesis using
M13 vectors" Nucl. Acids Res. 13: 4431-4443; and Carter (1987)
"Improved oligonucleotide-directed mutagenesis using M13 vectors"
Methods in Enzymol. 154: 382-403), deletion mutagenesis
(Eghtedarzadeh & Henikoff (1986) "Use of oligonucleotides to
generate large deletions" Nucl. Acids Res. 14: 5115),
restriction-selection and restriction-purification (Wells et al.
(1986) "Importance of hydrogen-bond formation in stabilizing the
transition state of subtilisin" Phil. Trans. R. Soc. Lond. A 317:
415-423), mutagenesis by total gene synthesis (Nambiar et al.
(1984) "Total synthesis and cloning of a gene coding for the
ribonuclease S protein" Science 223: 1299-1301; Sakamar and Khorana
(1988) "Total synthesis and expression of a gene for the a-subunit
of bovine rod outer segment guanine nucleotide-binding protein
(transducin)" Nucl. Acids Res. 14: 6361-6372; Wells et al. (1985)
"Cassette mutagenesis: an efficient method for generation of
multiple mutations at defined sites" Gene 34:315-323; and
Grundstrom et al. (1985) "Oligonucleotide-directed mutagenesis by
microscale `shot-gun` gene synthesis" Nucl. Acids Res. 13:
3305-3316), double-strand break repair (Mandecki (1986)
"Oligonucleotide-directed double-strand break repair in plasmids of
Escherichia coli: a method for site-specific mutagenesis" Proc.
Natl. Acad. Sci. USA, 83:7177-7181; and Arnold (1993) "Protein
engineering for unusual environments" Current Opinion in
Biotechnology 4:450-455). Additional details on many of the above
methods can be found in Methods in Enzymology Volume 154, which
also describes useful controls for trouble-shooting problems with
various mutagenesis methods.
[0347] Additional details regarding various diversity generating
methods can be found in the following U.S. patents, PCT
publications and applications, and EPO publications: U.S. Pat. No.
5,605,793 to Stemmer (Feb. 25, 1997), "Methods for In Vitro
Recombination;" U.S. Pat. No. 5,811,238 to Stemmer et al. (Sep. 22,
1998) "Methods for Generating Polynucleotides having Desired
Characteristics by Iterative Selection and Recombination;" U.S.
Pat. No. 5,830,721 to Stemmer et al. (Nov. 3, 1998), "DNA
Mutagenesis by Random Fragmentation and Reassembly;" U.S. Pat. No.
5,834,252 to Stemmer, et al. (Nov. 10, 1998) "End-Complementary
Polymerase Reaction;" U.S. Pat. No. 5,837,458 to Minshull, et al.
(Nov. 17, 1998), "Methods and Compositions for Cellular and
Metabolic Engineering;" WO 95/22625, Stemmer and Crameri,
"Mutagenesis by Random Fragmentation and Reassembly;" WO 96/33207
by Stemmer and Lipschutz "End Complementary Polymerase Chain
Reaction;" WO 97/20078 by Stemmer and Crameri "Methods for
Generating Polynucleotides having Desired Characteristics by
Iterative Selection and Recombination;" WO 97/35966 by Minshull and
Stemmer, "Methods and Compositions for Cellular and Metabolic
Engineering;" WO 99/41402 by Punnonen et al. "Targeting of Genetic
Vaccine Vectors;" WO 99/41383 by Punnonen et al. "Antigen Library
Immunization;" WO 99/41369 by Punnonen et al. "Genetic Vaccine
Vector Engineering;" WO 99/41368 by Punnonen et al. "Optimization
of Immunomodulatory Properties of Genetic Vaccines;" EP 752008 by
Stemmer and Crameri, "DNA Mutagenesis by Random Fragmentation and
Reassembly;" EP 0932670 by Stemmer "Evolving Cellular DNA Uptake by
Recursive Sequence Recombination;" WO 99/23107 by Stemmer et al.,
"Modification of Virus Tropism and Host Range by Viral Genome
Shuffling;" WO 99/21979 by Apt et al., "Human Papillomavirus
Vectors;" WO 98/31837 by del Cardayre et al. "Evolution of Whole
Cells and Organisms by Recursive Sequence Recombination;" WO
98/27230 by Patten and Stemmer, "Methods and Compositions for
Polypeptide Engineering;" WO 98/27230 by Stemmer et al., "Methods
for Optimization of Gene Therapy by Recursive Sequence Shuffling
and Selection," WO 00/00632, "Methods for Generating Highly Diverse
Libraries," WO 00/09679, "Methods for Obtaining in Vitro Recombined
Polynucleotide Sequence Banks and Resulting Sequences," WO 98/42832
by Arnold et al., "Recombination of Polynucleotide Sequences Using
Random or Defined Primers," WO 99/29902 by Arnold et al., "Method
for Creating Polynucleotide and Polypeptide Sequences," WO 98/41653
by Vind, "An in Vitro Method for Construction of a DNA Library," WO
98/41622 by Borchert et al., "Method for Constructing a Library
Using DNA Shuffling," and WO 98/42727 by Pati and Zarling,
"Sequence Alterations using Homologous Recombination;" WO 00/18906
by Patten et al., "Shuffling of Codon-Altered Genes;" WO 00/04190
by del Cardayre et al. "Evolution of Whole Cells and Organisms by
Recursive Recombination;" WO 00/42561 by Crameri et al.,
"Oligonucleotide Mediated Nucleic Acid Recombination;" WO 00/42559
by Selifonov and Stemmer "Methods of Populating Data Structures for
Use in Evolutionary Simulations;" WO 00/42560 by Selifonov et al.,
"Methods for Making Character Strings, Polynucleotides &
Polypeptides Having Desired Characteristics;" PCT/US00/26708 by
Welch et al., "Use of Codon-Varied Oligonucleotide Synthesis for
Synthetic Shuffling;" and PCT/US01/06775 "Single-Stranded Nucleic
Acid Template-Mediated Recombination and Nucleic Acid'Fragment
Isolation" by Affholter.
[0348] Several different general classes of sequence modification
methods, such as mutation, recombination, etc. are applicable to
the present invention and set forth, e.g., in the references above
and below. That is, nucleic acids encoding CD28BP or CTLA-4BP
polypeptides can be diversified by any of the methods described
herein, e.g., including various mutation and recombination methods,
individually or in combination, to generate nucleic acids with a
desired activity or property, including, e.g., those described
herein, such as an ability to enhance an immune response, such as
by inducing T cell activation or proliferation, an ability to
down-regulate or inhibit an immune response, such as by inhibiting
T cell activation or proliferation, an ability to preferentially
bind and/or signal through either or both CD28 and CTLA-4
receptors.
[0349] The following exemplify some of the different types of
preferred formats for diversity generation in the context of the
present invention, including, e.g., certain recombination based
diversity generation formats.
[0350] Nucleic acids can be recombined in vitro by any of a variety
of techniques discussed in the references above, including e.g.,
DNAse digestion of nucleic acids to be recombined followed by
ligation and/or PCR reassembly of the nucleic acids. For example,
sexual PCR mutagenesis can be used in which random (or pseudo
random, or even non-random) fragmentation of the DNA molecule is
followed by recombination, based on sequence similarity, between
DNA molecules with different but related DNA sequences, in vitro,
followed by fixation of the crossover by extension in a polymerase
chain reaction. This process and many process variants is described
in several of the references above, e.g., in Stemmer (1994) Proc.
Natl. Acad. Sci. USA 91:10747-10751. Thus, nucleic acids encoding
B7-1 polypeptides and subsequences thereof can be recombined in
vitro to generate nucleic acids encoding modified or recombinant
B7-1 polypeptides, NCSM polypeptides, CD28BP polypeptides, CTLA-4BP
polypeptides, or subsequences thereof, each of which has one or
more desired properties, including those described herein.
[0351] Similarly, nucleic acids can be recursively recombined in
vivo, e.g., by allowing recombination to occur between nucleic
acids in cells. Many such in vivo recombination formats are set
forth in the references noted above. Such formats optionally
provide direct recombination between nucleic acids of interest, or
provide recombination between vectors, viruses, plasmids, etc.,
comprising the nucleic acids of interest, as well as other formats.
Details regarding such procedures are found in the references noted
above. Thus, nucleic acids encoding B7-1 polypeptides and
subsequences thereof can be recombined in vivo prior to, or in
concert with screening and/or selection procedures to identify
modified or recombinant B7-1 polypeptides, NCSM polypeptides,
CD28BP polypeptides, CTLA-4BP polypeptides, or subsequences
thereof, each of which has one or more desired properties,
including those described herein. Whole genome recombination
methods can also be used in which whole genomes of cells or other
organisms are recombined, optionally including spiking of the
genomic recombination mixtures with desired library components
(e.g., genes corresponding to the pathways of the present
invention). These methods have many applications, including those
in which the identity of a target gene is not known. Details on
such methods are found, e.g., in WO 98/31837 by del Cardayre et al.
"Evolution of Whole Cells and Organisms by Recursive Sequence
Recombination;" and in, e.g., PCT/US99/15972 by del Cardayre et
al., also entitled "Evolution of Whole Cells and Organisms by
Recursive Sequence Recombination."
[0352] Synthetic recombination methods can also be used, in which
oligonucleotides corresponding to targets of interest (e.g., B7
polypeptides) are synthesized and reassembled in PCR or ligation
reactions which include oligonucleotides which correspond to more
than one parental nucleic acid, thereby generating new recombined
nucleic acids. Oligonucleotides can be made by standard nucleotide
addition methods, or can be made, e.g., by tri-nucleotide synthetic
approaches. Details regarding such approaches are found in the
references noted above, including, e.g., WO 00/42561 by Crameri et
al., "Oligonucleotide Mediated Nucleic Acid Recombination;"
PCT/US00/26708 by Welch et al., "Use of Codon-Varied
Oligonucleotide Synthesis for Synthetic Shuffling;" WO 00/42560 by
Selifonov et al., "Methods for Making Character. Strings,
Polynucleotides and Polypeptides Having Desired Characteristics;"
and WO 00/42559 by Selifonov and Stemmer "Methods of Populating
Data Structures for Use in Evolutionary Simulations."
[0353] In silico methods of recombination can be effected in which
genetic algorithms are used in a computer to recombine sequence
strings which correspond to homologous (or even non-homologous)
nucleic acids. The resulting recombined sequence strings are
optionally converted into nucleic acids by synthesis of nucleic
acids which correspond to the recombined sequences, e.g., in
concert with oligonucleotide synthesis/gene reassembly techniques.
This approach can generate random, partially random or designed
variants. Many details regarding in silico recombination, including
the use of genetic algorithms, genetic operators and the like in
computer systems, combined with generation of corresponding nucleic
acids (and/or proteins), as well as combinations of designed
nucleic acids and/or proteins (e.g., based on cross-over site
selection) as well as designed, pseudo-random or random
recombination methods are described in WO 00/42560 by Selifonov et
al., "Methods for Making Character Strings, Polynucleotides and
Polypeptides Having Desired Characteristics" and WO 00/42559 by
Selifonov and Stemmer "Methods of Populating Data Structures for
Use in Evolutionary Simulations." Extensive details regarding in
silico recombination methods are found in these applications. This
methodology is generally applicable to the present invention in
providing for recombination of the character strings corresponding
to nucleic acids encoding co-stimulatory B7 molecules in silico
and/or the generation of corresponding nucleic acids or
proteins.
[0354] Many methods of accessing natural diversity, e.g., by
hybridization of diverse nucleic acids or nucleic acid fragments to
single-stranded templates, followed by polymerization and/or
ligation to regenerate full-length sequences, optionally followed
by degradation of the templates and recovery of the resulting
modified nucleic acids can be similarly used. In one method
employing a single-stranded template, the fragment population
derived from the genomic library(ies) is annealed with partial, or,
often approximately full length ssDNA or RNA corresponding to the
opposite strand. Assembly of complex chimeric genes from this
population is then mediated by nuclease-base removal of
non-hybridizing fragment ends, polymerization to fill gaps between
such fragments and subsequent single stranded ligation. The
parental polynucleotide strand can be removed by digestion (e.g.,
if RNA or uracil-containing), magnetic separation under denaturing
conditions (if labeled in a manner conducive to such separation)
and other available separation/purification methods. Alternatively,
the parental strand is optionally co-purified with the chimeric
strands and removed during subsequent screening and processing
steps. Additional details regarding this approach are found, e.g.,
in "Single-Stranded Nucleic Acid Template-Mediated Recombination
and Nucleic Acid Fragment Isolation" by Affholter,
PCT/US01/06775.
[0355] In another approach, single-stranded molecules are converted
to double-stranded DNA (dsDNA) and the dsDNA molecules are bound to
a solid support by ligand-mediated binding. After separation of
unbound DNA, the selected DNA molecules are released from the
support and introduced into a suitable host cell to generate a
library enriched sequences which hybridize to the probe. A library
produced in this manner provides a desirable substrate for further
diversification using any of the procedures described herein.
[0356] Any of the preceding general recombination formats can be
practiced in a reiterative fashion (e.g., one or more cycles of
mutation/recombination or other diversity generation methods,
optionally followed by one or more selection methods) to generate a
more diverse set of recombinant nucleic acids.
[0357] Mutagenesis employing polynucleotide chain termination
methods have also been proposed (see e.g., U.S. Pat. No. 5,965,408,
"Method of DNA reassembly by interrupting synthesis" to Short, and
the references above), and can be applied to the present invention.
In this approach, double stranded DNAs corresponding to one or more
genes sharing regions of sequence similarity are combined and
denatured, in the presence or absence of primers specific for the
gene. The single stranded polynucleotides are then annealed and
incubated in the presence of a polymerase and a chain terminating
reagent (e.g., ultraviolet, gamma or X-ray irradiation; ethidium
bromide or other intercalators; DNA binding proteins, such as
single strand binding proteins, transcription activating factors,
or histones; polycyclic aromatic hydrocarbons; trivalent chromium
or a trivalent chromium salt; or abbreviated polymerization
mediated by rapid thermocycling; and the like), resulting in the
production of partial duplex molecules. The partial duplex
molecules, e.g., containing partially extended chains, are then
denatured and reannealed in subsequent rounds of replication or
partial replication resulting in polynucleotides which share
varying degrees of sequence similarity and which are diversified
with respect to the starting population of DNA molecules.
Optionally, the products, or partial pools of the products, can be
amplified at one or more stages in the process. Polynucleotides
produced by a chain termination method, such as described above,
are suitable substrates for any other described recombination
format.
[0358] Diversity also can be generated in nucleic acids or
populations of nucleic acids using a recombinational procedure
termed "incremental truncation for the creation of hybrid enzymes"
("ITCHY") described in Ostermeier et al. (1999) "A combinatorial
approach to hybrid enzymes independent of DNA homology" Nature
Biotech 17:1205. This approach can be used to generate an initial a
library of variants which can optionally serve as a substrate for
one or more in vitro or in vivo recombination methods. See, also,
Ostermeier et al. (1999) "Combinatorial Protein Engineering by
Incremental Truncation," Proc. Natl. Acad. Sci. USA, 96: 3562-67;
Ostermeier et al. (1999), "Incremental Truncation as a Strategy in
the Engineering of Novel Biocatalysts," Biological and Medicinal
Chemistry, 7: 2139-44.
[0359] Mutational methods which result in the alteration of
individual nucleotides or groups of contiguous or non-contiguous
nucleotides can be favorably employed to introduce nucleotide
diversity. For example, mutagenesis procedures resulting in changes
of one or more nucleotides can be used to generate any number of
nucleic acids encoding polypeptides of the present invention. Many
mutagenesis methods are found in the above-cited references;
additional details regarding mutagenesis methods can be found in
following, which can also be applied to the present invention.
[0360] For example, error-prone PCR can be used to generate nucleic
acid variants. Using this technique, PCR is performed under
conditions where the copying fidelity of the DNA polymerase is low,
such that a high rate of point mutations is obtained along the
entire length of the PCR product. Examples of such techniques are
found in the references above and, e.g., in Leung et al. (1989)
Technique 1:11-15 and Caldwell et al. (1992) PCR Methods Applic.
2:28-33. Similarly, assembly PCR can be used, in a process which
involves the assembly of a PCR product from a mixture of small DNA
fragments. A large number of different PCR reactions can occur in
parallel in the same reaction mixture, with the products of one
reaction priming the products of another reaction.
[0361] Oligonucleotide directed mutagenesis can be used to
introduce site-specific mutations in a nucleic acid sequence of
interest. Examples of such techniques are found in the references
above and, e.g., in Reidhaar-Olson et al. (1988) Science,
241:53-57. Similarly, cassette mutagenesis can be used in a process
that replaces a small region of a double stranded DNA molecule with
a synthetic oligonucleotide cassette that differs from the native
sequence. The oligonucleotide can contain, e.g., completely and/or
partially randomized native sequence(s).
[0362] Recursive ensemble mutagenesis is a process in which an
algorithm for protein mutagenesis is used to produce diverse
populations of phenotypically related mutants, members of which
differ in amino acid sequence. This method uses a feedback
mechanism to monitor successive rounds of combinatorial cassette
mutagenesis. Examples of this approach are found in Arkin &
Youvan (1992) Proc. Natl. Acad. Sci. USA 89:781-1-7815.
[0363] Exponential ensemble mutagenesis can be used for generating
combinatorial libraries with a high percentage of unique and
functional mutants. Small groups of residues in a sequence of
interest are randomized in parallel to identify, at each altered
position, amino acids which lead to functional proteins. Examples
of such procedures are in Delegrave & Youvan (1993)
Biotechnology Research 11:1548-1552.
[0364] In vivo mutagenesis can be used to generate random mutations
in any cloned DNA of interest by propagating the DNA, e.g., in a
strain of E. coli that carries mutations in one or more of the DNA
repair pathways. These "mutator" strains have a higher random
mutation rate than that of a wild-type parent. Propagating the DNA
in one of these strains will eventually generate random mutations
within the DNA. Such procedures are described in the references
noted above.
[0365] Other procedures for introducing diversity into a genome,
e.g. a bacterial, fungal, animal or plant genome can be used in
conjunction with the above described and/or referenced methods. For
example, in addition to the methods above, techniques have been
proposed which produce nucleic acid multimers suitable for
transformation into a variety of species (see, e.g., Schellenberger
U.S. Pat. No. 5,756,316 and the references above). Transformation
of a suitable host with such multimers, consisting of genes that
are divergent with respect to one another, (e.g., derived from
natural diversity or through application of site directed
mutagenesis, error prone PCR, passage through mutagenic bacterial
strains, and the like), provides a source of nucleic acid diversity
for DNA diversification, e.g., by an in vivo recombination process
as indicated above.
[0366] Alternatively, a multiplicity of monomeric polynucleotides
sharing regions of partial sequence similarity can be transformed
into a host species and recombined in vivo by the host cell.
Subsequent rounds of cell division can be used to generate
libraries, members of which, include a single, homogenous
population, or pool of monomeric polynucleotides. Alternatively,
the monomeric nucleic acid can be recovered by standard techniques,
e.g., PCR and/or cloning, and recombined in any of the
recombination formats, including recursive recombination formats,
described above.
[0367] Methods for generating multispecies expression libraries
have been described (in addition to the reference noted above, see,
e.g., Peterson et al. (1998) U.S. Pat. No. 5,783,431 "METHODS FOR
GENERATING AND SCREENING NOVEL METABOLIC PATHWAYS," and Thompson,
et al. (1998) U.S. Pat. No. 5,824,485 METHODS FOR GENERATING AND
SCREENING NOVEL METABOLIC PATHWAYS) and their use to identify
protein activities of interest has been proposed (In addition to
the references noted above, see Short (1999) U.S. Pat. No.
5,958,672 "PROTEIN ACTIVITY SCREENING OF CLONES HAVING DNA FROM
UNCULTIVATED MICROORGANISMS"). Multispecies expression libraries
include, in general, libraries comprising cDNA or genomic sequences
from a plurality of species or strains, operably linked to
appropriate regulatory sequences, in an expression cassette. The
cDNA and/or genomic sequences are optionally randomly ligated to
further enhance diversity. The vector can be a shuttle vector
suitable for transformation and expression in more than one species
of host organism, e.g., bacterial species, eukaryotic cells. In
some cases, the library is biased by preselecting sequences which
encode a protein of interest, or which hybridize to a nucleic acid
of interest. Any such libraries can be provided as substrates for
any of the methods herein described.
[0368] The above-described procedures have been largely directed to
increasing nucleic acid and/or encoded protein diversity. However,
in many cases, not all of the diversity is useful, e.g.,
functional, and contributes merely to increasing the background of
variants that must be screened or selected to identify the few
favorable variants. In some applications, it is desirable to
preselect or prescreen libraries (e.g., an amplified library, a
genomic library, a cDNA library, a normalized library, etc.) or
other substrate nucleic acids prior to diversification, e.g., by
recombination-based mutagenesis procedures, or to otherwise bias
the substrates towards nucleic acids that encode functional
products. For example, in the case of antibody engineering, it is
possible to bias the diversity generating process toward antibodies
with functional antigen binding sites by taking advantage of in
vivo recombination events prior to manipulation by any of the
described methods. For example, recombined CDRs derived from B cell
cDNA libraries can be amplified and assembled into framework
regions (e.g., Jirholt et al. (1998) "Exploiting sequence space:
shuffling in vivo formed complementarity determining regions into a
master framework" Gene 215: 471) prior to diversifying according to
any of the methods described herein.
[0369] Libraries can be biased towards nucleic acids which encode
proteins with desirable enzyme activities. For example, after
identifying a clone from a library which exhibits a specified
activity, the clone can be mutagenized using any known method for
introducing DNA alterations. A library comprising the mutagenized
homologues is then screened for a desired activity, which can be
the same as or different from the initially specified activity. An
example of such a procedure is proposed in Short (1999) U.S. Pat.
No. 5,939,250 for "PRODUCTION OF ENZYMES HAVING DESIRED ACTIVITIES
BY MUTAGENESIS." Desired activities can be identified by any method
known in the art. For example, WO 99/10539 proposes that gene
libraries can be screened by combining extracts from the gene
library with components obtained from metabolically rich cells and
identifying combinations which exhibit the desired activity. It has
also been proposed (e.g., WO 98/58085) that clones with desired
activities can be identified by inserting bioactive substrates into
samples of the library, and detecting bioactive fluorescence
corresponding to the product of a desired NCSM activity as
described herein using a fluorescent analyzer, e.g., a flow
cytometry device, a CCD, a fluorometer, or a spectrophotometer.
[0370] Libraries can also be biased towards nucleic acids which
have specified characteristics, e.g., hybridization to a selected
nucleic acid probe. For example, application WO 99/10539 proposes
that polynucleotides encoding a desired activity (e.g., an
enzymatic activity, for example: a lipase, an esterase, a protease,
a glycosidase, a glycosyl transferase, a phosphatase, a kinase, an
oxygenase, a peroxidase, a hydrolase, a hydratase, a nitrilase, a
transaminase, an amidase or an acylase) can be identified from
among genomic DNA sequences in the following manner. Single
stranded DNA molecules from a population of genomic DNA are
hybridized to a ligand-conjugated probe. The genomic DNA can be
derived from either a cultivated or uncultivated microorganism, or
from an environmental sample. Alternatively, the genomic DNA can be
derived from a multicellular organism, or a tissue derived
therefrom. Second strand synthesis can be conducted directly from
the hybridization probe used in the capture, with or without prior
release from the capture medium or by a wide variety of other
strategies known in the art. Alternatively, the isolated
single-stranded genomic DNA population can be fragmented without
further cloning and used directly in, e.g., a recombination-based
approach, that employs a single-stranded template, as described
above.
[0371] "Non-Stochastic" methods of generating nucleic acids and
polypeptides are alleged in Short "Non-Stochastic Generation of
Genetic Vaccines and Enzymes" WO 00/46344. These methods, including
proposed non-stochastic polynucleotide reassembly and
site-saturation mutagenesis methods be applied to the present
invention as well. Random or semi-random mutagenesis using doped or
degenerate oligonucleotides is also described in, e.g., Arkin and
Youvan (1992) "Optimizing nucleotide mixtures to encode specific
subsets of amino acids for semi-random mutagenesis" Biotechnology
10:297-300; Reidhaar-Olson et al. (1991) "Random mutagenesis of
protein sequences using oligonucleotide cassettes" Methods Enzymol.
208:564-86; Lim and Sauer (1991) "The role of internal packing
interactions in determining the structure and stability of a
protein" J. Mol. Biol. 219:359-76; Breyer and Sauer (1989)
"Mutational analysis of the fine specificity of binding of
monoclonal antibody 51F to lambda repressor" J. Biol. Chem.
264:13355-60); and "Walk-Through Mutagenesis" (Crea, R; U.S. Pat.
Nos. 5,830,650 and 5,798,208, and EP Patent 0527809 B1.
[0372] It will readily be appreciated that any of the above
described techniques suitable for enriching a library prior to
diversification can also be used to screen the products, or
libraries of products, produced by the diversity generating
methods.
[0373] Kits for mutagenesis, library construction and other
diversity generation methods are also commercially available. For
example, kits are available from, e.g., Stratagene (e.g.,
QuickChange.TM. site-directed mutagenesis kit; and Chameleon.TM.
double-stranded, site-directed mutagenesis kit), Bio/Can
Scientific, Bio-Rad (e.g., using the Kunkel method described
above), Boehringer Mannheim Corp., Clonetech Laboratories, DNA
Technologies, Epicentre Technologies (e.g., 5 prime 3 prime kit);
Genpak Inc, Lemargo Inc, Life Technologies (Gibco BRL), New England
Biolabs, Pharmacia Biotech, Promega Corp., Quantum Biotechnologies,
Amersham International plc (e.g., using the Eckstein method above),
and Anglian Biotechnology Ltd (e.g., using the Carter/Winter method
above).
[0374] The above references provide many mutational formats,
including recombination, recursive recombination, recursive
mutation and combinations or recombination with other forms of
mutagenesis, as well as many modifications of these formats.
Regardless of the diversity generation format that is used, the
nucleic acids of the invention can be recombined (with each other,
or with related (or even unrelated) sequences) to produce a diverse
set of recombinant nucleic acids, including, e.g., sets of
homologous nucleic acids, as well as corresponding
polypeptides.
[0375] A recombinant nucleic acid produced by recombining one or
more polynucleotide sequences of the invention with one or more
additional nucleic acids using any of the above-described formats
alone or in combination also forms a part of the invention. The one
or more additional nucleic acids may include another polynucleotide
of the invention; optionally, alternatively, or in addition, the
one or more additional nucleic acids can include, e.g., a nucleic
acid encoding a naturally-occurring B7-1, co-stimulatory homologue
or a subsequence thereof, or any homologous B7-1, co-stimulatory
sequence or subsequence thereof (e.g., as found in GenBank or other
available literature), or, e.g., any other homologous or
non-homologous nucleic acid or fragments thereof (certain
recombination formats noted above, notably those performed
synthetically or in silico, do not require homology for
recombination).
Polypeptides of the Invention
[0376] The invention provides isolated or recombinant NCSM
polypeptides, fragments thereof, and homologues, variants and
derivatives thereof, collectively referred to herein as "NCSM
polypeptides" or "NCSM polypeptide" unless otherwise specifically
noted. The term "NCSM polypeptide" is intended throughout to
include amino acid fragments, homologues, derivatives, variants of
the polypeptide and protein sequences specifically disclosed herein
unless otherwise noted. Polypeptide variants include those with
conservative amino acid substations ("conservatively substituted
variations") as described above. Also included in this invention
are fusion proteins comprising NCSM polypeptides and proteins,
chimeric NCSM polypeptides, comprising one or more fragments from
one or more NCSM polypeptides set forth herein.
[0377] As discussed above, the invention provides CD28BP
polypeptides and CTLA-4BP polypeptides and fragments of either
thereof that bind either or both of CD28 or CTLA-4 receptor. In
some embodiments, a CD28BP polypeptide of the invention (including
fragments thereof, such as soluble ECDs and ECD fusion proteins,
cytoplasmic domains, transmembrane domains, and/or signal peptides,
and fusion proteins thereof) has a binding affinity for CD28 that
is about equal to or greater than that of hB7-1 for CD28 (which is
about 4.times.10.sup.-6M) and/or a binding affinity for CTLA-4 that
is about equal to or less than about that of hB7-1 for CTLA-4
(i.e., about 0.2-0.4.times.10.sup.-6 M). In other embodiments, a
CD28BP of the invention has a CD28/CTLA-4 binding affinity ratio
that is about equal to or greater than that of hB7-1. In some such
embodiments, a ratio of specific binding affinities CD28/CTLA-4 for
a CD28BP is at least about 0.5-1.times.10.sup.-1.
[0378] In other embodiments, a CTLA-4BP polypeptide of the
invention (including fragments thereof, such as soluble ECDs and
ECD fusion proteins, cytoplasmic domains, transmembrane domains,
and/or signal peptides, and fusion proteins thereof) has a
CTLA-4/CD28 binding affinity ratio that is about equal to or
greater than that of hB7-1. In some embodiments, a CTLA-4BP
polypeptide of the invention has a binding affinity for CTLA-4 that
is about equal to or greater than that of hB7-1 for CTLA-4 (i.e.,
about 4.times.10.sup.-6M) and/or a binding affinity for CD28 that
is about equal to or less than that of hB7-1 for CD28 (which ranges
from about 0.2.times.10.sup.-6 M to about 0.4.times.le M). In other
embodiments, a CTLA-4BP has a binding affinity for CTLA-4 and CD28
that is less than the binding affinity of hB7-1 for either
receptor; however, the ratio of these binding affinities ratio
(CTLA-4/CD28) is still at least equal to or greater than that of
hB7-1. In other embodiments, for a CTLA-4BP, a ratio of specific
binding affinities CTLA-4/CD28 is at least about 10. Also included
are nucleic acid sequences (e.g., DNA and RNA) that encode all
aforementioned NCSM polypeptides and fragments thereof having one
or more properties outlined above, vectors comprising such nucleic
acid sequences, cells transformed with such vectors.
[0379] CD28BP Polypeptides
[0380] In one aspect, the invention provides an isolated or
recombinant CD28BP polypeptides comprising an extracellular domain
(ECD) sequence, wherein the ECD sequence has at least about 65%,
70% 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
99%, or 99.5% or more amino acid sequence identity to an
extracellular domain amino acid sequence of at least one of SEQ ID
NOS:48-68, 174-221, 283-285, and 290-293, and is not a
naturally-occurring extracellular domain amino acid sequence, and
wherein said polypeptide has a CD28/CTLA-4 binding affinity ratio
about equal to or greater than the CD28/CTLA-4 binding affinity
ratio of human B7-1.
[0381] For some such polypeptides, the polypeptide comprises an
extracellular domain amino acid sequence or the full-length amino
acid sequence of any one of SEQ ID NOS:48-68, 174-182, 184-221,
283-285, and 290-293. Some such polypeptides comprise an
extracellular domain amino acid sequence of any one of SEQ ID
NOS:48-68 and 174-209. For some such polypeptides, the polypeptide
comprises an extracellular domain amino acid sequence encoded by a
coding polynucleotide sequence that is selected from the group of:
(a) an ECD coding sequence of a polynucleotide sequence selected
from any of SEQ ID NOS:1-21 and 95-142; (b) an polynucleotide
sequence that encodes the ECD of a polypeptide selected from any of
SEQ ID NOS:48-68, 174-221, 283-285, and 290-293; and (c) a
polynucleotide sequence which, but for codon degeneracy, hybridizes
under stringent conditions over substantially the entire length of
a polynucleotide sequence (a) or (b). Some such CD28BP polypeptides
described above have an equal or enhanced binding affinity for CD28
as compared to a binding affinity of a WT co-stimulatory molecule
for CD28. Some such polypeptides have a CD28/CTLA-4 binding
affinity ratio at least equal to or greater than the CD28/CTLA-4
binding affinity ratio of hB7-1. In one aspect, some such
polypeptides have a decreased or a lowered binding affinity for
CTLA-4 as compared to a binding affinity of a wild type
co-stimulatory molecule for CTLA-4. Some such CD28BP polypeptides
may induce T-cell proliferation or T-cell activation or both T-cell
proliferation and T-cell activation, such as, e.g., in association
with co-stimulation of T cell receptor/CD3 (by, e.g., an antigen or
anti-CD3 antibody). The induced T-cell proliferative response may
be about equal to or greater than that of human B7-1 for some such
polypeptides. In another aspect, some such polypeptides described
above modulate T-cell activation, but do not induce proliferation
of purified T-cells activated by soluble anti-CD3 mAbs.
[0382] In another aspect, the invention provides isolated or
recombinant CD28BP polypeptides that comprise a
non-naturally-occurring amino acid sequence encoded by a nucleic
acid comprising a polynucleotide sequence selected from the group
of: (a) a polynucleotide sequence selected from SEQ ID NOS:1-21 and
95-142, or a complementary polynucleotide sequence thereof; (b) a
polynucleotide sequence encoding a polypeptide selected from SEQ ID
NOS:48-68, 174-221, 283-285, and 290-293, or a complementary
polynucleotide sequence thereof; (c) a polynucleotide sequence
which, but for degeneracy of the genetic code, hybridizes under
highly stringent conditions over substantially the entire length of
polynucleotide sequence (a) or (b); (d) a polynucleotide sequence
comprising all or a fragment of (a), (b), or (c), wherein the
fragment encodes a polypeptide having a CD28/CTLA-4 binding
affinity ratio about equal to or greater than the CD28/CTLA-4
binding affinity ratio of human B7-1; (e) a polynucleotide sequence
encoding a polypeptide, the polypeptide comprising an amino acid
sequence which is substantially identical over at least about 150
contiguous amino acid residues of any one of SEQ ID NOS:48-68,
174-221, 283-285, and 290-293; and (f) a polynucleotide sequence
encoding a polypeptide that has a CD28/CTLA-4 binding affinity
ratio equal to, about equal to or greater than the CD28/CTLA-4
binding affinity ratio of human B7-1, which polynucleotide sequence
has at least about 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98%, 99%, or more identity to at least one
polynucleotide sequence of (a), (b), (c), or (d). In one aspect,
such CD28BP polypeptides comprise the full-length amino acid
sequence of any one of SEQ ID NOS:48-68, 174-221, 283-285, and
290-293.
[0383] The above-described polypeptides have a CD28/CTLA-4 binding
affinity ratio about equal to, equal to or greater than the
CD28/CTLA-4 binding affinity ratio of human B7-1. Some such
polypeptides induce a T-cell proliferation in association with TCR
stimulation; the response may be about equal to or greater than
that of human B7-1.
[0384] In yet another embodiment, the invention provides isolated
or recombinant polypeptides comprising an amino acid sequence
according to the formula:
[0385]
MGHTM-X6-W-X8-SLPPK-X14-PCL-X18-X19-X20-QLLVLT-X27-LFYFCSGITPKSVTKR-
VKETVMLSCDY-X55-TSTE-X60-LTSLRIYW-X69-KDSKMVLAILPGKVQVWPEYKNRTITDMNDN-X101-
-RIVI-X106-ALR-X110-SD-X113-GTYTCV-X120-QKP-X124-LKGAYKLEHL-X135-SVRLMIRAD-
FPVP-X149-X150-X151-DLGNPSPNIRRLICS-X167-X168-X169-GFPRPHL-X177-WLENGEELNA-
TNTT-X192-SQDP-X197-T-X199-LYMISSEL-X208-FNVTNN-X215-SI-X218-CLIKYGEL-X227-
-VSQIFPWSKPKQEPPIDQLPF-X249-VIIPVSGALVL-X261-A-X263-VLY-X267-X268-ACRH-X27-
3-ARWKRTRRNEETVGTE RLSPIYLGSAQSSG (SEQ ID NO:284), or a subsequence
thereof comprising the extracellular domain, wherein position X6 is
Lys or Glu; position X8 is Arg or Gly; position X14 is Arg or Cys;
position X18 is Trp or Arg; position X19 is Pro or Leu; position
X20 is Ser or Pro; position X27 is Asp or Gly; position X55 is Asn
or Ser; position X60 is Glu or Lys; position X69 is Gln or Arg;
position X101 is Pro or Leu; position X106 is Leu or Gln; position
X110 is Pro or Leu; position X113 is Lys or Ser; position X120 is
Val or Ile; position X124 is Val or Asp; position X135 is Thr or
Ala; position X149 is Thr, Ser, or del; position X150 is Ile or
del; position X151 is Asn or Thr; position X167 is Thr or del;
position X169 is Ser or del; position X169 is Gly or del; position
X177 is Cys or Tyr; position X192 is Val or Leu; position X197 is
Gly or Glu; position X199 is Glu or Lys; position X208 is Gly or
Asp; position X215 is His or Arg; position X218 is Ala or Val;
position X227 is Ser or Leu; position X249 is Trp, Leu, or Arg;
position X261 is Ala or Thr; position X263 is Val, Ala, or Ile;
position X267 is Arg or Cys; position X268 is Pro or Leu; and
position X273 is Gly or Val. Some such polypeptides have one or
more of the properties of CD28 polypeptides described herein,
including an ability to enhance an immune response, induce a T cell
activation or proliferation response, exhibit a CD28/CTLA-4 binding
affinity ratio about equal to or greater than that of hB7-1, and/or
alter cytokine production. For some such polypeptides, the induced
T cell response is about equal to or greater than that of hB7-1. In
one embodiment, some such polypeptides comprise an extracellular
domain amino acid sequence of any one of SEQ ID NOS:51-56, 58, 61,
66, 67, 174-179, 181, 185-187, 189, 192-194, 197, 199, 202, 205,
208, 215, 217, 220, and 285.
[0386] In another embodiment, some such polypeptides comprise two,
three, four, five, six, eight, ten, or more of: Lys at position X6;
Arg at position X8; Arg at position X14; Trp at position X18; Pro
at position X19; Ser at position X20; Asp at position X27; Asn at
position X55; Leu at position X106; Pro at position X110; Lys at
position X113; Val at position X120; Val at position X124; Thr at
position X135; Asn at position X151; Cys at position X177; Val at
position X192; Gly at position X197; Glu at position X199; Gly at
position X208; His at position X215; Ala at position X218; Trp at
position X249; Ala at position X261; Val at position X263; Arg at
position X267; Pro at position X268; and Gly at position X273. In a
preferred embodiment, some such polypeptides comprise two, three,
four, five, six, eight, ten, or more of: Arg at position X8; Arg at
position X14; Trp at position X18; Pro at position X19; Ser at
position X20; Pro at position X110; Val at position X120; Val at
position X124; Cys at position X177; Val at position X192; Gly at
position X197; Glu at position X199; Gly at position X208; His at
position X215; Ala at position X218; Trp at position X249; Ala at
position X261; and Val at position X263. In yet another preferred
embodiment, some such polypeptides comprise the extracellular
domain amino acid sequence of SEQ ID NO:66 or SEQ ID NO:285. In yet
another preferred embodiment, some such polypeptides comprise the
sequence of SEQ ID NO:66 or SEQ ID NO:285.
[0387] In another aspect, the invention provides isolated or
recombinant CD28BP polypeptides comprising a subsequence of an
amino acid sequence set forth in any of SEQ ID NOS:48-68, 174-182,
184-221, 283-285, and 290-293, wherein the subsequence is the
extracellular domain of said amino acid sequence.
[0388] The invention also provides isolated or recombinant
polypeptides comprising an amino acid sequence according to the
formula:
[0389] MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPK
SVTKRVKETVM-X50-SCDY-X55-X56-STEELTSLRIYWQKDSKMVL
AILPGKVQVWPEYKNRTITD
MNDNPRIVELALRLSD-X113-GTYTCV-X120-QK-X123-X124-X125-X126-G-X128-X129-X130-
-X131-EHL-X135-SV-X138-L-X140-ERADFPVPSITDIGHPAPNVK
RIRCSASG-X170-FPEPRLAWMEDGFFJ,
NAVNTTV-X193-X194-X195-LDTELYSVSSELD-X209-N--X211-TNNHSIVCLEKYGELSVSQIFPW-
SKPK QEPPIDQLPFWVI-X252-X253-VSGALVLTAVVLYCLACRHVAR (SEQ ID
NO:290), or subsequence thereof comprising the extracellular
domain, wherein position X50 is Leu or Pro; position X55 is Asn or
Ser; position X56 is Ala or Thr; position X113 is Ser or Lys;
position X120 is Ile or Val; position X123 is Pro or deleted;
position X124 is Val, Asn, or Asp; position X125 is Leu or Glu;
position X126 is Lys or Asn; position X128 is Ala or Ser; position
X129 is Tyr or Phe; position X130 is Lys or Arg; position X131 is
Leu or Arg; position X135 is Ala or Thr; position X138 is Arg or
Thr; position X140 is Met or Ser; position X170 is Asp or Gly;
position X193 is Asp or is deleted; position X194 is Gln or is
deleted; position X195 is Asp or is deleted; position X211 is Val
or Ala; position X252 is Ile or Val; and position X253 is Leu or
Pro. Some such polypeptides have at least one of the properties of
CD28 polypeptides described herein, including an ability to enhance
an immune response, induce T cell activation or proliferation,
exhibit a CD28/CTLA-4 binding affinity ratio about equal to or
greater than that of hB7-1, and/or alter cytokine production. For
some such polypeptides, the induced T cell response is about equal
to or greater than that of hB7-1.
[0390] In a preferred embodiment, some such CD28BP polypeptides
comprise two, three, four, five, six, eight, ten, or more of: Leu
at position X50; Asn at position X55; Ala at position X56; Ser at
position X113; Ile at position X120; Pro at position X123; Val at
position X124; Leu at position X125; Lys at position X126; Ala at
position X128; Tyr at position X129; Lys at position X130; Leu at
position X131; Ala at position X135; Arg at position X138; Met at
position X140; Asp at position X170; Asp at position X193; Asp at
position X194; Asp at position X195; Val at position X211; Ile at
position X252; and Leu at position X253. In yet another preferred
embodiment, some such polypeptides comprise a sequence of any one
of SEQ ID NOS:59, 62, 180, 184, 188, 195, 196, 200, 201, 204, 211,
213, 219, and 291.
[0391] In another aspect, the invention provides isolated or
recombinant polypeptides comprising an amino acid sequence
according to the formula:
[0392] MGHTMKWG-X9-LPPKRPCLWLSQLLVLTGLFYFCSG-X35-TPKSVTKRV
KETVMLSCDY-X55-TSTEELTSLRIYWQKDSKMVLAILPGKVQVW
PEYKNRTITDMNDNPRIVILALR-X110-SDSGTYTCVIQKP-X124-LKGAYKLEHL-X135-SVRLMIRAD-
FPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENG-X183-ELNATNTT-X192-SQDPETKLYMISSELD-
FN-X211-TSN-X215-X216-X217-LCLVKYGDLTVSQ-X231-FYWQESKPTPSANQHLTWITOPVSAFGI-
SVIIAVI LTCLTCRNAAIRRQRRENEV-X288-M-X290-SCSQSP (SEQ ID NO:292), or
a subsequence thereof comprising the extracellular domain, wherein
position X9 is Thr or Ser; position X35 is Ile or Thr; position X55
is Asn or Ser; position X110 is Leu or Pro; position X124 is Asp or
Val; position X135 is Thr or Ala; position X183 is Lys or Glu;
position X192 is Leu or Val; position X211 is Met or Thr; position
X215 is His or is deleted; position X216 is Ser or is deleted;
position X217 is Phe or is deleted; position X231 is Thr or Ser;
position X288 is Lys or Glu; position X290 is Glu or Gln, and
wherein said sequence is a non naturally-occurring sequence.
Further, some such polypeptides have at least one of the properties
of CD28 polypeptides described herein, including an ability to
enhance an immune response, induce T cell activation or
proliferation, exhibit a CD28/CTLA-4 binding affinity ratio about
equal to or greater than that of hB7-1, and/or alter cytokine
production. For some such polypeptides, the induced T cell response
is about equal to or greater than that of hB7-1.
[0393] In a preferred embodiment, some such polypeptides comprise
two, three, four, five, six, eight, ten, or more of the following
amino acids: Thr at position X9; Ile at position X35; Asn at
position X55; Leu at position X110; Asp at position X124; Thr at
position X135; Lys at position X183; Leu at position X192; Met at
position X211; His at position X215; Ser at position X216; Phe at
position X217; Thr at position X231; Lys at position X288; and Glu
at position X290. In yet another preferred embodiment, some such
polypeptides comprise a sequence of any one of SEQ ID NOS:48, 182,
183, 212, 214, 216, 218, 221, and 293.
[0394] In another aspect, the invention provides isolated or
recombinant polypeptides comprising an amino acid sequence
corresponding to an extracellular domain, wherein said amino acid
sequence has at least about 92% or about 95% amino acid sequence
identity to the amino acid sequence corresponding to the
extracellular domain of SEQ ID NO:66, and wherein said polypeptide
has a CD28/CTLA-4 binding affinity ratio greater than the
CD28/CTLA-4 binding affinity ratio of human B7-1 or an ability to
induce a T cell proliferation or activation response that is
greater than or about equal to that induced by hB7-1. Some such
isolated or recombinant polypeptides further comprise at least one
further amino acid sequence corresponding to a signal peptide. Some
such isolated or recombinant polypeptides further comprise at least
one further amino acid sequence corresponding to a transmembrane
domain or a cytoplasmic domain.
[0395] The invention also provides isolated or recombinant
polypeptide variants, each polypeptide comprising an amino acid
sequence that differs from the ECD amino acid sequence of B7-1
polypeptide of an Artiodactyla mammal, such as a bovine B7-1,
wherein the difference between the amino acid sequence of the
variant and the ECD amino acid sequence of the Artiodactyla mammal
B7-1 (e.g., bovine B7-1) comprises a different amino acid at one or
more of the following amino acid residue positions: position 110,
124, 135, 192, 197, 199, 211, 213, 217, 218, 221, 225, 227, 231,
233, 235, 236, 237, 239, 240, 242, 243, and 244, wherein each
position corresponds to the position in the amino acid sequence of
the bovine B7-1 of SEQ ID NO:280. An Artiodactyla mammal includes
cloven-hoofed mammals, such as bovine, sheep, goats, camels, pigs,
deer, giraffes, and antelope
(www.ucmp.berkeley.edu/mammal/eutheria/ungulate.html). Some such
polypeptide variants comprise variants of full-length bovine B7-1
polypeptide.
[0396] For some such polypeptide variants, the difference between
the amino acid sequence of the variant and the ECD amino acid
sequence of the Artiodactyla B7-1 (e.g., bovine B7-1) comprises at
least one of: (a) a different amino acid at position 110 which is
Pro; (b) a different amino acid at position 124 which is Val; (c) a
different amino acid at position 135 which is Ala; (d) a different
amino acid at position 192 which is Val; (e) a different amino acid
at position 197 which is Gly; (f) a different amino acid at
position 199 which is Glu; (g) a different amino acid at position
211 which is Val; (h) a different amino acid at position 213 which
is Asn; (i) a different amino acid at position 217 which is Ile;
(j) a different amino acid at position 218 which is Val; (k) a
different amino acid at position 221 which is Ile; (l) a different
amino acid at position 225 which is Glu; (m) a different amino acid
at position 227 which is Ser; (n) a different amino acid at
position 231 which is Ile; (o) a different amino acid at position
233 which is Pro; (p) a different amino acid at position 235 which
is Ser; (q) a different amino acid at position 236 which is Lys;
(r) a different amino acid at position 237 which is Pro; (s) a
different amino acid at position 239 which is Gln; (t) a different
amino acid at position 240 which is Glu; (u) a different amino acid
at position 242 which is Pro; (v) a different amino acid at
position 243 which is Ile; and (w) a different amino acid at
position 244 which is Asp.
[0397] For some such polypeptide variants, the difference between
the amino acid sequence of the variant and the ECD amino acid
sequence of the Artiodactyla B7-1 (e.g., bovine B7-1) further
comprises at least one of: (1) a different amino acid at position
246 which is Leu; (2) a different amino acid at position 247 which
is Pro; (3) a different amino acid at position 248 which is Phe;
(4) a different amino acid at position 250 which is Val; and (5) a
different amino acid at position 253 which is Pro, wherein each
position corresponds to the position in the amino acid sequence of
bovine B7-1 of SEQ ID NO:280. Some such polypeptide variants
further comprise a signal peptide (e.g., of a WT mammalian B7-1 or
NCSM polypeptide described herein). Some such polypeptide variants
also comprise a transmembrane domain and/or cytoplasmic domain,
including, e.g., a TMD and/or CD of a WT mammalian B7-1 or NCSM
polypeptide described herein.
[0398] In some such variants of bovine B7-1, the amino acid in SEQ
ID NO:278 at at least one of positions 254, 255, and 256 is
deleted. Some such bovine B7-1 variants further comprise at least
one of: (6) a different amino acid at position 257 which is Val;
(7) a different amino acid at position 258 which is Ser; (8) a
different amino acid at position 260 which is Ala; (9) a different
amino acid at position 261 which is Leu; (10) a different amino
acid at position 263 which is Leu; (11) a different amino acid at
position 264 which is Thr; (12) a different amino acid at position
267 which is Val; (13) a different amino acid at position 269 which
is Tyr; (14) a different amino acid at position 272 which is Ala;
(15) a different amino acid at position 275 which is His; (16) a
different amino acid at position 276 which is Val; (17) a different
amino acid at position 275 which is His; wherein each position
corresponds to the position in the amino acid sequence of SEQ ID
NO:280.
[0399] Some such bovine B7-1 variants further comprise at least one
of: (18) a different amino acid at position 276 which is Val; (19)
a different amino acid at position 278 which is Arg; (20) a
different amino acid at position 279 which is Trp; (21) a different
amino acid at position 280 which is Lys; (22) a different amino
acid at position 281 which is Arg; (23) a different amino acid at
position 282 which is Thr; (24) a different amino acid at position
284 which is Arg; (25) a different amino acid at position 287 which
is Glu; (26) a different amino acid at position 288 which is Thr;
(27) a different amino acid at position 289 which is Val; (28) a
different amino acid at position 290 which is Gly; (29) a different
amino acid at position 291 which is Thr; (30) a different amino
acid at position 292 which is Glu; (31) a different amino acid at
position 293 which is Arg; (32) a different amino acid at position
294 which is Leu; wherein each position corresponds to the position
in the amino acid sequence of SEQ ID NO:280.
[0400] Some of the above-described polypeptide variants of
Artiodactyla mammalian B7-1 (e.g., bovine B7-1) further comprise
the following amino acid sequence at the C terminus:
IYLGSAQSSG.
[0401] Some of the above-described polypeptide variants of
Artiodactyla mammalian B7-1 (e.g., bovine B7-1) exhibit a
CD28/CTLA-4 binding affinity ratio that is equal to or greater than
that of hB7-1 and/or have an ability to induce a T cell
proliferation or activation response about equal to or greater than
that induced by hB7-1.
[0402] The invention also includes nucleic acid sequences (e.g.,
DNA and RNA) that encode all aforementioned CD28BP polypeptides and
Artiodactyla polypeptide variants, and fragments thereof having one
or more of the properties described above, and complementary
nucleic acid sequences thereof; and expression vectors comprising
all such nucleic acid sequences, and cells transformed with such
expression vectors.
[0403] CTLA-4BP Polypeptides
[0404] In one aspect, the invention provides isolated or
recombinant CTLA-4BP polypeptides each comprising an amino acid
sequence having at least about 85%, 88%, 89%, 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more percent identity to at
least one of SEQ ID NOS:69-92, 222-252, 286-289, or a subsequence
thereof comprising the extracellular domain, wherein said sequence
(a) is a non naturally-occurring sequence, and (b) comprises at
least one of: Gly at position 2; Thr at position 4; Arg at position
5; Gly at position 8; Pro at position 12; Met at position 25; Cys
at position 27; Pro at position 29; Leu at position 31; Arg at
position 40; Leu at position 52; His at position 65; Ser at
position 78; Asp at position 80; Tyr at position 87; Lys at
position 120; Asp at position 122; Lys at position 129; Met at
position 135; Phe at position 150; Ile at position 160; Ala at
position 164; His at position 172; Phe at position 174; Leu at
position 176; Asn at position 178; Asn at position 186; Glu at
position 194; Gly at position 196; Thr at position 199; Ala at
position 210; His at position 212; Arg at position 219; Pro at
position 234; Asn at position 241; Leu at position 244; Thr at
position 250; Ala at position 254; Tyr at position 265; Arg at
position 266; Glu at position 273; Lys at position 275; Ser at
position 276; an amino acid deletion at position 276; or Thr at
position 279, wherein the position number corresponds to that of
hB7-1 amino acid sequence (SEQ ID NO:278), wherein said polypeptide
has a CTLA-4/CD28 binding affinity ratio about equal to or greater
than a CTLA-4/CD28 binding affinity ratio of hB7-1.
[0405] Such CTLA-4BP polypeptides described above have an altered
binding affinity for CTLA-4 and/or CD28 as compared to the binding
affinity of a WT co-stimulatory molecule for CD28 or CTLA-4. Some
such polypeptides have a CTLA-4/CD28 binding affinity ratio about
equal to or greater than that of hB7-1. In one aspect, some such
polypeptides have a decreased binding affinity for CD28 or CTLA-4
as compared to a binding affinity of a hB7-1 to CD28 or CTLA-4,
respectively. Some such polypeptides may inhibit at least one or
both of T-cell proliferation or activation in association with
co-stimulation of TCR/CD3 (by, e.g., an antigen or anti-CD3
antibody). The induced T-cell proliferative response may be less
than that of hB7-1 for some such polypeptides. In another aspect,
some such polypeptides described above modulate T-cell activation,
but do not induce proliferation of purified T-cells activated by
soluble anti-CD3 mAbs.
[0406] Some such CTLA-4BP polypeptides each comprise an amino acid
sequence having at least about 98% identity to at least one of SEQ
ID NOS:69-92, 222-252, and 286-289, said sequence comprising at
least one of: Gly at position 2; Gly at position 8; Cys at position
27; His at position 65; Asp at position 80; Asp at position 122;
Met at position 135; Phe at position 150; Ala at position 164; Phe
at position 174; Asn at position 186; Glu at position 194; Arg at
position 219; Thr at position 250; Arg at position 266; Lys at
position 275; and Ser at position 276, wherein amino acid position
numbers correspond to that of the hB7-1 amino acid sequence (SEQ ID
NO:278). In one aspect, such polypeptides may comprise the ECD or
full-length amino acid sequence of any one of SEQ ID NOS:69-92,
222-252, and 286-289.
[0407] In a preferred embodiment, some such above-described
CTLA-4BP polypeptides comprise an amino acid sequence having at
least about 98% identity to the extracellular domain of at least
one of SEQ ID NOS:69-92, 222-252, and 286-289, said sequence
comprising at least one of: His at position 65; Asp at position 80;
Asp at position 122; Met at position 135; Phe at position 150; Ala
at position 164; Phe at position 174; Asn at position 186; Glu at
position 194; and Arg at position 219, wherein the amino acid
position numbers correspond to that of hB7-1 amino acid sequence
(SEQ ID NO:278).
[0408] Further, some such polypeptides comprise a sequence having
at least about 98% identity to the ECD of at least one of SEQ ID
NOS:69-92, 222-252, 286-289, said sequence comprising at least two,
three, four, five, six or more of: His at position 65; Asp at
position 80; Asp at position 122; Met at position 135; Phe at
position 150; Ala at position 164; Phe at position 174; Asn at
position 186; Glu at position 194; and Arg at position 219, wherein
the amino acid position numbers correspond to that of h B7-1 amino
acid sequence (SEQ ID NO:278). Some such CTLA-4BP polypeptides
comprise an ECD amino acid sequence of any one of SEQ ID NOS:69-92
and 222-247. In a preferred embodiment, such CTLA-4BP polypeptides
comprise an ECD sequence of any one of SEQ ID NOS:81, 85, 86, 88,
90, and 91.
[0409] In another aspect, some such above-described CTLA-4BP
polypeptides comprises an ECD domain sequence encoded by a coding
polynucleotide sequence, the coding polynucleotide sequence
selected from the group: (a) an ECD coding sequence of a
polynucleotide sequence selected from any of SEQ ID NOS:22-45 and
143-173; (b) a polynucleotide sequence that encodes the ECD amino
acid sequence of a polypeptide selected from any of SEQ ID
NOS:69-92, 222-252, and 286-289; and (c) a polynucleotide sequence
which, but for the codon degeneracy, hybridizes under stringent
conditions over substantially the entire length of a polynucleotide
sequence (a) or (b).
[0410] Some such above-described isolated or recombinant
polypeptides, including, but not limited to, those having the
binding and/or proliferation properties discussed above, further
comprise a signal peptide amino acid sequence encoded by a signal
peptide coding nucleotide sequence, the signal peptide coding
nucleotide sequence selected from the group of: (a) a nucleotide
sequence comprising a nucleotide fragment of a polynucleotide
sequence selected from any of the group of SEQ ID NOS:22-45 and
143-173, wherein said nucleotide fragment encodes a signal peptide;
(b) a nucleotide sequence that encodes the signal peptide of a
polypeptide selected from any of the group of SEQ ID NOS:69-92,
222-252, and 286-289; and (c) a nucleotide sequence which, but for
codon degeneracy, hybridizes under at least stringent conditions
over substantially the entire length of a nucleotide sequence (a)
or (b).
[0411] Some of the above-described isolated or recombinant
polypeptides further comprising a transmembrane domain (TMD) amino
acid sequence encoded by a TMD nucleotide sequence selected from
the group of: (a) a nucleotide sequence of a polynucleotide
sequence selected from any of the group of SEQ ID NOS:22-45 and
143-173, wherein said nucleotide sequence encodes a TMD
polypeptide; (b) a nucleotide sequence that encodes the TMD of a
polypeptide selected from any of the group of SEQ ID NOS:69-92,
222-252, and 286-289; and (c) a nucleotide sequence which, but for
codon degeneracy, hybridizes under at least stringent conditions
over substantially the entire length of a nucleotide sequence (a)
or (b). Some such polypeptides further comprise a cytoplasmic
domain (CD) amino acid sequence encoded by a CD nucleotide sequence
selected from the group of: (a) a nucleotide sequence of a
polynucleotide sequence selected from any of the group of SEQ ID
NOS:22-45 and 143-173, wherein said nucleotide sequence encodes a
CD polypeptide; (b) a nucleotide sequence that encodes the CD of a
polypeptide selected from any of the group of SEQ ID NOS:69-92,
222-252, and 286-289, and 290-293; and (c) a nucleotide sequence
which hybridizes under at least stringent conditions over
substantially the entire length of a nucleotide sequence (a) or
(b).
[0412] The invention includes isolated or recombinant polypeptides
each comprising an amino acid sequence that differs from a primate
B7-1 sequence in at least one of the mutation selected from the
following at an amino acid residue position of indicated, wherein
the position corresponds to the amino acid position within the
amino acid sequence of hB7-1 as shown in SEQ ID NO:278: 1) 40 Arg;
52 Leu; 65 His; 122 Asp; 129 Lys; 135 Met; 164 Ala; 174 Phe; 196
Gly; 199 Thr; 210 Ala; 219 Arg; 234 Pro; 241 Asn; or 2) 12 Pro; 25
Met; 27 Cys; 29 Pro; 40 Arg; 52 Leu; 65 His; 122 Asp; 129 Lys; 135
Met; 164 Ala; 174 Phe; 196 Gly; 199 Thr; 210 Ala; 219 Arg; 234 Pro;
241 Asn; 254 Ala; 275 Lys; 276 Ser; or 279 Thr. The invention also
provides isolated or recombinant polypeptides each comprising an
amino acid sequence that differs from a primate B7-1 sequence in at
least one mutation selected from: Ser 12 Pro; Leu 25 Met; Gly 27
Cys; Ser 29 Pro; Lys 40 Arg; His 52 Leu; Tyr 65 His; Glu 122 Asp;
Glu 129 Lys; Thr 135 Met; Thr 164 Ala; Ser 174 Phe; Glu 196 Gly;
Ala 199 Thr; Thr 210 Ala; Lys 219 Arg; Thr 234 Pro; Asp 241 Asn;
Val 254 Ala; Arg 275 Lys; Arg 276 Ser; or Arg 279 Thr. The mutation
being indicated is relative, e.g., to human B7-1 with the amino
acid sequence shown in SEQ ID NO:278, the sequence does not occur
in nature, and, in some sequences, the polypeptide has a
CTLA-4/CD28 binding affinity ratio about equal to, equal to or
greater than the CTLA-4/CD28 binding affinity ratio of human B7-1.
Each amino acid position corresponds to the position of the amino
acid sequence of SEQ ID NO:278. In some embodiments, the sequence
of some such polypeptides differs from primate B7-1 sequence in at
least two of said mutations. In some aspects, the primate B7-1 is
hB7-1 (SEQ ID NO:278), and in some aspects, the sequence differs
from the hB7-1 sequence in at least two mutations.
[0413] In another aspect, the invention provides isolated or
recombinant CTLA-4BP polypeptides comprising an amino acid sequence
having at least about 75%, 80%, 85%, 90%, 95%, or more percent
identity to at least one of SEQ ID NOS:263-272, or a subsequence
thereof comprising the ECD, wherein the sequence is not a
naturally-occurring, and the polypeptide has a CTLA-4/CD28 binding
affinity ratio about equal to or greater than the CTLA-4/CD28
binding affinity ratio of hB7-1 or an ability to induce a T cell
proliferation or activation response about equal to or less than
that of hB7-1.
[0414] In yet another aspect, the invention provides isolated or
recombinant polypeptides that each comprise a non
naturally-occurring amino acid sequence encoded by a nucleic acid
comprising a polynucleotide sequence selected from: (a) a
polynucleotide sequence selected from SEQ ID NOS:22-45, 143-173,
253-262, or a complementary polynucleotide sequence thereof; (b) a
polynucleotide sequence encoding a polypeptide selected from SEQ ID
NOS:69-92, 222-247, 263-272, 286-289, or a complementary
polynucleotide sequence thereof; (c) a polynucleotide sequence
which hybridizes under at least stringent or highly stringent
conditions over substantially the entire length of polynucleotide
sequence (a) or (b); (d) a polynucleotide sequence comprising all
or a fragment of (a), (b), or (c), wherein the fragment encodes a
polypeptide having a CTLA-4/CD28 binding affinity ratio about equal
to or greater than that of hB7-1; (e) a polynucleotide sequence
encoding a polypeptide, the polypeptide comprising an amino acid
sequence which is substantially identical over at least about 150,
180, 200, 225, 250 or more contiguous amino acid residues of any
one of SEQ ID NOS:69-92, 222-247, 263-272, 286-289, and (f) a
polynucleotide sequence encoding a polypeptide that has a
CTLA-4/CD28 binding affinity ratio about equal to or greater than
that of hB7-1, which polynucleotide sequence has at least about
70%, 80%, 85%, 90%, 93%, 95%, 96%, 97%, 98%, 99%, or more identity
to at least one polynucleotide sequence of (a), (b), (c), or (d).
Some such polypeptides comprise an amino acid sequence of any one
of SEQ ID NOS:69-92, 222-247, 263-272, and 286-289.
[0415] Such above-described polypeptides have a CTLA-4/CD28 binding
affinity ratio about equal to or greater than the CTLA-4/CD28
binding affinity ratio of human B7-1. Some such polypeptides
inhibit T-cell proliferation. The induced T-cell response may be
less than that of human B7-1.
[0416] In yet another aspect, the invention includes isolated or
recombinant polypeptides that each comprise a sequence according to
the formula:
[0417]
MGHTRRQGTSP-X12-KCPYLKFFQLLV-X25-ACL-X29-HLCSGVIHVT-X40-EVKEVATLSCG-
LNVSVFFLAQTRIHWQKEKKMVLTM
MSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKY-X122-KDAFKR-X129-HLAEVMLSVK-
AD
FPTPSITDFEIPPSNIRRIICS-X164-SGGFPEPHLFWLENGEELNAINTTVSQDPET-X196-LYTVSS-
KLDFNM TANHSFMCLI-X219-YGHLRVNQTFNWNTPKQEHFP-X241-NLLPSWA
ITLISANGIFVICCLTYRFAPRCRERKSNETLRRESVCPV (SEQ ID NO:287), or a
subsequence thereof comprising the extracellular domain, wherein
position X12 is Ser or Pro; position X25 is Leu or Met; position
X29 is Ser or Pro; position X40 is Lys or Arg; position X122 is Glu
or Asp; position X129 is Glu or Lys; position X164 is Thr or Ala;
position X196 is Glu or Gly; position X219 is Lys or Arg; and
position X241 is Asp or Asn. In a preferred embodiment, some such
polypeptides comprise the ECD of SEQ ID NO:288 or SEQ ID NO:289. In
another preferred embodiment, some such polypeptides comprise the
amino acid sequence SEQ ID NO:288 or SEQ ID NO:289. In one aspect,
such polypeptides exhibit at least one of the CTLA-4BP properties
described above, including a CTLA-4/CD28 binding affinity ratio
about equal to or greater than the CTLA-4/CD28 binding affinity
ratio of human B7-1. Some such polypeptides inhibit T-cell
proliferation; for some polypeptides, the induced T-cell response
is less than that induced by hB7-1 in the presence of e.g.,
anti-CD3 Abs or antigen.
[0418] The invention also provides isolated or recombinant
polypeptides that each comprise a subsequence of an amino acid
sequence set forth in any of SEQ ID NOS:69-92, 222-247, 263-272,
and 286-289, wherein the subsequence is the ECD of the amino acid
sequence.
[0419] In addition, the invention provides novel isolated or
recombinant polypeptides corresponding to baboon and orangutan
B7-1. Such polypeptides comprise the sequence SEQ ID NO:93 or SEQ
ID NO:94, or a subsequence thereof, wherein the subsequence
comprises at least one of: the signal sequence, extracellular
domain, transmembrane domain, and the cytoplasmic domain of the
polypeptide.
[0420] Also included are nucleic acid sequences (e.g., DNA and RNA)
that encode all aforementioned CTLA-4BP polypeptides and fragments
thereof having one or more of the properties described above, and
expression vectors comprising such nucleic acid sequences, and
cells transformed with such expression vectors.
[0421] B7-1 and B7-2 Polypeptide Variants
[0422] The invention also provides polypeptide variants of a WT or
mutant B7-1 polypeptide, including, e.g., polypeptide variants of
the hB7-1 polypeptide shown in SEQ ID NO:278 or other parental
primate B7-1 polypeptide described herein (e.g., SEQ ID NOS:93-94,
279-282). Each such variant comprises an amino acid sequence that
differs from the amino acid sequence of the WT or mutant
(reference) B7-1 by at least one amino acid residue. In one aspect,
the polypeptide variant comprises an amino acid sequence that
differs from that of a full-length WT or mutant (reference) B7-1
polypeptide by substitution in said full-length B7-1 polypeptide of
at least one amino acid residue at a position that corresponds to
position 65 of the hB7-1 polypeptide sequence shown in SEQ ID
NO:278. The substituted amino acid residue at this position may
comprise any amino acid residue that differs from that in the
reference sequence. In another aspect, the substituted amino acid
at this position is any amino acid residue other than alanine or an
amino acid residue existing at that position in a known primate
B7-1 polypeptide sequence. In another aspect, the substituted amino
acid at this position is an amino acid residue selected from the
group consisting of histidine (His), arginine (Arg), lysine (Lys),
proline (Pro), phenylalanine (Phe), and tryptophan (Tip).
Polypeptide variants of the invention include amino acid sequences
that differ from the amino acid sequence of a WT or mutant primate
B7-1 polypeptide by at least one amino acid substitution, wherein
the at least one amino acid substitution comprises a substitution
in the amino acid sequence of said primate B7-1 for the amino acid
position that corresponds to position 65 of SEQ ID NO:278 with any
amino acid residue selected from the group of His, Arg, Lys, Pro,
Phe, and/or Trp. Usually, the substituted amino acid is His, and
the amino acid for which His is substituted is Tyr. Polypeptide
variants also include amino acid sequences that differ from the
amino acid sequence of SEQ ID NO:278 by the substitution of the
amino acid residue in SEQ ID NO:278 (e.g., Tyr) at position 65 with
any amino acid residue selected from the group of His, Arg, Lys,
Pro, Phe, and Tip. Preferably, the polypeptide variant comprises an
amino acid sequence that differs from that of SEQ ID NO:278 by at
least one amino acid substitution comprising the substitution of
His for Tyr at position 65 in SEQ ID NO:278 (Tyr65His
substitution).
[0423] The invention also provides polypeptide variants of a
polypeptide fragment or segment of a full-length WT or mutant
(reference) B7-1 polypeptide, including, but not limited to, a
primate B7-1 polypeptide. In this aspect, the polypeptide variant
comprises an amino acid sequence that differs from a first amino
acid sequence, which comprises an amino acid fragment or segment of
a full-length amino acid sequence of a primate B7-1, by at least
one amino acid residue. The amino acid fragment typically comprises
a signal peptide and/or ECD polypeptide or a mature domain of the
primate B7-1 amino acid sequence. Some such polypeptide variants
comprise an amino acid sequence that differs from said first amino
acid sequence comprising a signal peptide and/or ECD or a mature
domain of a primate B7-1 sequence by substitution in said first
amino acid sequence of at least one amino acid residue at a
position that corresponds to position 65 of hB7-1 (SEQ ID NO:278).
The substituted amino acid at this position may comprise any amino
acid residue that differs from that in the first amino acid
sequence. Usually, the substituted amino acid comprises an amino
acid other than alanine or an amino acid residue existing at that
position in a primate B7-1 polypeptide sequence. Preferably, the
substituted amino acid at this position comprises an amino acid
residue selected from the group consisting of His, Arg, Lys, Pro,
Phe, and/or Trp.
[0424] Also included are polypeptide variants comprising amino acid
sequences that differ from a first amino acid sequence, wherein the
first amino acid sequence comprises a signal peptide sequence
and/or ECD polypeptide sequence of a primate B7-1 polypeptide
sequence (including, e.g., hB7-1), and wherein the variant that
differs from said first amino acid sequence by the substitution of
at least one amino acid residue in the first amino acid sequence at
a position corresponding to position 65 of the amino acid sequence
of SEQ ID NO:278. In one such aspect, the substituted amino acid
residue is selected from the group of His, Arg, Lys, Pro, Phe,
and/or Trp. Usually, the polypeptide variant comprises an amino
acid sequence that differs from an amino acid sequence comprising
amino acids 1-243 of SEQ ID NO:278 by the substitution of His for
Tyr at position 65 of SEQ ID NO:278 (Tyr65His substitution).
[0425] B7-1 polypeptide variants of a full-length primate B7-1
polypeptide or polypeptide fragments thereof (e.g., corresponding
to a signal peptide and/or ECD or mature domain of a primate B7-1
as described above) have an altered binding activity compared with
the binding activity of the full-length primate B7-1 polypeptide
sequence (or polypeptide fragment thereof as described above) or an
altered binding affinity ratio compared with the binding affinity
ratio of the full-length primate B7-1 polypeptide sequence (or
polypeptide fragment thereof as described above). Some such
polypeptide variants of a primate B7-1 polypeptide (or fragment
thereof described above) do not bind a CD28-Ig (FIGS. 23A-23B) as
does hB7-1, but they do bind CTLA-4-Ig in a manner that is
substantially identical or equivalent to that of hB7-1, or in a
manner that produces a binding profile substantially identical or
equivalent to that of hB7-1. Some such polypeptide variants have a
CTLA-4/CD28 binding affinity ratio that is about equal to or
greater than the CTLA-4/CD28 binding affinity ratio of a primate
B7-1 (e.g., hB7-1), under the conditions described in FIGS. 23-24.
In addition, some such variants induce a decreased level of T cell
proliferation compared to the level of T cell proliferation induced
by hB7-1 or CD28BP-15 (FIGS. 23A-23B).
[0426] The invention includes a polypeptide variant of a WT or
mutant B7-1 having an altered binding activity or altered binding
affinity ratio compared with the binding activity or binding
affinity ratio of a first B7-1 polypeptide or polypeptide fragment
thereof (e.g., a polypeptide fragment corresponding to a signal
peptide and/or ECD or mature domain of the first B7-1 polypeptide
as described above), wherein the polypeptide variant has an amino
acid sequence that differs from the amino acid sequence of the
first B7-1 polypeptide (or polypeptide fragment thereof) by at
least about 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
98%, or 99% homologous or identical with the amino acid sequence of
the full-length hB7-1 polypeptide sequence (i.e., the second
polypeptide) shown in SEQ ID NO:278 or with the amino acid sequence
of a polypeptide fragment of SEQ ID NO:278, such as, e.g., a
fragment corresponding to a signal peptide and/or ECD or mature
domain (e.g., a fragment comprising amino acid residues 1-243,
35-243, or 35-288 of SEQ ID NO:278, respectively). The difference
between the amino acid sequence of the variant and the amino acid
sequence of the first B7-1 polypeptide (or fragment thereof)
comprises a different amino acid at a position corresponding to
position 65 of the amino acid sequence of SEQ ID NO:278. In one
aspect, the different amino acid is selected from the group of His,
Arg, Lys, Pro, Phe, and/or Trp, and, preferably, comprises His. The
first B7-1 polypeptide may comprise a WT B7-1 or a mutant,
derivative, or conservatively substituted variant of the WT B7-1,
and some such variants induce a decreased level of T cell
proliferation or lack T cell proliferation compared to the level of
T cell proliferation induced by hB7-1.
[0427] The invention provides a polypeptide variant of a WT or
mutant B7-2 polypeptide, including, but not limited to, e.g., a
polypeptide variant of human B7-2 (hB7-2) or other primate B7-2
polypeptide, wherein the variant comprises an amino acid sequence
that differs from the amino acid sequence of a WT or mutant hB7-2
by at least one amino acid residue. The full-length polypeptide and
nucleic acid sequences of a WT (reference) hB7-2 are provided in
GenBank at GenBank Accession Nos. AAA58389 and L25259, respectively
(see Freeman, G. J. et al., (1993) Science 262:909-911). The
full-length polypeptide and nucleic acid sequences of a second WT
(reference) hB7-2 are provided at GenBank Accession Nos. AAA86473
and U17717, respectively (see Azuma, M. et al., (1993) Nature
366:76-79). In one aspect, the polypeptide variant comprises an
amino acid sequence that differs from that of a full-length WT or
mutant B7-2 (or fragment thereof comprising a signal peptide and/or
ECD or mature domain of the full-length B7-2) polypeptide by
substitution in said full-length B7-2 polypeptide (or fragment
thereof) of at least one amino acid residue at an amino acid
position corresponding to: 1) position 65 of the hB7-1 polypeptide
sequence shown in SEQ ID NO:278; 2) position 56 of the B7-2
polypeptide sequence shown at GenBank Acc. No. AAA58389; or 3)
position 50 of the B7-2 polypeptide sequence shown at GenBank Acc.
No. AAA86473. Usually, the substituted amino acid at this position
is an amino acid residue selected from the group consisting of His,
Arg, Lys, Pro, and/or Trp. In some aspect, the substituted amino
acid replaces phenylalanine in B7-2. The B7-2 polypeptide variant
may comprise a modified amino acid sequence comprising the B7-2
amino acid sequence shown at GenBank Acc. No. AAA58389 (or an amino
acid fragment thereof comprising a signal peptide and/or ECD or
mature domain of said B7-2 sequence) that has been modified by a
Phe56His substitution. The B7-2 polypeptide variant may comprise a
modified amino acid sequence comprising the B7-2 amino acid
sequence shown at GenBank Acc. No. AAA86473 (or an amino acid
fragment thereof comprising a signal peptide and/or ECD or mature
domain of said B7-2 sequence) that has been modified by a Phe50His
substitution.
[0428] Some such B7-2 polypeptide variants of a full-length primate
B7-2 polypeptide (or polypeptide fragment thereof, such as, e.g.,
that which corresponds to a signal peptide and/or ECD or mature
domain of a primate B7-2) have an altered binding activity compared
with the binding activity of the full-length (reference) primate
B7-2 polypeptide sequence (or polypeptide fragment thereof) or an
altered binding affinity ratio compared with the binding affinity
ratio of the full-length primate B7-2 polypeptide sequence (or
polypeptide fragment thereof). Some such polypeptide variants of a
primate B7-2 polypeptide (or fragment thereof) bind a CTLA-4
receptor with an equal or greater binding affinity than does the
primate B7-2 polypeptide (or fragment thereof) and/or bind a CD28
receptor with an equal or lesser binding affinity than does the
primate B7-2 (or fragment thereof). Some B7-2 polypeptide variants
have a CTLA-4/CD28 binding affinity ratio that is about equal to or
greater than the CTLA-4/CD28 binding affinity ratio of a primate
B7-2 polypeptide sequence or fragment thereof. Some such variants
induce a decreased level of T cell proliferation compared to the
level of T cell proliferation induced by hB7-2 and/or
CD28BP-15.
[0429] Also included is a polypeptide variant of a WT or mutant
B7-2 having an altered binding activity or altered binding affinity
ratio compared with the binding activity or binding affinity ratio
of a first B7-2 polypeptide or polypeptide fragment thereof (e.g.,
a polypeptide fragment corresponding to a signal peptide and/or ECD
or mature domain of the first B7-2 polypeptide), under the
conditions described in Example IX (see, e.g., FIGS. 23-24),
wherein the B7-2 polypeptide variant has an amino acid sequence
that differs from the amino acid sequence of the first B7-2
polypeptide (or polypeptide fragment thereof) and is at least about
70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%
homologous or identical with the amino acid sequence of the hB7-2
polypeptide sequence (i.e., the second polypeptide) shown at
GenBank Acc. No. AAA58389 or AAA86473, or with the amino acid
sequence of a polypeptide fragment of either of such B7-2 sequence
shown in GenBank. The difference between the amino acid sequence of
the B7-2 polypeptide variant and the amino acid sequence of the
first B7-2 polypeptide (or fragment thereof) comprises a different
amino acid at a position corresponding to: 1) position 65 of the
amino acid sequence of hB7-1 shown in SEQ ID NO:278; 2) position.
56 of the hB7-2 polypeptide sequence at GenBank Acc. No. AAA58389;
or 3) position 50 of the hB7-2 polypeptide sequence at GenBank Acc.
No. AAA86473. The different amino acid may be selected from the
group of His, Arg, Lys, Pro, and/or Trp, and preferably comprises
His. The first B7-2 polypeptide may comprise a WT B7-2 or a mutant,
derivative, or conservatively substituted variant of the WT B7-2.
Some variants induce a decreased level of T cell proliferation
compared to that induced by hB7-2 and/or CD28BP-15.
[0430] Also included are nucleic acid sequences (e.g., DNA and RNA)
that encode all aforementioned B7-1 and B7-2 polypeptide variants
and fragments thereof having one or more of the properties
described above, and expression vectors comprising such nucleic
acid sequences, and cells transformed with such expression vectors.
Degenerate nucleotide sequences of such nucleotide variants are
also a part of the invention. Also included are nucleotide variants
(e.g., DNA or RNA variants) of a nucleic acid sequence encoding a
WT or mutant B7-1 polypeptide, including, but not limited to, e.g.,
a nucleic acid variant of a nucleotide sequence encoding a
(reference) hB7-1 polypeptide (SEQ ID NO:273) or other parental
primate B7-1 described herein (SEQ ID NOS:46-47, 274-277) or a
fragment thereof comprising, e.g., a signal peptide and/or ECD
polypeptide or a mature domain of the (reference) human or primate
B7-1. Each such variant comprises a nucleic acid sequence that
differs from the nucleic acid sequence of a WT or mutant
(reference) B7-1 nucleic acid sequence by at least one nucleic acid
residue. The nucleic acid variant may comprise a nucleic acid
sequence that differs from a first nucleic acid sequence encoding a
full-length WT or mutant B7-1 polypeptide (or polypeptide fragment
thereof) by substitution in said first nucleic acid sequence of at
least one different nucleic acid residue at a position that
corresponds to one of the three nucleic acid residues in the codon
that encodes the amino acid corresponding to the amino acid at
position 65 of the hB7-1 polypeptide of SEQ ID NO:278. The modified
codon usually encodes an amino acid selected from the group of His,
Arg, Lys, Pro, Phe, and/or Trp, and, typically, His. All codons
encoding such amino acids are well known. In another aspect, the
nucleic acid variant comprises a nucleic acid sequence that differs
from a first nucleic acid sequence that encodes a full-length WT or
mutant B7-1 polypeptide (or polypeptide fragment thereof) by at
least one nucleic acid substitution in said first nucleic acid
sequence, wherein said at least one nucleic acid substitution
comprises a substitution of a cytosine (C) for a thymine (T) at
position 193 in SEQ ID NO:273.
[0431] In one aspect, the nucleic acid comprises: (a) a
polynucleotide sequence comprising the polynucleotide sequence of
SEQ ID NO:273 in which the 3 nucleic acid residues TAC at positions
193-195 are replaced by the three nucleic acid residues CAC, or a
complementary polynucleotide sequence thereof; (b) a polynucleotide
sequence encoding a polypeptide of SEQ ID NO:278, in which the
codon comprising 3 nucleotide residues encoding Tyr are replaced by
a codon comprising three nucleotide residues encoding His, or a
complementary polynucleotide sequence thereof; and (c) a
polynucleotide sequence comprising all or a nucleotide fragment of
(a) or (b), wherein the nucleotide fragment encodes a polypeptide
having a CTLA-4/CD28 binding affinity ratio about equal to or
greater than the CTLA-4/CD28 binding affinity ratio of human B7-1
or a polypeptide having an ability to induce a T cell proliferation
response that is less than that induced by human B7-1.
[0432] In addition, the invention includes nucleic acid variants
(e.g., DNA or RNA variants) of a nucleic acid sequence encoding a
WT or mutant B7-2 polypeptide, including, but not limited to, a
nucleic acid variant of the (reference) nucleotide sequence shown
at GenBank Acc. No. AAA86473 and U17717, or a nucleic acid variant
of a nucleotide sequence encoding a (reference) hB7-2 polypeptide
(GenBank Acc. No. AAA58389 or AAA86473) or other primate B7-2
sequence, or a polypeptide fragment thereof comprising, e.g., a
signal peptide and/or ECD polypeptide or a mature domain of the
(reference) human or primate B7-2. Each such variant comprises a
nucleic acid sequence that differs from the nucleic acid sequence
of a WT or mutant (reference) B7-2 nucleic acid sequence by at
least one nucleic acid residue. The nucleic acid variant may
comprise a nucleic acid sequence that differs from a first nucleic
acid sequence encoding a full-length WT or mutant B7-2 polypeptide
(or polypeptide fragment thereof) by substitution in said first
nucleic acid sequence of at least one different nucleic acid
residue at a position that corresponds to one of the three nucleic
acid residues in the codon that encodes the amino acid
corresponding to the amino acid at: 1) position 65 of the hB7-1
polypeptide of SEQ ID NO:278, 2) position 56 of the hB7-2
polypeptide sequence at GenBank Acc. No. AAA58389; or 3) position
50 of the hB7-2 polypeptide sequence at GenBank Acc. No. AAA86473.
The modified codon usually encodes an amino acid selected from the
group of His, Arg, Lys, Pro, and/or Trp, and, typically, His. All
codons encoding such amino acids are well known. Also provided are
nucleic acid sequences (and fragments thereof that encode
polypeptides having at least one of the properties set forth above)
that, but for codon degeneracy, hybridize under at least stringent
or highly stringent conditions to one or more of the B7-1 or B7-2
nucleotide variants (or fragments thereof) described above, and
nucleic acid sequences complementary to those described above.
[0433] Additional Aspects
[0434] The invention also includes a polypeptide comprising an ECD
of an NCSM polypeptide (or B7-1 or B7-2 polypeptide variant) of the
invention with at least one of a signal peptide, transmembrane
domain, and/or cytoplasmic domain. Usually, the transmembrane
domain and/or cytoplasmic domain is from a co-stimulatory molecule,
such as an NCSM polypeptide of the invention or a B7-1 or B7-2
polypeptide. Any isolated or recombinant CD28BP or CTLA-4
polypeptide described above may further comprise at least one of
the following components: a signal sequence, transmembrane domain,
or cytoplasmic domain. Various combinations of such from the
various NCSM polypeptide sequences described herein can be made. In
one aspect, a signal sequence, transmembrane domain or cytoplasmic
domain signal sequence is selected from the signal sequence,
transmembrane domain, or cytoplasmic domain, respectively, set
forth in any of SEQ ID NOS:48-94, 174-252, 263-272, and
283-293.
[0435] A wide variety of signal peptide sequences can be fused to
an ECD of a NCSM polypeptide or a B7-1 or B7-2 polypeptide variant
to generate a polypeptide comprising at least a signal peptide
sequence and an ECD polypeptide. Signal peptides that can be used
include, but are not limited to, the amino acid sequence
corresponding to a signal peptide of a WT B7-1 or B7-2 polypeptide,
including, but not limited to, a mammalian or primate B7-1 or B7-2
polypeptide, and a signal peptide sequence from tissue plasminogen
activator (TPA). The signal peptide sequence facilitates expression
of the ECD polypeptide in vitro and in vivo and is typically
cleaved from the ECD.
[0436] In some embodiments, the signal peptide sequence comprises
about 33, about 34, about 35, or about 36 amino acids. For the NCSM
polypeptide sequences showing in the sequence listing, the signal
peptide is typically about 34 amino acids in length. The ECD of an
NCSM polypeptide, such as a CD28BP or CTLA-4BP molecule, or a B7-1
or B7-2 polypeptide variant of the invention typically begins with
the first amino acid residue following the last amino acid residue
of the signal peptide sequence. The predicted cleavage site of a
signal peptide for any of the NCSM polypeptide sequences (and
nucleic acid sequences encoding such NCSM polypeptides) described
herein can be predicted by methods known to those skilled in the
art; see, e.g., Nielsen et al., Protein Eng'g 10:1-6 (1997),
www.cbs.dtu.dk/services/SignalP/, and
www.cbs.dtu.dk/services/SignalP/bg_prediction.html.
[0437] One of ordinary skill in the art would understand that the
predicted boundary between the signal peptide and ECD of an NCSM
polypeptide (or B7-1 B7-2 polypeptide variant) of the invention can
be determined from this alignment by comparing the ECD sequence of
WT hB7-1 with the sequence of the NCSM molecule of interest. As
shown in FIGS. 2A-2B, e.g., the signal peptide sequence for WT
hB7-1 generally ends with the three amino acid
residues-cysteine-serine-glycine (-CSG). As shown by alignment with
hB7-1, the signal peptide sequence for many CD28BPs of the
invention also ends with the residues (-CSG or -SG) (see; e.g.,
CD28BP-15 (SEQ ID NO:66)). The signal peptide sequence for many
CTLA-4BPs ends the residues-cysteine-serine-glycine (-CSG) (FIGS.
3A-3B).
[0438] The ECD sequence of WT hB7-1 generally begins with the three
amino acid residues valine-isoleucine-histidine-(VIH-). The ECD of
a CTLA-4BP usually begins with the same VIH-sequence, as shown in
the alignment of CTLA-4BP sequences with the hB7-1 sequence (FIGS.
3A-3B). The ECD of an NCSM polypeptide (or B7-1 or B7-2 polypeptide
variant) may begin with a hydrophobic amino acid residue. For
example, in some such aspects, the ECD of a CD28BP begins with
hydrophobic residue. In some aspects, the ECD sequence of a CD28BP
begins with the three amino acid residues
isoleucine-threonine-proline-(ITP-) (see, e.g., CD28BP-15 (SEQ ID
NO:66)). In some embodiments, the ECD of a CD28BP begins with a
proline residue; in some such embodiments, the ECD begins with the
three amino acid residues -PKS. In other embodiments, the ECD of
some CD28BPs begins with residues -IS (see, e.g., SEQ ID NOS: 49,
50, 65 and 191). The ECD sequence of many CTLA-4BPs generally
begins with amino acid residues
valine-isoleucine-histidine-(VIH-).
[0439] An ECD NCSM polypeptide (or B7-1 or B7-2 polypeptide
variant) may be fused to a signal peptide sequence from a WT B7-1
or WT B7-2 polypeptide, such as a mammalian or primate B7-1 or B7-2
polypeptide. Alternatively, an ECD NCSM polypeptide (or B7-1 or
B7-2 polypeptide variant) is fused to an amino acid sequence
corresponding to a signal peptide of any NCSM polypeptide of the
invention, including, e.g., the signal peptide sequence of SEQ ID
NOS:48-94, 174-252, 263-272, and 278-293.
[0440] A nucleic acid sequence encoding an ECD NCSM polypeptide (or
B7-1 or B7-2 polypeptide variant) may be fused to a nucleic acid
sequence encoding a signal peptide. The nucleic acid sequence
encoding the signal peptide comprises the nucleic acid sequence
encoding a signal peptide of a WT B7-1 or WT B7-2 polypeptide, such
as a mammalian or primate B7-1 or B7-2 polypeptide. In another
aspect, a nucleotide sequence encoding an ECD of an NCSM
polypeptide (or of a B7-1 or B7-2 polypeptide variant) is fused to
a nucleic acid sequence encoding a signal peptide sequence, wherein
said nucleic acid sequence comprises a signal peptide coding
nucleotide sequence of any NCSM nucleic acid or WT B7-1 or B7-2,
including, e.g., the signal peptide coding nucleotide sequence of
any of SEQ ID NOS:1-47, 95-173, 253-262, and 273-277. In a
particular embodiment, the invention provides a nucleic acid
sequence comprising encoding a signal peptide and ECD comprising
amino acid residues 1-244 of SEQ ID NO:66. For one such embodiment,
the nucleic acid comprises nucleotide residues 1-732 of SEQ ID
NO:19.
[0441] The predicted boundary between the ECD and TMD in the hB7-1
sequence is between amino acid residues 242 and 243, based on
numbering of the full-length WT hB7-1 sequence (FIG. 2G). The
predicted boundary between the ECD and TMD of an NCSM polypeptide
(or B7-1 or B7-2 polypeptide variant) can be determined by
comparison of the position of the amino acid residues at the
predicted ECD/TM boundary of hB7-1 with amino acid residues at the
corresponding positions in the NCSM polypeptide of interest. In one
embodiment, the predicted ECD/TM boundary of CD28BP-15 (SEQ ID
NO:66) is between amino acid residues 244 and 245, the ECD and TMD
of CD28BP-15 comprise residues 35-244 and 245-268 of SEQ ID NO:66,
respectively. In another embodiment, based on the numbering of
amino acid residues in the full-length hB7-1 sequence, the
predicted ECD/TM boundary of CTLA-4BP 5.times.4-12c (SEQ ID NO:86)
is between amino acid residues 242 and 243, the ECD and TMD of
CTLA-4BP 5.times.4-12c comprise residues 35-242 and 243-263 of SEQ
ID NO:86, respectively.
[0442] Alternatively, the predicted boundary between the ECD and
TMD of an NCSM polypeptide (or B7-1 or B7-2 polypeptide variant
described herein) is determined using a software program known by
those of ordinary skill in the art that identifies one or more
hydrophobic amino acid residues likely to be present at the
beginning of the TMD, after the ECD. The program Vector NTI BioPlot
analysis, version 6.0 Protein Scales via ProScales on ExPASy Server
(Kyte J., Doolittle R. F., J. Mol. Biol. 157:105-132 (1982)) can be
used, e.g., to determine hydropathicity regions of a polypeptide
sequence and predict, e.g., the transmembrane region of an NCSM
polypeptide, B7-1 or B7-2 polypeptide variant of the invention.
With this program, the following parameters can be selected: Amino
acid scale: Hydropathicity; window size: 9; relative weight of the
window edges compared to the window center (in %): 100%; weight
variation model (if the relative weight at the edges is <100%):
linear; and the scale need not be normalized from 0 to 1.
[0443] In one aspect, the predicted ECD/TM boundary of CD28BP-15 is
between amino acid residues 255 and 256, and the ECD and TMD of
CD28BP-15 comprise residues 35-255 and 256-272 of a polypeptide
selected from the group of SEQ ID NOS:48-68, 174-221, 283-285, and
290-293, and preferably SEQ ID NO:66. In another aspect, the TMD
comprises at least about amino acid residues 35-244, 35-243,
35-242, 35-255, 35-254, or 35-253 of a polypeptide selected from
any of SEQ ID NOS:48-68, 174-221, 283-285, and 290-293, and
preferably SEQ ID NO:66. In one aspect, the CD amino acid sequence
comprises a cytoplasmic domain of a polypeptide selected from any
of SEQ ID NOS:48-68, 174-221, 283-285, and 290-293, preferably SEQ
ID NO:66.
[0444] One of skill would recognize, however, that the ECD of a
CD28BP, CTLA-4BP, or B7-1 or B7-2 polypeptide variant may contain
additional (e.g., one, two, or three) amino acid residues or fewer
amino acid residues (e.g., one, two or three residues) at the
N-terminus and/or C-terminus and still maintain equivalent or
comparable properties as of the molecule as described herein, and
that the present invention includes such embodiments. Also included
are polypeptides comprising a subsequence of SEQ ID NOS:49 and 50,
wherein said subsequence corresponds to an ECD (e.g.,
co-stimulatory ECD).
[0445] Any isolated or recombinant CD28BP or CTLA-4BP polypeptide
described above may comprise a soluble extracellular domain of the
respective full-length CD28BP or CTLA-4BP polypeptide or a fragment
(e.g., truncated ECD) or subsequence thereof. Any such CD28BP or
CTLA-4BP polypeptide may comprise a fusion protein comprising a
CD28BP-ECD or CTLA-4BP-ECD or fragment thereof and at least one
additional amino acid sequence, which may comprise at least one Ig
polypeptide. The at least one Ig polypeptide may comprise at least
one human IgG polypeptide comprising an Fc hinge, a CH2 domain, and
a CH3 domain.
[0446] Any isolated or recombinant CD28BP or CTLA-4BP polypeptide
described above may also comprise a polypeptide purification
subsequence. The polypeptide purification subsequence is selected
from, e.g., an epitope tag, a FLAG tag, a polyhistidine sequence,
and a GST fusion.
[0447] In addition, isolated or recombinant CD28BP or CTLA-4BP
polypeptide described above or a B7-1 or B7-2 polypeptide variant
may comprise a modified amino acid. The modified amino acid can be,
e.g., a glycosylated amino acid, a PEGylated amino acid, a
farnesylated amino acid, an acetylated amino acid, a biotinylated
amino acid, an amino acid conjugated to a lipid or sugar moiety,
polymer, and an amino acid conjugated to an organic derivatizing
agent. Methods for modifying one or more amino acids of CD28BP,
CTLA-4BP, and/or B7-1 and B7-2 polypeptide variants, including
methods of glycosylating and pegylating amino acids are known in
the art; additional methods are set forth in PCT Application No.
PCT/DK01/00094 (Publ. No. WO 01/58935), which published on Aug. 16,
2001. The invention also provides a composition comprising at least
one polypeptide of any CD28BP and/or CTLA-4BP polypeptide described
above and an excipient or carrier. In one aspect, the composition
comprises an isolated or recombinant NCSM polypeptide comprising
the amino acid sequence SEQ ID NOS:48-94, 174-252, 263-272, and
283-293, or a fragment thereof and a carrier or excipient. The
CD28BP fragment has a CD28/CTLA-4 binding affinity ratio about
equal to or greater than the CD28/CTLA-4 binding affinity ratio of
human B7-1 and/or an ability to induce a T cell response about
equal to or greater than that induce by hB7-1. The CTLA-4BP
fragment has a CTLA-4/CD28 binding affinity ratio about equal to or
greater than that of h7-1. The composition may be a pharmaceutical
composition including a pharmaceutically acceptable excipient or
carrier. Exemplary and preferred compositions and pharmaceutically
acceptable excipients and carriers are described below.
[0448] Consensus Sequences and Subsequences
[0449] The present invention also includes at least one NCSM
polypeptide consensus sequence derived from a comparison of two or
more NCSM polypeptide sequences described herein. For example, the
present invention includes at least one CD28BP or CTLA-4BP
polypeptide consensus sequences derived from a comparison of,
respectively, two or more CD28BP or CTLA-4BP polypeptide sequences
described herein. A CD28BP polypeptide consensus sequence as used
herein refers to a normaturally-occurring or recombinant
polypeptide that predominantly includes those amino acid residues
that are common to all CD28BP polypeptides of the present invention
described herein (e.g., full-length and ECD polypeptides and
fragments having activities described herein) and that includes, at
one or more of those positions wherein there is no amino acid
common to all subtypes, an amino acid that predominantly occurs at
that position and in no event includes any amino acid residue that
is not extant in that position in at least one CD28BP of the
invention. A CD28BP polypeptide consensus sequence may have at
least one property of a CD28BP polypeptide as described herein
(e.g., CD28/CTLA-4 binding affinity ratio at least about equal to
greater than that of hB7-1; and/or ability to enhance an immune
response, stimulate T cell proliferation or activation).
[0450] A CTLA-4BP polypeptide consensus sequence refers to a
normaturally-occurring or recombinant polypeptide that
predominantly includes those amino acid residues which are common
to all CTLA-4BP polypeptides of the present invention (e.g.,
full-length and ECD polypeptides) and that includes, at one or more
of those positions wherein there is no amino acid common to all
subtypes, an amino acid that predominantly occurs at that position
and in no event includes any amino acid residue that is not extant
in that position in at least one CTLA-4BP of the invention. A
CTLA-4BP consensus polypeptide may have at least one property of a
CTLA-4BP polypeptide as described herein (e.g., CTLA-4BP/CD28
binding affinity ratio at least about equal to greater than that of
hB7-1; suppress an immune response, or inhibit T cell proliferation
or activation).
[0451] An alignment of the amino acid sequence of the full-length
parental WT hB7-1 with each R1 and R2CD28BP amino acid sequence is
shown in FIGS. 2A-2H. An alignment of the amino acid sequence of
the full-length parental WT hB7-1 with each R1 and R2CTLA-4BP amino
acid sequence is shown in FIGS. 3A-3H. Both figures also show the
regions of hB7-1 corresponding to the signal peptide, ECD,
transmembrane domain, cytoplasmic domain, and mature region (see
arrows).) As shown, a number of the CD28BP and CTLA-4BP sequences
include two additional amino acid residues in the putative signal
sequence, as shown by comparison of these recombinant (chimeric)
NCSMs with hB7-1; thus, the ECD for these sequences putatively
begins at amino acid residue 37. Of the 7 parental species used for
recursive sequence recombination, only the bovine amino acid
sequence includes two additional amino acid residues in the
putative signal peptide sequence.
[0452] In one aspect, the invention provides the CD28BP consensus
polypeptide sequence (SEQ ID NO:283) and the CTLA-4BP consensus
polypeptide sequence (SEQ ID NO:286) and respective fragments or
subsequences thereof that have at least one property of a CD28BP or
CTLA-4BP polypeptide as described herein. A subsequence of a CD28BP
or CTLA-4 consensus sequence includes a sequence that substantially
corresponds (via visual inspection of alignment) to each of the
ECD, transmembrane domain, cytoplasmic domain, signal peptide, or
mature region of any respective CD28BP or CTLA-4BP polypeptide
shown in the alignment in FIGS. 2A-2H and 3A-3H.
[0453] The present invention also includes fragments and
subsequences of the other CD28BP and CTLA-4BP amino acid sequences
shown in FIGS. 2A-2H and 3A-H, respectively, and nucleic acids
encoding such fragments and subsequences. Some such CD28BP and
CTLA-4BP amino acid fragments and subsequences have at least one
property similar or equivalent (or improved upon) to a CD28BP or
CTLA-4BP polypeptide, respectively, as described above.
[0454] In particular, the invention includes amino acid fragments
or subsequences of the CD28BP or CTLA-4BP shown in FIGS. 2A-2H and
3A-H, respectively, and nucleic acid sequences encoding such
fragments and subsequences, wherein said fragments or subsequences
comprise at least one of the mature domain, ECD, transmembrane
domain, signal peptide, and/or cytoplasmic domain of the CD28BP or
CTLA-4BP sequences shown in FIGS. 2A-2H and 3A-H. These domains may
be identified by functional analysis, expression pattern, or
comparison by amino acid (or nucleic acid) alignment with a
corresponding domain of a WT B7-1 sequence.
[0455] For example, a hB7-1 polypeptide (or polynucleotide)
sequence is aligned with a fragment or subsequence of the
invention, with amino acid (or nucleic acid) residues being aligned
at equivalent positions. The numbering of amino acid residues (or
nucleic acid residues) in a particular domain, such as the ECD, for
a CD28BP or CTLA-4BP fragment or subsequence is based upon the
numbering of residues in the corresponding CD28BP or CTLA-4BP
polypeptide (or polynucleotide) sequence or, if desired, upon the
amino acid numbering in a parental or WT B7-1 polypeptide (or
polynucleotide) sequence, such as hB7-1. The amino acids comprising
a signal sequence, ECD, mature domain, transmembrane domain, or
cytoplasmic domain of a C28BP or CTLA-4BP polypeptide of the
invention, or polynucleotide encoding same, can be determined by
alignment with a corresponding region of a WT B7-1 (e.g., hB7-1)
polypeptide, or polynucleotide encoding the same; positions
equivalent to those for the WT B7-1 (FIGS. 2A-2H and 3A-3H) can be
determined.
[0456] The invention also provides at least one fragment of an
isolated or recombinant CD28BP polypeptide sequence selected from
at least one of SEQ ID NOS:48-68, 174-221, 283-285, and 289-293,
wherein the fragment binds or specifically binds with a CD28 and/or
CTLA4 receptor and/or induces T cell proliferation or activation in
conjunction with stimulation of a T cell receptor (e.g., by
antigen) as described herein for CD28BP polypeptides, and provided
the fragment itself is not an amino acid fragment known in the art
to have such properties.
[0457] In addition, the invention provides at least one fragment of
an isolated or recombinant CTLA-4BP polypeptide sequence selected
from at least one of SEQ ID NOS:69-92, 222-272, and 286-288,
wherein the fragment binds or specifically binds with a CD28 and/or
CTLA4 receptor and/or inhibits T cell activation or proliferation
as described herein for CTLA-4BP polypeptides, and further provided
the fragment itself is not an amino acid fragment known in the art
to have such properties. Fragments of SEQ ID NOS:93-94 having such
properties as described for either of CTLA-4BP or CD28 polypeptides
are also included.
[0458] Also provided are polypeptide sequences corresponding to at
least one of the following components of any of SEQ ID NOS:48-94,
174-252, 263-272, and/or 283-293: a signal peptide, ECD,
transmembrane domain, cytoplasmic domain, or mature region or any
combination thereof of such components, such as, e.g., a signal
peptide and ECD. A recombinant polypeptide comprising one or more
of any of these individual components from one such sequence fused
to one or more of these individual components at least one
additional sequence is also contemplated in the invention.
[0459] Making Polypeptides
[0460] Recombinant methods for producing and isolating NCSM
polypeptides of the invention are described above. In addition to
recombinant production, the polypeptides may be produced by direct
peptide synthesis using solid-phase techniques (see, e.g., Stewart
et al. (1969) Solid-Phase Peptide Synthesis, WH Freeman Co, San
Francisco; Merrifield J. (1963) J Am Chem Soc 85:2149-2154).
Peptide synthesis may be performed using manual techniques or by
automation. Automated synthesis may be achieved, for example, using
Applied Biosystems 431A Peptide Synthesizer (Perkin Elmer, Foster
City, Calif.) in accordance with the instructions provided by the
manufacturer. For example, subsequences may be chemically
synthesized separately and combined using chemical methods to
provide full-length NCSM polypeptides or fragments thereof.
Alternatively, such sequences may be ordered from any number of
companies which specialize in production of polypeptides. Most
commonly, NCSM polypeptides are produced by expressing coding
nucleic acids and recovering polypeptides, e.g., as described
above.
[0461] Methods for producing the polypeptides of the invention are
also included. One such method comprises introducing into a
population of cells any NCSM nucleic acid described herein, which
is operatively linked to a regulatory sequence effective to produce
the encoded polypeptide, culturing the cells in a culture medium to
produce the polypeptide, and isolating the polypeptide from the
cells or from the culture medium. An amount of nucleic acid
sufficient to facilitate uptake by the cells (transfection) and/or
expression of the NCSM polypeptide is utilized. The culture medium
can be any described herein and in the Examples. The nucleic acid
is introduced into such cells by any delivery method described
herein, including, e.g., injection, gene gun, passive uptake, etc.
The NCSM nucleic acid may be part of a vector, such as a
recombinant expression vector, including a DNA plasmid vector, or
any vector described herein. The nucleic acid or vector comprising
a NCSM nucleic acid may be prepared and formulated as described
herein, above, and in the Examples below. Such a nucleic acid or
expression vector may be introduced into a population of cells of a
mammal in vivo, or selected cells of the mammal (e.g., tumor cells)
may be removed from the mammal and the nucleic acid expression
vector introduced ex vivo into the population of such cells in an
amount sufficient such that uptake and expression of the encoded
polypeptide results. Or, a nucleic acid or vector comprising a NCSM
nucleic acid is produced using cultured cells in vitro. In one
aspect, the method of producing a NCSM polypeptide comprises
introducing into a population of cells a recombinant expression
vector comprising any NCSM nucleic acid described herein in an
amount and formula such that uptake of the vector and expression of
the NCSM polypeptide will result; administering the expression
vector into a mammal by any introduction/delivery format described
herein; and isolating the polypeptide from the mammal or from a
byproduct of the mammal.
[0462] Using Polypeptides
[0463] Antibodies
[0464] In another aspect of the invention, a NCSM polypeptide or
fragments thereof of the invention is used to produce antibodies
which have, e.g., diagnostic, therapeutic, or prophylactic uses,
e.g., related to the activity, distribution, and expression of NCSM
polypeptides and fragments thereof. Antibodies to NCSM polypeptides
or peptide fragments thereof of the invention may be generated by
methods well known in the art. Such antibodies may include, but are
not limited to, polyclonal, monoclonal, chimeric, humanized, single
chain, Fab fragments and fragments produced by a Fab expression
library. Antibodies, e.g., those that block receptor binding, are
especially preferred for therapeutic and/or prophylactic use.
[0465] NCSM polypeptides for antibody induction do not require
biological activity; however, the polypeptides or oligopeptides are
antigenic. Peptides used to induce specific antibodies may have an
amino acid sequence consisting of at least about 10 amino acids,
preferably at least about 15 or 20 amino acids or at least about 25
or 30 amino acids. Short stretches of a NCSM polypeptide may be
fused with another protein, such as keyhole limpet hemocyanin, and
antibody produced against the chimeric molecule.
[0466] Methods of producing polyclonal and monoclonal antibodies
are known to those of skill in the art, and many antibodies are
available. See, e.g., Current Protocols in Immunology, John
Colligan et al., eds., Vols. I-IV (John Wiley & Sons, Inc., NY,
1991 and 2001 Supplement); and Harlow and Lane (1989) Antibodies: A
Laboratory Manual Cold Spring Harbor Press, NY; Stites et al.
(eds.) Basic and Clinical Immunology (4th ed.) Lange Medical
Publications, Los Altos, Calif., and references cited therein; and
Goding (1986) Monoclonal Antibodies: Principles and Practice (2d
ed.) Academic Press, New York, N.Y.; and Kohler and Milstein (1975)
Nature 256:495-497. Other suitable techniques for antibody
preparation include selection of libraries of recombinant
antibodies in phage or similar vectors. See, Huse et al. (1989)
Science 246:1275-1281; and Ward et al. (1989) Nature 341:544-546.
Specific monoclonal and polyclonal antibodies and antisera will
usually bind with a K.sub.D of at least about 0.1 .mu.M, preferably
at least about 0.01 .mu.M or better, and most typically and
preferably, 0.001 .mu.M or better.
[0467] Detailed methods for preparation of chimeric (humanized)
antibodies can be found in U.S. Pat. No. 5,482,856. Additional
details on humanization and other antibody production and
engineering techniques can be found in Borrebaeck (ed.) (1995)
Antibody Engineering, 2.sup.nd Edition Freeman and Company, NY
(Borrebaeck); McCafferty et al. (1996) Antibody Engineering, A
Practical Approach IRL at Oxford Press, Oxford, England
(McCafferty), and Paul (1995) Antibody Engineering Protocols Humana
Press, Towata, N.J. (Paul). In one useful embodiment, this
invention provides for fully humanized antibodies against the NCSM
polypeptides of the invention or fragments thereof. Humanized
antibodies are especially desirable in applications where the
antibodies are used as therapeutics and/or prophylactics in vivo in
human patients. Human antibodies consist of characteristically
human immunoglobulin sequences. The human antibodies of this
invention can be produced in using a wide variety of methods (see,
e.g., Larrick et al., U.S. Pat. No. 5,001,065, and Borrebaeck
McCafferty and Paul, supra, for a review). In one embodiment, the
human antibodies of the present invention are produced initially in
trioma cells. Genes encoding the antibodies are then cloned and
expressed in other cells, such as nonhuman mammalian cells. The
general approach for producing human antibodies by trioma
technology is described by Ostberg et al. (1983), Hybridoma
2:361-367, Ostberg, U.S. Pat. No. 4,634,664, and Engelman et al.,
U.S. Pat. No. 4,634,666. The antibody-producing cell lines obtained
by this method are called triomas because they are descended from
three cells--two human and one mouse. Triomas have been found to
produce antibody more stably than ordinary hybridomas made from
human cells.
[0468] Sequence Variations
[0469] Conservatively Modified Variations
[0470] NCSM polypeptides of the present invention include
conservatively modified variations of the sequences of any of SEQ
ID NOS:48-94, 174-252, 263-272, and 283-293 and fragments thereof.
Such conservatively modified variations comprise substitutions,
additions or deletions that alter, add or delete a single amino
acid or a small percentage of amino acids (typically less than
about 5%, more typically less than about 4%, 2%, or 1%) in any of
SEQ ID NOS:48-94, 174-252, 263-272, and 283-293.
[0471] For example, a conservatively modified variation (e.g., a
deletion) of the 296 amino acid polypeptide identified herein as
SEQ ID NO:48 will have a length of about 282 amino acids,
preferably about 285 amino acids, more preferably about 288 amino
acids, still more preferably about 291 amino acids, and still even
more preferably about 294 amino acids or more, corresponding to a
deletion of less than about 5%, 4%, 3%, 2%, or 1% of the
polypeptide sequence.
[0472] Another example of a conservatively modified variation
(e.g., a "conservatively substituted variation") of the polypeptide
identified herein as SEQ ID NO:48 will contain "conservative
substitutions," according to the six substitution groups set forth
in Table 2 (supra), in up to about 15 residues (i.e., less than
about 5%) of the 296 amino acid polypeptide.
[0473] As an example, if four conservative substitutions were
localized in the region corresponding to amino acids 69-94 of SEQ
ID NO:48, examples of conservatively substituted variations of this
region,
[0474] QKDSK MVLAI LPGKV QVWPE YKNRTI, would include:
[0475] NKDSK MVVAI LPGKV QVWPE YKNKTI and
[0476] QKDAK MVLAI LPGRV QMWPE YKQRTI and the like, where
conservative substitutions are underlined.
[0477] The NCSM polypeptide sequences of the invention or fragments
thereof, including conservatively substituted sequences, can be
present as part of larger polypeptide sequences such as occur upon
the addition of one or more domains for purification of the protein
(e.g., poly-his segments, FLAG tag segments, etc.). These
additional functional domains either have little or no effect on
the activity of the NCSM portion of the protein, or the additional
domains can be removed by post synthesis processing steps such as
by treatment with a protease, inclusion of an intein, or the
like.
Defining NCSM Polypeptides by Immunoreactivity
[0478] A further indication that two nucleic acid sequences or
polypeptides are substantially identical is that the polypeptide
encoded by the first nucleic acid is immunologically cross reactive
with a polypeptide encoded by the second nucleic acid. A
polypeptide is typically substantially identical to a second
polypeptide, e.g., where the two peptides differ only by
conservative substitutions.
[0479] The phrase "specifically (or selectively) binds,"
"specifically (or selectively bound," or "specifically (or
selectively) immunoreactive with," when referring to a polypeptide,
refers to a binding reaction with an antibody which is
determinative of the presence of the polypeptide, or an epitope
from the polypeptide, in the presence of a heterogeneous population
of polypeptides and other biologics. Specific binding between an
antibody or other binding agent and an antigen generally means a
binding affinity of at least about 10.sup.5 to 10.sup.6
M.sup.-1.
[0480] Thus, under designated immunoassay conditions, the specified
antibodies bind to a particular polypeptide and do not bind in a
significant amount to other polypeptides present in the sample. The
antibodies raised against a multivalent antigenic polypeptide will
generally bind to the polypeptides from which one or more of the
epitopes were obtained. Specific binding to an antibody under such
conditions may require an antibody that is selected for its
specificity for a particular polypeptide. A variety of immunoassay
formats may be used to select antibodies specifically
immunoreactive with a particular polypeptide. For example,
solid-phase ELISA immunoassays, Western blots, or
immunohistochemistry are routinely used to select monoclonal
antibodies specifically immunoreactive with a protein. See Harlow
and Lane (1988) Antibodies, A Laboratory Manual, Cold Spring Harbor
Publications, New York (hereinafter "Harlow and Lane"), for a
description of immunoassay formats and conditions that can be used
to determine specific immunoreactivity. Typically, a specific or
selective reaction is at least twice background signal or noise and
more typically 2.5.times.-5.times. or more than 10 to 100 times
background.
[0481] The polypeptides of the invention provide structural
features that can be recognized, e.g., in immunological assays. The
generation of antisera containing antibodies (for at least one
antigen) which specifically binds the polypeptides of the
invention, as well as the polypeptides which are bound by such
antisera, are a feature of the invention. Preferred binding agents,
including antibodies described herein, bind NCSM polypeptides and
fragments thereof with affinities of at least about 10.sup.6 to
10.sup.7 M.sup.-1, and preferably 10.sup.8M.sup.-1 to 10.sup.9
M.sup.-1 or 10.sup.10 M.sup.-1. Conventional hybridoma technology
can be used to produce antibodies having affinities of up to about
10.sup.9 M-1. However, new technologies, including phage display
and transgenic mice, can be used to achieve higher affinities
(e.g., up to at least about 10.sup.12M.sup.-1). In general, a
higher binding affinity is advantageous.
[0482] The invention includes NCSM polypeptides and fragments
thereof that specifically bind to or that are specifically
immunoreactive with an antibody or polyclonal antisera generated
against at least one immunogen comprising at least one amino acid
sequence selected from one or more of SEQ ID NOS:48-94, 174-252,
263-272, and 283-293 or fragments thereof. To eliminate
cross-reactivity with other peptides, the antibody or antisera is
subtracted with polypeptides encoded by sequences such as, e.g.,
those represented at GenBank accession numbers A92749, A92750,
AA983817, AB026121, AB030650, AB030651, AB038153, AF010465,
AF065893, AF065894, AF065895, AF065896, AF079519, AF106824,
AF106825, AF106828, AF106829, AF106830, AF106831, AF106832,
AF106833, AF106834, AF203442, AF203443, AF216747, AF257653,
AH004645, AH008762, AX000904, AX000905, D49843, L12586, L12587,
M27533, M83073, M83074, M83075, M83077, NM005191, S74541, S74540,
S74695, S74696, U05593, U10925, U19833, U19840, U26832, U33063,
U33208, U57755, U88622, X60958, Y08823, and Y09950. Where the
GenBank sequence corresponds to a nucleic acid, a polypeptide
encoded by the nucleic acid is generated and used for
antibody/antisera subtraction purposes. Where the nucleic acid
corresponds to a non-coding sequence, e.g., a pseudo-gene, an amino
acid which corresponds to the reading frame of the nucleic acid is
generated (e.g., synthetically), or is minimally modified, e.g., to
include a start codon, promoter or the like for recombinant
production.
[0483] In one typical format, the immunoassay uses a polyclonal
antiserum which was raised against one or more NCSM polypeptides
comprising one or more of the sequences corresponding to one or
more of SEQ ID NOS:48-94, 174-252, 263-272, and 283-293, or a
substantial subsequence or fragment thereof (i.e., comprising at
least about 30%, 40%, 50%, 60%, 70%, 80%, 90% or more of the amino
acids of the full length sequence provided). The full set of
potential polypeptide immunogens derived from SEQ ID NOS:48-94,
174-252, 263-272, and 283-293 are collectively referred to herein
as "the immunogenic polypeptides." The resulting antisera is
optionally selected to have low cross-reactivity against the
control, e.g., co-stimulatory homologues and any such
cross-reactivity is removed by immunoabsorbtion with one or more of
the control polypeptides, prior to use of the polyclonal antiserum
in the immunoassay. Sequences which are substantially identical to
such sequences can also be used, e.g., which are at least about
60%, 70%, 75%, 80%, 85%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97%, 98%, 99%, 99.5% or more identical, e.g., as determined using
BLAST or the other algorithms described herein and above, e.g.,
using default parameters.
[0484] In another aspect, the invention provides an antibody or
antisera produced by administering a NCSM polypeptide of the
invention to a mammal, which antibody or antisera specifically
binds one or more antigens, the one or more antigens comprising a
polypeptide comprising one or more of the amino acid sequences SEQ
ID NOS:48-94, 174-252, 263-272, and 283-293, which antibody or
antisera does not specifically bind to a polypeptide encoded by one
or more of GenBank Nucleotide Accession Nos: A92749, A92750,
AA983817, AB026121, AB030650, AB030651, AB038153, AF010465,
AF065893, AF065894, AF065895, AF065896, AF079519, AF106824,
AF106825, AF106828, AF106829, AF106830, AF106831, AF106832,
AF106833, AF106834, AF203442, AF203443, AF216747, AF257653,
AH004645, AH008762, AX000904, AX000905, D49843, L12586, L12587,
M27533, M83073, M83074, M83075, M83077, NM005191, S74541, S74540,
S74695, S74696, U05593, U10925, U19833, U19840, U26832, U33063,
U33208, U57755, U88622, X60958, Y08823, and Y09950.
[0485] The antisera comprises the serum of a subject that has been
immunized against at least one antigen. The antiserum can be
monovalent or polyvalent; that is, it can contain antibodies
specific for one or more antigenic determinants, depending on
whether the subject was immunized with one antigen or a mixture of
antigens.
[0486] Also included is an antibody or antisera (comprising one or
more antibodies) which specifically binds a polypeptide comprising
a sequence selected from: SEQ ID NOS:48-94, 174-252, 263-272, and
283-293, wherein the antibody or antisera (comprising antibodies)
does not specifically bind to a polypeptide encoded by one or more
of GenBank Nucleotide Accession Nos. set forth above.
[0487] In order to produce antisera for use in an immunoassay, one
or more of the immunogenic polypeptides is produced and purified as
described herein. For example, recombinant protein may be produced
in a mammalian cell line. An inbred strain of mice (used in this
assay because results are more reproducible due to the virtual
genetic identity of the mice) is immunized with the immunogenic
protein(s) in combination with a standard adjuvant, such as
Freund's adjuvant, and a standard mouse immunization protocol (see
Harlow and Lane, supra, for a standard description of antibody
generation, immunoassay formats and conditions that can be used to
determine specific immunoreactivity). Alternatively, one or more
synthetic or recombinant polypeptides derived from the sequences
disclosed herein is conjugated to a carrier protein and used as an
immunogen.
[0488] Polyclonal antisera are collected and titered against the
immunogenic polypeptide in an immunoassay, for example, a solid
phase immunoassay with one or more of the immunogenic proteins
immobilized on a solid support. Polyclonal antisera with a titer of
10.sup.6 or greater are selected, pooled and subtracted with the
control co-stimulatory polypeptides to produce subtracted pooled
titered polyclonal antisera.
[0489] The subtracted pooled titered polyclonal antisera are tested
for cross reactivity against the control polypeptides. Preferably
at least two of the immunogenic NCSM polypeptides are used in this
determination, preferably in conjunction with at least two of the
control polypeptides, to identify antibodies which are specifically
bound by the immunogenic polypeptide(s).
[0490] In this comparative assay, discriminatory binding conditions
are determined for the subtracted titered polyclonal antisera which
result in at least about a 5-10 fold higher signal to noise ratio
for binding of the titered polyclonal antisera to the immunogenic
NCSM molecules as compared to binding to any control polypeptides.
That is, the stringency of the binding reaction is adjusted by the
addition of non-specific competitors such as albumin or non-fat dry
milk, or by adjusting salt conditions, temperature, or the like.
These binding conditions are used in subsequent assays for
determining whether a test polypeptide is specifically bound by the
pooled subtracted polyclonal antisera. In particular, test
polypeptides which show at least a 2-5.times. higher signal to
noise ratio than the control polypeptides under discriminatory
binding conditions, and at least about a 1/2 signal to noise ratio
as compared to the immunogenic polypeptide(s), share substantial
structural similarity with the immunogenic polypeptides as compared
relative to known B7-1 or related co-stimulatory polypeptides, and
are thus NCSM polypeptides of the invention.
[0491] In another example, immunoassays in the competitive binding
format are used for detection of a test polypeptide. For example,
as noted, cross-reacting antibodies are removed from the pooled
antisera mixture by immunoabsorption with the control polypeptides.
The immunogenic polypeptide(s) are then immobilized to a solid
support which is exposed to the subtracted pooled antisera. Test
proteins are added to the assay to compete for binding to the
pooled subtracted antisera. The ability of the test protein(s) to
compete for binding to the pooled subtracted antisera as compared
to the immobilized protein(s) is compared to the ability of the
immunogenic polypeptide(s) added to the assay to compete for
binding (the immunogenic polypeptides compete effectively with the
immobilized immunogenic polypeptides for binding to the pooled
antisera). The percent cross-reactivity for the test proteins is
calculated, using standard calculations.
[0492] In a parallel assay, the ability of the control proteins to
compete for binding to the pooled subtracted antisera is determined
as compared to the ability of the immunogenic polypeptide(s) to
compete for binding to the antisera. Again, the percent
cross-reactivity for the control polypeptides is calculated, using
standard calculations. Where the percent cross-reactivity is at
least 5-10.times. as high for the test polypeptides, the test
polypeptides are said to specifically bind the pooled subtracted
antisera.
[0493] In general, the immunoabsorbed and pooled antisera can be
used in a competitive binding immunoassay as described herein to
compare any test polypeptide to the immunogenic polypeptide(s). In
order to make this comparison, the two polypeptides are each
assayed at a wide range of concentrations and the amount of each
polypeptide required to inhibit 50% of the binding of the
subtracted antisera to the immobilized protein is determined using
standard techniques. If the amount of the test polypeptide required
is less than twice the amount of the immunogenic polypeptide that
is required, then the test polypeptide is said to specifically bind
to an antibody generated to the immunogenic protein, provided the
amount is at least about 5-10.times. as high as for a control
polypeptide.
[0494] As a final determination of specificity, the pooled antisera
is optionally fully immunoabsorbed with the immunogenic
polypeptide(s) (rather than any control polypeptides) until little
or no binding of the resulting immunogenic polypeptide subtracted
pooled antisera to the immunogenic polypeptide(s) used in the
immunoabsorbtion is detectable. This fully immunoabsorbed antisera
is then tested for reactivity with the test polypeptide. If little
or no reactivity is observed (i.e., no more than 2.times. the
signal to noise ratio observed for binding of the fully
immunoabsorbed antisera to the immunogenic polypeptide), then the
test polypeptide is specifically bound by the antisera elicited by
the immunogenic protein.
Proliferation/Activation and Anti-Proliferation/Inactivation
Properties of NCSM Molecules
[0495] The effect of the NCSM polypeptides and fragments thereof
was examined on T cells as described in the Examples, infra. The
results indicate that compositions comprising a NCSM polypeptide of
the present invention or fragment thereof, or a soluble NSCM-ECD
and NCSM-ECD-Ig, can be used in methods of the invention to induce
or inhibit proliferation and/or activation of T cells, for example,
in conjunction with stimulation of T cell receptor (e.g., by
antigen or anti-CD3 Ab). The ability of a NCSM polypeptide or
fragment thereof to induce or inhibit T cell
proliferation/activation is typically measured against the ability
of wild-type B7-1 (such as, e.g., a human, primate, or cow B7-1) to
induce or inhibit T cell proliferation or activation, e.g., in
conjunction with stimulation of T cell receptor (e.g., by antigen
or anti-CD3 Ab). Similarly, a NCSM polynucleotide that encodes such
a NCSM polypeptide or fragment thereof, or a soluble NSCM-ECD and
NCSM-ECD-Ig, can be used in methods of the invention to induce or
inhibit proliferation and/or activation of T cells by using e.g.,
cells transfected with and expressing or secreting such NCSM
molecules. Here, too, the ability of the expressed or secreted NCSM
peptide molecule to induce or inhibit T cell proliferation and/or
activation is measured in the same manner.
[0496] Inducing or inhibiting of proliferation/activation of T
cells can be performed in vitro (as useful, e.g., in a variety of
proliferation assays or in generation of, e.g., tumor-antigen
specific T cells that can be administered to cancer patients), or
in vivo (as useful, e.g., as a therapeutic and/or
prophylactic).
[0497] CD28BPs and CTLA-4BPs of the invention (and fragments
thereof) and the nucleic acids encoding such CD28BPs and CTLA-4BPs
of the invention (and fragments thereof) are useful in numerous
applications, either when used as gene-based therapeutics/vaccines
or when administered as, e.g., soluble polypeptides, proteins, or
fragments thereof, in the presence or absence of a specific antigen
or mixture of antigens.
[0498] Compositions of the present invention can be used to
prophylactically or therapeutically treat and thereby prevent,
alleviate or ameliorate a variety of conditions where stimulation
of T cell proliferation/activation or inhibition of T cell
proliferation and/or activation would be beneficial to a patient.
Such uses include, but are not limited to, e.g., prophylaxis of
infectious disease, therapeutic and prophylactic treatment of a
variety of chronic infectious diseases, cancers, allergies,
autoimmune diseases, septic shock, prevention and treatment of
graft versus host disease, and the like; and the prevention of
organ transplant rejection and the like.
[0499] The products of the invention can also be used in gene
therapy to reduce immune system recognition of cells expressing a
transgene, thus prolonging the longevity of the expression of the
transgene. Generation of transgenic animals expressing products of
the invention optionally can be used as sources of organs for
humans (e.g., the organs express a CTLA-4BP of the invention which,
on the surface of the organ, down-regulates host T cell responses
thus reducing risk of rejection), etc.
[0500] A desired goal in developing CTLA-4BPs was to create NCSM
molecules that specifically signal through CTLA-4 and thus can,
e.g., induce tolerance, suppress activated T cells, and induce
regulatory T cells. Other routes of modifying immune responses
(e.g., nonspecific immunosuppression with cyclosporin A, blockage
of APC-T cell interaction with CTLA-4-Ig or with Anti-B7 monoclonal
antibodies (mAbs), or blockage of APC-B-cell activation with
Anti-CD40L Abs) have drawbacks (e.g., they induce general
immunosuppression or they inhibit T cell growth, etc.) and do not
achieve the goal of CTLA-4BPs of the invention, namely induction of
tolerance of antigen-specific T cells. An example (but not
limiting) application of CTLA-4BP in gene therapy is illustrated
by, e.g., using a vector encoding a CTLA-4BP and a transgene
(alternatively the CTLA-4BP and transgene can be on separate
plasmids) which is introduced into a target cell and whose gene
products are presented on the same cell surface. The transgene (in
context with MCH) interacts with the T cell receptor (TCR) on the T
cell while the CTLA-4BP interacts with CTLA-4 on the T cell, all of
which leads to an inhibition or reduction of T cell response and a
prolonged expression of the transgene.
[0501] The products (i.e., polypeptides, nucleic acids, and
fragments thereof) of the present invention can be useful in such
things as vaccine adjuvants (e.g., for genetic vaccines, protein
vaccines, attenuated or killed viral vaccines). For example, the
nucleic acids of CD28BPs and CTLA-4BPs (or fragments thereof) can
be components of genetic vaccines and gene therapy vectors (e.g.,
DNA vaccines, viral vectors), or they can be expressed in cells of
interest (e.g., tumor cells, dendritic cells) which then can be
used as vaccines or therapeutics. Additionally, products of the
invention can be transfected into tumor cells which, after being
rendered unable to proliferate (e.g., by irradiation) then can be
used as cell-based vaccines. Alternatively, such transfected cells
are lysed and the resulting lysate used as a vaccine. CD28BPs can
serve as T cell adjuvants and administered in either as nucleic
acids (including, e.g., vectors comprising nucleic acids encoding
CD28BPs) or as proteins. Use of a wild-type human B7 gene as a
component in a DNA vaccine along with an antigen(s) of interest
results in both positive and negative signals to T cells since
wild-type human B7 can bind with both CD28 and CTLA-4 on T cells.
However, DNA vaccines encoding a product of the invention, e.g.,
CD28BP or fragments thereof, can selectively tailor the T cell
response, e.g., CD28BP in a DNA vaccine will result in positive
signals to T cells (e.g., signals to induce T cell
proliferation/activation). For example, a CD28BP is optionally used
in a treatment vaccine for melanoma (in the context of TRP-1, TRP-2
and/or tyrosinase). An illustrative, but not limiting example is:
intradermal injection of DNA (antigen) followed by subcutaneous
injection of protein (CD28BP) with time periods of, e.g., 2 weeks
between treatments for, e.g., 4 cycles. The CD28BP presents low
risk of cross-reactivity with wild-type in treatment of life
threatening melanoma. Fragments of the CD28BP encoding nucleic acid
are optionally used in the procedure. As another illustrative, but
not limiting example, CTLA-4BPs of the invention or fragments
thereof are optionally used in conjunction with MBP (myelin basic
protein) in a treatment vaccine for multiple sclerosis which is
given, e.g., as an intramuscular injection every 3 weeks for 6
months or as the condition warrants.
[0502] A gene-based vaccine utilizing a NCSM (e.g., a CD28BP or
CTLA-4BP) or fragments thereof is optionally comprised of a plasmid
encoding both the antigen(s) of interest and the NCSM (e.g., either
CD28BP or CTLA-4BP) (alternatively, the antigen(s) of interest is
on a separate plasmid from the NCSM gene (e.g., the CD28BP or
CTLA-4BP gene(s)). The products of the genes of the plasmid(s) are
expressed on the surface of, e.g., an APC. Interaction occurs
between the antigen of interest (in the context of MHC) and CD28BP
(both on the, e.g., APC) with, respectively, the T cell receptor
and CD28 on the T cell which leads to T cell
proliferation/activation. Optionally, interaction occurs between
the antigen of interest (in the context of MHC) and CTLA-4BP (both
on the, e.g., APC) with, respectively, the TCR and CTLA-4 on the T
cell which leads to T cell anergy/tolerance.
[0503] Another example of CD28BP application is illustrated by
inducing specific T cell activation through use of a plasmid
encoding a CD28BP or fragments thereof. The plasmid is transfected
into a tumor cell (e.g., ex vivo), which is, e.g., irradiated to
stop proliferation, and is then used as a vaccine (or optionally a
tumor cell lysate, e.g., Melacine.RTM. is used). The tumor antigens
are presented (in context with MHC) to the T cell and interact with
the TCR. Additionally, the CD28BP expressed on the cell along with
the tumor antigen is presented to the T cell and interacts with
CD28, thus leading to T cell activation.
Soluble NCSM Polypeptides and Nucleic Acids
[0504] The present invention provides soluble NCSM polypeptides (or
fragments thereof) and nucleic acids encoding them. Selected
regions (e.g., the ECD, truncated extracellular domain, secreted
subsequence of a NCSM polypeptide) or fragments thereof are
provided in both polypeptide and nucleic acid format. These soluble
molecules are suited for use as prophylactics, therapeutics, and/or
diagnostic tools and can be targeted or designed for specific
actions and a variety of applications as described herein.
[0505] Soluble B7-1 proteins and fragments have been described and
characterized. See, e.g., U.S. Pat. No. 6,071,716. Standard
procedures for expressing soluble B7-1 proteins and fragments
thereof, recovering such molecules from culture media, screening
and characterizing such molecules for e.g., T cell proliferation or
lymphokine production, as described in, e.g., U.S. Pat. No.
6,071,716, can be used and applied to soluble NCSM polypeptides and
fragments thereof of the present invention.
[0506] A "soluble" NCSM polypeptide, such as a soluble CD28BP or
CTLA-4BP of the invention, means a polypeptide comprising an amino
acid sequence that corresponds to that of the extracellular domain
(ECD) of a NCSM polypeptide or a fragment of said ECD (e.g., a
truncated ECD). The soluble NCSM polypeptide typically does not
include the amino acid sequences corresponding to the full-length
cytoplasmic or transmembrane domain. The amino acid sequence
corresponding to the signal peptide or leader, or a fragment
thereof, may or may not be included in the soluble NCSM
polypeptide. A soluble NSCM polypeptide may further comprise an
immunoglobulin (Ig) or Ig fragment, such as, e.g., an Fc portion of
an Ig (e.g., IgG) linked to an NCSM ECD or fragment thereof. In one
aspect, a soluble NCSM polypeptide comprises a fusion protein
comprising an NCSM ECD or fragment thereof and an Ig or fragment
thereof, including, e.g., an Fc portion. The Ig may be from a
human, primate, or other mammal. A soluble NCSM polypeptide is
freely secreted into the medium surrounding a host cell when it is
recombinantly produced in the host cell. Nucleic acids encoding any
such soluble NCSM polypeptides (or fragments thereof) described
above and hereinafter are also an aspect of the invention.
[0507] For each NCSM molecule of the invention, a putative ECD
polypeptide sequence (or nucleotide sequence encoding said
polypeptide sequence) may be determined by alignment of the NCSM
ECD polypeptide sequence (or nucleotide sequence encoding same)
with an analogous ECD polypeptide sequence (or nucleotide sequence
encoding same) of human B7-1 or other mammalian B7-1 (e.g.,
primate). The putative amino acid and nucleic acid sequences
corresponding to the respective putative signal peptide,
transmembrane domain, cytoplasmic domain, and mature region can
also be similarly determined for each NCSM molecule of the
invention. It is readily understood by one of ordinary in the art
that each of these domains/regions of the NCSM polypeptides and
polynucleotides determined by such alignment comparison is putative
and thus may vary in length by one or more amino acids or nucleic
acids, respectively. One of skill can readily confirm such
domains/regions by other analyses known in the art, including those
used to determine corresponding domains/regions in hB7-1.
[0508] The soluble NCSM molecules can show preferential binding to
either CTLA-4 or CD28 receptor. Soluble CD28BPs (and fragments
thereof) can bind preferentially with CD28 and CTLA-4BPs (and
fragments thereof) can bind preferentially with CTLA-4 as compared
to the binding of soluble wild-type (WT) human B7-1 to CD28 and
CTLA-4. For example, when an antigen is presented (in context with
MHC) on the surface of a cell where it interacts with the TCR on a
T cell, a soluble CD28BP optionally can interact simultaneously
with the T cell through the CD28 molecule, thus leading to T cell
proliferation/activation. Conversely, when an antigen is presented
(in context with MHC) on the surface of a cell where it interacts
with the TCR on a T cell while simultaneously a soluble CTLA-4BP
also interacts with the T cell (through the CTLA-4 molecule), T
cell anergy/tolerance can result.
[0509] Optionally, and additionally, the soluble NCSM molecules of
the invention, or fragments thereof, can be used as agonists or
antagonists of the respective T cell receptors. The soluble CD28BP
molecules can optionally act as agonists by stimulating T cell
proliferation/activation by binding with CD28 or the soluble CD28BP
molecules can optionally act as antagonists by binding with CD28
without stimulating T cell proliferation/activation. Furthermore,
soluble CTLA-4BP molecules can optionally act as agonists by
binding with CTLA-4 and inhibiting T cell proliferation/activation
(e.g., not stimulating T cells) or the soluble CTLA-4BP molecules
can act as antagonists by binding with CTLA-4 and not inhibiting T
cell proliferation/activation.
[0510] These soluble NCSM molecules can be delivered to a subject
by a variety of formats. For example, the soluble NCSM molecules
can be delivered as polypeptides or proteins (or fragments thereof)
or as nucleic acids (or fragments thereof) encoding such
polypeptides or proteins.
[0511] In one aspect, the invention includes an isolated or
recombinant nucleic acid comprising a polynucleotide sequence
selected from: (a) a polynucleotide sequence selected from SEQ ID
NOS:1-21 and 95-142, or a complementary polynucleotide sequence
thereof; (b) a polynucleotide sequence encoding a polypeptide
selected from SEQ ID NOS:48-68, 174-221, 283-285, and 290-293, or a
complementary polynucleotide sequence thereof; (c) a polynucleotide
sequence which, but for the degeneracy of the genetic code,
hybridizes under at least stringent conditions over substantially
the entire length of polynucleotide sequence (a) or (b); and (d) a
polynucleotide sequence comprising all or a nucleotide fragment of
(a), (b), or (c), wherein the nucleotide fragment encodes a soluble
polypeptide having a CD28/CTLA-4 binding affinity ratio about equal
to or greater than the CD28/CTLA-4 binding affinity ratio of human
B7-1 and/or a soluble polypeptide that, in the presence of
activated T cells, down-regulates or inhibits a T cell
proliferation response compared to the response of soluble hB7-1
(e.g., hB7-1-ECD or hB7-1-ECD-Ig)--that is causes a lower T cell
proliferation response that does soluble hB7-1. The present
invention also provides fusion proteins, including soluble fusion
proteins, comprising a fusion of a protein (such as a CD28BP,
CTLA-4BP, B7-1 polypeptide variant, or B7-2 polypeptide variant of
the current invention) or fragments thereof with an immunoglobulin
(Ig) or portion of an immunoglobulin. The resulting protein-Ig
fusions (or immunoadhesions or Fc-fusion proteins) can show
improved pharmacokinetics, such as longer half-life in vivo, and/or
increased expression. Such fusion proteins can also simplify
purification and augment isotype effector functions for specific
proteins. See, e.g., Ashkenazi, A. et al. (1997) Curr Op in Immunol
9(2):195-200 for a review of the uses and applications of 1
g-protein fusions, which is incorporated by reference in its
entirety for all purposes. Examples of Ig protein fusion
components, including peptide linkers and Fc regions, that are can
be fused to NCSM molecules of the invention, including full-length
NCSM molecules and at least one component thereof (e.g., signal
peptide, ECD, TM, and/or CD of such NCSM), and B7-1 and B7-2
variants of the invention, are provided in Ashkenazi et al. For
example, the invention includes a nucleic acid sequence encoding
the signal peptide and ECD of an NCSM described herein can be fused
to a nucleotide sequence encoding a linker peptide and/or Fc region
and a fusion protein encoded therefrom. The NCSMs of the invention
can be fused to many variations of, e.g., immunoglobulins and the
NCSM fusions are not limited by, e.g., the type of Ig molecule
used. In addition to full length NCSM molecules, fragments of NCSM
molecules (e.g., the extracellular domain (ECD) or fragments of the
ECD) can be fused to Ig molecules. Various sequences, e.g., peptide
linker sequences, proteolytic cleavage sites (such as, e.g., Factor
Xa cleavage site), etc., can also be incorporated into the NCSM-Ig
fusion protein. In some embodiments, the small peptide linker
forming the in-frame translational coupling between an NCSM ECD (or
hB7-1) and the IgG1 Fc comprised the amino acid sequence
valine-threonine (VT) or glycine-valine-threonine (GVT), depending
upon the nucleotide sequence compatibility of the 3' codon of the
NCSM ECD (see, e.g., FIG. 14B and Example IV below). The length and
nature of the amino acid sequence of the peptide linker positioned
between the Fc region and ECD is believed important for providing
proper contact between the Fc regions of NCSM-ECD monomers or
NCSM-ECD-Ig fusion monomers and facilitating or enhancing
multimerization of such NCSM-ECD or NCSM-ECD-Ig monomers. In one
aspect, e.g., the linker sequence may comprise from at least about
one to at least about 11 amino acids; the specific amino acid may
include residues GVT, as described above, or other amino acid
residues having characteristics that facilitate aggregation of
NCSM-ECD or NCSM-ECD-Ig fusion monomers. In another aspect, the
invention provides multimers of NCSM-ECD and NCSM-ECD-Ig fusion
monomers. Nucleotide sequences encoding all such NCSM-ECCD
monomers, and NCSM-Ig and NCSM-ECD-Ig fusion proteins are another
aspect of the invention.
[0512] A fusion protein comprising a NCSM polypeptide or fragment
thereof fused to human IgG Fc domain is an aspect of the present
invention, see, e.g., Example 4, infra. The NCSM-Ig fusion proteins
have the benefits of being soluble (thus, e.g., expanding their
uses as prophylactics and therapeutics) and being stabilized by the
Ig portion of the fusion. The soluble NCSM polypeptide-IgG fusion
proteins of the present invention are suited for use as
prophylactics and/or therapeutics since they can be targeted or
tailored for specific actions and a variety of applications.
[0513] The NCSM-Ig fusion proteins and polypeptides of the
invention can be used for, e.g., similar applications (including,
e.g., therapeutic, prophylactic, and diagnostic applications
described herein) as the NCSM proteins and polypeptides of the
invention (as indicated throughout). These Ig-fusion proteins of
the invention also show preferential binding to either CTLA-4 or
CD28. CD28BP-Ig fusions (and fragments thereof) bind preferentially
with CD28 and CTLA-4BP-Ig fusions (and fragments thereof) bind
preferentially with CTLA-4 as compared to the binding of human B7-1
to CD28 and CTLA-4. For example, when an antigen is presented (in
context with MHC) on the surface of a cell where it interacts with
the TCR on a T cell, a soluble CD28BP-Ig fusion protein optionally
can interact simultaneously with the T cell through the CD28
molecule, thus leading to T cell proliferation/activation.
Conversely, when an antigen is presented (in context with MHC) on
the surface of a cell where it interacts with the TCR on a T cell
while simultaneously a soluble CTLA-4BP-Ig fusion protein also
interacts with the T cell (through the CTLA-4 molecule), T cell
anergy/tolerance can result.
[0514] Optionally, the soluble NCSM-Ig fusion proteins (e.g.,
CD28BP-Ig and CTLA-4BP-Ig), or fragments thereof, or proteins (or
protein fusions) based on the NCSMs (e.g., CD28BPs or CTLA-4BPs)
are used as agonists or antagonists of the respective receptors on
the T cell. For example, CD28BP or CD28BP-Ig fusions acting as
agonists by stimulating T cell proliferation/activation through
binding to CD28 or as antagonists by binding to CD28 without
inducing T cell proliferation/activation. Alternatively, CTLA-4 or
CTLA-4BP-Ig fusions acting as agonists by inhibiting (or not
stimulating) T cell proliferation/activation through binding to
CTLA-4 or as antagonists by binding to CTLA-4 without inhibiting T
cell proliferation/activation.
[0515] In one aspect, the IgG Fc hinge, CH2 and CH3 domains are
modified or evolved using a recursive sequence recombination
method, such as DNA shuffling, or another diversity generation
method to produce a library of recombinant IgG Fc hinge CH2 and CH3
domains from a group of selected parental IgG Fc sequences, and
then screening the library by appropriate screening procedures to
identity a chimeric IgG Fc comprising at least one recombined Fc
constant domain exhibiting reduced binding to at least one Fey
receptor--e.g., Fc.gamma.RII and Fc.gamma.RIII. Specifically, the
library of recombinant (shuffled) IgG molecules are digested with
BsteII and EcoRI, and ligated into a BstEII--EcoRI digested plasmid
comprising at least one NCSM nucleic acid sequence to produce a
non- or reduced-Fc.gamma.R binding NCSM-Ig fusion protein
molecules. Supernatants from 293 cells transiently transfected with
such expression plasmids are incubated with 293 cells expressing
either Fc.gamma.RII or Fc.gamma.RIII, and binding affinity of the
expressed recombinant clones is determined by FACS analysis methods
using a NCSM-specific mAb conjugated with FITC. IgG Fc variants
exhibiting reduced or no binding to one or more Fc.gamma.R are used
as fusion partners with one or more specific NCSMs of the present
invention and are useful in the applications described above.
[0516] In addition to fusion with Ig sequences or regions, the
fusion proteins of the invention can include any protein sequence
in combination with the NCSM molecule, or fragment thereof. The
invention also includes the nucleic acid sequence encoding any such
fusion polypeptide. For example, a NCSM polypeptide of the
invention or fragments thereof can be fused with polypeptide
sequences which, e.g., enable sorting of the fusion proteins, e.g.,
fluorescence indicator molecules. Alternatively, the NCSM
polypeptides or fragments thereof can be incorporated into fusion
proteins that enable, e.g., targeting of the fusions to specific
cell types or cells.
[0517] The fusion proteins of the present invention can be
delivered to a subject by a variety of formats, including, e.g., as
a polypeptide or protein, or as a nucleic acid encoding such
polypeptide or protein as described in detail herein.
Therapeutic and Prophylactic Treatment Methods
[0518] The NCSM polynucleotides and polypeptides of the invention
have properties that are of beneficial use in a variety of
application, including, e.g., protein- and DNA-based vaccinations
and in prophylactic and therapeutic disease treatments where
manipulation of an immune response (e.g., inducing or suppressing),
T cell activation or proliferation, and/or cytokine production is
desirable.
[0519] In one aspect, the present invention includes methods of
therapeutically or prophylactically treating a disease or disorder
by administering, in vivo or ex vivo, one or more nucleic acids or
fragments thereof or polypeptides or fragments thereof of the
invention described above (or compositions, vectors, or transduced
cells comprising a pharmaceutically acceptable excipient and one or
more such nucleic acids or polypeptides) to a subject or to a
population of cells of the subject, including, e.g., a mammal,
including, e.g., a human, primate, monkey, orangutan, baboon,
mouse, pig, cow, cat, goat, rabbit, rat, guinea pig, hamster,
horse, sheep; or a non-mammalian vertebrate such as a bird (e.g., a
chicken or duck) or a fish, or invertebrate.
[0520] In one aspect of the invention, in ex vivo methods, one or
more cells or a population of cells of interest of the subject
(e.g., tumor cells, tumor tissue sample, organ cells, blood cells,
cells of the skin, lung, heart, muscle, brain, mucosae, liver,
intestine, spleen, stomach, lymphatic system, cervix, vagina,
prostate, mouth, tongue, etc.) are obtained or removed from the
subject and contacted with an amount of a polypeptide of the
invention that is effective in prophylactically or therapeutically
treating a disease, disorder, or other condition. The contacted
cells are then returned or delivered to the subject to the site
from which they were obtained or to another site (e.g., including
those defined above) of interest in the subject to be treated. If
desired, the contacted cells may be grafted onto a tissue, organ,
or system site (including all described above) of interest in the
subject using standard and well-known grafting techniques or, e.g.,
delivered to the blood or lymph system using standard delivery or
transfusion techniques.
[0521] The CD28BP polypeptides of the invention and/or nucleic
acids of the invention can be used in methods to activate T cells
ex vivo by, e.g., obtaining or removing T cells from a subject
(e.g., mammal, such as a human) and administering to the subject a
sufficient amount of one or more polypeptides of the invention to
activate effectively the T cells (or administering a sufficient
amount of one or more nucleic acids of the invention with a
promoter such that uptake of the nucleic acid into one or more such
T cells occurs and sufficient expression of the nucleic acid
results to produce an amount of a polypeptide effective to activate
said T cells. The activated T cells are then returned to the
subject. T cells can be obtained or isolated from the subject by a
variety of methods known in the art, including, e.g., by deriving T
cells from peripheral blood of the subject or obtaining T cells
directly from a tumor of the subject.
[0522] The CD28BP polypeptides of the invention and/or nucleic
acids of the invention can be used to activate T cells ex vivo by,
e.g., obtaining or removing cells (e.g., antigen presenting cells)
from a subject (e.g., a mammal, such as a human) and administering
to the removed cells a sufficient amount of one or more
polypeptides of the invention to activate effectively T cells once
the removed cells are returned to the subject (or administering a
sufficient amount of one or more nucleic acids of the invention
with a promoter such that uptake of the nucleic acid into one or
more removed cells occurs and sufficient expression of the nucleic
acid results to produce an amount of a polypeptide effective to
activate T cells upon return of the removed cells to the
subject).
[0523] The CTLA-4BP polypeptides of the invention and/or nucleic
acids encoding polypeptides of the invention are useful in
inhibiting T cell response (e.g., inhibiting T cell activation or
proliferation) in a subject to which at least one at the
polypeptides or nucleic acids of the invention is administered. In
another aspect, the CTLA-4BP polypeptides of the invention and/or
nucleic acids encoding polypeptides of the invention modulate T
cell activation without completely inhibiting T cell proliferation
following administration. In another aspect, the CTLA-4BP
polypeptides of the invention and/or nucleic acids encoding
polypeptides of the invention modulate T cell activation in a
subject following administration, but do not induce proliferation
of purified T cells activated by soluble monoclonal antibodies
(e.g., anti-CD3 monoclonal antibodies that bind T cell receptor
(TCR) on a T cell).
[0524] The invention also provides in vivo methods in which at
least one cell or a population of cells of interest of the subject
are contacted directly or indirectly with a sufficient amount of a
NCSM polypeptide of the invention effective in prophylactically or
therapeutically treating a disease, disorder, or other condition.
In direct (e.g., local) contact or administration formats, the
polypeptide is typically administered or transferred directly
(e.g., locally) to the cells to be treated or to the tissue site of
interest (e.g., tumor cells, tumor tissue sample, organ cells,
blood cells, cells of the skin, lung, heart, muscle, brain,
mucosae, liver, intestine, spleen, stomach, lymphatic system,
cervix, vagina, prostate, mouth, tongue, etc.) by any of a variety
of formats, including topical administration, injection (e.g.,
using a needle or syringe), or vaccine or gene gun delivery, or
pushing into a tissue, organ, or skin site.
[0525] The NCSM molecule can be delivered by a variety of routes,
e.g., intramuscularly, intradermally, subdermally, subcutaneously,
orally, intraperitoneally, intrathecally, intravenously, mucosally,
systemically, parenterally, via inhalation, or placed within a
cavity of the body (including, e.g., during surgery), or by
inhalation or vaginal or rectal administration.
[0526] In in vivo and ex vivo indirect contact/administration
formats, the NCSM polypeptide is typically administered or
transferred indirectly to the cells to be treated or to the tissue
site of interest, including those described above (such as, e.g.,
skin cells, organ systems, lymphatic system, or blood cell system,
etc.), by contacting or administering the NCSM polypeptide of the
invention directly to one or more cells or population of cells from
which treatment can be facilitated. For example, tumor cells within
the body of the subject can be treated by contacting cells of the
blood or lymphatic system, skin, or an organ with a sufficient
amount of the polypeptide such that delivery of the polypeptide to
the site of interest (e.g., tissue, organ, or cells of interest or
blood or lymphatic system within the body) occurs and effective
prophylactic or therapeutic treatment results. Such contact,
administration, or transfer is typically made by using one or more
of the routes or modes of administration described above.
[0527] In another aspect, the invention provides ex vivo methods in
which one or more cells of interest or a population of cells of
interest of the subject (e.g., tumor cells, tumor tissue sample,
organ cells, blood cells, cells of the skin, lung, heart, muscle,
brain, mucosae, liver, intestine, spleen, stomach, lymphatic
system, cervix, vagina, prostate, mouth, tongue, etc.) are obtained
or removed from the subject and transformed by contacting said one
or more cells or population of cells with a polynucleotide
construct comprising a target nucleic acid sequence of the
invention or fragments thereof, that encodes a biologically active
polypeptide of interest (e.g., a polypeptide of the invention) that
is effective in prophylactically or therapeutically treating the
disease, disorder, or other condition. The one or more cells or
population of cells is contacted with a sufficient amount of the
polynucleotide construct and a promoter controlling expression of
said nucleic acid sequence such that uptake of the polynucleotide
construct (and promoter) into the cell(s) occurs and sufficient
expression of the target nucleic acid sequence of the invention
results to produce an amount of the biologically active polypeptide
effective to prophylactically or therapeutically treat the disease,
disorder, or condition. The polynucleotide construct may include a
promoter sequence (e.g., WT, recombinant, or chimeric CMV promoter
sequence) that controls expression of a NCSM nucleic acid sequence
of the invention and/or, if desired, one or more additional
nucleotide sequences encoding at least one of another NCSM
polypeptide, a cytokine, an adjuvant, or a co-stimulatory molecule,
or other polypeptide of interest.
[0528] Following transfection, the transformed cells are returned,
delivered, or transferred to the subject to the tissue site or
system from which they were obtained or to another site (e.g.,
tumor cells, tumor tissue sample, organ cells, blood cells, cells
of the skin, lung, heart, muscle, brain, mucosae, liver, intestine,
spleen, stomach, lymphatic system, cervix, vagina, prostate, mouth,
tongue, etc.) to be treated in the subject. If desired, the cells
may be grafted onto a tissue, skin, organ, or body system of
interest in the subject using standard and well-known grafting
techniques or delivered to the blood or lymphatic system using
standard delivery or transfusion techniques. Such delivery,
administration, or transfer of transformed cells is typically made
by using one or more of the routes or modes of administration
described above. Expression of the target nucleic acid occurs
naturally or can be induced (as described in greater detail below)
and an amount of the encoded polypeptide is expressed sufficient
and effective to treat the disease or condition at the site or
tissue system.
[0529] In another aspect, the invention provides in vivo methods in
which one or more cells of interest or a population of cells of the
subject (e.g., including those cells and cell(s) systems and
subjects described above) are transformed in the body of the
subject by contacting the cell(s) or population of cells with (or
administering or transferring to the cell(s) or population of cells
using one or more of the routes or modes of administration
described above) a polynucleotide construct comprising a nucleic
acid sequence of the invention that encodes a biologically active
polypeptide of interest (e.g., a polypeptide of the invention) that
is effective in prophylactically or therapeutically treating the
disease, disorder, or other condition.
[0530] The polynucleotide construct can be directly administered or
transferred to cell(s) exhibiting or having the disease or disorder
(e.g., by direct contact using one or more of the routes or modes
of administration described above). Alternatively, the
polynucleotide construct can be indirectly administered or
transferred to cell(s) exhibiting or having the disease or disorder
by first directly contacting non-diseased cell(s) or other diseased
cells using one or more of the routes or modes of administration
described above with a sufficient amount of the polynucleotide
construct comprising the nucleic acid sequence encoding the
biologically active polypeptide, and a promoter controlling
expression of the nucleic acid sequence, such that uptake of the
polynucleotide construct (and promoter) into the cell(s) occurs and
sufficient expression of the nucleic acid sequence of the invention
results to produce an amount of the biologically active polypeptide
effective to prophylactically or therapeutically treat the disease
or disorder, and whereby the polynucleotide construct or the
resulting expressed polypeptide is transferred naturally or
automatically from the initial delivery site, system, tissue or
organ of the subject's body to the diseased site, tissue, organ or
system of the subject's body (e.g., via the blood or lymphatic
system). Expression of the target nucleic acid occurs naturally or
can be induced (as described in greater detail below) such that an
amount of the encoded polypeptide expressed is sufficient and
effective to treat the disease or condition at the site or tissue
system. The polynucleotide construct may include a promoter
sequence (e.g., wild-type, recombinant or chimeric CMV promoter
sequence) that controls expression of the nucleic acid sequence
and/or, if desired, one or more additional nucleotide sequences
encoding at least one of another NCSM polypeptide, a cytokine, an
adjuvant, or a co-stimulatory molecule, or other polypeptide of
interest.
[0531] In one aspect, tumor cells of a patient are transfected with
a DNA plasmid vector encoding a NCSM polypeptide of interest (e.g.,
CD28BP) to facilitate an improved immune response, (e.g., enhanced
T cell response or increased antibody titer). The tumor cells may
be removed from the patient and transfected ex vivo, and then
re-delivered to the patient, preferably at the tumor site.
Alternatively, the tumor cells of a tumor are transfected in vivo,
by delivering a DNA plasmid encoding a NCSM polypeptide of interest
(e.g., CD28BP). In either case, the immune response can be measured
by measuring T cell proliferation using methods described herein or
antibody levels using standard protocols. In another aspect, a DNA
plasmid encoding a soluble NCSM-ECD or soluble NCSM-ECD-Ig is
administered to a patient by any means described herein, including
systemically, subcutaneously, i.m., intradermally, etc. and the
like, via a needle or gene gun or other introduction mechanism
described herein; if desired, the plasmid is introduced directly
into cells of a tumor or tumor-related cells of the patient.
[0532] In yet another aspect, a soluble NCSM-ECD polypeptide or
soluble NCSM-ECD-Ig fusion protein is administered to a patient by
any means described herein, including systemically, subcutaneously,
i.m., intradermally, etc. and the like, via a needle or gene gun or
other introduction mechanism described herein; if desired, the
polypeptide or fusion protein is introduced directly into cells of
a tumor or tumor-related cells of the patient. The soluble NCSM can
be administered in conjunction with an antigen (either
simultaneously or consecutively) as part of a vaccine protocol.
[0533] The NCSM polypeptides of the invention and the NCSM
polynucleotides encoding them are also useful as vaccine adjuvants
in vaccine applications as discussed herein and for diagnostic
purposes, as for in vitro applications for testing and diagnosing
such diseases. For example, a polynucleotide encoding a NCSM of the
invention, (e.g., CD28BP) or an NCSM polypeptide (or fragment
thereof, e.g., ECD, or fusion protein) can serve as an adjuvant to
a DNA vaccine or protein vaccine by enhancing immune-stimulating
properties of the antigen encoded by the DNA vaccine or the protein
antigen itself, respectively. In any of these formats, the NCSM
molecule that results may non-specifically enhance the immune
response of the subject to an antigen.
[0534] In each of the in vivo and ex vivo treatment methods as
described above, a composition comprising an excipient and the NCSM
polypeptide or nucleic acid of the invention can be administered or
delivered. In one aspect, a composition comprising a
pharmaceutically acceptable excipient (e.g., PBS) and a NCSM
polypeptide or nucleic acid of the invention is administered or
delivered to the subject as described above in an amount effective
to treat the disease or disorder.
[0535] In another aspect, in each in vivo and ex vivo treatment
method described above, the amount of polynucleotide administered
to the cell(s) or subject can be an amount sufficient that uptake
of said polynucleotide into one or more cells of the subject occurs
and sufficient expression of said nucleic acid sequence results to
produce an amount of a biologically active NCSM polypeptide (e.g.,
ECD) effective to enhance an immune response in the subject,
including an immune response induced by an immunogen (e.g.,
antigen). In another aspect, for each such method, the amount of
polypeptide administered to cell(s) or subject can be an amount
sufficient to enhance an immune response in the subject, including
that induced by an immunogen (e.g., antigen).
[0536] In yet another aspect, in each in vivo and ex vivo treatment
method described above, the amount of polynucleotide administered
to the cell(s) or subject can be an amount sufficient that uptake
of said polynucleotide into one or more cells of the subject occurs
and sufficient expression of said nucleic acid sequence results to
produce an amount of a biologically active polypeptide effective to
produce a tolerance or anergy response in the subject. In another
aspect, for each such method, the amount of polypeptide
administered to cell(s) or subject can be an amount sufficient to
produce a tolerance or anergy response in the subject.
[0537] The amount of DNA plasmid for use in such methods where
administration is by injection is from about 50 micrograms (ug) to
5 mg, usually about 100 ug to about 2.5 mg, typically about 500 ug
to 2 mg or about 800 ug to about 1.5 mg, and often about 1 mg. The
amount of DNA plasmid for use in these methods where administration
is via a gene gun, e.g., is from about 100 to 1000 times less;
thus, for each range given above for DNA plasmid administration via
injection, the range for DNA plasmid administration via gene gun is
about 100 to 1000 times less. For example, for gene gun delivery,
the amount of DNA plasmid corresponding to the first range above is
from about 50.times.10.sup.-8 g to 5.times.10.sup.-5 g (100 times
less) or from about 50.times.10.sup.-9 to about 5.times.10.sup.-6
g. DNA plasmid amounts can be readily adjusted by those of ordinary
skill in the art based upon responses in animal models obtained
using the DNA plasmid vector encoding WT hB7-1 and/or antigen or
based upon known DNA vaccination studies using plasmid vectors
encoding a mammalian B7-1, such as WT hB7-1. Such amounts of DNA
plasmid can be used, if desired, in the method in Example VI.
[0538] In yet another aspect, in an in vivo or in vivo treatment
method in which a polynucleotide construct (or composition
comprising a polynucleotide construct) is used to deliver a
physiologically active polypeptide to a subject, the expression of
the polynucleotide construct can be induced by using an inducible
on- and off-gene expression system. Examples of such on- and
off-gene expression systems include the Tet-On.TM. Gene Expression
System and Tet-Off.TM. Gene Expression System (see, e.g., Clontech
Catalog 2000, pg. 110-111 for a detailed description of each such
system), respectively. Other controllable or inducible on- and
off-gene expression systems are known to those of ordinary skill in
the art. With such system, expression of the target nucleic of the
polynucleotide construct can be regulated in a precise, reversible,
and quantitative manner. Gene expression of the target nucleic acid
can be induced, for example, after the stable transfected cells
containing the polynucleotide construct comprising the target
nucleic acid are delivered or transferred to or made to contact the
tissue site, organ or system of interest. Such systems are of
particular benefit in treatment methods and formats in which it is
advantageous to delay or precisely control expression of the target
nucleic acid (e.g., to allow time for completion of surgery and/or
healing following surgery; to allow time for the polynucleotide
construct comprising the target nucleic acid to reach the site,
cells, system, or tissue to be treated; to allow time for the graft
containing cells transformed with the construct to become
incorporated into the tissue or organ onto or into which it has
been spliced or attached, etc.).
[0539] The present invention also provides a therapeutic method of
activating or enhancing a T cell response in a subject suffering
from a cancer, such as, e.g., where the subject has a tumor. The
method comprises administering to the subject a composition that
comprises a nucleotide sequence that encodes a soluble NCSM
polypeptide and an excipient, wherein the NCSM polypeptide is
expressed by the tumor cells or the tumor-related cells, and the T
cell response is activated or enhanced against the tumor. The
composition may be a pharmaceutical composition, and the excipient
may be a pharmaceutically acceptable excipient. The pharmaceutical
composition may comprise a nucleotide sequence encoding a soluble
NCSM polypeptide (or fragment thereof having at least one NCSM
property) and a pharmaceutically acceptable excipient. Such
nucleotide sequence may be incorporated in a vector and may be
operably linked to a promoter to facilitate expression.
[0540] In one embodiment, the composition comprising a nucleotide
sequence encoding a soluble NCSM polypeptide (or fragment thereof
having at least one NCSM property) and an excipient is administered
to the subject by i.d., i.m. or, e.g., direct injection or via gene
gun or other vaccine delivery device. The composition may be
introduced or administered by a variety of routes, including,
direct administration to the tumor or tumor site, if known, or
administration systemically to the subject by direct injection or
gene gun or the like. A sufficient amount of the composition is
delivered such that transfection of the subject's tumor cells with
the NCSM-polypeptide-encoding nucleotide sequence occurs and a T
cell response or activation results. As described above, a DNA
plasmid expression vector comprising the nucleotide sequence may be
delivered as "naked" DNA or may be formulated with other components
(e.g., calcium phosphate, lipids, etc.) to facilitate transfection.
Exemplary amounts of the total DNA (e.g., in milligrams) (for the
NCSM polynucleotide and vector) suggested for such treatment are
described herein and in the Examples below. The amount of DNA
plasmid may be a therapeutically effective amount to inhibit
further growth of the tumor or kill the tumor. One of skill in the
art can also determine a therapeutically effective DNA plasmid
vector amounts based on known clinical studies to treat cancers
using gene therapy or DNA vaccination methods and WT hB7-1 and
mammalian models.
[0541] In another aspect, tumor cells are obtained from the subject
(or alternatively allogeneic tumor cells are used). The tumor cells
are transfected using techniques described herein) with a
sufficient amount of an expression vector, such as e.g., a pMaxVax
vector, described in the Example V below, that comprises a NCSM
polynucleotide encoding a NCSM polypeptide (full-length) or soluble
NCSM-ECD polypeptide (or NCSM-ECD-Ig fusion protein) such that
expression results, and in the case of soluble polypeptides, the
soluble polypeptides are secreted.
[0542] Genetic Vectors
[0543] Gene therapy and genetic vaccine vectors are useful for
treating and/or preventing various diseases and other conditions.
The following discussion focuses on the on the use of vectors
because gene therapy and genetic vaccine method typically employ
vectors, but persons of skill in the art appreciate that the
nucleic acids of the invention can, depending on the particular
application, be employed in the absence of vector sequences.
Accordingly, references in the following discussion to vectors
should be understood as also relating to nucleic acids of the
invention that lack vector sequences. The invention includes
vectors comprising one or more NCSM nucleic acids of the invention,
including nucleic acids encoding B7-1 and B7-2 polypeptide variants
as described herein, including, e.g., variants of human, primate,
and bovine B7-1 and B7-2.
[0544] Vectors can be delivered to a subject to induce an immune
response or other therapeutic or prophylactic response. Suitable
subjects include, but are not limited to, a mammal, including,
e.g., a human, primate, monkey, orangutan, baboon, mouse, pig, cow,
cat, goat, rabbit, rat, guinea pig, hamster, horse, sheep; or a
non-mammalian vertebrate such as a bird (e.g., a chicken or duck)
or a fish, or invertebrate.
[0545] Vectors can be delivered in vivo by administration to an
individual patient, typically by local (direct) administration or
by systemic administration (e.g., intravenous, intraperitoneal,
intramuscular, subdermal, intracranial, anal, vaginal, oral,
mucosal, inhalation, systemic, parenteral, buccal route or they can
be inhaled) or they can be administered by topical application.
Alternatively, vectors can be delivered to cells ex vivo, such as
cells explanted from an individual patient (e.g., lymphocytes, bone
marrow aspirates, tissue biopsy) or universal donor hematopoietic
stem cells, followed by reimplantation of the cells into a patient,
usually after selection for cells which have incorporated the
vector.
[0546] In local (direct) administration formats, the nucleic acid
or vector is typically administered or transferred directly to the
cells to be treated or to the tissue site of interest (e.g., tumor
cells, tumor tissue sample, organ cells, blood cells, cells of the
skin, lung, heart, muscle, brain, mucosae, liver, intestine,
spleen, stomach, lymphatic system, cervix, vagina, prostate, mouth,
tongue, etc.) by any of a variety of formats, including topical
administration, injection (e.g., by using a needle or syringe), or
vaccine or gene gun delivery, pushing into a tissue, organ, or skin
site. For standard gene gun administration, the vector or nucleic
acid of interest is precipitated onto the surface of microscopic
metal beads. The microprojectiles are accelerated with a shock wave
or expanding helium gas, and penetrate tissues to a depth of
several cell layers. For example, the Accel.TM. Gene Delivery
Device manufactured by Agacetus, Inc. Middleton Wis. is suitable
for use in this embodiment. The nucleic acid or vector can be
delivered, for example, intramuscularly, intradermally,
subdermally, subcutaneously, orally, intraperitoneally,
intrathecally, intravenously, mucosally, systemically,
parenterally, via inhalation, or placed within a cavity of the body
(including, e.g., during surgery), or by inhalation or vaginal or
rectal administration.
[0547] In in vivo indirect contact/administration formats, the
nucleic acid or vector is typically administered or transferred
indirectly to the cells to be treated or to the tissue site of
interest, including those described above (such as, e.g., skin
cells, organ systems, lymphatic system, or blood cell system,
etc.), by contacting or administering the nucleic acid or vector of
the invention directly to one or more cells or population of cells
from which treatment can be facilitated. For example, tumor cells
within the body of the subject can be treated by contacting cells
of the blood or lymphatic system, skin, or an organ with a
sufficient amount of the polypeptide such that delivery of the
nucleic acid or vector to the site of interest (e.g., tissue,
organ, or cells of interest or blood or lymphatic system within the
body) occurs and effective prophylactic or therapeutic treatment
results. Such contact, administration, or transfer is typically
made by using one or more of the routes or modes of administration
described above.
[0548] A large number of delivery methods are well known to those
of skill in the art. Such methods include, for example
liposome-based gene delivery (Debs and Zhu (1993) WO 93/24640;
Mannino and Gould-Fogerite (1988) BioTechniques 6(7):682-691; Rose
U.S. Pat. No. 5,279,833; Brigham (1991) WO 91/06309; and Feigner et
al. (1987) Proc. Natl Acad. Sci. USA 84:7413-7414), as well as use
of viral vectors (e.g., adenoviral (see, e.g., Berns et al. (1995)
Ann. NY Acad. Sci. 772:95-104; Ali et al. (1994) Gene Ther.
1:367-384; and Haddada et al. (1995) Curr. Top. Microbiol. Immunol.
199 (Pt 3):297-306 for review), papillomaviral, retroviral (see,
e.g., Buchscher et al. (1992) J. Virol. 66(5) 2731-2739; Johann et
al. (1992) J. Virol. 66 (5):1635-1640 (1992); Sommerfelt et al.,
(1990) Virol. 176:58-59; Wilson et al. (1989) J. Virol.
63:2374-2378; Miller et al., J. Virol. 65:2220-2224 (1991);
Wong-Staal et al., PCT/US94/05700, and Rosenburg and Fauci (1993)
in Fundamental Immunology, Third Edition Paul (ed) Raven Press,
Ltd., New York and the references therein, and Yu et al., Gene
Therapy (1994) supra.), and adeno-associated viral vectors (see,
West et al. (1987) Virology 160:38-47; Carter et al. (1989) U.S.
Pat. No. 4,797,368; Carter et al. WO 93/24641 (1993); Kotin (1994)
Human Gene Therapy 5:793-801; Muzyczka (1994) J. Clin. Invst.
94:1351 and Samulski (supra) for an overview of AAV vectors; see
also, Lebkowski, U.S. Pat. No. 5,173,414; Tratschin et al. (1985)
Mol. Cell. Biol. 5(11):3251-3260; Tratschin, et al. (1984) Mol.
Cell. Biol., 4:2072-2081; Hermonat and Muzyczka (1984) Proc. Natl.
Acad. Sci. USA, 81:6466-6470; McLaughlin et al. (1988) and Samulski
et al. (1989) J. Virol., 63:03822-3828), and the like.
[0549] "Naked" DNA and/or RNA that comprises a genetic vaccine can
also be introduced directly into a tissue, such as muscle, by
injection using a needle or other similar device. See, e.g., U.S.
Pat. No. 5,580,859. Other methods such as "biolistic" or
particle-mediated transformation (see, e.g., Sanford et al., U.S.
Pat. No. 4,945,050; U.S. Pat. No. 5,036,006) are also suitable for
introduction of genetic vaccines into cells of a mammal according
to the invention. These methods are useful not only for in vivo
introduction of DNA into a subject, such as a mammal, but also for
ex vivo modification of cells for reintroduction into a mammal. DNA
is conveniently introduced directly into the cells of a mammal or
other subject using, e.g., injection, such as via a needle, or a
"gene gun." As for other methods of delivering genetic vaccines, if
necessary, vaccine administration is repeated in order to maintain
the desired level of immunomodulation, such as the level or
response of T cell activation or T cell proliferation, or antibody
titer level. Alternatively, nucleotides can be impressed into the
skin of the subject.
[0550] Gene therapy and genetic vaccine vectors (e.g., DNA,
plasmids, expression vectors, adenoviruses, liposomes,
papillomaviruses, retroviruses, etc.) comprising at least one NCSM
sequence can be administered directly to the subject (usually a
mammal) for transduction of cells in vivo or ex vivo. The vectors
can be formulated as pharmaceutical compositions for administration
in any suitable manner, including parenteral (e.g., subcutaneous,
intramuscular, intradermal, or intravenous), inhalation, mucosal,
topical, oral, rectal, vaginal, intrathecal, buccal (e.g.,
sublingual), or local administration, such as by aerosol or
transdermally, for immunotherapeutic or other prophylactic and/or
therapeutic treatment. Pretreatment of skin, for example, by use of
hair-removing agents, may be useful in transdermal delivery.
Suitable methods of administering such packaged nucleic acids are
available and well known to those of skill in the art, and,
although more than one route can be used to administer a particular
composition, a particular route can often provide a more immediate
and more effective reaction than another route.
[0551] Further, the vectors of this invention comprising at least
one nucleotide sequence encoding at least one NCSM (and, if
desired, further comprising a nucleotide sequence encoding antigen
or other co-stimulatory molecule co-expressed on the same vector)
can be used to prophylactically or therapeutically treat or
supplement such treatment of other immunological disorders and
diseases or enhance protection against disorders, diseases, and
antigens (including WT and recombinant antigens), e.g., in protein
vaccines and DNA vaccines, including, but not limited to, e.g.,
allergy/asthma, neurological, organ transplantation (e.g., graft
versus host disease, and autoimmune diseases), malignant diseases,
chronic infectious diseases, including, but not limited to, e.g.,
viral infectious diseases, such as those associated with, but not
limited to, e.g., alpha viruses, hepatitis viruses, e.g., hepatitis
B virus (HBV), herpes simplex virus (HSV), hepatitis C virus (HCV),
HIV, human papilloma virus (HPV), malaria, Venezuelan equine
encephalitis (VEE), Western equine encephalitis (WEE), Japanese
encephalitis virus, Eastern equine encephalitis, and the like, and
bacterial infectious diseases, such as, e.g., but not limited to,
e.g., Lyme disease, tuberculosis, and chlamydia infections; and
other diseases and disorders described herein.
[0552] If desired, a separate vector comprising a nucleotide
sequence encoding an antigen or other co-stimulatory molecule can
be delivered simultaneously with a vector comprising a NCSM
sequence of the invention.
[0553] Compositions and Formulations
[0554] The present invention also includes compositions of any NSCM
nucleic acid or NCSM polypeptide of the invention, including B7-1
and B7-2 variant nucleic acids and polypeptide variants, including,
e.g., nucleic acid variants and polypeptide variants of human,
primate, and bovine B7-1 and B7-2. The invention also includes
compositions comprising one or more vectors or cells (or a
population of cells) comprising any such polypeptide or nucleic
acid of the invention. In one aspect, the invention provides
therapeutic and/or prophylactic compositions comprising at least
one NCSM polypeptide (or fragment thereof) or nucleic acid (or
fragment thereof) of the invention, or vectors, transduced cells,
or vaccines comprising at least one NCSM nucleic acid or
polypeptide (or fragment) of the invention. Such compositions
optionally are tested in appropriate in vitro and in vivo animal
models of disease, to confirm efficacy, tissue metabolism, and to
estimate dosages, according to methods well known in the art. In
particular, dosages for therapeutic and prophylactic methods for
treating or preventing a disease or condition can be determined by
activity comparison of the NCSM molecules to other known
therapeutics using similar compositions in a relevant assay and
mammalian model, including as described below.
[0555] Administration optionally is by any of the routes normally
used for introducing a molecule into ultimate contact with blood or
tissue cells. See, supra. The NCSM polypeptides and
polynucleotides, and vectors, cells, and compositions comprising
such molecules, are administered in any suitable manner, preferably
with pharmaceutically acceptable carriers. Suitable methods of
administering such NCSM molecules, in the context of the present
invention, to a patient are available, and, although more than one
route can be used to administer a particular composition, a
particular route can often provide a more immediate and more
effective reaction than another route. Preferred routes are readily
ascertained by those of skill in the art.
[0556] Compositions comprising cells expressing at least one full
length form of a NCSM polypeptide or a fragment thereof (ECD) are
also a feature of the invention. Such cells may also express one or
more antigens specific for the intended application (e.g., cancer
antigen). Such cells are readily prepared as described herein by
transfection with DNA plasmid vector encoding at least one of the
NCSM polypeptide and/or antigen. Separate vectors each encoding a
NCSM polypeptide and antigen may be used to transfect the cells, or
a bicistronic vector encoding both the NCSM polypeptide and antigen
can be used. Compositions of such cells may be pharmaceutically
compositions further comprising a pharmaceutically acceptable
carrier or excipient.
[0557] Pharmaceutical compositions of the invention can, but need
not, include a pharmaceutically acceptable carrier.
Pharmaceutically acceptable carriers are determined in part by the
particular composition being administered, as well as by the
particular method used to administer the composition. Accordingly,
there are a wide variety of suitable formulations of pharmaceutical
compositions of the present invention. A variety of aqueous
carriers can be used, e.g., buffered saline, such as PBS, and the
like. These solutions are sterile and generally free of undesirable
matter. These compositions may be sterilized by conventional, well
known sterilization techniques. The compositions may contain
pharmaceutically acceptable auxiliary substances as required to
approximate physiological conditions such as pH adjusting and
buffering agents, toxicity adjusting agents and the like, for
example, sodium acetate, sodium chloride, potassium chloride,
calcium chloride, sodium lactate and the like. The concentration of
gene therapy or genetic vaccine vector in these formulations can
vary widely, and will be selected primarily based on fluid volumes,
viscosities, body weight and the like in accordance with the
particular mode of administration selected and the patient's
needs.
[0558] Compositions comprising NCSM polypeptides and
polynucleotides, and vectors, cells, and other formulations
comprising these and other components of the invention, can be
administered by a number of routes including, but not limited to
oral, intranasal, intravenous, intraperitoneal, intramuscular,
transdermal, subcutaneous, intradermal, topical, systemic, mucosal,
inhalation, parenteral, sublingual, vaginal, or rectal means.
Polypeptide and nucleic acid compositions can also be administered
via liposomes. Such administration routes and appropriate
formulations are generally known to those of skill in the art.
[0559] The NCSM polypeptide or polynucleotide or fragment thereof,
or vector comprising a NCSM nucleic acid, alone or in combination
with other suitable components, can also be made into aerosol
formulations (e.g., they can be "nebulized") to be administered via
inhalation. Aerosol formulations can be placed into pressurized
acceptable propellants, such as dichlorodifluoromethane, propane,
nitrogen, and the like.
[0560] Formulations suitable for oral administration can consist of
(a) liquid solutions, such as an effective amount of the packaged
nucleic acid suspended in diluents, such as water, saline or PEG
400; (b) capsules, sachets or tablets, each containing a
predetermined amount of the active ingredient, as liquids, solids,
granules or gelatin; (c) suspensions in an appropriate liquid; and
(d) suitable emulsions. Tablet forms can include one or more of
lactose, sucrose, mannitol, sorbitol, calcium phosphates, corn
starch, potato starch, tragacanth, microcrystalline cellulose,
acacia, gelatin, colloidal silicon dioxide, croscarmellose sodium,
talc, magnesium stearate, stearic acid, and other excipients,
colorants, fillers, binders, diluents, buffering agents, moistening
agents, preservatives, flavoring agents, dyes, disintegrating
agents, and pharmaceutically compatible carriers. Lozenge forms can
comprise the active ingredient in a flavor, usually sucrose and
acacia or tragacanth, as well as pastilles comprising the active
ingredient in an inert base, such as gelatin and glycerin or
sucrose and acacia emulsions, gels, and the like containing, in
addition to the active ingredient, carriers known in the art. It is
recognized that the gene therapy vectors and genetic vaccines, when
administered orally, must be protected from digestion. This is
typically accomplished either by complexing the vector with a
composition to render it resistant to acidic and enzymatic
hydrolysis or by packaging the vector in an appropriately resistant
carrier such as a liposome. Means of protecting vectors from
digestion are well known in the art. The pharmaceutical
compositions can be encapsulated, e.g., in liposomes, or in a
formulation that provides for slow release of the active
ingredient.
[0561] The packaged nucleic acids, alone or in combination with
other suitable components, can be made into aerosol formulations
(e.g., they can be "nebulized") to be administered via inhalation.
Aerosol formulations can be placed into pressurized acceptable
propellants, such as dichlorodifluoromethane, propane, nitrogen,
and the like.
[0562] Suitable formulations for rectal administration include, for
example, suppositories, which consist of the packaged nucleic acid
with a suppository base. Suitable suppository bases include natural
or synthetic triglycerides or paraffin hydrocarbons. In addition,
it is also possible to use gelatin rectal capsules which consist of
a combination of the packaged nucleic acid with a base, including,
for example, liquid triglycerides, polyethylene glycols, and
paraffin hydrocarbons.
[0563] Formulations suitable for parenteral administration, such
as, for example, by intraarticular (in the joints), intravenous,
intramuscular, intradermal, subdermal, intraperitoneal, and
subcutaneous routes, include aqueous and non-aqueous, isotonic
sterile injection solutions, which can contain antioxidants,
buffers, bacteriostats, and solutes that render the formulation
isotonic with the blood of the intended recipient, and aqueous and
non-aqueous sterile suspensions that can include suspending agents,
solubilizers, thickening agents, stabilizers, and preservatives. In
the practice of this invention, compositions can be administered,
for example, by intravenous infusion, orally, mucosally, topically,
intraperitoneally, intravesically or intrathecally. The
formulations of packaged nucleic acids or polypeptides of the
invention can be presented in unit-dose or multi-dose sealed
containers, such as ampules and vials.
[0564] Parenteral administration and intravenous administration are
preferred methods of administration. In particular, any routes of
administration already in use for existing co-stimulatory
therapeutics and prophylactic treatment protocols, including those
currently employed with e.g., mammalian B7-1 polynucleotides and
polypeptides, such as hB7-1, along with pharmaceutical compositions
and formulations in current use, are preferred routes of
administration and formulation for the NCSM polynucleotides or
polypeptides (and fragments thereof).
[0565] Injection solutions and suspensions can be prepared from
sterile powders, granules, and tablets of the kind previously
described. Cells transduced by the packaged nucleic acid can also
be administered intravenously or parenterally.
[0566] Cells transduced with the NCSM nucleic acids as described
herein in the context of ex vivo or in vivo therapy can also be
administered intravenously or parenterally. It will be appreciated
that the delivery of cells to patients is routine, e.g., delivery
of cells to the blood via intravenous, intramuscular, or
intraperitoneal administration or other common route.
[0567] The dose administered to a patient, in the context of the
present invention is sufficient to effect a beneficial effect, such
as an altered immune response or other therapeutic and/or
prophylactic response in the patient over time, or to, e.g.,
inhibit infection by a pathogen, depending on the application. The
dose will be determined by the efficacy of the particular nucleic
acid, polypeptide, vector, composition or formulation, transduced
cell, cell type, and/or the activity of the NCSM polypeptide and/or
polynucleotide included therein or employed, and the condition of
the patient, as well as the body weight, surface area, or vascular
surface area, of the patient to be treated. The size of the dose
also will be determined by the existence, nature, and extent of any
adverse side-effects that accompany the administration of any such
particular polypeptide, nucleic acid, vector, formulation,
composition, transduced cell, cell type, or the like in a
particular patient. Dosages to be used for therapeutic or
prophylactic treatment of a particular disease or disorder can be
determined by one of skill by comparison to those dosages used for
existing therapeutic or prophylactic treatment protocols for the
same disease or disorder.
[0568] Injection solutions and suspensions can be prepared from
sterile powders, granules, and tablets of the kind previously
described. Cells transduced by the packaged nucleic acid can also
be administered intravenously or parenterally.
[0569] In determining the effective amount of the vector, cell
type, composition, or formulation to be administered to a subject
for the treatment or prophylaxis of the medical condition or
disease state (e.g., cancers or viral diseases), a physician
evaluates the subject for, e.g., circulating plasma levels,
vector/cell/formulation/NCSM molecule toxicities, progression of
the disease or condition, and the production of anti-vector/NCSM
polypeptide antibodies, and depending on the subject other factors
that would be known to one of skill in the art.
[0570] In one aspect, for example, in determining the effective
amount of the vector to be administered in the treatment or
prophylaxis of an infection or other condition, wherein the vector
comprises any NCSM nucleic acid sequence described herein or
encodes any NCSM polypeptide described herein, the physician
evaluates vector toxicities, progression of the disease, and the
production of anti-vector antibodies, if any. In one aspect, the
dose equivalent of a naked nucleic acid from a vector for a typical
70 kilogram patient can range from about 10 ng to about Ig, about
100 ng to about 100 mg, about 1 .mu.g to about 10 mg, about 10
.mu.g to about 1 mg, or from about 30-300 .mu.g. Doses of vectors
used to deliver the nucleic acid are calculated to yield an
equivalent amount of therapeutic nucleic acid. Administration can
be accomplished via single or divided doses.
[0571] In another aspect, the dose administered, e.g., to a 70
kilogram patient can be in the range equivalent to any dosages of
currently-used co-stimulatory or WT B7-1 therapeutic or
prophylactic proteins (such a hB7-1) or the like, and doses of
vectors or cells which produce NCSM sequences optionally are
calculated to yield an equivalent amount of NCSM nucleic acid or
expressed polypeptide or protein. The vectors of this invention
comprising at least one nucleotide sequence encoding at least one
NCSM (and, if desired, further comprising a nucleotide sequence
encoding antigen or other co-stimulatory molecule either on the
same vector) can be used to prophylactically or therapeutically
treat or supplement such treatment of a variety of cancers,
including e.g., colorectal cancer, breast cancer, pancreatic
cancer, lung cancer, prostate cancer, naso-pharyngeal cancer,
cancer, brain cancer, leukemia, melanoma, head- and neck cancer,
stomach cancer, cervical cancer, ovarian cancer, lymphomas, colon
cancer, colorectal, and virally-mediated conditions by any known
conventional therapy, including cytotoxic agents, nucleotide
analogues (e.g., when used for treatment of HIV infection),
biologic response modifiers, and the like.
[0572] In therapeutic applications, compositions are administered
to a patient suffering from a disease (e.g., an infectious disease,
cancer, or autoimmune disorder) in an amount sufficient to cure or
at least partially arrest or ameliorate the disease or at least one
of its complications. An amount adequate to accomplish this is
defined as a "therapeutically effective dose." Amounts effective
for this use will depend upon the severity of the disease and the
general state of the patient's health. Single or multiple
administrations of the compositions may be administered depending
on the dosage and frequency as required and tolerated by the
patient. In any event, the composition should provide a sufficient
quantity of protein to effectively treat the patient.
[0573] In prophylactic applications, compositions are administered
to a human or other mammal to induce an immune or other
prophylactic response that can help protect against the
establishment of an infectious disease, cancer, autoimmune
disorder, or other condition.
[0574] In some applications, an amount of NCSM polypeptide that is
administered to a subject for a particular therapeutic or
prophylactic treatment protocol or vaccination ranges from about 1
to about 50 mg/kg weight of the subject. Such amount of polypeptide
can be administered 1 time/week or up to 3 times/week, as desired.
Such NCSM polypeptide can be administered as a soluble molecule
comprising, e.g., an NCSM-ECD, or NCSM-trunECD-Ig or NCSM-ECD-Ig
fusion protein. Alternatively, such NCSM polypeptide can be
administered in the form of a NCSM-polypeptide-encoding
polynucleotide, which is operably linked to a promoter, such that
the polynucleotide expresses in the subject such a NCSM polypeptide
of from about 1 to about 50 mg/kg weight of the subject (e.g., on
the surface of targeted cells) or as an expressed soluble NCSM
polypeptide. The NCSM polypeptide (or nucleic acid encoding the
polypeptide) can be administered to a population of cells of a
subject in vivo, or to a population of cells of the subject ex vivo
as described herein. Compositions comprising soluble NCSM
polypeptides in such range amounts or comprising nucleic acids or
expression vectors that can express such amounts in the subject are
also contemplated.
[0575] In cancer immunotherapy or prophylactic applications (e.g.,
multiple myeloma, breast cancer, lymphoma, and the like), it is
advantageous to administer at least one NCSM molecules (including,
e.g., CD28BPs and CTLA-4BPs) and at least one cancer antigen with
at least one other molecule of interest, such as, e.g., a cytokine
(IL-12, IL-15, IL-2, or variant thereof, etc.) and/or colony
stimulating factor (e.g., GM-CSF); such combination can serve to
enhance a desired response, e.g., to enhance lymphocyte
proliferation and/or gamma-interferon release. Included are
recombinant, variant and mutant forms of IL-12, including
recombinant IL-12p-40 and IL-12p35 polypeptides and nucleic acids
described in PCT App. No. US00/32664 (Publ. No. WO 01/40257), which
is incorporated herein by reference in its entirety for all
purposes. In one format, a bicistronic vector comprising nucleotide
sequences encoding an NCSM polypeptide, cancer antigen, and
polypeptide(s) of interest is administered to the subject (e.g., by
intramuscular or intradermal injection). In another format, a
vector comprising a nucleotide sequence encoding the molecule of
interest can be administered separately to the patient, at the same
time or following administration of the one or more vectors
comprising sequences encoding the antigen and NCSM polypeptide.
Typically, a dose of at least about 1 mg nucleic acid (e.g., DNA)
of GM-CSF and/or IL-2, IL-12 or other cytokine is administered at
the time of immunization with the antigen and NCSM nucleic acids.
Alternatively, the additional molecule of interest (GM-CSF, IL-12,
IL-2, or other cytokine) is administered to the subject as a
polypeptide (e.g., by i.m. or i.d. injection). The initial dose of
this polypeptide is administered at about the same time as the
vector encoding the NCSM polypeptide and antigen, and typically
comprises at least about 75 ug. Subsequent additional "boost" doses
of at least about 75 ug are usually delivered once/day for at least
four days following the initial immunization. In another format,
one or more vectors encoding either or both an NCSM polypeptide and
molecule of interest (cytokine, GM-CSF) are administered (via,
e.g., i.d. or i.m. injection) in vivo into the tumor of a subject
where the tumor is inoperable, or into tumor cells removed from a
patient (ex vivo administration). Additional vector formats can
also be used (adenoviral, retroviral, bicistronic, tricistronic).
The toxicity and therapeutic efficacy of the vectors that include
recombinant molecules provided by the invention are determined
using standard pharmaceutical procedures in cell cultures or
experimental animals. One can determine the LD.sub.50 (the dose
lethal to 50% of the population) and the ED.sub.50 (the dose
therapeutically effective in 50% of the population) using
procedures presented herein and those otherwise known to those of
skill in the art. Nucleic acids, polypeptides, proteins, fusion
proteins, transduced cells and other formulations of the present
invention can be administered at a rate determined, e.g., by the
LD.sub.50 of the formulation, and the side-effects thereof at
various concentrations, as applied to the mass and overall health
of the patient. Again, administration can be accomplished via
single or divided doses.
[0576] A typical pharmaceutical composition for intravenous
administration is about 0.1 to 10 mg per patient per day. Dosages
from 0.1 up to about 100 mg per patient per day may be used,
particularly when the drug is administered to a secluded site and
not into the blood stream, such as into a body cavity or into a
lumen of an organ. Substantially higher dosages are possible in
topical administration. For recombinant promoters of the invention
that express the linked transgene at high levels, it may be
possible to achieve the desired effect using lower doses, e.g., on
the order of about 1 .mu.g or 10 .mu.g per patient per day. Actual
methods for preparing parenterally administrable compositions will
be known or apparent to those skilled in the art and are described
in more detail in such publications as Remington's Pharmaceutical
Science, 15th ed., Mack Publishing Company, Easton, Pa. (1980).
[0577] For introduction of recombinant NCSM nucleic acid transduced
cells into a patient, an illustrative, but not limiting example
includes taking blood samples, obtained prior to infusion, and
saved for analysis. Between, e.g., 1.times.10.sup.6 and
1.times.10.sup.12 transduced cells are infused intravenously over,
e.g., 60-200 minutes. Vital signs and oxygen saturation by pulse
oximetry are closely monitored. Blood samples are obtained, e.g., 5
minutes and, e.g., 1 hour following infusion and saved for
subsequent analysis. Leukopheresis, transduction and reinfusion are
optionally repeated every, e.g., 2 to 3 months for a total of,
e.g., 4 to 6 treatments in a one year period. After the first
treatment, infusions can be performed, e.g., on a outpatient basis
at the discretion of the clinician. If the reinfusion is given as
an outpatient, the participant is monitored for, e.g., at least 4,
and preferably, e.g., 8 hours following the therapy. Transduced
cells are prepared for reinfusion according to established methods.
See, Abrahamsen et al. (1991) J Clin Apheresis 6:48-53; Carter et
al. (1988) J Clin Arpheresis 4:113-117; Aebersold et al. (1988), J
Immunol Methods 112:1-7; Muul et al. (1987) J Immunol Methods
101:171-181 and Carter et al. (1987) Transfusion 27:362-365. After
a period of, e.g., about 2-4 weeks in culture, the cells should
number between, e.g., 1.times.10.sup.6 and 1.times.10.sup.12. In
this regard, the growth characteristics of cells vary from patient
to patient and from cell type to cell type. About, e.g., 72 hours
prior to reinfusion of the transduced cells, an aliquot is taken
for analysis of phenotype, and percentage of cells expressing the
therapeutic agent.
[0578] If a patient undergoing infusion of a vector or transduced
cell or protein formulation develops, e.g., fevers, chills, or
muscle aches, he/she receives the appropriate dose of, e.g.,
aspirin, ibuprofen, acetaminophen or other pain/fever controlling
drug. Patients who experience reactions to the infusion such as
fever, muscle aches, and chills are premedicated, e.g., 30 minutes
prior to the future infusions with, e.g., either aspirin,
acetaminophen, or, e.g., diphenhydramine, etc. Meperidine is used
for more severe chills and muscle aches that do not quickly respond
to antipyretics and antihistamines. Cell infusion is, e.g., slowed
or discontinued depending upon the severity of the reaction.
[0579] The NCSM polypeptides, NCSM nucleic acids, and cells,
vectors, transgenic animals, and compositions that include the NCSM
molecules of the invention can be packaged in packs, dispenser
devices, and kits for administration to a subject, such as a
mammal. For example, packs or dispenser devices that contain one or
more unit dosage forms are provided. Typically, instructions for
administration of the compounds will be provided with the
packaging, along with a suitable indication on the label that the
compound is suitable for treatment of an indicated condition. For
example, the label may state that the active compound within the
packaging is useful for treating a particular infectious disease,
autoimmune disorder, tumor, or for preventing or treating other
diseases or conditions that are mediated by, or potentially
susceptible to, a subject's or mammalian immune response.
[0580] Any NCSM nucleic acid, polypeptide, protein, fusion protein,
or vector or comprising any such NCSM molecule described herein,
and any composition comprising at least one NCSM nucleic acid,
polypeptide, protein, fusion protein, or vector or cell comprising
at least one such NCSM molecule, can be used in any of the methods
and applications described herein. In one aspect, the invention
provides for the use of any NCSM polypeptide or nucleic acid (or
vector or cell comprising a NCSM nucleic acid) or composition
thereof as a medicament, or as a vaccine, for the treatment of one
of the diseases described herein or for preventing one of the
diseases described herein, or the like. In another aspect, the
invention provides for the use of any NCSM polypeptide or nucleic
acid (or vector or cell comprising a NCSM nucleic acid) or
composition thereof for the manufacture of a medicament,
prophylactic, therapeutic, drug, or vaccine, including for any
therapeutic or prophylactic application relating to treatment of a
disease or disorder as described herein.
[0581] In one aspect, the invention provides methods for modulating
or altering an immune response T-cell response specific to an
antigen in a subject. Some such methods comprise administering to
the subject at least one polynucleotide sequence comprising a NCSM
polynucleotide described here (e.g., SEQ ID NOS:1-47, 95-173, and
253-262, 274-277) or at least one polynucleotide encoding a
polypeptide comprising any of SEQ ID NOS:48-94, 174-252, 263-272,
279-293 or fragment thereof, and a polynucleotide sequence encoding
the antigen or antigenic fragment thereof. Each of the at least one
polynucleotide sequences is expressed in the subject in an amount
effective to modulate or alter an immune response or a T cell
response. In some such methods, the polypeptide or fragment thereof
interacts with or binds a T cell surface receptor. In some such
methods, T-cell response is enhanced as measured by assays
described herein, and in some such methods, the enhanced T cell
response is sufficient to eliminate cells bearing the antigen or
antigenic fragment thereof. In other methods, the T-cell response
is suppressed or inhibited as measured by assays described
herein.
[0582] In some such methods, the antigen or antigenic fragment
thereof is an antigen or antigenic fragment thereof of an
infectious agent or a cancer. The encoded polypeptide may
comprising any NCSM polypeptide of fragment thereof described
herein, such as SEQ ID NO:66 or SEQ ID NO:86, or the extracellular
domain amino acid sequence of any NCSM polypeptide described
herein, or fusion protein thereof.
[0583] The at least one polynucleotide sequence encoding a NCSM
polypeptide or fragment thereof may be operably linked to a
promoter in a vector, such as an expression vector or DNA plasmid.
In one aspect, the at least one polynucleotide sequence encoding
the antigen or antigenic fragment thereof may be included in the
same vector and operably linked to a second promoter in the same
vector (e.g., bicistronic vector). Alternatively, the
polynucleotide sequences encoding the NCSM polypeptide and the
antigen or antigenic fragment are present in separate vectors and
administered separately, e.g., either simultaneously or
consecutively. The antigen or antigenic fragment thereof may thus
be operably linked to a promoter in the second vector.
[0584] In another aspect, the invention provides vectors comprising
at least one NCSM polynucleotide sequence described herein (e.g.,
SEQ ID NOS 1-47, 95-173, and 253-262) or a polynucleotide sequence
encoding a polypeptide comprising any of SEQ ID NOS:48-94, 174-252,
263-272 and 283-293 or fragment thereof, and a polynucleotide
sequence encoding the antigen or antigenic fragment thereof,
wherein the NCSM polypeptide or fragment thereof interacts with or
binds to a T cell receptor when expressed in a subject, and wherein
each of the at least one polynucleotide sequences is operably
linked to a promoter for expression in the subject and is present
in an amount sufficient that when expressed is effective to
modulate or alter a T cell response. In some such methods, the at
least one polynucleotide sequence encoding a polypeptide comprises
a polynucleotide sequence of any of SEQ ID NOS:1-47, 95-173, and
253-262. Each of the at least one polynucleotide sequences may be
expressed in the subject in an amount effective to enhance a T cell
response such that cells expressing the antigen or antigenic
fragment thereof are eliminated. In some methods, each of the at
least one polynucleotide sequences is expressed in the subject in
an amount effective to inhibit a T cell response.
[0585] In another aspect, the invention provides vectors comprising
at least one NCSM polynucleotide sequence described herein or at
least one polynucleotide sequence encoding a polypeptide comprising
any of SEQ ID NOS:48-94, 174-252, 263-272 and 283-293 or fragment
thereof, wherein the polypeptide or fragment thereof interacts with
or binds to a T cell receptor when expressed in a subject, wherein
the at least one polynucleotide sequence is operably linked to a
promoter for expression in the subject and is present in an amount
sufficient that when expressed is effective to modulate or alter a
T cell response.
[0586] In yet another aspect, the invention provides methods of
modulating or altering an immune response in a subject, the method
comprising introducing into cells of a tumor of the subject at
least one polynucleotide sequence encoding a polypeptide comprising
any of SEQ ID NOS:48-94, 174-252, 263-272 and 283-293 or fragment
thereof, wherein the polypeptide or fragment thereof interacts with
or binds to a T cell receptor when expressed in a subject, and
wherein the at least one polynucleotide sequence is operably linked
to a promoter for expression in the subject and present in an
amount sufficient that when expressed is effective to modulate or
alter a T cell response.
[0587] The invention includes therapeutic methods for activating or
enhancing a T-cell response in a subject, wherein the subject may
have a tumor or from whom a tumor was surgically removed. Such
methods comprise administering to the subject a composition that
comprises a polynucleotide sequence encodes a NCSM polypeptide and
an excipient, wherein the NCSM polypeptide is expressed by tumor
cells or tumor-related cells of the subject, and the T-cell
response is activated or enhanced against the tumor. For some such
methods, the polynucleotide sequence encodes a soluble NCSM
polypeptide. The composition may comprise a vector comprising the
polynucleotide sequence that encodes a NCSM polypeptide. Further, a
therapeutically effective amount of the composition sufficient to
enhance a T-cell response against the tumor may be administered. A
pharmaceutical composition comprising an expression vector
comprising a polynucleotide sequence that encodes a NCSM
polypeptide and a pharmaceutically acceptable excipient are also
provided.
[0588] The invention also includes therapeutic methods for
activating or enhancing a T-cell response in a subject who has a
tumor or from whom a tumor was removed surgically, the method
comprising administering to the subject a composition that
comprises a soluble NCSM polypeptide and an excipient, wherein the
T-cell response is activated or enhanced against the tumor. Also
included are methods for activating or enhancing a T-cell response
in such a subject, the methods comprising administering to the
subject a sufficient amount of a composition comprising an
excipient and a population of cells expressing a NCSM polypeptide
and an antigen, such that the T-cell response is thereby activated
or enhanced against the tumor. Also contemplated are methods for
activating or enhancing a T-cell response in such a subject, the
method comprising administering to the subject a sufficient amount
of a composition comprising an excipient and a population of cells
expressing a NCSM polypeptide, such that the T-cell response is
thereby activated or enhanced against the tumor.
Uses and Applications
[0589] The evolved novel NCSM molecules of the invention, in all
formats described herein, including, but not limited to, e.g., NCSM
nucleic acids, NCSM polypeptides and proteins, and vectors, cells,
compositions including such NCSM molecules, are useful in a broad
range of clinical, therapeutic, and prophylactic applications.
Optionally, the polypeptides alone or fragments thereof are used to
enhance the immune system (e.g., NCSM polypeptides or soluble NCSM
polypeptides (e.g., ECD), NCSM fusion proteins (e.g., comprising an
NCSM-ECD fused to an Ig)). For example, these molecules are useful
in enhancing tumor immunity and as polypeptide or protein adjuvants
and DNA vaccine adjuvants in combination with, e.g., antigens for
specific diseases. For example, CD28BP polypeptides and nucleic
acids encoding CD28BP polypeptides are useful are adjuvants to
enhance or boost an immune response in a subject, including to
augment or enhance a response to a particular compound that is
delivered to the subject simultaneously or before or after the
CD28BP adjuvant. They are also useful in the treatment of a variety
of medical conditions, including, e.g., chronic infectious
diseases, allergies, autoimmune diseases, and in organ
transplantation and the reversal of septic shock. Moreover,
transgenic animals, such as pigs, mice, etc., expressing CD28BP
and/or CTLA-4BP can be generated using methods known to those
skilled in the art. Proteins, tissues or organs from such animals
can be used to modulate T cell responses in patients undergoing
tissue or organ transplantation.
[0590] Furthermore, NCSM molecules, such as the CD28BP and CTLA-4BP
molecules described herein, are useful as components in
multi-component vaccines, which optionally comprise, e.g., a single
vector with multiple components or multiple vectors encoding
different vector components or a multi-component protein-based
vaccines in which a CD28BP or CTLA-4BP protein is delivered with
other proteins, such as a protein vaccine. The CD28BP or CTLA-4BP
protein can be delivered simultaneously with the other protein(s)
if desired, or delivered at a different time, and can also be
administered to a subject following delivery of a protein vaccine
or DNA vaccine to boost the immune response to the protein vaccine
or DNA vaccine. A multi-component vaccine optionally comprises,
e.g., a vector, such as a DNA plasmid vector, that comprises, for
example, in addition to nucleotide sequences encoding one or more
CD28BP and/or CTLA-4BP polypeptides, one or more nucleotide
sequences encoding at least of the following components: at least
one antigen(s), cytokine(s), adjuvant(s), promoter (e.g., wild-type
CMV promoter (such as human CMV promoter with or without an intron
A sequence; or a recombinant, or chimeric CMV promoter with or
without a recombinant or WT intron A sequence), and/or other
co-stimulatory molecule(s) (each of which may have been optimized
by recursive sequence recombination and selection/screening
procedures, random mutagenesis, or other known mutagenesis
procedures), and combinations of such various components. Such
multi-component vector expresses two or more such components and
includes appropriate expression elements for such expression (see,
e.g., an exemplary multi-component vector described in Example V).
Such an arrangement permits co-delivery of various components,
including recursively recombined components, for a particular
treatment regimen or therapeutic or prophylactic application. Such
vectors are designed according to the specific treatment regimen or
therapeutic or prophylactic application desired. One or more such
single-component or multi-component vectors as described above may
be used simultaneously or in sequential administration in a
therapeutic or prophylactic treatment method of the invention.
[0591] Also, an immune response is optionally modified or enhanced
by, e.g., administering one or more nucleic acids encoding one or
more novel CD28BPs (or fragments thereof, including, e.g., soluble
CD28BPs or fusion proteins thereof) or CTLA-4BPs (or fragments
thereof, including, e.g., soluble CTLA-4BPs or fusion proteins
thereof) with an antigen. Alternatively, an antigen response is
optionally enhanced or modified by administration of one or more
CD28BPs (or fragments thereof, including, e.g., soluble CD28BPs) or
CTLA4-BPs (or fragments thereof, including, e.g., soluble
CTLA-4BPs) with an antigen.
[0592] CD28BPs and CTLA-4BPs, and B7-1 and B7-2 polypeptide
variants described herein (and nucleic acids encoding any of these
polypeptides or fragments thereof), are useful in modulating the
immune response in vivo in a variety of animals, (e.g., mammals,
(including humans)) and in vitro. These molecules are particularly
useful in therapeutic and/or prophylactic applications when
modulation of T cell responses is desired. Examples of useful
applications for CD28BP and/or CTLA4BP (or fragments thereof of
each, or soluble and/or fusion protein versions of each) include
conditions or diseases that may benefit from enhanced T cell
responses or where enhanced T cell responses are desired. They are
also useful, for example, in treating diseases where inhibition of
T cell proliferation/activation is desired. Examples of medical
conditions and/or diseases where enhanced T cell response is
desired (e.g., by use of CD28BPs) (or fragments thereof, soluble
and/or fusion protein versions) include, for example, cancer,
chronic infectious diseases, and vaccinations. Cancers include, but
are not limited to, e.g., colorectal cancer, breast cancer,
pancreatic cancer, lung cancer, prostate cancer, naso-pharyngeal
cancer, cancer, brain cancer, leukemia, melanoma, head- and neck
cancer, stomach cancer, cervical cancer, ovarian cancer, and
lymphomas.
[0593] CD28BPs, CTLA-4BPs, and B7-1 and B7-2 polypeptide variants
described herein (and nucleic acids encoding any of these), are
useful in a variety of therapeutic and prophylactic treatment of
diseases and conditions, including, e.g., allergy/asthma,
neurological, organ transplantation (e.g., graft versus host
disease, and autoimmune diseases), malignant diseases, chronic
infectious diseases, including, but not limited to, e.g., viral
infectious diseases, such as those associated with, but not limited
to, e.g., hepatitis B virus (HBV), herpes simplex virus (HSV),
hepatitis C virus (HCV), HIV, human papilloma virus (HPV), and the
like, and bacterial infectious diseases, such as, but not limited
to, e.g., Lyme disease, tuberculosis, and chlamydia infections, and
the like.
[0594] Furthermore, CD28BPs, CTLA-4BPs, and B7-1 and B7-2
polypeptide variants described herein (and nucleic acids encoding
these) are useful in methods for modulating production of specific
cytokines, including those discussed in the Examples below. These
molecules are particularly useful in therapeutic and/or
prophylactic applications in which an adjustment, alteration of a
cytokine level, or production or stimulation of a specific cytokine
production is desired.
[0595] CD28BP polypeptides of the invention, or fragments thereof
or soluble and/or fusion proteins thereof, modulate T cell
proliferation or activation and augment the immune response. In one
embodiment, such a CD28BP polypeptide can be delivered in a
treatment protocol as a component of a DNA vaccine vector, as a
full-length polypeptide, as a soluble polypeptide subsequence of
the full-length CD28BP polypeptide (e.g., ECD) used, if desired, as
a polypeptide or protein vaccine or "boosting" polypeptide, or as a
soluble fusion protein comprising a full-length CD28BP polypeptide
or subsequence thereof, such as a soluble polypeptide subsequence
(e.g., ECD); in such formats, the CD28BP polypeptide may act as an
agonist. In another embodiment, such as a genetic vaccine, in
combination with a nucleic acid sequence encoding a specific
antigen, a nucleic acid sequence encoding a CD28BP polypeptide
augments the antigen specific T cell response for infectious
disease or cancer antigens.
[0596] The CTLA4BPs, or fragments thereof or soluble and/or fusion
proteins thereof, of the invention can modulate T cell
proliferation and/or activation and inhibit the immune response in
autoimmune diseases or, as soluble molecules, act as antagonists.
Such a CTLA-4BP polypeptide can be delivered in a treatment
protocol as a component of a DNA vaccine vector, as a full-length
polypeptide, as a soluble polypeptide subsequence of the
full-length CTLA-4BP polypeptide (e.g., ECD) used, if desired, as a
polypeptide or protein vaccine or "boosting" polypeptide, or as a
soluble fusion protein comprising a full-length CTLA-4BP
polypeptide or subsequence thereof, such as a soluble polypeptide
subsequence (e.g., ECD); in such formats, the CTLA-4BP polypeptide
may serve as an agonist.
[0597] As discussed above, genetic vaccine comprising a vector
comprising a nucleic acid sequence encoding a CTLA4-BP polypeptide
and at least one nucleic acid sequence encoding at least, one
additional polypeptide of interest is also a feature of the
invention. For example, in a DNA vaccine, in combination with a
specific allergen, the CTLA4BPs (or fragments thereof, or soluble
and/or fusion proteins thereof) may inhibit the allergen specific T
cell response in allergy. Similarly, in combination with a specific
auto-antigen, such as myelin basic protein, the CTLA-4BPs (or
fragments thereof, or soluble and/or fusion proteins thereof) may
inhibit the auto-antigen-specific T cell response in autoimmunity,
such as in multiple sclerosis.
[0598] Other clinical applications in which inducing tolerance is
important and thus in which CTLA-4BPs are of use include
autoimmunity (e.g., multiple sclerosis, rheumatoid arthritis,
psoriasis), severe allergy and asthma, organ transplantation,
generation of transgenic tissues to enable xenotransplants, graft
versus host disease, and with components of gene therapy vectors to
prolong survival of cells expressing foreign proteins.
[0599] Examples of medical conditions and/or diseases where
down-regulation, or other altered type of T cell function by
delivery of a CTLA-4BP of the invention either as a DNA expression
vector comprising a nucleic acid sequence encoding a CTLA-4BP
polypeptide or as a soluble described herein), or fragments thereof
or soluble and/or fusion proteins thereof, may be of benefit
include allergy, undesired immune response, autoimmune diseases,
septic shock, and organ transplantation.
[0600] Examples of useful pathogen antigens, cancer antigens,
allergens and auto-antigens for use in methods of the invention
and/or in combination with NCSM polypeptides have been provided in
the following commonly assigned patent applications: Punnonen et
al. (1999) WO 99/41369; Punnonen et al. (1999) WO 99/41383;
Punnonen et al. (1999) WO 99/41368; and Punnonen et al. (1999) WO
99/41402), each of which is incorporated herein by reference in its
entirety for all purposes. Several other useful antigens have been
described in the literature or can be discovered using genomics
approaches. Since typical tumor antigens are self proteins and thus
host tolerant, it is optionally necessary to generate "non-self"
tumor antigens that induce cross-reactivity against self tumor
antigens also. This is optionally accomplished through, e.g.,
recursive sequence recombination of existing tumor antigens from
diverse species to produce chimeric tumor antigens. Such chimeric
antigens are then screened for ones which activate antigen-specific
T cells which also recognize the wild-type tumor antigen. Optional
screenings test whether chimeric antigens activate patient T cells
(e.g., T cell lines specific for wild-type antigens generated and
activation induced by APCs expressing recursively recombined
antigens analyzed) and whether the chimeric antigen induces T cells
that recognize wild-type antigen (e.g., T cell lines specific for
recursively recombined antigens generated and activation induced by
APCs expressing WT antigen analyzed).
[0601] A NCSM polypeptide of the invention is also useful in
therapeutic or prophylactic treatment methods for treating or
preventing any of the above-mentioned diseases and disorders when
administered to a subject as a polypeptide (e.g., administer at
least one full-length or soluble NCSM or fragment thereof) or
cell-based vaccine (e.g., cell expressing or secreting at least one
NCSM polypeptide) or a gene-based therapeutic polypeptide (i.e.,
polypeptide product expressed by a NCSM gene), wherein such NSMC
polypeptides are delivered alone or co-administered simultaneously
or subsequently with one or more of an antigen, another
co-stimulatory molecule, or adjuvant. A NCSM molecule is also
useful for treating or preventing any of the above-mentioned
diseases and disorders when administered to a subject as a genetic
vaccine (e.g., DNA vaccine) in which at least one NCSM
polynucleotide is administered alone or in a plasmid vector or gene
therapy format (i.e., a vector encoding at least one NCSM
polypeptide). Or, if desired, at least one NCSM polynucleotide is
co-administered with a second DNA vector encoding at least one of
an antigen, co-stimulatory molecule, and/or adjuvant.
Alternatively, if desired, a vector comprising at least one
NCSM-encoding polynucleotide sequence and at least one of an
antigen, co-stimulatory molecule, and/or adjuvant can be prepared
and administered to a subject in a treatment protocol; in this
instance, the at least one NCSM-encoding polynucleotide is
co-expressed with at least one antigen, co-stimulatory molecule,
and/or adjuvant.
[0602] In another aspect, a soluble NCSM polypeptide may be used in
methods for treating or preventing any of the above-mentioned
diseases or disorders when administered to a subject alone or in
conjunction simultaneously or subsequently with one or more of an
antigen, another co-stimulatory, and/or adjuvant. The soluble NCSM
may comprise a NCSM-ECD or subsequence thereof or may be formulated
as a soluble fusion protein. Further, a NCSM polynucleotide that
encodes a NSCM or any soluble form of a NCSM as described herein is
useful in therapeutic or prophylactic treatment methods for
treating or preventing any of the above-mentioned diseases or
disorders when administered to a subject alone or in conjunction
(simultaneously or subsequently) with one or more nucleotide
sequences encoding one or more of an antigen, another
co-stimulatory, and/or adjuvant. If desired, the NCSM
polynucleotide sequence and one or more polynucleotide sequences
encoding one or more of an antigen, another co-stimulatory, and/or
adjuvant may be incorporated into one vector for delivery to the
subject and co-expression of the resulting NCSM polypeptide,
antigen, another co-stimulatory, and/or adjuvant.
[0603] As noted above, a variety of antigens can be delivered
simultaneously with or following delivery of a NCSM molecule, where
the NCSM molecule is administered to the subject in either
polypeptide or nucleic acid format. The antigen may be delivered as
a polypeptide or polynucleotide (via a vector). Antigens may be WT
antigens or recombinant or chimeric antigens, including, e.g.,
shuffled or mutated antigens.
[0604] Examples of cancer antigens that be used with NCSM molecules
and in methods of the invention described herein include, e.g.,
EpCam/KSA, bullous pemphigoid antigen 2, prostate mucin antigen
(PMA) (Beckett and Wright (1995) Int. J. Cancer 62:703-710), tumor
associated Thomsen-Friedenreich antigen (Dahlenborg et al. (1997)
Int. J. Cancer 70:63-71), prostate-specific antigen (PSA) (Dannull
and Belldegrun (1997) Br. J. Urol. 1:97-103), luminal epithelial
antigen (LEA.135) of breast carcinoma and bladder transitional cell
carcinoma (TCC) (Jones et al. (1997) Anticancer Res. 17:685-687),
cancer-associated serum antigen (CASA) and cancer antigen 125 (CA
125) (Kierkegaard et al. (1995) Gynecol. Oncol. 59:251-254), the
epithelial glycoprotein 40 (EGP40) (Kievit et al. (1997) Intl. J.
Cancer 71:237-245), squamous cell carcinoma antigen (SCC) (Lozza et
al. (1997) Anticancer Res. 17: 525-529), cathepsin E (Mota et al.
(1997) Am. J. Pathol. 150:1223-1229), tyrosinase in melanoma
(Fishman et al. (1997) Cancer 79: 1461-1464), cell nuclear antigen
(PCNA) of cerebral cavernomas (Notelet et al. (1997) Surg. Neurol.
47: 364-370), DF3/MUC1 breast cancer antigen (Apostolopoulos et al.
(1996) Immunol. Cell. Biol. 74: 457-464; Pandey et al. (1995)
Cancer Res. 55: 4000-4003), carcinoembryonic antigen (Paone et al.
(1996) J. Cancer Res. Clin. Oncol. 122:499-503; Schlom et al.
(1996) Breast Cancer Res. Treat. 38:27-39), tumor-associated
antigen CA 19-9 (Tolliver and O'Brien (1997) South Med. J.
90:89-90; Tsuruta et al. (1997) Urol. Intl. 58:20-24), human
melanoma antigens MART-1/Melan-A27-35 and gp100 (Kawakami and
Rosenberg (1997) Intl. Rev. Immunol. 14:173-192; Zajac et al.
(1997) Intl. J. Cancer 71:491-496), the T and Tn pancarcinoma (CA)
glycopeptide epitopes (Springer (1995) Crit. Rev. Oncog. 6:57-85),
a 35 kD tumor-associated autoantigen in papillary thyroid carcinoma
(Lucas et al. (1996) Anticancer Res. 16:2493-2496), KH-1
adenocarcinoma antigen (Deshpande and Danishefsky (1997) Nature
387:164-166), the A60 mycobacterial antigen (Maes et al. (1996) J.
Cancer Res. Clin. Oncol. 122:296-300), heat shock proteins (HSPs)
(Blachere and Srivastava (1995) Semin. Cancer Biol. 6:349-355), and
MAGE, tyrosinase, melan-A and gp75 and mutant oncogene products
(e.g., p53, ras, CDk4, and HER-2/neu (Bueler and Mulligan (1996)
Mol. Med. 2:545-555; Lewis and Houghton (1995) Semin. Cancer Biol.
6: 321-327; Theobald et al. (1995) Proc. Nat'l. Acad. Sci. USA 92:
11993-11997), prostate specific membrane antigen (PSMA) Bangma C H
et al. (2000) Microsc Res Tech 51:430-5, TAG-72, McGuinness R P et
al. Hum Gene Ther (1999) 10:165-73, and variants, derivatives, and
mutated, and recombinant forms (e.g., shuffled forms) thereof of
these antigens.
[0605] To generate, e.g., vaccines with evolved NCSM molecules,
pre-clinical studies can first be done in, e.g., mice. Mice can be
used for study of, e.g., CTLA-4BPs because, e.g., effects of the
protein are more difficult to study in vitro, work in monkeys is
less cost effective than work with mice, mouse models of autoimmune
diseases have been established giving excellent means to study
induction and breaking tolerance, and the same mouse models can be
used for biological characterization of CD28BPs as well.
Pre-clinical mice studies can allow optimization of, e.g., vectors
for specific targets of interest, pharmacokinetics, drug half life,
adjuvant stability and in vivo efficacy of such things as DNA
vaccines and soluble protein administration. Mouse studies
optionally can be followed by pre-clinical studies in non-human
primates. Non-human primate trials can, e.g., optimize efficacy in
boosting the innate immune system as well as optimize efficacy of
use of NCSM molecules as vaccine adjuvants. Non-human primate
trials optionally can serve to, e.g., optimize protective immunity
and thereby help identify the best vaccine for human clinical
trials.
[0606] As an illustrative, but not limiting example, either or both
types of NCSM (i.e., CD28BPs and CTLA-4BPs) or fragments thereof
can be used in a boosting method or format to modify an immune
response. This method typically comprises, e.g., initially
administering a DNA vaccine (a "prime boost") to a subject,
followed by, e.g., a second administration with, e.g., one or more
of the NCSM polypeptide molecules either in polypeptide format or
in nucleic acid format.
[0607] Furthermore, the invention also provides for gene therapy
vectors comprising at least one nucleotide sequence encoding at
least one CTLA-4BP or fragment, variant or homologue thereof. In
one aspect, a gene therapy vector (e.g., adenovirus (AV),
adeno-associated virus (AAV), retrovirus, poxvirus, or lentivirus
vectors) comprising at least one nucleic acid sequence encoding at
least one CTLA-4BP polypeptide or fragment thereof) is used to
reduce recognition of the transduced cells by specific T cells. The
incorporation of the CTLA-4BP-encoding nucleic acid sequence helps
to prolong survival of the gene therapy vector. In gene therapy,
when the therapeutic or prophylactic transgene is expressed by the
host cells, these cells are often also recognized by the cells of
the immune system and cytotoxic T cells may destroy the cells
expressing the transgene, thereby limiting the efficacy of gene
therapy. If the cells expressing the transgene simultaneously
express a CTLA-4BP, this will reduce the activity of those
cytotoxic T cells, thereby prolonging the survival of the
transduced cells and improving the efficacy of gene therapy.
[0608] The present invention additionally provides a method to
design or identify small molecule agonists and antagonists that
either enhance or inhibit signaling through CD28 and/or CTLA-4
molecules. Methods known to those skilled in the art, such as X-ray
crystallography, are used to identify the 3-dimensional structures
of proteins (i.e., the CD28BPs and CTLA-4BPs of the invention) and
fragments thereof of each. These and other methods can be used to
identify and determine the conformations and structures that
contribute to the preferential binding of the NMCS molecules (e.g.,
CD28BPs and CTLA-4BPs) of the invention to CD28 and CTLA-4. Based
on the information obtained, small molecules that specifically bind
to CD28 or CTLA-4 can be designed. Functional screening assays
known to those skilled in the art, such as in vitro T cell
proliferation/activation assays, can be used to analyze whether
such molecules are specific antagonists or agonists. The resulting
small molecules that are agonists for CD28 and/or antagonists for
CTLA-4 can be used to, e.g., enhance or modify T cell dependent
immune responses. Similarly, small molecules that are antagonists
for CD28 and/or agonists for CTLA-4 can be used to, e.g.,
down-regulate or modify T cell specific immune responses and/or to
induce tolerance and/or anergy. These various types of small
molecules optionally are beneficial as, e.g., vaccine adjuvants
and, e.g., in treating diseases when manipulation of T cell
response is desired.
[0609] The invention includes methods of designing or identifying
CD28 agonists that enhance or inhibit signaling through either CD28
or CTLA-4 molecules of T-cells, based on visual viewing and/or
analysis of the three-dimensional structure (e.g., X-ray
crystallography), an analysis of the residues involved in CD28
and/or CTLA-4 binding, and the positions and types of such residues
of any of the polypeptides of the invention as found in SEQ ID
NOS:48-94, 174-252, 263-272, 283-293, or fragments thereof.
[0610] The invention also includes methods of treating a disease or
disorder in a subject in need of such treatment, comprising:
administering to the subject any NCSM polypeptide described herein
in an amount effective to treat said disease or disorder. In
another aspect, the invention provides methods for therapeutic or
prophylactic treatment of a disease or disorder in a subject in
need of such treatment, comprising: administering to the subject
any NCSM polypeptide and an immunogen specific for said disease or
disorder, wherein the combined amount of polypeptide and immunogen
is effective to prophylactically or therapeutically treat said
disease or disorder. In some such methods, the polypeptide is
present in an amount sufficient to enhance, diminish or modify an
immune response induced by the immunogen. The composition may
comprise the polypeptide, the immunogen, and a pharmaceutically
acceptable excipient is administered to the subject in an amount
effective to treat the disease or disorder. For all such methods,
the subject may be a mammal, including, e.g. a human. Further, for
some such methods, the polypeptide is administered in vivo to the
subject or ex vivo to a population of cells obtained from the
subject. In another aspect, the invention includes methods for
treating a disease or disorder described herein in a subject in
need of such treatment, comprising administering to the subject a
NCSM polypeptide in an amount effective to treat the disease or
disorder.
[0611] The invention includes methods of designing or identifying
CD28 agonists that enhance or inhibit signaling through either CD28
or CTLA-4 molecules of T-cells, based on visual viewing and/or
analysis of the three-dimensional structure (e.g., X-ray
crystallography), an analysis of the residues involved in CD28
and/or CTLA-4 binding, and the positions and types of such residues
of any of the polypeptides of the invention as found in SEQ ID
NOS:48-94, 174-252, 263-272, 283-293, or fragments thereof.
[0612] The NCSM polynucleotides and polypeptides, B7-1 and B7-2
polynucleotide variants and polypeptide variants, and fragments and
homologues of all such molecules as described throughout, can be
administered to a subject by any one of the delivery routes
described below (including, but not limited to, e.g.,
intramuscularly, intradermally, subdermally, subcutaneously,
orally, intraperitoneally, intrathecally, intravenously, mucosally,
systemically, parenterally, via inhalation, or placed within a
cavity of the body (including, e.g., during surgery)).
Integrated Systems
[0613] The present invention provides computers, computer readable
media, and integrated systems comprising character strings
corresponding to the sequence information herein for the
polypeptides and nucleic acids herein, including, e.g., those
sequences listed herein and various silent substitutions and
conservative substitutions thereof. Various methods and genetic
algorithms (GAs) known in the art can be used to detect homology or
similarity between different character strings, or can be used to
perform other desirable functions such as to control output files,
provide the basis for making presentations of information including
the sequences and the like. Examples include BLAST, discussed
supra.
[0614] Thus, different types of homology and similarity of various
stringency and length can be detected and recognized in the
integrated systems herein. For example, many homology determination
methods have been designed for comparative analysis of sequences of
biopolymers, for spell-checking in word processing, and for data
retrieval from various databases. With an understanding of
double-helix pair-wise complement interactions among 4 principal
nucleobases in natural polynucleotides, models that simulate
annealing of complementary homologous polynucleotide strings can
also be used as a foundation of sequence alignment or other
operations typically performed on the character strings
corresponding to the sequences herein (e.g., word-processing
manipulations, construction of figures comprising sequence or
subsequence character strings, output tables, etc.). An example of
a software package with GAs for calculating sequence similarity is
BLAST, which can be adapted to the present invention by inputting
character strings corresponding to the sequences herein.
[0615] Similarly, standard desktop applications such as word
processing software (e.g., Microsoft Word.TM. or Corel
WordPerfect.TM.) and database software (e.g., spreadsheet software
such as Microsoft Excel.TM., Corel Quattro Pro.TM., or database
programs such as Microsoft Access.TM. or Paradox.TM.) can be
adapted to the present invention by inputting a character string
corresponding to the NCSM polypeptides or polynucleotides of the
invention or both, or fragments of either. For example, the
integrated systems can include the foregoing software having the
appropriate character string information, e.g., used in conjunction
with a user interface (e.g., a GUI in a standard operating system
such as a Windows, Macintosh or LINUX system) to manipulate strings
of characters. As noted, specialized alignment programs such as
BLAST can also be incorporated into the systems of the invention
for alignment of nucleic acids or proteins (or corresponding
character strings).
[0616] Integrated systems for analysis in the present invention
typically include a digital computer with GA software for aligning
sequences, as well as data sets entered into the software system
comprising any of the sequences described herein. The computer can
be, e.g., a PC (Intel x86 or Pentium chip-compatible DOS.TM.,
OS2.TM. WINDOWS.TM. WINDOWS NT.TM., WINDOWS95.TM., WINDOWS98.TM.
LINUX based machine, a MACINTOSHT.TM., Power PC, or a UNIX based
(e.g., SUN.TM. work station) machine) or other commercially common
computer which is known to one of skill. Software for aligning or
otherwise manipulating sequences is available, or can easily be
constructed by one of skill using a standard programming language
such as Visualbasic, Fortran, Basic, Java, or the like.
[0617] Any controller or computer optionally includes a monitor
which is often a cathode ray tube ("CRT") display, a flat panel
display (e.g., active matrix liquid crystal display, liquid crystal
display), or others. Computer circuitry is often placed in a box
which includes numerous integrated circuit chips, such as a
microprocessor, memory, interface circuits, and others. The box
also optionally includes a hard disk drive, a floppy disk drive, a
high capacity removable drive such as a writeable CD-ROM, and other
common peripheral elements. Inputting devices such as a keyboard or
mouse optionally provide for input from a user and for user
selection of sequences to be compared or otherwise manipulated in
the relevant computer system.
[0618] The computer typically includes appropriate software for
receiving user instructions, either in the form of user input into
a set parameter fields, e.g., in a GUI, or in the form of
preprogrammed instructions, e.g., preprogrammed for a variety of
different specific operations. The software then converts these
instructions to appropriate language for instructing the operation
of the fluid direction and transport controller to carry out the
desired operation.
[0619] The software can also include output elements for
controlling nucleic acid synthesis (e.g., based upon a sequence or
an alignment of a sequence herein) or other operations which occur
downstream from an alignment or other operation performed using a
character string corresponding to a sequence herein.
[0620] The invention provides a computer or computer readable
medium comprising a database comprising a sequence record
comprising one or more character string corresponding to a nucleic
acid or protein sequence selected from SEQ ID NOS:1-272 and
283-293.
[0621] In another aspect, the invention provides an integrated
system comprising a computer or computer readable medium comprising
a database comprising at least one sequence record, each comprising
at least one character string corresponding to a nucleic acid or
protein sequence selected from SEQ ID NOS:1-272 and 283-293, the
integrated system further comprising a user input interface
allowing a user to selectively view one or more sequence records.
For some such integrated systems, the computer or computer readable
medium comprising an alignment instruction set which aligns the
character strings with at least one additional character string
corresponding to a nucleic acid or protein sequence. The
instruction set may comprise one or more of: a local homology
comparison determination, a homology alignment determination, a
search for similarity determination, and a BLAST determination.
Some such systems may further comprise a user readable output
element which displays an alignment produced by the alignment
instruction set.
[0622] In some aspects, the computer or computer readable medium
further comprises an instruction set which translates at least one
nucleic acid sequence comprising a sequence selected from SEQ ID
NOS:1-47, 95-173, and 253-262 into an amino acid sequence. In other
aspects, the computer or computer readable medium further
comprising an instruction set for reverse-translating at least one
amino acid sequence comprising a sequence selected from SEQ ID
NOS:48-94, 174-252, 263-272, and 283-293, into a nucleic acid
sequence. For some such systems, the instruction set selects the
nucleic acid sequence by applying a codon usage instruction set or
an instruction set which determines sequence identity to a test
nucleic acid sequence.
[0623] Also provided is a method of using a computer system to
present information pertaining to at least one of a plurality of
sequence records stored in a database, each of said sequence
records each comprising at least one character string corresponding
to SEQ ID NOS:1-272 and 283-293, the method comprising: determining
a list of one or more character strings corresponding to one or
more of SEQ ID NOS:1-272 and 283-293, or a subsequence thereof;
determining which one or more character strings of said list are
selected by a user; and displaying the selected character strings,
or aligning the selected character strings with an additional
character string. Some such methods further comprise displaying an
alignment of the selected character string with the additional
character string and/or displaying the list.
Kits
[0624] The present invention also provides kits including the NCSM
polypeptides, polynucleotides, expression vectors, cells, vaccines,
methods, compositions, systems, and apparatuses of the invention.
Kits of the invention optionally comprise at least one of the
following of the invention: (1) an apparatus, system, system
component, or apparatus component as described herein; (2) at least
one kit component comprising a NCSM polypeptide or polynucleotide,
soluble NCSM polypeptide or polynucleotide, or fragment thereof; an
NCSM-Ig or NCSM-ECD-Ig fusion protein; plasmid expression vector
encoding a NCSM polypeptide, soluble NCSM polypeptide, or fragment
thereof; cell expressing a NCSM polypeptide, soluble NCSM
polypeptide, or fragment thereof; a composition or vaccine
composition comprising at least one of any such component; (3)
instructions for practicing any method described herein, including
a therapeutic or prophylactic methods, instructions for using any
component identified in (2) or any vaccine or composition of any
such component; and/or instructions for operating any apparatus,
system or component described herein; (4) a container for holding
said at least one such component or composition, and (5) packaging
materials.
[0625] In a further aspect, the present invention provides for the
use of any apparatus, component, composition, or kit described
above and herein, for the practice of any method or assay described
herein, and/or for the use of any apparatus, component,
composition, or kit to practice any assay or method described
herein.
EXAMPLES
[0626] The following examples are offered to illustrate the present
invention, but not to limit the spirit or scope of the present
invention in any way.
Materials and Methods.
[0627] A. Isolation of Mammalian Parental cDNAs for Library
Construction.
[0628] Human, rhesus monkey, baboon, orangutan, cow (GenBank Acc.
No. Y09950), cat, and rabbit (GenBank Acc. No. D49843) wild-type
B7-1 (CD80) parental genes were cloned by the reverse transcriptase
polymerase chain reaction (RT-PCR) method. RAH, PUTI, LCL8664, and
26CB-1 cell lines were used as sources of total or messenger RNA
(mRNA) for human (Homo sapiens), orangutan (Pongo pygmaeous),
rhesus monkey (Macaca mulatta)(GenBank Acc. No. U19840) and baboon
(Papio hamadryas) B7-1 genes for B7-1 cDNA preparation. mRNA or
total RNA encoding feline (Felis catus), bovine (Bos taurus) and
rabbit (Oryctolagus cuniculus sub-species domesticus) B7-1 genes
for B7-1 cDNA preparation were obtained from peripheral blood
mononuclear cells (PBMCs) derived from the respective species.
PBMCs were isolated from cat, cow, and rabbit intravenous blood
draws by Ficoll gradient separation. The cells were then activated
for 2 days in Dulbecco's modified Eagle's medium (DMEM) containing
10% fetal calf serum (HyClone, Logan, Utah), 5 microgram/milliliter
(ug/ml) lipopolysaccharides (LPS), 0.254 ml pokeweed mitogen (PWM)
and 0.14 ml phytohemagglutinin (PHA). Cell lines were maintained at
37.degree. C. in DMEM containing 10% fetal calf serum.
[0629] The cell lines or activated PBMCs were harvested and mRNA or
total RNA was isolated using FastTrack 2.0 mRNA isolation kit
(Invitrogen, Carlsbad, Calif.) or Promega RNAgents Total RNA
Isolation System kit (Promega, Madison, Wis.), respectively.
Primers used to clone the respective mammalian B7-1 cDNAs were
designed based on published sequences for human, bovine and rabbit
B7-1 genes (see, e.g., Freeman, G. J. et al. (1989) J Immunol
143:2714-22; Parsons, K. R. & Howard, C. J. (1999)
Immunogenetics 49:231-4; and Isono, T. & Seto, A. (1995)
Immunogenetics 42:217-20)(see also, for human B7-1, GenBank Access.
Nos. U33208, AF024703; Cow B7-1, GenBank Acc. No. Y09950; rabbit
B7-1, GenBank Access. No. D49843. The primers, which were purchased
from Gibco BRL, contained a Barn H I site 5' of the start codon and
a Kpn I site 3' of the stop codons. cDNA was generated using the
mRNA or total RNA in the Invitrogen cDNA Cycle kit. The cDNAs were
generated by RT-PCR, which was performed using the cDNA Cycle kit
(Invitrogen, Carlsbad, Calif.) according to the manufacturer's
instructions and standard techniques. Each cDNA was then used as a
template for PCR generation of, e.g., double-stranded cDNA using
primer(s) specific for each species.
[0630] All primers used to clone B&-1 (CD80) cDNAs contained a
Bam HI site 5' of the species start codon and a Kpn I site 3' of
the species stop codons. The PCR products were gel purified using
the Bio101 GENECLEAN II kit, digested with BamHI and Kpn I or Asp
718, and ligated into a pcDNA3.1(-) expression vector (Invitrogen,
Carlsbad, Calif.) digested with BamHI and Kpn I or Asp 718. The
Life Technologies E. coli strain DH10B was transformed with the
cDNA clones; colonies were picked, grown, and the clones were
isolated from the bacteria using the Qiagen Plasmid Maxi kit
(Qiagen, Valencia, Calif.).
B. Generation of Recombinant Nucleic Acid Libraries.
[0631] Recombinant libraries comprising recombinant (chimeric)
nucleic acid sequences were generated by recursive sequence
recombination procedures using the seven mammalian cDNAs isolated
as described above. In one aspect, libraries comprising shuffled
chimeric nucleic acid sequences were generated by applying DNA
shuffling procedures to the seven mammalian cDNA sequences as
described previously in, e.g., Stemmer, W. (1994) Nature
370:389-391 (1994) and Crameri, A. et al. (1998) Nature 391:288-91,
and other references cited above in the section describing
recursive sequence recombination and shuffling methods. The
shuffled nucleotide sequences were digested with Bam HI and Asp 718
and gel purified using standard techniques. The resulting chimeric
shuffled nucleotide sequences were cloned into a pcDNA3.1.sup.-
expression vector (Invitrogen, Carlsbad, Calif.) using standard
cloning techniques (see, e.g., Sambrook, supra) and according to
manufacturer's instructions. The vector was used for transfecting
cells as described below.
[0632] The FLAG sequence (DYKDDDDK) was inserted at the junction
separating the sequence encoding the signal peptide and the
sequence encoding the mature polypeptide (e.g., mature coding
region) for each of the human B7-1 and CD28BP clones (e.g.,
CD28BP-15) using the ExSite PCR site-directed mutagenesis kit
(Stratagene, San Diego, Calif.) according to manufacturer's
instructions. The nucleotide sequences corresponding to the signal
sequence and mature coding region were determined for each shuffled
nucleotide sequence by comparison with the known sequences
corresponding to the signal sequence and mature coding region for
hB7-1. Mutagenesis primers were designed with the FLAG sequence
flanked by 24 nucleotides of signal and mature coding sequence
specific to each clone. Plasmid DNA was prepared and purified from
the cDNA libraries following standard procedure in Maniatis et al.,
Molecular Cloning: A laboratory Manual, Cold Spring Harbor, N.Y.
(1987).
C. Protein Conjugation.
[0633] Soluble CD28-Ig (sCD28-Ig) is a soluble fusion protein
between the extracellular domain of human CD28 and the Fc portion
of human immunoglobulin G (IgG); soluble CTLA-4-Ig (sCTLA-4-Ig) is
a soluble fusion protein between the extracellular domain of human
CTLA-4 and a human Ig C gamma chain (see, e.g., Linsley et al.
(1991), J Exp Med 174:561-569). Soluble CD28-Ig Fc (Fc portion of
human IgG1) and soluble CTLA-4-Ig Fc (Fc portion of human IgG1)
fusion proteins were both obtained from R&D Systems,
Minneapolis, Minn. NHS-biotin was obtained from Pierce (Rockford,
Ill.) and Fluorescein Isothiocyanate Isomer I (FITC) was obtained
from Molecular Probes (Eugene, Oreg.).
[0634] Molar ratios of 1:38.5 for CTLA-4-Ig Fc:FTTC and 1:35 for
CD28-Ig Fc:Biotin were used during the conjugation. Proteins at 1-3
mg/ml were dialyzed vs. 0.1 M Carbonate buffer for FITC conjugation
and 0.1 M Sodium Bicarbonate buffer for Biotin conjugation. Ratios
of 155 ug FITC/1 mg of CTLA-4-Ig Fc and 124 ug Biotin/1 mg CD28Fc
were used during the conjugation. FITC or biotin at 2 mg/ml in
dimethyl sulfoxide (DMSO) was added dropwise while vortexing to
dialyzed protein, incubated at 25.degree. C. in the dark for 2
hours, and then dialyzed against PBS overnight to exchange buffers.
(For additional methods, see Linsley et al., supra.)
D. Binding Activity Assays and Flow Cytometry.
[0635] Soluble CD28-Ig and soluble CTLA-4-Ig fusion proteins were
conjugated with biotin and fluorescein isothiocyanate,
respectively, as described above. The transfectants were treated
with 0.5 mM EDTA in PBS/2% FCS for 15-30 minutes. Several
representative wells were counted to determine the number of cells
per well. An equal volume of conjugated sCD28-Ig (Fc) or conjugated
sCTLA-4-Ig (Fc) was added to the transfected 293 or COS-7 cells at
appropriate concentrations as follows. For competitive binding
assays, the transfected cells were first incubated with
biotin-conjugated sCD28-Ig at room temperature. FITC-conjugated
CTLA-4-Ig was then added to this incubation mixture 15 minutes
(min) after the addition of biotin-conjugated sCD28-Ig, and the
entire mixture was incubated for an additional 1 hour and 45
minutes. (Alternatively, an individual binding assay can be
performed using the same procedure, but in which the transfected
cells are incubated individually with biotin-conjugated sCD28-Ig or
FITC-conjugated CTLA-4-Ig.)
[0636] The labeled cells were subsequently handled at 4.degree. C.,
washed twice with DMEM/10% FCS and incubated with 0.1 .mu.g/ml
Streptavidin-phycoerythrin (PE) (Pharmingen, San Diego, Calif.) in
100 .mu.l for 15 min. Biotin binds the fluorescence marker
Streptavidin-PE. (R-PE has an excitation maximum of 565 nanometers
(nm) and an emission maximum of 578 nm. B-PE has excitation and
emission maxima of 545 nm and 578 nm, respectively. FITC has
excitation and emission maxima of 494 and 519, respectively.) The
cells were again washed twice and resuspended in 200 .mu.l medium
with 5 .mu.g/ml propidium iodide (PI). The cells were then analyzed
using a FACSCalibur flow cytometer and CellQuest software (BDIS,
San Jose, Calif.). Cell sorting was performed by flow-cytometry
based cell sorting screening methods using FACS
(Fluorescence-Activated Cell Sorting) Vantage SE cell sorter (BDIS)
(Becton Dickinson; San Jose, Calif.). The staining concentration
was determined for each labeled protein to provide a maximal Mean
Fluorescence Intensity (MFI) and minimal background signal (e.g.,
optimum staining concentration was the concentration per 10.sup.6
cells).
[0637] Representative binding profile for the competitive binding
assays are shown in FIGS. 4A-4D. For the individual binding assay,
individual binding profiles are generated for binding of the
transfected cells to each of the biotin-conjugated sCD28-Ig or
FITC-conjugated CTLA-4-Ig (data not shown).
[0638] For a description of flow cytometry cell sorting methods,
which are known in the art, see Current Protocols in Immunology,
John Colligan et al., eds., Vols. I-IV (John Wiley & Sons,
Inc., 1991 and 2001 Supplement); Sambrook; Rapley and Walker, all
supra, each of which is incorporated herein by reference in its
entirety for all purposes.
E. Library Sorting/Enrichment.
[0639] Libraries were pre-enriched by FACS sorting for preferential
binding to CTLA-4 over CD28 or for preferential binding to CD28
over CTLA-4. Library sorting/enrichment was performed as follows.
293 cells were transfected with a bulk population of recombinant
clones from the recombinant libraries, and each transfected library
was incubated with both soluble reagents sCD28-Ig and sCTLA-4-Ig
(see Section D, above). Transfectants from the CTLA-4-Ig binding
biased library were incubated with an optimal concentration of
sCD28-Ig and a 10-fold lower concentration of sCTLA-4-Ig than
optimal. Transfectants from the CD28-Ig binding biased library were
labeled with optimal amounts of both soluble reagents. Cells that
preferentially bound CD28 over CTLA-4 were sorted from the CD28-Ig
binding biased library transfectants, and cells that preferentially
bound CTLA-4 over CD28 were sorted from the CTLA-4-Ig binding
biased library transfectants.
[0640] Plasmid was recovered from the sorted cells by lysis with
400 .mu.l Hirt's solution (0.6% sodium dodecyl sulfate (SDS), 10
milliMolar (mM) EDTA pH 8.0) for 0.5 hour, the addition of 100
.mu.l of 0.5 M NaCl to the lysate, and the lysate incubated over
night. The lysate was spun (e.g., centrifuged at 14,000.times.g for
60 minutes), extracted with equal volume of Phenol/Chloroform,
ethanol precipitated, and resuspended in 10 .mu.l TE buffer. The
isolated plasmid was used to transform E. coli strain DH10B and the
transformed cells were plated on LB agar plates. All colonies were
harvested and combined and plasmid DNA was isolated using the
Qiagen Maxiprep kit.
F. DNA Purification and Transfections.
[0641] E. coli strain DH10B (Life Technologies, Rockville, Md.) was
transformed with Maxiprep DNA from the libraries comprising
recombinant (chimeric) nucleic acid clones generated by DNA
shuffling or other recursive sequence recombination procedures, as
described above. The transformed cells were plated overnight.
Individual colonies were picked from the plated libraries and
inoculated into 96-well blocks containing 1.2 ml Terrific Broth-amp
(50 .mu.g/ml). Each block was also inoculated with a
pcDNA3.1-expression vector (Invitrogen, Carlsbad, Calif.) (control
vector) and human CD80 each in one well. The 96-well plate cultures
were grown for 20 hours at 37.degree. C., and plasmid DNA was
purified using the Biorobot (Qiagen, Valencia, Calif.). Cells of
either the mammalian cell line 293 or COS-7 (or other cell line
f=of interest) were plated in 96-well plates at a density of
2.times.10.sup.4 cells per well the day prior to transfections. The
cells were transfected with plasmids encoding a wild-type B7-1 or
chimeric polypeptide using Superfect (Qiagen) or Lipofectamine
(Life Technologies) according to the manufacturer's
instructions.
[0642] The following procedure was used for large-scale
transfections. Large-scale transfections are typically used in
pre-enrichment sorts, and for the generation of therapeutic and/or
prophylactic tumor vaccines, including, e.g., composition
comprising NCSM polypeptide-expressing tumor cells. Human embryonic
kidney 293 cells (or alternatively, e.g., monkey COS-7 cells or
tumor cells) were transfected with human CD80 (B7-1) 25, plasmid
DNA using Life Technologies Lipofectamine and OptiMEM medium. Per
20 cm.sup.2 of plated 293 cells, 3 micrograms (.mu.g) DNA in 200
microliters (.mu.l) OptiMEM were combined with 18 .mu.l
Lipofectamine in 200 .mu.l OptiMEM. This mixture was incubated for
15-30 minutes at 25.degree. C., 1.6 milliliters (ml) OptiMEM were
added, and 2 ml of this mixture were added per 20 cm.sup.2 of
plated 293 cells. Transfections were performed in T25 to T175
flasks containing 60-80% confluent 293. Cells were incubated for
5-7 hours in a 37.degree. C. humidified incubator containing 5%
CO.sub.2. An equal volume of Dulbecco's modified Eagle's medium
(DMEM)/20% fetal calf serum (FCS) (HyClone, Logan, Utah) was added
to the flask and incubated overnight. Cells were trypsinized,
replated, and incubated for 24 hours. Cells were then removed from
plastic using EDTA treatment. Cells transfected with, respectively,
a control vector, pcDNA3.1-expression vector (Invitrogen, Carlsbad,
Calif.), or plasmid vector encoding human CD80 (B7-1) were counted
and aliquoted at 2.times.10.sup.6 cells/ml.
[0643] The following procedure was used for high-throughput (HTP)
transfections for screening library clones in both T cell and
binding assays. For Lipofectamine HTP transfections, plated 293 or
COS-7 cells were washed 1.times. with 200 .mu.l PBS, and 50 .mu.l
OptiMEM was added to each well. DNA clone concentrations were
normalized to 100 ng/.mu.l.+-.33 ng/ul. The DNA preparation was
diluted to 5 ng/.mu.l.+-.33% in OptiMEM, and 50 .mu.l was plated
per well in empty 96-well U bottom plates. 50 .mu.l of OptiMEM with
Lipofectamine at 0.03 .mu.l/1 .mu.l OptiMEM was added to each well
containing diluted DNA preparation. Each well contained 50 ng
DNA.+-.33% and 0.3 .mu.l Lipofectamine. The mix was incubated for
15 minutes at room temperature, and then 20 .mu.l per well of the
mixture was added to each well containing 293 or COS-7 cells in 50
.mu.l OptiMEM. The cells were incubated at 37.degree. C. for 5-7
hours, 70 .mu.l DMEM/20% FCS was added to each well and the plates
were incubated overnight. The wells were subsequently trypsinized,
washed 2.times. with DMEM/10% FCS, replated in sterile V-bottom
plates, and incubated overnight. Alternatively, a Superfect
(Qiagen) HTP protocol for transfection, and like transfection
protocols, can be used by following the manufacturer's
instructions.
G. T Cell Proliferation Assays.
[0644] Peripheral blood was obtained from healthy blood donors as
standard buffy coat preparations collected at Stanford Medical
School Blood Center (Palo Alto, Calif.). Peripheral blood
mononuclear cells (PBMC) were isolated from human blood by
centrifugation over Histopaque-1077 (Sigma, St. Louis, Mo.) (using
Ficol gradient separation).
[0645] T cells were isolated and purified either by staining the
cells with anti-human CD2 monoclonal antibodies (mAbs) and sorting
for CD2 positive (CM.sup.+) cells using a FACS Vantage SE or
removing cells that stained with mAbs specific for CD14, CD20, CD56
and CD94 by magnetic beads (Dynabeads, Dynal, Lake Success, N.Y.);
Abs were purchased from Pharmigen (San Diego, Calif.). Magnetic
separation of the T cells using Dynal Dynabeads was performed by
first labeling PBMCs with pure monoclonal antibodies against CD14,
CD20, CD56 and CD94, then labeling the cells with Sheep anti-mouse
Dynabeads. Non-T cells were removed by depleting with a magnet. The
purity of the T cells was 96-99% when analyzed by staining with
anti-CD3 mAbs purchased from Pharmigen (San Diego, Calif.).
[0646] T cell proliferation was measured by .sup.3H-thymidine
incorporation. Briefly, 293 cells (or COS-7, or other cells of
interest) were transfected as described above for HTP transfections
with a plasmid (expression vector) encoding a hB7-1 (or other
mammalian B7-1), a chimeric CD28BP or CTLA-4BP polypeptide (i.e., a
clone selected from the CD28-Ig/CTLA-4-Ig binding screen assay), or
with a control vector lacking the B7-1 or NCSM nucleic acid insert.
(The Effectine HTP (Qiagen, Valencia, Calif.) 96-well transfection
method, which can also be used for plasmid transfections, was used
to transfect cells with CTLA-4BP selected from Round 1 libraries
according to the manufacturer's instructions.) Twenty-four hours
after transfection, 5.times.10.sup.4 purified T cells were cultured
in triplicate in the presence of irradiated (5000 rads)
transfectants and soluble anti-human CD3 mAbs (5 .mu.g/ml) U-bottom
96-well plates (VWR, West Chester, Pa.) at 37.degree. C. in a
humidified atmosphere containing 5% CO.sub.2 in Yssel's medium
supplemented with 10% FCS (200 .mu.l/well) for a total of 3 days
(72 hours). 1 microCurie WO/well of .sup.3H-thymidine (Amersham,
Piscataway, N.J.) was added by pulsing to the cell cultures during
the last 8 hours of the culture period, and the cells were
harvested for counting onto filter paper by a cell harvester
(Tomtec, Hamden, Conn.). Yssel's medium is described in Yssel et
al. (1984) J Immunol Methods 72(1):219. .sup.3H-thymidine
uptake/incorporation in the cultured cells was determined by
measuring the radioactivity on the dried filters using a MicroBeta
scintillation counter (Wallac, Turku, Finland). Proliferation of T
cells is expressed as the mean counts per minute (cpm) of
triplicate wells. The results shown are representative of typically
an average of 6 experiments. Chimeric clones that induced or
inhibited T cell proliferation at a level about equal to, greater
than, or less than that observed with human CD80 (hB7-1) were
identified and selected for further characterization.
H. Mixed Lymphocyte Culture Assay.
[0647] Proliferation of purified T cells was also measured in mixed
lymphocyte cultures (MLC). Mixed lymphocyte reaction (MLR) was
performed using irradiated PBMC as stimulator cells and allogeneic
PBMC as responders. Stimulator cells were irradiated (2500 rads)
and co-cultured with allogeneic PBMC (1.times.10.sup.5 cells/well)
in 96-well flat-bottomed microtiter culture plates (VWR) at 1:1
ratio for a total of 5 days. During the last 8 hours of the culture
period, the cells were pulsed with 1 uCi/well of .sup.3H-thymidine,
and the cells were harvested for counting onto filter paper by a
cell harvester as described above. .sup.3H-thymidine incorporation
was measured as described above for purified T cells. Proliferation
of T cells was expressed as the mean cpm of triplicate wells. The
results shown representative of more than one experiment.
I. Analysis of Cytokine Levels in Culture Supernatants.
[0648] Supernatants of cell cultures from mixed lymphocyte reaction
were collected after 48 hours and stored at -80.degree. C. until
they were analyzed for the presence of various cytokines. IL-10 and
TN-gamma levels were determined in duplicate using
cytokine-specific ELISA kits (R&D Systems, Minneapolis, Minn.)
by following the manufacturer's instructions (R&D Systems,
Minneapolis, Minn.). Controls were provided in the kits.
J. Concentration-Dependent CTLA4-Ig or CD28-Ig Binding Assays.
[0649] For each particular transfectant, 2.times.10.sup.5 cells
were incubated with serial dilutions of CTLA-4-Ig in
phosphate-buffered saline (PBS) containing 5% FCS for 30 minutes on
ice. Next, the cells were washed with PBS-FCS and incubated
subsequently with a saturating concentration of FITC-conjugated
goat anti-human IgG mAb (Fc specific) (Caltag Laboratories, San
Francisco, Calif.) for another 30 minutes on ice. The cells were
analyzed using a FACSCalibur flow cytometer and CellQuest software,
and cell sorting was performed using FACS Vantage SE cell sorter
(BDIS) described above. Plasmids were recovered from the sorted
cells by Hirt preparation as described above.
Example I
Cloning of Parent cDNA Sequences for Library Construction
[0650] The cDNAs encoding human, rhesus monkey, orangutan, baboon,
bovine, rabbit, and feline B7-1 (CD80) co-stimulatory molecules
were cloned by RT-PCR. These starting B7-1 genes encoded
polypeptide molecules with, by comparison, amino acid sequence
identities ranging from about 58-98% amino acid sequence identity
using Jotun Hein method, DNASTAR (in MegaLine.TM. DNASTAR package,
MegaLine.TM. Ver. 4.03), following manufacturer's instructions and
using default values specified in the program. The polynucleotide
sequences for baboon B7-1 (SEQ ID NO:46) and orangutan B7-1 (SEQ ID
NO:47) are examples of WT NCSM polynucleotides whose sequences were
previously unknown. These baboon B7-1 and orangutan B7-1
polynucleotides, as well as homologues and baboon B7-1 (SEQ ID
NO:93) and orangutan B7-1 (SEQ ID NO:94) polypeptides encoded
therefrom, are included as NCSM molecules of the invention.
[0651] The RAJI, PUTI, LCL8664, and 26CB-1 cell lines were used as
sources of messenger or total RNA for primate B7-1 cDNA preparation
as described previously. Intravenous draws of peripheral blood were
used as the source of messenger or total RNA for cat, cow, and
rabbit B7-1 cDNA preparation as discussed previously. Peripheral
blood mononuclear cells (PBMCs) were isolated from the cat, cow,
and rabbit blood draws by Ficol gradient separation.
[0652] PBMCs were activated for 2 days with medium containing
lipopoly-saccharide (LPS), pokeweed mitogen (PWM) and
phytohemagglutinin (PHA). Cell lines and activated PBMCs were
harvested and mRNA or total RNA was isolated. cDNA was generated
from messenger or total RNA by using the Invitrogen cDNA Cycle kit.
By using primers specific for each species, double-stranded cDNA
was generated via PCR.
Example II
Preparation and Screening of Round I NCSM Libraries
[0653] Nucleic acid libraries comprising recombinant nucleic acid
sequences were generated by using the seven cloned cDNA wild-type
CD80 nucleic acid sequences as parental sequences and applying
recursive sequence recombination methods as described above to such
sequences. In one aspect, libraries comprising chimeric nucleic
acid sequences were generated by applying DNA shuffling procedures
to the seven mammalian cDNA sequences as described previously in,
e.g., Stemmer, W. (1994) Nature 370:389-391 (1994) and Crameri, A.
et al. (1998) Nature 391:288-91, each of which is incorporated
herein by reference in its entirety for all purposes. Sequencing of
randomly selected chimeric clones a recombinant library indicated
that 12 out of 12 clones comprised nucleotide fragments from at
least two of the starting genes, illustrating efficient
chimerism.
[0654] Initial screening of the resulting chimeric NCSM clones was
based on binding assays in which binding of a polypeptide encoded
by a clone nucleic acid and expressed on the surface of a cell
transfected for one of the two B7-1 ligands, CD28 or CTLA-4, was
evaluated. For a detailed review of the binding assays, see the
"Materials and Methods" section above. In brief, cells from a human
HEK 293 cell line were transfected with plasmid DNA of the
resulting recombinant libraries of recursively recombined NCSM
polynucleotides. Library transfectants were incubated with soluble
CD28-Ig and CTLA-4-Ig conjugated with fluorescence-indicators, and
sorted according to their fluorescence via FACS-sorting and 96-well
format HTP transfections. The invention is not limited by the
choice of fluorescence indicator molecules used (i.e., numerous
indicator molecules may be used).
[0655] Flow cytometry-based cell sorting was used to screen the
libraries for clones with increased or decreased relative binding
to CD28 and CTLA-4. (Fluorescently-labeled soluble CD28-Ig and
CTLA-4-Ig molecules were used as soluble CD28 and CTLA-4 receptors,
respectively, in the competitive or individual binding assays.)
Transfected cells that preferentially bound CD28 over CTLA-4 (as
compared to CD28 and CTLA-4 binding of wild-type co-stimulatory
B7-1 molecules, such as, e.g., hB7-1) in an individual or
competitive binding assay were sorted out from the library
transfectants as were cells that preferentially bound CTLA-4 over
CD28 (again, as compared to CD28 and CTLA-4 binding of wild-type
B7-1 molecules, such as, e.g., hB7-1) in an individual or
competitive binding assay. A large fraction of the cell-surface
displayed shuffled chimeric molecules displayed exhibited binding
to either sCD28-Ig or sCTLA-4-Ig. Less than 10% of the randomly
selected chimeras demonstrated no binding to either sCD28-Ig or
sCTLA-4-Ig (data not shown), indicating high functional fitness of
polypeptides and proteins generated by DNA shuffling of natural
wild-type mammalian B7-1 genes.
[0656] Plasmid DNA encoding the recursively recombined NCSM
molecules was recovered from both categories of sorted cells and
DNA was prepared for binding assays. In the binding assays, DNA
from individual clones was transfected into human HEK 293 cells.
(or COS or other cells of interest), and the cells were analyzed
for the ability to preferentially bind either fluorescent-labeled
sCD28-Ig or fluorescent-labeled sCTLA-4-Ig (either separately or
competitively), as compared to the binding of cells expressing
wild-type B7-1 to the labeled sCD28-Ig or sCTLA-4-Ig. Clones
exhibiting preferential binding for either CD28 or CTLA, as
compared to the binding of wild-type (WT) B7-1 to CD28 or CTLA-4,
were then analyzed by DNA sequencing, amino acid sequencing, and
functional assays as described below.
[0657] Subsequent analysis of 1000 individual clones recovered from
the sorted cells identified a number of clones with altered ligand
binding profiles for CD28 and CTLA-4 relative to the binding of
wild-type B7-1 to CD28 and CTLA-4. Four clones with preferential
binding to sCD28-Ig over sCTLA-4-Ig (compared to the relative
binding of WT hB7-1 to sCD28-Ig and sCTLA-4-Ig) were subjected to
more detailed analysis; reduced binding of these clones to
sCTLA-4-Ig was observed in at least two separate experiments, while
their binding to sCD28-Ig remained intact (data not shown).
Although the level of binding of these clones to sCTLA-4-Ig was
reduced, however, it was still detectable (data not shown).
Preferential binding to sCTLA-4-Ig over sCD28-Ig (compared to the
relative binding of WT hB7-1 to sCD28-Ig and sCTLA-4-Ig) was
observed in at least 15 clones of the 1000 individual Round 1
clones analyzed by flow cytometry (data not shown). Again, the loss
of binding to sCD28-Ig was only partial.
[0658] Based on the results of this screening assay, exemplary NCSM
molecules having a desired phenotype comprising an altered
CD28/CTLA-4 binding affinity ratio or CTLA-4/CD28 binding affinity
ratio (relative to that of WT hB7-1) were identified. Plasmid DNA
encoding NCSM molecules of these selected clones was recovered and
DNA was prepared for subsequent binding and T cell proliferation
functional assays.
[0659] In T cell proliferation assays, DNA from each of the
selected exemplary CD28BP or CTLA44BP clones identified in the
binding assays was transfected into either monkey (COS-7) or human
embryonic kidney (human 293 cell line) cells in vitro, using
procedures described above, and tested for an ability to induce or
inhibit T cell proliferation as compared to human wild-type B7-1.
Anti-CD28 mAbs can be used as a positive control. (An alternative
functional test is to transfect or vaccinate human or animal cells
in vivo with the nucleic acid from a selected clone, as described
below.) To stimulate T cell activation via two-signaling pathway,
human T cells were incubated with the cells expressing a selected
NCSM molecule and anti-CD3 antibody. See "T Cell Proliferation
Assays" in "Materials and Methods." For example, by incubating T
cells, with anti-CD3 antibody and cells expressing a CD28BP of the
invention, the cell surface-expressed CD28BP bound CD28 receptor on
the T cells and the anti-CD3 bound the CD3 T cell receptor. This
was followed by addition of H.sup.3-thymidine to measure the
increase in DNA synthesis (a commonly used indication of cell
proliferation), as described previously. FIGS. 10 and 12 illustrate
results of T cell proliferation assays.
[0660] Clones that induced T cell proliferation that was about
equal to, equal to or higher than that induced by WT hB7-1 were
identified and selected for further characterization from the
recombinant nucleic acid library pre-enriched by FACS sorting for
clones having preferential binding to CD28 over CTLA-4. Four
exemplary clones having the most biased binding to CD28 and an
ability to induce a cell proliferation response about equal to or
higher than that induced by WT hB7-1 were identified and designated
Round 1 (R1) CD28BP-71, -84, -118, and -126 clones. Amino acid and
nucleic acid sequences of these NCSM clones were determined using
standard sequencing techniques described above.
[0661] Clones that reduced or suppressed T cell proliferation
relative to the that generated by WT human B7-1 were identified and
selected for further characterization from the recombinant nucleic
acid library pre-enriched by FACS sorting for clones having
preferential binding to CTLA-4 over CD28. Five exemplary clones
exhibiting the most biased binding to CTLA-4 and the ability to
reduce or suppress a T cell proliferation relative to that
generated by WT human B7-1 were identified and designated R1
CTLA-4BP-5, -7, -11, -13, and -27 clones. The amino acid and
nucleic acid sequences of these NCSM clones were determined using
standard sequence techniques as described above.
[0662] Round 1 clones showed diverse amino acid and nucleotide
differences from wild-type B7-1 sequences. For example, R1 CTLA4BP
clones demonstrated a 93.4-97.6% amino acid identity with a
wild-type B7-1 molecule and a 97-98.5% identity at the nucleotide
level. In competitive binding assays using CD28-Ig and CTLA-4-Ig,
the R1 CTLA-4BPs displayed preferential binding to CTLA-4-Ig as
compared to the wild-type B7-1 binding preference to CD28-Ig and
CTLA-4-Ig.
Example III
Preparation and Screening of Round 2 NCSM Libraries
[0663] The nucleotide sequences (or nucleotide segments or
fragments thereof) corresponding to R1 CD28BP-71, -84, -118, and
-126 clones were used as parental sequences for recursive sequence
recombination in the generation of a second round CD28BP NCSM
recombinant nucleic acid library. The nucleotide sequences (or
nucleotide segments or fragments thereof) corresponding to R1
CTLA-4BP-5, -7, -11, -13, and -27 clones were used as parental
sequences for DNA shuffling in the generation of a second round
CTLA-4BP NCSM recombinant nucleic acid library. As in Round 1, the
nucleotide sequences corresponding to the selected CD28BP clones
were recursively recombined with one another and the selected
CTLA-4BPs were recursively recombined with one another by DNA
shuffling in parallel experiments. Two separate sets of libraries
were generated (one derived from the selected CD28BP parental
clones and one derived from the selected CTLA-4BP clones). Binding
assays were performed as previously described on the recombinant
libraries generated in Round 2 (e.g., libraries containing
recursive sequence recombinants were incubated with soluble CD28-Ig
and CTLA-4-Ig conjugated with fluorescence indicators, and sorted
according to their fluorescence binding profiles).
[0664] Screening of 1000 individual clones from both libraries
identified a number of clones that exhibited strongly biased
binding to either sCD28-Ig or sCTLA-4-Ig. The second round of
breeding resulted in a number of different clones exhibiting biased
(altered) binding to sCD28-Ig or sCTLA-4-Ig, respectively. For
example, a number of Round 2 (R2) CD28BP clones showed even greater
preferential binding to CD28 than did the R1 CD28BP clones.
Similarly, a number of R2 CTLA-4BP clones showed even greater
preferential binding to CTLA-4 than did the R1 CTLA-4BP clones.
From the shuffled recombinant libraries of the second round of
breeding, a number of clones with further biased binding to
sCD28-Ig or sCTLA-4-Ig, respectively, as compared to the clones
selected from the first round of breeding (data not shown), were
selected from the Round 2 libraries using the same criteria as in
Round 1. The clones displayed a range of expression on the stable
transfectants as compared to WT hB7-1 transfectants. The plasmid
DNA for selected clones was recovered and DNA prepared for further
binding and functional assays. In addition, the amino acid and
nucleic acid sequences of these clones were determined using
standard procedures known in the art.
[0665] A. Round 2 Clones with Preferential Binding Properties.
[0666] Seventeen R2CD28BP clones were found to have preferential
binding to CD28 over CTLA-4 as shown in both individual and
competitive binding assays between these cells transfected with
these clones and soluble CD28-Ig fusions and/or CTLA4-Ig fusions.
Binding profiles for the 17 clones are shown in FIG. 5. These
clones were designated clones Round 2 (R2) CD28BP-1 through
CD28BP-17 and their respective amino acid and nucleic acid
sequences were determined (see Table 3). Thirty-six R2 CD28BP
clones were also found to have preferential binding to CD28 over
CTLA-4 relative to WT hB7-1 as demonstrated in both individual and
competitive binding assays between these cells transfected with
these clones and soluble CD28-Ig fusions and/or CTLA4-Ig fusions.
These clones were designated clones R2 CD28A12-5 through CD28E2-4
and their respective amino acid and nucleic acid sequences were
determined (see Table 3). Twelve R2 CD28BP clones binding profiles
similar to that of WT hB7-1 were also selected from both R2
libraries and their respective amino acid and nucleic acid
sequences were determined. Binding profiles for other recombinant
CD28BP clones described herein were also generated (data not
shown).
TABLE-US-00003 TABLE 3 Nucleic acid Protein Binding SEQ ID NO: SEQ
ID NO: Clone ID Score SEQ ID NO: 1 SEQ ID NO: 48 R1clone71 1 SEQ ID
NO: 2 SEQ ID NO: 49 R1clone 84 1 SEQ ID NO: 3 SEQ ID NO: 50 R1clone
118 1 SEQ ID NO: 4 SEQ ID NO: 51 R1clone 126 1 SEQ ID NO: 5 SEQ ID
NO: 52 CD28BP1 2 SEQ ID NO: 6 SEQ ID NO: 53 CD28BP2 2 SEQ ID NO: 7
SEQ ID NO: 54 CD28BP3 2 SEQ ID NO: 8 SEQ ID NO: 55 CD28BP4 2 SEQ ID
NO: 9 SEQ ID NO: 56 CD28BP5 2 SEQ ID NO: 10 SEQ ID NO: 57 CD28BP6 2
SEQ ID NO: 11 SEQ ID NO: 58 CD28BP7 2 SEQ ID NO: 12 SEQ ID NO: 59
CD28BP8 2 SEQ ID NO: 13 SEQ ID NO: 60 CD28BP9 2 SEQ ID NO: 14 SEQ
ID NO: 61 CD28BP10 2 SEQ ID NO: 15 SEQ ID NO: 62 CD28BP11 2 SEQ ID
NO: 16 SEQ ID NO: 63 CD28BP12 2 SEQ ID NO: 17 SEQ ID NO: 64
CD28BP13 2 SEQ ID NO: 18 SEQ ID NO: 65 CD28BP14 2 SEQ ID NO: 19 SEQ
ID NO: 66 CD28BP15 2 SEQ ID NO: 20 SEQ ID NO: 67 CD28BP16 2 SEQ ID
NO: 21 SEQ ID NO: 68 CD28BP17 2 SEQ ID NO: 95 SEQ ID NO: 174
CD28A12-5 1 SEQ ID NO: 96 SEQ ID NO: 175 CD28A4-5* 1 SEQ ID NO: 97
SEQ ID NO: 176 CD28A4-9 1 SEQ ID NO: 98 SEQ ID NO: 177 CD28A6-9 1
SEQ ID NO: 99 SEQ ID NO: 178 CD28A6-1 1 SEQ ID NO: 100 SEQ ID NO:
179 CD28A8-4 1 SEQ ID NO: 101 SEQ ID NO: 180 CD28A8-6 1 SEQ ID NO:
102 SEQ ID NO: 181 CD28B2-8 1 SEQ ID NO: 103 SEQ ID NO: 182
CD28B4-3 1 SEQ ID NO: 104 SEQ ID NO: 183 CD28B6-3 1 SEQ ID NO: 105
SEQ ID NO: 184 CD28B6-6 1 SEQ ID NO: 106 SEQ ID NO: 185 CD28B8-5* 1
SEQ ID NO: 107 SEQ ID NO: 186 CD28C11-5 2 SEQ ID NO: 108 SEQ ID NO:
187 CD28C6-1 1 SEQ ID NO: 109 SEQ ID NO: 188 CD28C7-3 1 SEQ ID NO:
110 SEQ ID NO: 189 CD28C8-6 2 SEQ ID NO: 111 SEQ ID NO: 190
CD28C9-5* 1 SEQ ID NO: 112 SEQ ID NO: 191 CD28C2-4 1 SEQ ID NO: 113
SEQ ID NO: 192 CD28D2-3 1 SEQ ID NO: 114 SEQ ID NO: 193 CD28D2-9 1
SEQ ID NO: 115 SEQ ID NO: 194 CD28D8-9 1 SEQ ID NO: 116 SEQ ID NO:
195 CD28D11-1 2 SEQ ID NO: 117 SEQ ID NO: 196 CD28D12-5 2 SEQ ID
NO: 118 SEQ ID NO: 197 CD28E10-6 1 SEQ ID NO: 119 SEQ ID NO: 198
CD28F7-2 2 SEQ ID NO: 120 SEQ ID NO: 199 CD28F8-4 1 SEQ ID NO: 121
SEQ ID NO: 200 CD28F10-2 1 SEQ ID NO: 122 SEQ ID NO: 201 CD28F12-5*
1 SEQ ID NO: 123 SEQ ID NO: 202 CD28G2-8 1 SEQ ID NO: 124 SEQ ID
NO: 203 CD28G1-5 1 SEQ ID NO: 125 SEQ ID NO: 204 CD28G1-9 1 SEQ ID
NO: 126 SEQ ID NO: 205 CD28H4-3 1 SEQ ID NO: 127 SEQ ID NO: 206
CD28H11-3 1 SEQ ID NO: 128 SEQ ID NO: 207 CD28H6-6 1 SEQ ID NO: 129
SEQ ID NO: 208 CD28E2-4 1 SEQ ID NO: 130 SEQ ID NO: 209 CD28B4-5a 1
SEQ ID NO: 131 SEQ ID NO: 210 CD28A2-5 0 SEQ ID NO: 132 SEQ ID NO:
211 CD28B4-5* 0 SEQ ID NO: 133 SEQ ID NO: 212 CD28D5-6 0 SEQ ID NO:
134 SEQ ID NO: 213 CD28D10-4 0 SEQ ID NO: 135 SEQ ID NO: 214
CD28E2-5* 0 SEQ ID NO: 136 SEQ ID NO: 215 CD28E5-2 0 SEQ ID NO: 137
SEQ ID NO: 216 CD28E8-6 0 SEQ ID NO: 138 SEQ ID NO: 217 CD28E9-6 0
SEQ ID NO: 139 SEQ ID NO: 218 CD28F3-1 0 SEQ ID NO: 140 SEQ ID NO:
219 GD28F3-5 0 SEQ ID NO: 141 SEQ ID NO: 220 CD28F3-6 0 SEQ ID NO:
142 SEQ ID NO: 221 CD28F11-8 0
[0667] Table 3 above presents a summary of the relative binding
activities of these selected R2 CD28BP NCSM clones based on three
exemplary binding profiles shown in FIGS. 6B(1)-6B(3). In the three
exemplary binding profiles, the Y-axis represents binding to CD28,
and the X-axis represents binding to CTLA-4. An exemplary binding
profile for the binding of WT B7-1 to CD28 and CTLA-4 is shown in
FIG. 6B(1), indicating approximately equal binding affinity of WT
B7-1 to CD28 and CTLA-4. An example of a binding profile indicating
high preferential binding to CD28 over CTLA-4 relative to that of
WT B7-1 is shown in FIG. 6B(3); that is, the clone has a
CD28/CTLA-4 binding affinity ratio significantly greater than the
CD28/CTLA-4 binding affinity ratio of WT hB7-1. An example of a
binding profile indicating intermediate preferential binding to
CD28 over CTLA-4 relative to that of WT B7-1 is shown in FIG. 6B(2)
(i.e., a CD28/CTLA-4 binding affinity ratio greater than the
CD28/CTLA-4 binding affinity ratio of WT hB7-1).
[0668] A score is assigned to each clone based upon comparison to
the three exemplary binding profiles. A score of zero (0) indicates
the CD28BP clone has a binding profile equivalent or substantially
equivalent to that of WT B7-1. A score of 1 indicates the CD28BP
clone has a binding profile similar to that shown in FIG. 6B(2)
(i.e., CD28/CTLA-4 binding affinity ratio greater than the
CD28/CTLA-4 binding affinity ratio of WT hB7-1). A score of 2
indicates the clone has a binding profile similar to that shown in
FIG. 6B(3) (i.e., a CD28/CTLA-4 binding affinity ratio
significantly greater than the CD28/CTLA-4 binding affinity ratio
of WT hB7-1). Table 3 shows the clone identification (ID) name for
each selected R2 CD28BP clone and its score.
[0669] R2 CD28BP clones 3, 6, and 9 (corresponding to nucleic acid
sequences SEQ ID NOS:7, 10, and 13, and amino acid sequences 54,
57, and 60, respectively) comprise identical amino acid and nucleic
acid sequences; the competitive binding assays and T cell
proliferation assays for these clones were conducted in a repeated
manner to verify functional activity. Clones Round 2 CD28BP-1 and
-12 comprise identical amino acid sequences (amino acid sequences
SEQ ID NOS:52 and 63, respectively); however, the nucleic acid
sequences of clones R2 CD28BP-1 and -12 (nucleic acid sequences SEQ
ID NOS:5 and 16, respectively) differ from one another by one
nucleic acid residue at position 894 in both sequences. Clone 1 has
nucleic acid residue C at position 894 (with the resulting codon
TCC encoding Ser); clone 12 has nucleic acid residue T at position
894 (with the resulting codon TCT also encoding Ser).
[0670] Fifty R2 CTLA-4BP clones were found to have preferential
binding to CD28 over CTLA-4 as shown in both individual and
competitive binding assays between cells transfected with these
clones and fluorescently labeled soluble CD28-Ig fusions and/or
CTLA4-Ig fusions. Exemplary binding profiles for selected clones
are shown in FIGS. 7A-7H. The respective amino acid and nucleic
acid sequences of the clones were determined (Table 4). Table 4
presents a summary of the relative binding activities of these
selected 50 R2 CTLA-4BP clones based on the three exemplary binding
profiles shown in FIGS. 6A(1)-6A(3). In the three exemplary
competitive binding profiles, the Y-axis represents binding to
CD28, and the X axis represents binding to CTLA-4 (see binding
assays described in "Materials and Methods"). An exemplary binding
profile for the binding of WT B7-1 to CD28 and CTLA-4 is shown in
FIG. 6A(1), indicating approximately equal binding affinity of WT
B7-1 to CD28 and CTLA-4. An exemplary binding profile indicating
for a particular clone a preferential binding to CTLA-4 over CD28
relative to that of WT B7-1 is shown in FIG. 6A(3); the clone has a
CTLA4/CD28 binding affinity ratio significantly greater than the
CTLA-4/CD28 binding affinity ratio of WT hB7-1. An exemplary
binding profile indicating intermediate preferential binding to
CD28 over CTLA-4 relative to that of WT B7-1 is shown in FIG.
6A(2); the clone has a CTLA4/CD28 binding affinity ratio greater
than that of WT hB7-1.
[0671] A score is assigned to each NCSM clone based upon comparison
to the three exemplary binding profiles. A score of zero (0)
indicates the CTLA-4BP clone has a binding profile similar or
equivalent to that of WT B7-1. A score of 1 indicates the CTLA-4BP
clone has a binding profile similar or equivalent to that shown in
FIG. 6A(2) (i.e., with a CTLA-4/CD28 binding affinity ratio greater
than the CTLA-4/CCD28 binding affinity ratio of WT hB7-1). A score
of 2 indicates the CTLA-4BP clone has a binding profile similar or
equivalent to that shown in FIG. 6A(3) (i.e., with a CTLA-4/CD28
binding affinity ratio significantly greater than that of WT
hB7-1). The clone identification (ID) name and score assigned to
each selected CTLA-4BP clone are shown in Table 4. Binding profiles
for other CTLA-4BP clones described herein were also generated
(data not shown).
TABLE-US-00004 TABLE 4 Nucleic acid Protein Binding SEQ ID NO: SEQ
ID NO: Clone ID Score SEQ ID NO: 22 SEQ ID NO: 69 R1-5 2 SEQ ID NO:
23 SEQ ID NO: 70 R1-7 1 SEQ ID NO: 24 SEQ ID NO: 71 R1-11 1 SEQ ID
NO: 25 SEQ ID NO: 72 R1-13 1 SEQ ID NO: 26 SEQ ID NO: 73 R1-27 1
SEQ ID NO: 27 SEQ ID NO: 74 5x2-10c 2 SEQ ID NO: 28 SEQ ID NO: 75
5x2-11d 2 SEQ ID NO: 29 SEQ ID NO: 76 5X2-12F 1 SEQ ID NO: 30 SEQ
ID NO: 77 5x2-2g 2 SEQ ID NO: 31 SEQ ID NO: 78 5x2-3c 2 SEQ ID NO:
32 SEQ ID NO: 79 5x2-4c 1 SEQ ID NO: 33 SEQ ID NO: 80 5x2-7b 1 SEQ
ID NO: 34 SEQ ID NO: 81 5x2-8c 2 SEQ ID NO: 35 SEQ ID NO: 82
5x3-10e 2 SEQ ID NO: 36 SEQ ID NO: 83 5X3-11B 1 SEQ ID NO: 37 SEQ
ID NO: 84 5x3-6f 2 SEQ ID NO: 38 SEQ ID NO: 85 5X4-11D 2 SEQ ID NO:
39 SEQ ID NO: 86 5X4-12C 2 SEQ ID NO: 40 SEQ ID NO: 87 5x4-1F 2 SEQ
ID NO: 41 SEQ ID NO: 88 5X5-2E 2 SEQ ID NO: 42 SEQ ID NO: 89 5X5-6E
2 SEQ ID NO: 43 SEQ ID NO: 90 5X6-9D 2 SEQ ID NO: 44 SEQ ID NO: 91
5X8-1F 2 SEQ ID NO: 45 SEQ ID NO: 92 5X9-12C 2 SEQ ID NO: 143 SEQ
ID NO: 222 5x9-d10 1 SEQ ID NO: 144 SEQ ID NO: 223 5x6-f6 1 SEQ ID
NO: 145 SEQ ID NO: 224 5x5-h12 1 SEQ ID NO: 146 SEQ ID NO: 225
5x5-c10 1 SEQ ID NO: 147 SEQ ID NO: 226 5x3-e8 1 SEQ ID NO: 148 SEQ
ID NO: 227 5x3-c4 1 SEQ ID NO: 149 SEQ ID NO: 228 5x3-c3 1 SEQ ID
NO: 150 SEQ ID NO: 229 5x2-h11 1 SEQ ID NO: 151 SEQ ID NO: 230
5x2-d7 1 SEQ ID NO: 152 SEQ ID NO: 231 5x2-b7 1 SEQ ID NO: 153 SEQ
ID NO: 232 5x2-b1 1 SEQ ID NO: 154 SEQ ID NO: 233 5x1-f1 1 SEQ ID
NO: 155 SEQ ID NO: 234 5x1-d7 1 SEQ ID NO: 156 SEQ ID NO: 235
2x4-g9 1 SEQ ID NO: 157 SEQ ID NO: 236 2x4-a6 1 SEQ ID NO: 158 SEQ
ID NO: 237 2x2-f3 1 SEQ ID NO: 159 SEQ ID NO: 238 2x2-f12 1 SEQ ID
NO: 160 SEQ ID NO: 239 2x1-g8 1 SEQ ID NO: 161 SEQ ID NO: 240
2x1-f10 1 SEQ ID NO: 162 SEQ ID NO: 241 2x1-c9 1 SEQ ID NO: 163 SEQ
ID NO: 242 2x1-h12 1 SEQ ID NO: 164 SEQ ID NO: 243 2x1-e2 1 SEQ ID
NO: 165 SEQ ID NO: 244 2x1-c4 1 SEQ ID NO: 166 SEQ ID NO: 245
2x1-b12 1 SEQ ID NO: 167 SEQ ID NO: 246 2x2-f1 1 SEQ ID NO: 168 SEQ
ID NO: 247 5X4-h1 2 SEQ ID NO: 169 SEQ ID NO: 248 5x4-a1 0 SEQ ID
NO: 170 SEQ ID NO: 249 5x2-f3 0 SEQ ID NO: 171 SEQ ID NO: 250
5x2-e12 0 SEQ ID NO: 172 SEQ ID NO: 251 2x4-h11 0 SEQ ID NO: 173
SEQ ID NO: 252 2x3-h2 0 SEQ ID NO: 253 SEQ ID NO: 263 A-H3-6 1 SEQ
ID NO: 254 SEQ ID NO: 264 A-B11-5 1 SEQ ID NO: 255 SEQ ID NO: 265
A-E2-6 1 SEQ ID NO: 256 SEQ ID NO: 266 A-F1-6 1 SEQ ID NO: 257 SEQ
ID NO: 267 A-F6-9 1 SEQ ID NO: 258 SEQ ID NO: 268 A-H4-5* 1 SEQ ID
NO: 259 SEQ ID NO: 269 A-B4-6 1 SEQ ID NO: 260 SEQ ID NO: 270
A-F10-1 1 SEQ ID NO: 261 SEQ ID NO: 271 A-G8-1 1 SEQ ID NO: 262 SEQ
ID NO: 272 A-C9-9 0
[0672] The plasmids corresponding to the 36 clones displaying
preferential binding to CD28 over CTLA-4 relative to that of WT
hB7-1 were recovered; each corresponding CD28BP molecule was
recovered, and nucleic acid and amino acid sequences were
determined. The clones were assigned scores of 2 and 1, as shown in
Table 3, depending upon the magnitude of the observed preferential
binding.
[0673] The plasmids for the 12 R2 clones from the CD28BP R2 library
that displayed CD28 and CTLA-4 binding profiles equal or
approximately equivalent to that of WT B7-1 were recovered; each
corresponding clone molecule was recovered and its nucleic acid and
amino acid sequences were determined. These clones were assigned a
score of zero, as shown in Table 3.
[0674] Two groups of R2 CTLA-4BP clones (19 in the first group,
Group I, and 26 in the second group, Group II) were identified as
having preferential binding to CTLA-4 over CD28 relative to that of
hB7-1 as demonstrated in competitive binding assays between cells
transfected with these clones and fluorescently labeled soluble
CD28-Ig fusions and/or CTLA4-Ig fusions. These clones are
identified in Table 4, which indicates the clone ID name and
binding score (as explained with regard to Table 3); the amino acid
and nucleic acid sequences for each CTLA-4BP clone were determined.
In general, the R2 clones displayed a greater degree of CTLA-4
binding preference than the R1 clones. In addition, five R2 clones
from the CTLA-4 R2 library with binding profiles equal or
approximately equivalent to that of WT human B7-1 were identified.
Plasmids for all such clones were recovered; the nucleic acid and
amino acid sequences were determined for each clone, and each clone
was assigned a binding score (see Table 4).
[0675] Preferred or enhanced binding of a selected clone to CD28
over CTLA-4 relative to hB7-1 was observed by an increase in the
observed CD28/CTLA-4 binding affinity ratio for the clone compared
to the CD28/CTLA-4 binding affinity ratio of hB7-1. Preferred or
enhanced binding of a selected clone to CTLA-4 over CD28 relative
to hB7-1 is observed by an increase in the observed CTLA-4/CD28
binding affinity ratio for the clone compared to the CTLA-4/CD28
binding affinity ratio of hB7-1.
[0676] The R2 selected clone that exhibited the greatest increase
in CD28/CTLA-4 binding affinity ratio compared to the CD28/CTLA-4
binding affinity ratio of hB7-1 was clone R2 CD28BP-15. The
identified clone that exhibited the greatest increase in
CTLA-4/CD28 binding affinity ratio compared to the CTLA-4/CD28
binding affinity ratio of hB7-1 was clone R2 CTLA-4BP
5.times.4-12c. FIGS. 4A-4D show a characterization of competitive
ligand binding properties of CD28BP-15 and CTLA-4BP 5.times.4-12c
compared to human B7-1. 293 cells transfected with CD28BP-15,
CTLA-4BP 5.times.4-12c, hB7-1, or a negative control vector (which
did not contain the B7-1, CTLA4-BP, or CD28BP nucleotide sequence
insert) were stained with fluorescently labeled biotin-conjugated
sCD28-Ig or FITC-conjugated CTLA-4-Ig fusion proteins. The results
of a representative flow cytometry analysis are shown in FIGS.
4A-4D; similar results were obtained in five other experiments.
Transfectants expressing CD28BP-15 or CTLA-4BP 5.times.4-12c, and
stained under identical conditions, demonstrated dramatically
altered ligand binding profiles, as compared to transfectants
expressing hB7-1 stained in an identical manner. In particular,
CD28BP-15 showed a significantly changed binding profile to CD28 as
compared to the binding of hB7-1 to CD28. CD28BP-15 also showed a
significant loss of CTLA-4 binding as compared to the binding of
human B7-1 to CTLA-4.
[0677] FIGS. 8A-8B show the respective amino acid sequences for
CD28BP-12 and CTLA-4BP 5.times.4-12c and the genealogy of these
sequences. The nucleotide and amino acid sequences for each of
CD28BP-12 and CTLA-4BP 5.times.4-12c were aligned with the starting
genes to identify the parental origins of the recombinant
sequences. The chimeric nature of each recombinant amino acid
sequence is indicated by a solid labeled line designating each
amino acid subsequence derived from a particular parental species
sequence. Any amino acid residue that differs from a residue in the
WT human B7-1 sequence in the corresponding (equivalent) amino acid
residue position is indicated with a star (*). Three point
mutations in CTLA-4BP 5.times.4-12c that were not derived from any
of the starting parental genes are indicated with a solid triangle.
The predicted transmembrane domain is illustrated with a dashed
line (prediction based on equivalent analysis for mammalian B7-1
molecules in Parsons, K. R. & Howard, C. J. (1999)
Immunogenetics 49:231-4).
[0678] Sequence analysis of CD28BP-15 indicated the amino acid
sequence comprised a chimera derived principally from human,
bovine, and rabbit sequences (FIG. 8B). The remaining clones
selected from the libraries resulting from second round of
recombination that displayed preferential binding to CD28 over
CTLA-4 shared about 74 to about 99% sequence identity with
CD28BP-15 based on sequence alignment comparisons (using DNASTAR or
Vector NTI algorithm with default parameters as described above),
illustrating the diversity of clones having the preferential
binding properties. The nucleotide and amino acid sequence
identities of CD28BP-15 with human B7-1 were 73% and 61%,
respectively (using DNASTAR or Vector NTI algorithm with default
parameters). Based on amino acid sequence alignments, all of the
selected CD28BP clones exhibiting preferential binding to CD28 over
CTLA-4 relative to hB7-1 contained a substitution of valine for
isoleucine at amino acid position 49 (Ile49Val) of the mature
CD28BP-15 amino acid sequence (corresponding to alignment with the
mature hB7-1 sequence). This substitution corresponds to a
substitution at amino acid position 85 in the full-length CD28BP-15
and amino acid position 83 in full-length human B7-1, since
CD28BP-15 includes two additional amino acid residues in the
putative sequence. Although Ile49 does not appear to be directly
involved in the interaction of B7-1 with CTLA-4 (see, e.g.,
Stamper, C. et al. (2001) Nature 410:608-611), substitution De49Ala
was previously shown to completely abolish binding of B7-1 to both
CD28 and CTLA-4, suggesting the importance of this residue in the
ligand binding (Peach, R. J. et al. (1995) J Biol Chem
270:21181-7). Although the Ile49Val substitution is also considered
a conservative replacement, our data suggest that mutations derived
from naturally existing genes, in this case from the bovine B7-1
gene sequence, provide improved means to search for altered
functional properties in proteins. Notably, bovine CD28 receptor is
the only exception among CD28 and CTLA-4 receptor amino acid
sequences analyzed from 12 different species in which the
hexapeptide MYPPPY and Gly-66 are not fully conserved in the
receptor sequence (i.e., MYPPPY is replaced by LYPPPY, and Gly-66
is replaced by valine. (see Metzler, W. J. et al. (1997) Nat Struct
Biol 4:527-31). The hexapeptide MYPPPY is conserved in the F-G loop
of both CD28 and CTLA-4 in a variety of mammalian species. Mutation
of any residue in the MYPPPY sequence leads to reduced binding to
B7-1 and B7-2 (see id.), and all these residues, with the exception
of Pro101, are in direct contact with B7-1 (Stamper, C. et al.
(2001) Nature 410:608-611), suggesting that changes in this region
of bovine CD28 receptor have driven the natural evolution of bovine
B7-1 to acquire properties that also benefited the in vitro
evolution of CD28BP described herein.
[0679] CTLA-4BP 5.times.4-12c contained amino acid sequences
corresponding principally to the human, baboon, rhesus monkey and
bovine B7-1 genes (FIG. 8A), and the nucleotide and amino acid
sequences of CTLA-4BP were 97% and 96% identical with those of
hB7-1, respectively. In addition, CTLA-4BP 5.times.4-12c contained
three amino acid mutations that were not derived from any of the
starting genes (FIG. 8A). The remaining clones with preferential
binding to sCTLA-4-Ig over sCD28-Ig in the binding assays exhibited
95-99% identity with CTLA-4BP 5.times.4-12c (e.g., using DNASTAR or
Vector NTI algorithm with default parameters).
[0680] Tyr-31 in the mature sequence of CTLA-4BP 5.times.4-12c (as
measured from the N-terminus of the mature domain, using the amino
acid position and numbering corresponding to the amino acid
sequence of hB7-1 (SEQ ID NO:278) was replaced by histidine (i.e.,
Try31His); the Tyr31His substitution was also present in a number
of selected recombinant clones with preferential binding to CTLA-4,
whereas all selected clones with preferential binding to CD28
retained the tyrosine at that position. Tyr-31 was also present at
an equivalent position in all of the mature parental sequences.
Tyr-31 of the mature CTLA-4BP and mature hB7-1 sequences (as
measured from the N-terminus of the mature domain, using the amino
acid position and numbering corresponding to the amino acid
sequence of hB7-1) corresponds to Tyr-65 of the full-length
CTLA4-BP and hB7-1 sequences, respectively (as measured from the
N-terminus, which includes the signal peptide sequence). DNA
sequence analysis of CTLA-4BP 5.times.4-12c showed a mutation in
the codon corresponding to amino acid position 31 as measured from
the N-terminus in mature hB7-1--TAC--to codon CAC (at the
corresponding position in mature form of CTLA-4BP 5.times.4-12c).
Interestingly, it has been suggested that Tyr31 in human B7-2 may
be replaced by phenylalanine without any apparent change in the
ligand binding affinities 15' (see, e.g., Freeman, G. J. et al.
(1993) Science 262: 909-11); Azuma, M. et al. (1993) Nature
366:76-9), whereas a Tyr31Ala substitution in hB7-1 appears to
completely abolish the binding of hB7-1 to both CD28 and CTLA-4
(see Peach, R. J. et al. (1995) J Biol Chem 270:21181-7). The
present data demonstrate that the Tyr31His substitution, at least
when present in the context of the shuffled CTLA-4BP sequence, does
not significantly affect interaction with CTLA-4, whereas this
mutation appears to contribute to the loss in binding to CD28,
further supporting the suggestion that this residue, plays an
important role in the ligand binding of B7-1. Information regarding
the three-dimensional structures of CD28BP and CTLA-4BP is useful
in characterizing further the amino acid residues and structures
that contribute to the preferential binding of NCSMs to their two
respective ligands.
[0681] Sequence Round 2 CD28BP clones showed a range of amino acid
and nucleotide diversity from wild-type B7-1 molecules. For
example, the Round 2 CTLA4BP clones had a 93.8-96.9% amino acid
identity with a WT B7-1 molecule and had a 96.2-97.7% identity at
the nucleotide level.
[0682] The amino acid sequence of clone R2 CD28BP-15 differs from
that of identical clones R2 CD28BP-3, -6, and -9 by only one amino
acid residue at position 110; CD29BP-15 has a proline residue at
position 110; clones CD28BP-3, -6, and -9 include a leucine residue
at position 110.
[0683] The binding of labeled soluble ligand sCD28-Ig and sCTLA4-Ig
to clones CD28BP-15 and CTLA-4BP 5.times.4-12c was further studied,
as shown in FIGS. 9A-9H. Specifically, 293 cells were transiently
(FIGS. 9A-9B) or stably (FIGS. 9C-9D) transfected with CD28BP-15
(solid circles) or hB7-1 (open squares), and with (dashed lines)
and without (solid lines) a FLAG-tag. 293 cells were stably
transfected with CTLA-4BP 5.times.4-12c (solid triangles) or WT
hB7-1 (open squares) (FIGS. 9D-9E). Cells transiently (FIGS. 9A-9B)
or stably (FIGS. 9C, 9D, 9E, 9F) transfected with a vector lacking
a WT hB7-1, CD28BP or CTLA-4BP nucleic acid insert were used as
negative controls (open diamonds). The transfectants were stained
with increasing concentrations of labeled soluble CD28-Ig (FIGS.
9A, 9C, 9E) or soluble CTLA-4-Ig (FIGS. 9B, 9D, 9F), prepared as
described above, and the cells were analyzed by flow cytometry.
Stable 293 transfectants expressing CTLA-4BP 5.times.4-12c (gray
histograms), hB7-1 (gray histograms) and negative control
transfectants (open histograms) were stained with anti-hB7-1 mAbs
(FIGS. 9G-9H), and the expression levels were analyzed by flow
cytometry.
[0684] Staining of transfectants individually with sCD28-Ig or
sCTLA-4-Ig indicated that CD28BP-15 transfectants bound sCD28-Ig at
higher levels than transfectants expressing hB7-1 (as shown by
increased MFI values), while sCTLA-4-Ig binding was significantly
reduced, yet detectable (FIGS. 9A-9D) (as indicated by reduced
MFI). On the other hand, little or virtually no binding of sCD28-Ig
to CTLA-4BP 5.times.4-12c transfectants was detected even at high
sCD28-Ig concentrations, while the same transfectants did bind
sCTLA-4-Ig, although at somewhat lower levels than the
transfectants expressing hB7-1 (FIGS. 9E-9F) (as shown by MFI
values). The lack of binding of sCD28-Ig to CTLA-4BP 5.times.4-12c
was not due to the lack of expression, as was determined by the
binding of anti-hB7-1 monoclonal antibody (mAb) to the
transfectants (FIGS. 9G-9H). In contrast to CTLA-4BP 5.times.4-12c,
mAbs specific for hB7-1 did not recognize CD28BP (data not
shown).
[0685] To analyze whether increased expression of CD28BP-15 on the
transfected cells contributed to the improved binding of sCD28-Ig,
we fused a FLAG-tag (see according to Brizzard, B. L. et al. (1994)
Biotechniques 16:730-5) to hB7-1 and the shuffled clones, and the
binding of a FLAG-specific mAb M2 (see id.) to the corresponding
transfectants was studied. In seven separate transient
transfections, the mean fluorescence intensity (MFI) of 293 cells
transfected with CD28BP-FLAG and hB7-1-FLAG was 52.+-.20 and
55.+-.12, respectively (mean.+-.SEM). Although no significant
difference in the expression of the FLAG-constructs was observed,
significantly improved binding of CD28-Ig was also observed using
the FLAG-constructs (FIGS. 9A-9B), strongly suggesting the improved
binding of sCD28-Ig by CD28BP-15 was due to improved affinity
rather than improved expression of CD28BP-15.
[0686] We also analyzed the ligand binding properties of all
starting B7-1 genes by two-color analysis using sCD28-Ig and
sCTLA-4-Ig to illustrate that CD28BP-14 and CTLA-4BP 5.times.4-12c
showed evidence of truly new properties. 293 cells transfected with
human, rhesus monkey, orangutan, and baboon B7-1 genes exhibited
essentially identical binding profiles to SCD28-Ig and sCTLA-4-Ig,
whereas feline B7-1 showed little or no binding to sCD28-Ig or
sCTLA-4-Ig (data not shown). Bovine and rabbit B7-1 transfectants
demonstrated sCD28-Ig binding in the same range as that observed
for human and primate B7-1, but their level of binding to
sCTLA-4-Ig was somewhat lower. However, the binding level of
sCTLA-4-Ig to CD28BP-15 was consistently less than that of any of
the other starting genes; the mean MFIs of sCTLA-4-Ig binding to
human (n=4), bovine (n=4), rabbit B7-1 (n=2), and CD28BP-15 (n=2)
were 247, 102, 205, and 30, respectively. Thus, CD28BP-15 and
CTLA-4BP 5.times.4-12c displayed properties that were unique as
compared to any of the starting genes.
[0687] B. Functional Assays.
[0688] To investigate the functional properties of shuffled R2
CD28BP molecules, nucleic acid sequences corresponding to
representative clones R2 CD28BP-1 to R2 CD28BP-17 were transfected
into B7-negative cell lines and the capacity of the resulting
transfectants to activate human T cells was analyzed (using T cell
proliferation assays with .sup.3H thymidine incorporation as
described above). Representative results of selected clones are
shown in FIG. 10. When used to costimulate T cells in soluble
anti-CD3 induced proliferation assays, these selected clones
induced a range of proliferative responses from slight induction
(potential antagonist) to improved induction over human B7-1 (FIG.
10). At one end of the range, clone CD28BP-8 (amino acid SEQ ID.
NO:59), which was shown to bind CD28, induced low T cell
proliferation as compared to the wild-type hB7-1. CD28BP-8 induced
a T cell proliferation level slightly greater than that induced by
cells transfected with an empty vector (lacking a B7-1, CD28BP, or
CTLA-4BP nucleic acid insert). In contrast, CD28BP-15 induced a T
cell proliferation response significantly greater than that induced
by WT hB7-1 (FIG. 10). Other CD28BP clones induced a T cell
proliferation response about equal to that induced by WT hB7-1.
[0689] The enhanced co-stimulation of purified human T cells by
clone CD28BP-15 was further investigated as follows (FIGS.
11A-11C). 293 cells were transiently (FIG. 11A) or stably (FIG.
11B) transfected with CD28BP-15 nucleic acid, hB7-1 nucleic acid,
or an empty control vector lacking the B7-1 or CD28BP-15 nucleic
acid insert, and the irradiated transfectants were co-cultured with
purified human T cells and anti-CD3 mAbs (to induce costimulation
of T cells via the TCR) as described above. Mean.+-.SEM (standard
error of mean) of counts per minute (C.P.M.) (3H thymidine
incorporation) obtained in three (FIG. 11A) or six (FIG. 11B)
independent experiments are shown.
[0690] CD28BP-15 transfectants induced greatly increased
proliferation of purified human T cells cultured in the presence of
anti-CD3 mAbs compared to cells transfected with hB7-1 (FIG. 11A).
Moreover, we generated stable transfectants of CD28BP-15 and hB7-1
by selecting clones that expressed similar levels of the NCSM
molecules based on binding of sCD28-Ig at saturating
concentrations. Similar to transient transfectants, stable
transfectants expressing CD28BP-15 induced a more potent T cell
proliferation than those transfectants expressing hB7-1 (FIG.
11B).
[0691] Irradiated stable transfectants expressing CD28BP-15 or
hB7-1 and negative control cells transfected with a vector lacking
the insert were co-cultured with purified human T cells, and the
levels of IFN-gamma production were measured after a culture period
of 48 hours. A representative experiment is shown in FIG. 11C;
similar data were obtained in three other experiments. Production
of IFN-gamma in response to transfectants expressing CD28BP-15 was
higher than that induced by hB7-1 transfectants (FIG. 11C).
Approximately 10-fold fewer transient or stable transfectants
expressing CD28BP-15 than those expressing hB7-1 were required to
obtain a similar level of human T cell proliferation. Importantly,
the maximum levels of T cell proliferation and IFN-gamma production
were also increased (FIG. 11C). We believe these results are likely
attributable to the lack of negative signaling through CTLA-4. The
increased affinity to CD28 and reduced affinity to CTLA-4 appears
to have contributed to the CD28BP-15-mediated improved T cell
response.
[0692] The effect of Round 2 CTLA-4BP clones on purified T cells in
T cell proliferation assays was investigated. In a representative T
cell proliferation study performed as described above, 19 selected
clones of the R2 library (designated as CTLA4BP-1 through
CTLA4BP-19) having reduced binding to CD28, but relatively strong
binding to CTLA-4, were found to reduce T cell proliferation in a
soluble anti-CD3 induced T cell proliferation assay (see FIG. 12)
compared to that induced by wild-type hB7-1. Cells transfected with
an empty vector (lacking a B7-1 or CTLA-4BP nucleic acid insert),
were used as the control. These selected CTLA-4BP clones produced a
range of responses from reduced or suppressed induction of T cells
relative to hB7-1 induction, to a significant inhibition of T cell
proliferation (FIG. 12).
[0693] The effect of exemplary clone CTLA-4BP 5.times.4-12c on
purified T cells and on T cell proliferation and cytokine synthesis
induced in MLR was further investigated. Representative results are
shown in FIGS. 13A-13D. In the co-stimulation experiments, purified
T cells were co-cultured in the presence of soluble anti-CD3 mAbs
(5 micrograms/ml) and transient transfectants expressing hB7-1,
CD28BP-15, CTLA-4BP 5.times.4-12c, or a vector control lacking the
expressed sequence (FIG. 13A); a representative experiment is
shown. Similar data were obtained in two other experiments.
Increasing numbers of 293 cells stably transfected with CTLA-4BP
5.times.4-12c nucleic acid (solid triangles), hB7-1 nucleic acid
(open squares), or a control vector lacking a B7-1, CTLA-4BP, or
CD28BP nucleic acid insert (open diamonds) were added to the MLR
cultures, as shown in FIG. 13B. The data represent mean.+-.SEM of
C.P.M. obtained in six separate MLR cultures, each performed using
4-6 replicate wells. MLR was cultured in the presence of 25000
irradiated 293 cells stably transfected with hB7-1, CTLA-4BP
5.times.4-12c or a control vector without an insert, as shown in
FIGS. 13C-13D. IFN-gamma and IL-10 levels were measured by ELISA
after an MLR culture period of 48 hours (FIGS. 13C-13D). Six
independent experiments were performed and the values obtained
within one experiment are connected with a solid line. The
production levels of IFN-gamma significantly increased (P<0.05)
and those of IL-10 significantly decreased (P<0.01) for CTLA-4BP
5.times.4-12c compared to hB7-1 or vector control (paired Student's
t-test).
[0694] Relative to CD28BP-15, hB7-1, and a control vector, CTLA-4BP
5.times.4-12c exhibited very little ability to co-stimulate human T
cells cultured in the presence of soluble anti-CD3 mAbs (FIG. 13A).
No co-stimulation of human T cells was induced by either transient
or stable CTLA-4BP 5.times.4-12c transfectants, although efficient
expression of the molecule on the surface of the transfectants was
observed using anti-B7-1 mAbs (see FIGS. 9G-9H, FIG. 13A, and data
not shown). In fact, only 2 of 19 selected Round 0.2 clones (from
Group I of the second round of recombination) that displayed
preferential binding to CTLA-4 over CD28 had the capacity to induce
a T cell response that was more than 10% of that induced by hB7-1
(data not shown), illustrating the lack of sCD28-Ig binding to
these clones correlated with the lack of signaling through
CD28.
[0695] More importantly, CTLA-4BP 5.times.4-12c transfectants
inhibited T cell proliferation induced in a mixed lymphocyte
reaction (MLR) in a dose-dependent manner (FIG. 13B). Moreover,
CTLA-4BP 5.times.4-12c transfectants induced IL-10 production in
MLR, but reduced IFN-g production, compared to hB7-1 or control
transfectants (FIGS. 13D and 13C, respectively), further supporting
the notion that CTLA-4BP 5.times.4-12c has a dramatically altered
biological function as compared to hB7-1. Several studies have
suggested supporting roles for CTLA-4 (see, e.g., McAdam, A. J. et
al. (1998) Immunol Rev 165:231-47; Waterhouse, P. et al. (1995)
Science 270:985-8; Perez, V. L. et al. (1997) Immunity 6:411-7;
Shrikant, P. et al. (1999) Immunity 11:483-93; van Elsas, A. et al.
(1999) J Exp Med 190:355-66; Greenwald, R. et al. (2001) Immunity
14:145-155) and IL-10 (see, e.g., Groux, H. et al. (1997) Nature
389:737-42; Rizzo, L. V. et al. (1999) J Immunol 162:2613-22) in
inducing and maintaining immunological tolerance. The results of
the present invention also suggest that CTLA-4BPs of the invention,
including, e.g., CTLA-4BP 5.times.4-12c, are useful in
downregulating the function of specific T cells in autoimmune
diseases and the like, and are thus of benefit in therapeutic and
prophylactic methods for treating such diseases.
[0696] Previous studies on B7 mutants showed that binding sites for
CD28 and CTLA-4 are largely overlapping and that mutations in B7
that affected the binding to one ligand (i.e., CD28 or CTLA-4)
generally also affected the binding to the other ligand. However,
only a limited number of variants were tested and they were
generally designed based on information of expected ligand binding
sites. For example, in contrast to the present results, mutations
of human B7-1 (hB7-1) that were previously designed based on
structural information and predicted receptor binding sites
generally produced equivalent effects on binding to CD28 and CTLA-4
(see, e.g., Peach, R. J. et al. J Biol Chem 270, 21181-7 (1995).
The current data show that the frequency of functional variants
with altered ligand binding properties is sufficiently high enough
that a desired phenotype may be rapidly identified using the
appropriate selection criteria and screening procedures. Thus,
appropriate screening of the sequences produced by recombination of
known mammalian genomes serves as an effective means to identify
those recombined sequences having novel functional properties
without detailed knowledge of the receptor binding sites or the
structures of the proteins. These results illustrate the advantages
of the crossbreeding of mammalian genes of different species to
evolve proteins having novel functional properties. CD28BP and
CTLA-4BP may also help in further deducing the mechanisms by which
CD28 and CTLA-4 trigger positive and negative signals to T cells,
respectively. The fact that B7-1 and B7-2 naturally bind to both
CD28 and CTLA-4 has limited the potential scope of their clinical
applications. The chimeric CD28BP and CTLA-4BP molecules described
herein have wide-ranging clinical applications; they are useful,
for example, in the manipulation of T cell responses in vitro and
in vivo in a variety of pharmaceutical and medical applications and
vaccinations.
Example IV
Production of Soluble NCSM Polypeptides and Fusion Proteins and
Nucleic Acids Encoding Them
[0697] The present invention also provides soluble NCSM
polypeptides, and subsequences and fragments thereof that encompass
a variety of formats, described herein, including, but not limited
to, e.g., at least one of an extracellular domain (ECD), of a NCSM
polypeptide or a fragment, variant or homologue thereof, and an
NCSM-ECD-Ig fusion protein or fragment, variant, or homologue
thereof; and nucleotide and polynucleotide sequences encoding all
such polypeptides, proteins, fragments, homologues, and
variants.
[0698] A soluble form of an NCSM polypeptide is useful in in vivo,
ex vivo, or in vitro methods, including, e.g., therapeutic or
prophylactic treatment or diagnostic methods, administered as
either a DNA plasmid expression vector (e.g., DNA vaccine; gene
therapy applications) or protein, for treating or preventing
various immunological disorders and diseases, including, e.g.,
cancers, including, but not limited to, e.g., colorectal cancer,
breast cancer, pancreatic cancer, lung cancer, prostate cancer,
naso-pharyngeal cancer, cancer, brain cancer, leukemia, melanoma,
head- and neck cancer, stomach cancer, cervical cancer, ovarian
cancer, lymphomas, colon cancer, colorectal); allergy/asthma,
autoimmune diseases, organ transplantation (e.g., graft versus host
disease, and autoimmune diseases), chronic infectious diseases,
including, but not limited to, e.g., viral infectious diseases,
such as those associated with, but not limited to, e.g., hepatitis
B virus (HBV), herpes simplex virus (HSV), hepatitis C virus (HCV),
HIV, human papilloma virus (HPV), and the like, and bacterial
infectious diseases, such as, but not limited to, e.g., Lyme
disease, tuberculosis, and chlamydia infections; and other diseases
described herein for non-soluble NCSMs of the invention, and as
vaccine adjuvants in vaccine applications as described for
non-soluble NCSMS. Soluble NCSMs are also useful for diagnostic
purposes, as for in vitro applications for testing and diagnosing
such diseases.
[0699] In this example, selected CD28BP and CTLA-4BP clones were
used for the preparation of corresponding soluble CD28BP and
CTLA-4BP polypeptides and nucleic acids encoding such polypeptides.
A CD28BP ECD polypeptide or fragment thereof may have a CD28/CTLA-4
binding affinity ratio about equal to, equal to or greater than the
CD28/CTLA-4 binding affinity ratio of hB7-1, and other biological
properties described below; a CTLA-4BP ECD polypeptide of fragment
thereof may have a CD28/CTLA-4 binding affinity ratio equal to or
greater than that of hB7-1, and other biological properties
described below.
[0700] A. Expression Vectors Encoding Soluble ECDs of NCSM
Polypeptides
[0701] Mammalian expression plasmids encoding soluble (non-membrane
bound) extracellular domains (sECDs) of NCSM polypeptides (or
fragments thereof) were constructed by PCR amplification using pfu
turbo polymerase (Stratagene, La Jolla, Calif.) of selected NCSM
ECDs from plasmids containing a selected full-length NCSM DNA
sequence. The PCR primers were designed to specifically anneal with
the first or last 20-24 nucleotides of a particular nucleic acid
region corresponding to a NCSM ECD (or fragment thereof), and
flanked by restriction sites NheI and Nod, at their 5' and 3' ends,
respectively. Amplicons of .about.730 base pairs (bp) (specific
base pair numbers for each clone are shown in Table 5) encoding
individual ECDs (or fragments thereof) were digested with NheI and
Nod (New England BioLabs, Beverly, Mass.), subsequently purified by
low melt agarose gel electrophoresis (see procedure described in
Sambrook, supra). A pcDNA3.1(+) expression plasmid (Invitrogen,
Carlsbad, Calif.), which was used as the backbone vector, was
digested with NotI and ApaI restriction enzymes and fused (ligated)
in-frame to a nucleic acid sequence encoding a carboxy-terminal
epitope fusion tag comprised of the E-epitope (Amersham Pharmacia
Biotech) and hexa-His tag using standard cloning procedures. This
vector fragment was then digested with NheI and NotI and to an
.about.5400 by NheI-NotI fragment comprising the vector backbone
and E-epitope/His-tag fusion sequence. This vector fragment was gel
purified and ligated to each .about.730 by NheI-NotI NCSM ECD
polynucleotide to produce soluble ECD NCSM expression plasmids.
Mammalian expression plasmids encoding a soluble ECD form of
wild-type human B7-1 were similarly prepared from plasmids
containing the full-length WT human B7-1 DNA sequence.
TABLE-US-00005 TABLE 5 Nucleo- Amino tide Acid Clone ID Position
Position 3' end ECD wild-type huB7.1- 1-726 1-242 PDN ECD CD28BP-8
ECD 1-735 1-245 IDQ CD28BP-11 ECD 1-732 1-244 IDQ CD28BP-15 ECD
1-735 1-245 IDQ CTLA4-5X2-8C ECD 1-726 1-242 PDN CTLA4-5X2-10C ECD
1-726 1-242 PDN CTLA4-5X4-1F ECD 1-726 1-242 PDN CTLA4-5X4-11D ECD
1-726 1-242 PDN CTLA4-5X4-12C ECD 1-726 1-242 PDN CTLA4-5X5-2E ECD
1-726 1-242 PDN CTLA4-5X5-6E ECD 1-726 1-242 PDN CTLA4-5X6-9D ECD
1-726 1-242 PDN CTLA4-5X8-1F ECD 1-726 1-242 PDN Nucleo- Amino tide
Acid Clone ID Position Position 5' end Fc P01857 Hu IgG1-Fc 298-690
100-230 PKSCDKTH . . .
[0702] Table 5 shows for positions of nucleotide residues and
corresponding amino acid residues of the signal peptide sequence
and representative ECD domains of selected CD28BP and CTLA-4BP
clones, and equivalent positions in WT hB7-1 ECD, and the last
three amino acid residues at the 3' end of each ECD of a selected
NCSM clone or WT hB7-1. The present invention provides for ECD
domains of the NCSM polypeptides (and nucleic acid sequences
encoding such polypeptides) that lack the signal peptide sequence,
such that the first about 33 or about 34 amino acids (or about 99
or about 102 nucleic acids encoding same, respectively) of each
NCSM ECD polypeptide (or nucleic acid encoding said polypeptide)
are absent. For example, in CD28BP-15 polypeptide (SEQ ID NO:66),
the amino acid sequence of the signal peptide comprises
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSG (see FIG. 2A), and the nucleic
acid sequence that encodes the signal peptide comprises at least
about the first 102 nucleotide residues of SEQ ID NO:19. The signal
peptide sequence of NCSM molecules may vary in length. One of
ordinary skill in the art can readily determine the amino acid
sequence of an NCSM molecule that comprises the signal peptide
sequence by aligning the full-length amino acid sequence of WT
hB7-1 with the full-length amino acid sequence of the NCSM
molecule, comparing the signal peptide sequence of WT hB7-1 with
the corresponding sequence of the NCSM molecule, and determining
the segment of the full-length amino acid sequence of the NCSM
molecule that corresponds to the signal peptide. The nucleic acid
sequence that encodes the signal peptide of hB7-1 comprises the
nucleotide residues of SEQ ID NO:273 that encode the signal peptide
of SEQ ID NO:278. The nucleic acid sequence that encodes the signal
peptide of an NCSM molecule can be similarly determined by
comparison of the full-length nucleic acid sequence of WT hB7-1
with the full-length nucleic acid sequence of the NCSM
molecule.
[0703] FIG. 14A shows a schematic representation of a hB7-1-ECD
fused to an E-epitope amino acid sequence and a hexa-His tag amino
acid. The amino acid sequences corresponding to the E-epitope and
hexa-His tag, and selected amino acids of the ECD, are shown.
[0704] A representative plasmid expression vector, termed
pNSCMsECD, comprising 6063 bps and encoding a soluble NCSM ECD,
made by the above procedure is shown in FIG. 15. The vector
includes, among other things, selected elements of the pcDNA3.1(+)
backbone, including an ampicillin resistant gene, A.sup.R, and a
bovine growth hormone (BGH) poly A termination sequence; nucleic
acid sequence encoding an E-epitope/his tag; nucleic acid sequence
encoding a NCSM-ECD; and a CMV promoter (e.g., known or WT CMV
promoter, such as human CMV promoter, or recombinant or chimeric
CMV promoter). A plasmid vector encoding a soluble hB7-1-ECD or
fragment thereof can be made by substituting a hB7-1-ECD sequence
or fragment thereof for the NCSM-ECD sequence shown in the
figure.
[0705] A plasmid expression vector encoding either a soluble
NCSM-truncated ECD (e.g., NCSM ECD fragment) or a soluble WT
hB7-1-trunECD can be made using the procedure above by substituting
a truncated NCSM ECD nucleic acid sequence or truncated hB7-1 ECD
nucleotide sequence for NCSM ECD nucleotide sequence. Table 6 shows
the positions of nucleotide residues and corresponding amino acid
residues of the signal peptide sequence and exemplary truncated ECD
domains of selected CD28BP and CTLA-4BP clones and WT hB7-1 ECD,
and the last three amino acid residues at the 3' end of each
truncated ECD of a NCSM clone or WT hB7-1.
TABLE-US-00006 TABLE 6 Nucleo- Amino tide Acid Clone ID Position
Position 3' end ECD wild-type huB7.1- 1-702 1-234 NIT ECD CD28BP-8
ECD 1-717 1-237 SKP CD28BP-11 ECD 1-717 1-237 SKP CD28BP-15 ECD
1-717 1-237 SKP CTLA4-5X2-8C ECD 1-702 1-234 NTP CTLA4-5X2-10C ECD
1-702 1-234 NTP CTLA4-5X4-1F ECD 1-702 1-234 NTP CTLA4-5X4-11D ECD
1-702 1-234 NTP CTLA4-5X4-12C ECD 1-702 1-234 NTP CTLA4-5X5-2E ECD
1-702 1-234 NTP CTLA4-5X5-6E ECD 1-702 1-234 NTT CTLA4-5X6-9D ECD
1-702 1-234 NTP CTLA4-5X8-1F ECD 1-702 1-234 NTP Nucleo- Amino tide
Acid Clone ID Position Position 5' end Fc X70421 Hu IgG1-Fc 85-768
29-256 DKTH . . .
[0706] The invention also provides for ECD domains of the NCSM
polypeptides (and nucleic acid sequences encoding such
polypeptides) that lack the signal peptide sequence; the first 34
amino acids (or 102 nucleic acids encoding same) of each NCSM ECD
polypeptide (or nucleic acid encoding a NCSM ECD polypeptide) are
absent. In secreted forms, the signal sequence is cleaved.
[0707] B. Expression and Purification of Soluble ECD and NSCM
Polypeptides.
[0708] Soluble polypeptides from the CTLA-4BP-ECD, CD28BP-ECD, and
hB7-1-ECD expression vectors described above was expressed by
transfection of these vectors into cells of a human HEK 293 cell
line using Superfect Reagent (Qiagen) and expression of the
sequence encoding the NCSM ECD or a fragment thereof. In each case,
soluble protein was purified from crude culture supernatants using
a Hi-Trap anti-e-epitope mAb affinity column (Amersham-Pharmacia,
Piscataway, N.J.) followed by buffer exchange into PBS, according
to the manufacturer's instructions. Purity of a recovered fusion
protein was assessed by SDS-PAGE followed by either coumassie stain
or immunoblotting with a mouse anti-penta-His mAb (Serotech, UK),
performed according to manufacturer's instructions and using known
methods as described in, e.g., Rapley and Walker; Harlow and Lane;
Colligan; Sambrook, all supra (data not shown). The SDS-PAGE
results for soluble hB7-1-ECD and soluble CD28BP-15 sECD revealed a
molecular weight (MW) of .about.50 kDa for each, as shown in FIG.
16. A reference mixture spotted in the far-left lane indicated
bands of compounds of known MWs of 188 kiloDaltons (kDa), 98 kDa,
56 kDa, and 31kDa, respectively, for comparison. SDS-PAGE analysis
showed a hB7-1-Ig fusion protein homodimer of .about.140 kDa; this
dimer is believed to contain a covalent linkage between cysteine
residues of the hinge-CH2--CH3 domain of the Fc. A hB7-1-Ig monomer
thus has an apparent MW of .about.70 kDa. A-70-kDa monomer of
hB7-1-Ig-delta Cys mutant fusion protein was also observed (see
FIG. 16). It is believed the deleted cysteine (.delta.Cys) mutant
prevents covalent dimerization of two individual
B7-1-ECD/hinge-CH2--CH3 (Ig) molecules.
[0709] C. Expression Vectors Encoding Soluble NCSM-Ig Fusion
Proteins.
[0710] Mammalian expression plasmids encoding a soluble NCSM-ECD-Ig
fusion protein and soluble WT hB7-1-ECD-Ig fusion protein were
constructed first by PCR amplification using pfu turbo polymerase
(Stratagene, La Jolla, Calif.) of selected NCSM ECDs or hB7-1-ECD
from plasmids containing a full-length NCSM DNA sequence and hB7-1
DNA sequence as described above. The PCR primers were designed to
anneal specifically with the first or last 20-24 nucleotides of a
particular nucleic acid region corresponding to the ECD of a
specific NCSM or hB7-1, and flanked by restriction sites BamHI and
BsteII, at their 5' and 3' ends, respectively. In some instances,
the small peptide linker forming the in-frame translational
coupling between the NCSM ECD (or hB7-1) and the IgG1 Fc contained
the sequences valine-threonine (VT) or glycine-valine-threonine
(GVT), depending upon the nucleotide sequence compatibility of the
3' codon of the NCSM ECD. Incorporation of the BsteII restriction
site at the fusion junction creates the in-frame valine-threonine
linker. The factor Xa cleavage site (IEGR) was inserted between the
3' end of the NCSM ECD (or hB7-1 ECD) and 5' end of the GVT or VT
linker to allow production of sECD void of the Fc domain (FIG.
14B).
[0711] DNA sequences encoding human IgG1 Fc were obtained from
human spleen mRNA (Clontech, Palo Alto, Calif.) using a RT-PCR kit
(Stratagene, La Jolla, Calif.) according to the manufacturer's
instructions, and primers specific to the first or last 20-28
nucleotides of the sequence corresponding to the entire human IgG1
Fc hinge domain or a fragment thereof (see, e.g., the protein
sequences shown at GenBank Accession Nos. P01857 and X70421,
respectively; other Fc sequences can also be used) flanked by
restriction sites BstEII and EcoRI, at their 5' and 3' ends,
respectively (FIG. 14B). Alternatively, a variant derived from a
human IgG1 Fc hinge domain (e.g., GenBank Access. No. P01857 or
X70421) can be prepared that imparts specific desirable biological
and pharmacological properties to the soluble NCSMs.
[0712] The IgG1-Fc amplicon (-730 bp) was digested with BstEII and
EcoRI and subsequently cloned into pcDNA3.1(+) expression vector
(serving as a backbone vector) digested with BamHI and EcoRI. The
NCSM-Ig expression plasmids were constructed by ligating (fusing
in-frame) low melt agarose purified NCSM BamHI-BstEII DNA fragments
(.about.730 bp), Ig-Fc BstEII-EcoRI DNA fragments (.about.730) and
pcDNA3.1(+) BamHI-EcoRI DNA fragment (-5400 bp) to produce soluble
NCSM-ECD-IgFc fusion expression vectors (see FIG. 17).
[0713] A sequence complementary to either that corresponding to the
sequence shown at GenBank Accession No. X70421 or P01857 and an IgG
Fc variant containing two amino acid substitutions (D234E and
L241M) were cloned and deduced by DNA sequence analysis using known
methods. The NCSM-Ig fusions proteins may contain an IgG Fc
sequence corresponding to that shown at GenBank Accession No.
X70421 or P01857 or IgG Fc variant sequence as the fusion
partner.
[0714] FIG. 14B shows a representation of a soluble WT human
B7-1-ECD-Ig sequence, including the signal domain, ECD, Factor Xa
(IEGR), VT or GVT linker, and human B7 hinge CH2--CH3 domain of the
Fc region of IgG1 corresponding to the sequence shown at GenBank
Accession No. P01857. The amino acid residues positioned at the
beginning and end of a representative ECD domain and 5' end of the
human B7 hinge CH2--CH3 domain are shown. A NCSM-ECD-Ig sequence
would be comparable to that shown for hB7-1ECD-Ig in FIG. 14B.
[0715] Nucleotide sequences encoding truncated NCSM ECDs or
truncated hB7-1ECDs were also used to make NCSM-trunECD-Ig and
hB7-1-trun ECD-Ig expression constructs and fusion proteins,
respectively. Truncated NCSM ECDs typically contained at least one
less amino acid residue than the full-length NCSM ECD; nucleotide
sequences encoding truncated NCSM ECDs comprised corresponding
fewer nucleotides.
[0716] The nucleotide positions and corresponding amino acid
positions of an exemplary full-length ECD or truncated ECD of
selected NCSM clones and hB7-1 used for construction of expression
plasmids encoding the fusion proteins are shown in Tables 5 and 6.
Table 5 shows the nucleotide positions and corresponding amino acid
positions of the hIgG1 Fc sequence shown at GenBank Accession No.
P01857, and amino acid residues at the 5' end of this Fc region.
Table 6 shows the nucleotide positions and corresponding amino acid
positions of the hIgG1 Fc sequence at GenBank Accession No. X70421,
and amino acid residues at the 5' end of this Fc region. The
invention also provides for fusion proteins in which the ECD
domains of the NCSM polypeptides (and nucleic acid sequences
encoding such polypeptides) lack the signal peptide sequence; in
this aspect, the first 34 amino acids (or 102 nucleic acids
encoding same) of each NCSM ECD polypeptide (or nucleic acid
encoding NCSM ECD polypeptide) is absent. In secreted forms, the
signal sequence is cleaved.
[0717] A representative plasmid vector encoding a soluble
hB7-1-ECD-Ig fusion protein, phB7-1-ECD-Ig, is shown in FIG. 17.
The vector includes, among other things, selected elements of the
pcDNA3.1(+) backbone, including an ampicillin resistant gene,
A.sup.R, and a bovine growth hormone (BGH) poly A termination
sequence; nucleic acid sequences encoding a hB7-1-ECD/IgG1 Fc
fusion protein; and a CMV promoter (e.g., known or WT CMV promoter,
such as human CMV promoter, or recombinant or chimeric CMV
promoter). A plasmid vector encoding a soluble NCSM-ECD-IgG1 fusion
protein or fragment thereof can be made by substituting a NCSM-ECD
sequence or fragment thereof for the hB7-1 ECD sequence in the
vector shown in FIG. 17. Plasmid vectors encoding a
hB7-1-trunECD-Ig or NCSM trunECD-Ig fusion protein are also be made
using the same procedure.
[0718] In another aspect, a non-dimerizing Ig-Fc domain
(PKSCDKTHTCPPCP.fwdarw.PKSSDKTHTSPPSP) was engineered by PCR
mutagenesis (Stratagene, La Jolla, Calif.) to mutate the cysteine
residues within the Ab hinge region to serine residues so as to
prevent the formation of NCSM-ECD-Ig or hB7-1-ECD-Ig homodimers
covalently linked by disulfide bonds between the hinge-CH2
cysteines of neighboring NCSM-ECD-Ig or hB7-1-ECD-Ig molecules.
This non-dimerizing Ig-Fc domain can alternatively be used as the
Ig portion in an NCSM-ECD-Ig or hB7-1-ECD-Ig fusion protein
prepared as described above. Affinity purified
huB7-1-ECD-Ig.delta.Cys, comprising hB7-1-ECD fused to Ig in which
the cysteines were mutated (represented by delta or 6Cys) was shown
to have a molecular weight of .about.70 kDa (molecular size of
non-disulfide linked Fc fusion monomer) (FIG. 16). The present
invention provides similarly prepared Cys-mutant Ig fusion
proteins, NCSM-ECD-Ig.delta.Cys or NCSM-trunECD-Ig.delta.Cys, and
nucleic acid sequences encoding such proteins.
[0719] D. Expression and Purification of Soluble NCSM ECD-Ig
Protein
[0720] Soluble protein from CTLA-4BP-ECD-Ig fusion and
CD28BP-ECD-Ig fusion expression vectors was expressed by
transfection into cells of a human HEK 293 cell line using
Superfect Reagent (Qiagen) and purified from crude cultured
supernatants using a Hi-Trap Protein-A affinity column
(Amersham-Pharmacia, Piscataway, N.J.) followed by buffer exchange
into PBS, according to the manufacturer's instructions. Purity of
the recovered fusion protein was assessed by SDS-PAGE followed by
either silver stain or immunoblotting with a goat anti-human IgG Fc
specific horseradish peroxidase (HRP) mAb (Kirkegaard and Perry
Laboratories), according to manufacturer's instructions and known
methods as described in, e.g., Rapley and Walker, Sambrook, and
Colligan, all supra.
[0721] As an example, a soluble wild-type human B7-1-ECD-Ig fusion
protein (e.g., comprising, in part, an ECD fragment, "truncated
ECD," or full-length ECD of hB7-1) was purified from human HEK 293
cells transfected with the expression plasmid, phuB7-1 ECD-Ig,
using Protein-A affinity chromatography and fractionated on a
SDS-PAGE. Serial dilutions of soluble human B7-1 ECD-Ig fusion
protein showed a band which co-migrated with a commercially
available form of soluble WT human B7-1-ECD-Ig or B7-2-ECD-Ig
fusion protein from R&D Systems, thus demonstrating that a
protein of the correct molecular weight for a soluble WT
hB7-1-ECD-Ig fusion protein was produced in vitro (data not shown).
The results indicated that WT hB7-1 ECD-Ig fusion protein is
predominantly an ECD-Ig homodimer fusion protein. (Soluble hWT
hB7-1 ECD monomer was shown to have a molecular weight on SDS-PAGE
of about .about.50 kDa.) SDS-PAGE analysis revealed the affinity
purified CD28BP-15 ECD-Ig and CTLA-4BP 5.times.4-12C ECD Ig fusion
proteins co-migrated with WT human B7-1 ECD-Ig fusion proteins, as
shown in FIG. 18, and thus have molecular weights nearly identical
to or at least approaching that of WT hB7-1 ECD-Ig fusion protein.
A reference mixture included at the far-left shows bands of
compounds of known MWs (FIG. 18).
[0722] Crude supernatants from HEK 293 cells transfected with
expression plasmids encoding either a soluble (e.g., truncated or
full-length ECD) fusion protein form of various CTLA-4BPs and
CD28BPs of the invention, a WT hB7-1-ECD-Ig, or a pcDNA3.1(+)
vector control were fractionated on an SDS-PAGE, blotted to
nitrocellulose and hybridized with a goat anti-human IgG Fc
specific HRP mAb using known Western blotting methods (e.g., Rapley
and Walker; Sambrook; Harlow and Lane, all supra). Results, shown
in FIG. 19, showed a predominant band and fainter band around
.about.140 kD and .about.70 kDa, respectively, which correspond to
the predicted molecular weight of dimeric and monomeric forms of
the NCSM fusion proteins. 8 potential N-glycosylation sites located
in the ECD. Note that the MWs are approximate weights, since the
proteins may be glycosylated. A band co-migrating with soluble WT
hB7-1ECD-Ig was visible for all CTLA-4BP ECD-Ig and CD28BP ECD-Ig
fusions. NCSM-trunECD-Igs also showed similar results to
hB7-1-trunECD-Igs. The supernatant from the negative control
transfection (HEK 293 cells transfected with a pcDNA3.1(+) vector)
did not produce a detectable band. Oligomeric or multimeric forms
(NCSM-ECD-Ig dimers, trimers, etc.) were observed for CTLA-4BPs
(Clones 5.times.4-11D, 5.times.4-12C, 5.times.5-2E, 5.times.8-1F)
and CD28BPs (Clones 8 and 11).
[0723] E. Construction of Stable Cell Lines Expressing Soluble
NCSM-ECD and NCSM-ECD-Ig
[0724] Stable 293 cell lines expressing soluble NCSM-ECD
(NCSM-sECD) polypeptides or soluble NCSM-ECD--Ig fusion proteins
were produced by electroporating HEK 293 cells with DraHI digested
expression plasmids comprising nucleic acid sequences encoding such
polypeptides or proteins according to the known methods as
described in, e.g., Ausubel and Sambrook, both supra. Stable
integrants were selected using DMEM containing 10% FCS and 2 mg/ml
G418 antibiotic (Geneticin, Gibco-BRL). Purification was performed
as described above except the eluate containing NCSM-Ig fusions
from the Protein-A column was further purified by standard
gel-filtration chromatography (size-exclusion chromatography) (see,
e.g., Rapley and Walker; Sambrook, both supra) using a Superdex 200
10/30 (24 ml) column (Amersham-Pharmacia) (following manufacturer's
instructions) to remove non-NCSM proteins. The approximate apparent
molecular weights (App MW) of purified soluble NCSMs as determined
by this gel-filtration analysis are shown in Table 7 below.
TABLE-US-00007 TABLE 7 Molecule Type App MW (kDa) sCD28BP-15-ECD
~49.04 HuB7-1/IgFc (commercial, R&D Systems) ~643.39
wtHuB7-1-Ig ~320.02 wtHuB7-1-Ig.delta.Cys ~403.31 CTLA-4BP
5X4-12C-ECD-Ig ~330.28 CTLA-4BP 5x4-12C-ECD ~106 CD28BP-15-ECD-Ig
~345.54
[0725] In addition to monomers of NCSM-ECD-Ig and NCSM-trun-ECD-Ig,
the present invention includes aggregates and multimers (e.g.,
crosslinked forms) of the soluble NCSM polypeptides of the
invention, such as, e.g., NCSM-ECD-Ig and NCSM-trun-ECD-Ig, where
the Ig portion comprises an Fc region or variant thereof as
described above.
[0726] F. In Vitro Characterization of Biological Activities.
[0727] 1. T Cell Proliferation Assays Using Soluble NCSM Fusion
Proteins
[0728] Soluble NCSM were generated and purified as described above.
Human wild-type B7-1 was also expressed using the same methods. In
addition, a commercial human wild-type B7-1-Ig fusion protein was
obtained from R&D Systems (see also Table 7). To characterize
the biological properties of these molecules, two different formats
were used to further analyze the effects of crosslinking and
non-crosslinking on the function of the molecules. More
specifically, we analyzed the fusion proteins both as standard
non-crosslinked soluble molecules as well after preincubation with
mAbs specific for the Fc portion of human IgG (crosslinked
molecules). Crosslinking has previously been shown to affect the
function of wild-type human B7-1 (Rennert et al., Intl Immunol.
1997 Jun; 9(6):805-13). Crosslinked molecules comprise at least two
molecules of interest, e.g., multimers, such as two NCSM molecules.
A non-crosslinked NCSM molecule comprises one NCSM molecule.
[0729] Purified human T cells were used in these studies. T
lymphocytes were sorted using a Moflow flow cytometer by the
methods described previously in "T Cell Proliferation Assay" in the
"Materials and Methods" section above and used at 1.times.10.sup.5
cells/well in U-shaped 96-well assay plate. T cells were cultured
in the presence of soluble anti-CD3 mAbs (Pharmingen, San Diego,
Calif.) to deliver a primary signal (also called Signal 7). The
secondary signal to T cells was delivered by adding the purified Ig
fusion proteins; e.g., WT hB7-1-ECD-Ig, CD28BP-ECD-Ig, or
CTLA-4BP-ECD-Ig were added at various concentrations, and anti-CD28
mAbs (Pharmingen) were used as a positive control. To obtain
crosslinked Ig-fusion molecules, purified Ig fusion proteins were
pre-incubated with 5-fold excess of affinity-purified goat
anti-human IgG Fc portion (KPL, Gaithersburg, Md.) for 30 minutes
(min) on ice prior to use. The cross-linked complex was then added
into 96-well plate containing T cells in total volume of 200 ul of
Yssel's medium (Yssel et al. (1984) J Immunol Methods 72(1):219)
supplemented with 10% FBS. Assay plates were incubated for total of
3 days. The cultures were pulsed with 1 microCi/well of
.sup.3H-thymidine (Amersham, Piscataway, N.J.) during the last 8
hours of incubation and then harvested. .sup.3H-thymidine
incorporation (cpm) was calculated from triplicate cultures.
[0730] A representative experiment using crosslinked fusion
proteins and purified human T cells is shown in FIG. 20A.
Increasing concentrations (conc) of soluble Ig-fusion proteins of
hB7.1 (solid square), CD28BP-15 (open triangle) and a control
antibody human IgG (open circle) were added at various
concentrations to the cultures as indicated. A fixed concentration
(125 micrograms/milliliter (25 ug/ml)) of goat anti-human IgG Fc
was preincubated with soluble Ig-fusion proteins prior to use. The
data represent a mean+/-SD of C.P.M. Both crosslinked
CD28BP-15-ECD-Ig-fusion protein and WT hB7-1-ECD-Ig fusion protein
induced a strong proliferative effect on purified human T cells
cultured in the presence of anti-CD3 mAbs. CD28BP-15-ECD-Ig fusion
protein induced a more significant T cell proliferation response
than did hB7-1-ECD-Ig fusion protein after cross-linking with goat
anti-human IgG Fc antibodies. FIG. 20E represents a summary of data
from 4 separate experiments using crosslinked fusion proteins
comprising NCSM multimers and purified human T cells as described
in FIG. 20A above. The data represent a mean+/-SEM of C.P.M. Based
on these analyses using anti-human IgG mAbs to make multimeric,
crosslinked NCSM molecules, crosslinked CD28BP-ECD-Igs (e.g.,
CD28BP-15-ECD-Ig) promoted activation of the CD28 receptor to a
greater extent than did crosslinked WT hB7-1-ECD-Ig.
[0731] These data indicate that the formulation/multimerization of
the soluble NCSM fusion proteins and soluble NCSMs significantly
affects their biological properties. That is, soluble multimeric
forms of NCSM molecules (e.g., comprising two or more subunits of a
NCSM-ECD-Ig, NCSM-trunECD-Ig, NCSM-ECD, NCSM-trunECD or other
protein and fusion protein variants thereof) have biological
properties that are different from corresponding soluble monomeric
forms. In such multimeric forms, each NCSM subunit of the multimer
need not be identical. Soluble multimeric forms comprising two or
more NCSM subunits (e.g., NCSN-ECD subunits) can be made by
crosslinking, using leucine zippers, or engineering the subunits by
other means known to those skilled in the art for making multimers
or aggregates. When tested as soluble molecules without
crosslinking, soluble monomeric CD28BP-15-ECD-Ig fusion proteins
inhibited PHA-induced proliferation of human PBMC (see below).
However, similar to the membrane-bound version of CD28BP-15 (full
length), the crosslinked soluble CD28BP-ECD-Ig molecule strongly
enhanced the proliferation of purified T cells in the presence of
soluble anti-CD3 mAbs. These data indicate that crosslinked or
aggregated (e.g., multimeric) forms of soluble forms of the NCSM
polypeptides (e.g., soluble NCSM-ECD-Ig, NCSM-trunECD-Ig, NCSM-ECD,
NCSM-trunECD and other protein and fusion protein variants thereof)
are promising drugs to activate the immune system, which is
expected to be beneficial in the treatment of malignant diseases
(e.g., cancer), infectious diseases, and immunodeficiencies. The
crosslinking can be generated in vitro (e.g., as described in
assays above) or in vivo (e.g., through high-affinity binding to Fc
receptors on antigen-presenting cells). In addition, when using
cell-based vaccines, the crosslinking can be caused by transfecting
receptors for human IgG (Fc receptors) into the cells that are used
as vaccines (and the NCSM-Ig fusion binds to the Fc receptors
expressed on the cells that are used as vaccines. In contrast,
without prior crosslinking, the soluble NCSM polypeptides inhibited
the PHA-induced proliferation of human PBMC, indicating that they
have inhibitory effects on human T cell function. Furthermore,
soluble CD28BP-ECD (without Ig portion) strongly inhibited T cell
proliferation in vitro. Therefore, these soluble NCSM polypeptides
are promising drugs for the treatment of autoimmune and
inflammatory diseases, such as rheumatoid arthritis, multiple
sclerosis, inflammatory bowel disease, psoriasis, and organ
transplantation.
[0732] When PBMCs were cultured in the presence of the soluble
molecules of CD28BP-15-ECD-Ig or CTLA-4 BP 5.times.4-12c-ECD-Ig
without prior crosslinking (and no PHA), no T cell activation was
observed except in the case of insect cell derived commercial
wild-type B7-1-Ig (see Table 7). An increasing concentration of
non-crosslinked ECD-Ig fusion proteins of hB7.1 (solid square), and
a control antibody human IgG (open circle), and commercially
obtained insect cell derived human B7-1-Ig fusion proteins (R&D
Systems) (solid triangle), were added to cultures of PBMC and
proliferation was measured as described above (FIG. 20B). The
insect cell derived human B7-1-Ig fusion proteins induced
proliferation of human PBMC, whereas the hB7-1 expressed in 293
cells did not induce T cell proliferation. When these proteins were
analyzed by gel filtration, it was evident that the protein
expressed in insect cell had a 2-fold higher molecular weight than
hB7-1-Ig fusion expressed in 293 cells (Table 7). These data
further, support the conclusion that higher molecular weight
aggregates (e.g., crosslinked or multimeric molecules) improve the
capacity of these soluble NCSM polypeptides to signal through their
respective ligands.
[0733] We also performed a PHA-activated T cell proliferation
assay. In this assay, PBMCs were isolated from human blood by
centrifugation over Histopaque-1077. PBMCs were used at
1.times.10.sup.5 cells/well in 96-well round bottom plate (Costar);
each well contained a total volume of 200 ul Yssel's medium (Yssel
et al. (1984) J Immunol Methods 72(1):219) supplemented with 10%
FBS. 1 ug/ml of PHA (Phytohemagglutinin) (Sigma, St. Louis Mo.) was
added into these cultures. PHA is a plant protein (lectin-like
molecule) that is extracted from Phaseolus vulgaris (red kidney
bean) and binds to various sugars and sugar residues in
oligosaccharides. PHA is used as a T cell mitogen to activate T
cells (including, e.g., memory T cells, naive T cells, etc.).
Increasing concentrations (ug/ml) of soluble non-crosslinked
CD28BP-15-ECD-Ig (open triangle), non-crosslinked hB7-1-ECD-Ig
(solid square), R&DhB7-1-Ig fusion proteins (R&D Systems,
Minneapolis, Minn.) (solid triangle), made as described previously,
and CTLA-4-Ig ligand (R&D Systems) (solid diamond) and control
hIgG antibody (open circle)(Jackson ImmunoResearch Lab. Inc., West
Grove, Pa.) were added to these cultures as shown in FIG. 20C. The
data represent mean+/-SEM of a representative of 4 experiments,
each preformed using triplicate wells. When the soluble
CD28BP-15-ECD-Ig fusion proteins were cultured as soluble molecules
without prior crosslinking in the presence of PHA, they inhibited
PHA-induced proliferation of human PBMC in a dose-dependent manner
(FIG. 20C) and thus are useful in immunosuppressive applications.
Wild-type hB7-1-ECD-Ig did not affect PHA-induced proliferation of
human PBMC under the same culture conditions (FIG. 20C). At most
concentrations, CTLA-4-Ig inhibited PHA-induced proliferation of
human PBMC more than did hB7-1-ECD-Ig.
[0734] Furthermore, we studied the effect of soluble CD28BP-15-ECD
(without Ig-fusion) on PHA-activated PBMC. As shown in FIG. 20D,
soluble CD28BP-ECD inhibited proliferation in a dose-dependent
manner and the inhibition was greater than that induced by soluble
hB7-1-ECD. These data are in line with the conclusion that soluble
CD28BP-15-ECD, in contrast to crosslinked soluble CD28BP-15-ECD-Ig,
acts as an antagonist of CD28 signaling. In other words, the level
of crosslinking and multimerization determines whether soluble NCSM
induce a positive signal through their receptors CD28 and CTLA-4,
or whether they act as antagonists by binding to the receptors
without significantly inducing activation of the receptor (and
thereby preventing the interaction of the endogenous ligands with
these receptors). The effect of soluble non-crosslinked
CD28BP-15-ECD-Ig fusion protein and CD28BP-15-ECD on mixed
lymphocyte reaction (MLR), as described above, was studied using
populations of PBMCs from two human donors. PBMCs from one donor
acted as a responder; PBMCs from the second donor, which were
irradiated at 2500 rads, served as a stimulator for the responder.
Increasing concentrations (ug/ml) of soluble non-crosslinked
CD28BP-15-ECD-Ig (open triangle), non-crosslinked hB7-1-ECD-Ig
(solid square), non-crosslinked CD28BP-15-ECD (solid triangle),
non-crosslinked hB7-1-ECD (open square), and negative control hIgG
antibody (open circle) were added to these cultures as shown in
FIG. 20F. These data represent an average of counts per minute
(CPM) from 4 MLR experiments. CD28BP-15-ECD-Ig and CD28BP-ECD
inhibited mixed lymphocyte reaction to a greater extent than did
hB7-1-ECD-Ig and hB7-1-ECD.
[0735] G. Multimeric NCSM Molecules Using Leucine Zippers
[0736] Multimeric NCSM molecules are generated using leucine
zippers. In this approach, leucine repeats are utilized to generate
multimeric NCSM molecules that have properties which are equivalent
or substantially identical to properties of the crosslinked NCSM
multimers described above generated by crosslinking using goat
anti-human IgG Fc mAbs (and crosslinked NCSM fragments having such
properties). The use of leucine zippers to oligomerize proteins is
well known (see, e.g., Rieker and Hu (2000) Methods Enzymol.
323:282-96; Behncken et al. (2000) J. Biol. Chem. 275:17000-17007;
Su et al. (1999) J. Immunol. 162:5924-5930). Leucine zippers
comprise a motif comprising parallel .alpha.-helical coiled coils
as exemplified by those found in transcription factors GCN4
(RMKQLEDKVEELLSKNYELENECARLKKLVGER), Fos
(LTDTLQAETDQLEDKKSALQTEIANLLKEKEKLEFILAA), and Jun
(RIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMN). The motif is represented
by the occurrence of leucines in every seventh position and
hydrophobic and branched amino acids occupying position 1 over four
or five heptad repeats. These motifs act as molecular clamps and
facilitate homo- and hetero-dimer formation of proteins.
Homodimerization or higher order self-oligomerization of a protein
is also accomplished using other zipper motifs (e.g., Zhang et al.
(1999) Current Biol. 9:417-420) or mutated peptide sequences
derived from transcription factors, GCN4, Fos, or Jun.
[0737] Soluble monomeric NCSM molecules are modified with leucine
zippers using standard molecular biology methods utilizing either
natural (genomic eukaryotic/prokaryotic DNA or plasmid/viral DNA)
or synthetic DNA encoding known or newly discovered oligomerization
motifs. These sequence motifs are engineered as molecular zipper
cassettes containing unique restriction enzyme sites to make
in-frame fusion with either the N-terminus or C-terminus of a
soluble monomeric NCSM. For example, a DNA sequence encoding the
leucine zipper comprising the restriction site Not I at the 5' end
and restriction site Apa I at the 3' end is used to facilitate
cloning into a vector backbone, such as, e.g., pcDNA3.1
(GCGGCCGCa<GCN4>TAGGGGCCC; GCN4 nucleotide sequence can be
codon optimized to improve translation in a particular cell of
interest, such as a human cell). This allows for easy shuttling of
DNA fragments encoding soluble monomeric NCSM-ECD polypeptides or
monomeric NCSM-ECD Ig-fusion polypeptides to oligomerization
expression vectors. These expression vectors can also include an
E-epitope and hexa-His tag for diagnostic and purification of
soluble proteins.
[0738] H. Variations of Soluble NCSM-ECD-Ig Fusion Proteins and
Related Nucleic Acid Sequences
[0739] Any of the NCSM polypeptide homologues of the invention are
optionally utilized in the construction of Ig fusion proteins and
nucleic acids encoding them. Full-length NSCM polypeptides of the
invention can be used. Furthermore, various fragments of each NCSM
polypeptide can be utilized in the construction of fusion proteins,
including, e.g., the entire ECD of a NCSM polypeptide (such as
CD28BP-15 or CTLA-4BP 5.times.4-12c); various lengths or
subsequences (e.g., truncated regions or fragments) of the ECD of a
NCSM polypeptide; the cytoplasmic region of a NCSM polypeptide (and
truncated regions and subsequences or fragments thereof); the
transmembrane domain region of a NCSM (and truncated regions and
subsequences or fragments thereof), etc. Various additional
sequences can also be added to the NCSM-Ig fusion protein's, e.g.,
various linker sequences (such as, e.g., Val-Thr), various
proteolytic cleavage sites (such as, e.g., Factor Xa cleavage sites
(MGR), subtilisin, etc.), various Ig domains (or portions thereof),
markers, purification sequences, restriction enzyme cleavage sites,
and the like. As noted throughout, non-Ig sequences can also be
fused to the given NCSM sequences to produce fusion proteins.
[0740] For example, as illustrated above, NCSM polypeptide
sequences of the invention were utilized to construct Ig fusion
proteins incorporating both linkers (V-T and G-V-T) and Factor Xa
Cleavage sites. See, e.g., FIGS. 14A-14B, Tables 5-6. The NCSM
portions of these fusion proteins were longer than the truncated
NCSM sequences used to construct the fusion proteins as described,
elsewhere herein. Various sequence lengths of NCSMs (both amino
acid and nucleotide) can be utilized in constructing Ig fusions as
well as myriad, e.g., linkers and other sequences, etc. Various
configurations of linkers, NCSM lengths, etc. are all aspects of
the present invention. Any of the NCSM sequences described herein
can be fused using essentially the same strategy.
[0741] The invention also provides nucleic acids encoding any of
the variant soluble NSMC polypeptides and fusion proteins described
above or fragments thereof. Also included are vectors and
expression cassettes including such nucleic acids.
Example V
Construction of an Expression Cassette
A. Construction of Vector pMaxVax10.1.
[0742] This example describes the construction of an exemplary
vector for expression in mammalian cells. The mammalian expression
vector pMaxVax10.1 (see FIG. 21) comprises, among other things: (1)
a promoter for driving the expression of a transgene in mammalian
cells; (2) a polylinker for cloning of one or more transgenes; (3)
a polyadenylation signal (polyA); and (4) a prokaryotic replication
origin and antibiotic resistant gene for amplification in E.
coli.
[0743] 1. Construction of minimal plasmid for amplification in E.
coli.
[0744] The minimal plasmid Col/Kana comprises the replication
origin ColE1 and the kanamycin resistant gene (Kana.sup.r). The
ColE1 replication origin mediates high copy number plasmid
amplification. Alternatively, low copy number replication origins,
such as p15A (from plasmid pACYC177, New England Biolabs Inc.) can
be used.
[0745] The ColE1 origin was isolated by polymerase chain reaction
(PCR) methods known in the art from vector pUC19 (New England
Biolabs Inc.). To link the ColE1 origin to the Kana.sup.r gene,
NgoMIV (or "NgoMT") and DraIII recognition sequences where added to
the 5' and 3' PCR primers, respectively. NgoMIV and Drain are
unique cloning sites in the pMaxVax vector. For subsequent cloning
of the mammalian transcription unit the 5' forward primer contains
the additional restriction site NheI downstream of the NgoMIV site
and the 3' reverse primer additional EcoRV and BsrGI cloning sites
upstream of the DraIII site. All primers contain additional 6-8
base pairs overhang for optimal restriction digest. The sequence
for the 5' forward primer is:
acacatagcgccggcgctagctgagcaaaaggccagcaaaaggcca. The sequence for
the 3' reverse primer is:
aactctgtgagacaacagtcataaatgtacagatatcagaccaagtttactcatatatac. The
PCR reactions are usually performed with proof-reading polymerases,
such as Tth (PE Applied Biosystems), Pfu, PfuTurbo and Herculase
(Stratagene), or Pwo (Roche), according to the manufacturer's
recommendations. A typical PCR reaction for Herculase polymerase
contains 1 .mu.l template plasmid DNA (1-10 ng/.mu.l), 5 .mu.l
10.times. buffer, 1 .mu.l dNTPs (deoxynucleotide triphosphate) at
10 mM each, 1 .mu.l forward primer (20 .mu.M), 1 .mu.l reverse
primer (20 .mu.M), 40 .mu.l deionized, sterile water and 0.5 .mu.l
Herculase polymerase in a 50 .mu.l reaction. The PCR reaction is
performed at 94.degree. C. for 30 seconds, 55.degree. C. for 30
seconds, and 72.degree. C. for 30 seconds per cycle, for a total of
25 cycles. The PCR products were purified with phenol/chloroform
using Phase lock Gel.TM.Tube (Eppendorf) followed by standard
ethanol precipitation. The purified PCR products were digested with
the restriction enzymes NgoMIV and Drain according to the
manufacturer's recommendations (New England Biolabs, Inc.) and gel
purified using the QiaExII gel extraction kit (Qiagen) according to
the manufacturer's instructions.
[0746] The Kanamycin resistant gene (transposon Tn903) was isolated
by PCR from plasmid pACYC177 (New England Biolabs, Inc.) using
standard known procedures. The Kana.sup.r gene is used for in vivo
or in vitro studies. Alternative antibiotic resistant genes, such
as ampicillin, tetracycline, and blasticidin resistant genes, can
be used for in vivo or in vitro studies in a variety of cell
cultures.
[0747] The 5' PCR primers contain the DraIII cloning site and an
additional single restriction site, AscI, downstream of it. The 3'
PCR primers contain the NgoMIV cloning site. The 5' forward primer
sequence is: ggcttctcacagagtggcgcgccgtgtctcaaaatctct. The sequence
for the 3' reverse primer is:
ttgctcagctagcgccggcgccgtcccgtcaagtcagcgt. The PCR reactions,
product purification and digest with DraIII and NgoMIV were
performed as described above. About 20 ng of each of the two PCR
products were ligated in a 20 .mu.l reaction, containing 2 .mu.l
10.times. buffer and 1U ligase (Roche). Amplification in E. coli
was performed using standard procedures as described in Sambrook,
supra. Plasmids were purified with the QiaPrep-spin Miniprep kit
(Qiagen) following the manufacturer's instructions and digested
with BsrG1 and DraIII for subsequent ligation of the mammalian
transcription unit (promoter and polyA).
[0748] 2. Expression Vector pMaxVax10.1.
[0749] In this example, the CMV Towne promoter was used for driving
the expression of the transgene in mammalian cells. Alternatively,
other CMV promoters or non-naturally occurring recombinant or
chimeric CMV promoters can be used; for example, a chimeric or
recombinant promoter, including an optimized CMV promoter, as
described in copending, commonly assigned PCT Application Serial
No. US01/20123, entitled "Novel Chimeric Promoters," filed Jun. 21,
2001 as LJAQ Attorney Docket No. 02-031910PC, can be used, which is
incorporated herein by reference in its entirety for all purposes.
Different strains of CMV can be obtained from ATCC. Strains AD169
(VR-538; Rowe, W. (1956) Proc. Soc. Exp. Biol. Med. 145:794-801)
and Towne (VR-977; Plotkin, S. A. (1975) Infect. Immun. 12:521-27)
were isolated from human patients with CMV infections, while
strains 68-1 (Asher, D. M. (1969) Bacteriol. Proc. 269:91) and CSG
(Black, H. (1963) Proc. Soc. Exp. Biol. Med. 112:601) were isolated
from Rhesus and Vervet monkeys, respectively. Other viral
promoters, e.g., from RSV and SV40 virus, and cellular promoters,
such as the actin and SR.alpha. promoter, and the like, and, other
promoters known to those of skill in the art, confer ubiquitous
transcription in mammalian cells as well. For cell type-specific
transcription, the use of cell type-specific promoters, such as
muscle specific, liver specific, keratinocyte specific, and the
like, and others known to those of skill in the art can be
used.
[0750] The CMV Towne promoter was isolated from DNA of the CMV
virus Towne strain by commonly known PCR methods. The cloning sites
EcoRI and BamHI were incorporated into the PCR forward and reverse
primers. The EcoRI and BamHI digested PCR fragment was cloned into
pUC19 for amplification. For construction of the vector
pMakVax10.1, the CMV promoter was isolated from the pUC19 plasmid
by restriction digest with BamHI and BsrG1. The BsrG1 site is
located 168 by downstream of the 5' end of the CMV promoter start,
resulting in a 1596 by fragment, which was isolated by gel purified
for subsequent ligation.
[0751] The polyadenylation signal from the bovine growth hormone
(BGH) gene was used in this example. Other poly A signals, which
work well in mammalian cells, include, e.g., poly A signal
sequences from, e.g., SV40, Herpes simplex Tk, and rabbit beta
globin, and the like, and others known to those of skill in the
art. The BGH poly A was isolated from the pcDNA3.1 vector
(Invitrogen) using commonly known PCR methods. The 5' PCR forward
primer contained additional 14 by sequence comprising recognition
sites for the restriction enzymes PmeI and BglII, which form part
of the poly linker. The 3' reverse primer contains the restriction
site DraIII for cloning to the minimal plasmid Col/Kana. The 5'
forward primer sequence is:
agatctgtttaaaccgctgatcagcctcgactgtgccttc. The 3' reverse primer
sequence is: acctctaaccactctgtgagaagccatagagcccaccgca. The
resulting PCR product was diluted 1:100, and 1 .mu.l was used as a
template for a second PCR reaction with the same 3' reverse primer
and a new 5' forward primer. This primer was overlapping the 5' end
of the template by 20 by and contained another 40 by 5', containing
BamHI, KpnI, XbaI, EcoRI and NotI recognition sequences to form the
rest of the polylinker. The sequence of the 5' extension primer is:
ggatccggtacctctagagaattcggcggccgcagatctgtttaaaccgctga. An
alternative PCR product was generated with different 5' forward PCR
primers to generate a vector with a modified polylinker, designated
pMaxVax10.1 mp (FIG. 21 with modified polylinker as described
above). The orientation of the restriction sites in this polylinker
is 5'-3': BamHI, XbaI, KpnI, EcoRI, NotI, BglII, and PmeI. The
polylinker sequence is:
ggatccactcatctagaacaatggtaccaatacgaattcggcggccgcagatctgtttaaacc.
The PCR products were digested with BamHI and DraIII and gel
purified.
[0752] The final ligation reaction contained about 20 ng each of
the BsrG1 and BamHI digested CMV promoter, of the BamHI and DraIII
digested polylinker and BGH poly A, and the DraIII and BsrG1
digested minimal plasmid Col/Kana in a 50 .mu.l reaction with 5
.mu.l 10.times. ligase buffer and 2U ligase (Roche). Ligation,
amplification and plasmid purification were performed as described
above.
B. Construction of Vector pMaxVax with NCSM Polynucleotide
Sequence
[0753] The nucleotide sequence encoding a NCSM polypeptide (e.g., a
CD28BP or CTLA-4BP polypeptide or fragment thereof, such as an ECD
domain) or any other immunomodulatory molecule can be isolated by
PCR with BamHI and KpnI restriction enzyme recognition sequences in
the PCR forward and reverse primer as described above. In this
example, a polynucleotide sequence encoding a CD28BP polypeptide
(e.g., CD28BP-15 polypeptide (SEQ ID NO:19) is incorporated into
the pMAxVax 10.1 vector. To verify the correct sequence of the PCR
products, the fragments are cloned conveniently into the TOPO.RTM.
cloning vectors (Invitrogen) for sequencing according to the
manufacturer's protocols. After BamHI and KpnI digestion and gel
purification, the genes are cloned into a mammalian expression
vector to confirm the expression of the gene. To clone the genes
into the polylinker of pMaxVax, the vector pMaxVax 10.1 mp (FIG. 21
with modified polylinker as described above) was digested with
BamHI and KpnI, gel purified and ligated to the respective genes,
as described above. The construct pMaxVax-CD28BP (see FIG. 22A),
which includes the nucleotide sequence encoding a CD28BP (here,
e.g., SEQ ID NO:19), can be used for in vivo and in vitro
expression in human and other mammalian cells and other cells in
culture, including non-mammalian cells and the like.
[0754] For in vitro expression the immune stimulatory molecules can
also be cloned in any commercially available vectors such, as
pcDNA3.1+/-, pcDNA4 (Invitrogen), which are suitable for stable
expression under drug selection in mammalian cells. If secretion is
a desired feature, the genes can be cloned into vectors such as
pSecTag, pDisplay, pBC1 (Invitrogen), which link the expressed
proteins to secretion signals. For regulated expression vectors
from the Tet.TM.System (Clontech) or Ecdysone regulatory vectors
(Invitrogen) can be used. For high expression levels in cell
culture the immune stimulatory molecules can also be cloned into
viral vectors constructed from Retrovirus, Adenovirus (Clontec),
and Sindbis virus (Invitrogen), or replicating viral vectors
constructed from EBV, BPV, HPV and SV40 virus. For in vivo studies,
viral vectors constructed from Adenovirus, Lentivirus, and
Alphaviruses, and the like can be used. If restriction sites other
than BamHI and KpnI are required for cloning into the different
vectors, flanking restriction sites from the polylinker can be
used. Alternatively, the genes can be isolated by PCR with the
desired restriction sites located in the PCR primers as described
above.
C. Bicistronic vector pMaxVax-CD28BP-EpCAM/KSA
[0755] For immunotherapy studies it is desirable to express the
immunostimulatory molecule in the same cells as, for example, a
cancer antigen. A nucleotide sequence encoding a cancer antigen,
such as EpCam/KSA or a mutant or variant thereof, can be cloned
into the pMaxVax vector (FIG. 21) to generate a pMaxVax-EpCam/KSA
vector, using a procedure analogous to that described above for
cloning the CD28BP polynucleotide sequence into the pMaxVax vector
backbone. Two expression constructs, e.g., the pMaxVax-CD28BP
vector (FIG. 22A) (or other pMaxVax-NCSM vector) and the
pMaxVax-EpCam/KSA vector (or other pMaxVax vector including a
nucleotide sequence encoding an antigen), can then be
co-transfected in cell culture or co-administered in vivo to a
subject in need of such therapeutic or prophylactic treatment.
[0756] In an alternative format, which may be an optimal format for
some therapeutic or prophylactic applications, both the EpCam/KSA
(of a EpCam/KSA mutant or variant thereof) and CD28BP genes (or a
different antigen gene and/or NCSM polynucleotide) can be expressed
from the same vector. In one format, the resulting antigen and NCSM
proteins can be co-expressed from a single promoter linked by an
internal ribosomal entry site (e.g., IRES bicistronic expression
vectors, Clontec). This example describes the construction of an
exemplary bicistronic vector for expression of at least one NCSM
polypeptide and at least one antigen or antigen fragment (or a
different co-stimulatory molecule) in which the NCSM polynucleotide
and the nucleotide sequence encoding the antigen or antigen
fragment form two separate expression units. In particular, this
example describes the construction of a bicistronic vector for
expression of CD28BP (e.g., CD28BP-15) and the cancer antigen
EpCAM/KSA (or mutant or variant thereof) in which the CD28BP
polynucleotide and the polynucleotide encoding the cancer antigen
or antigen fragment form two separate expression units, each
regulated by its own respective promoter and poly A signal. One of
skill will understand that this procedure can also be readily
adapted to construct a bicistronic vector comprising at least one
NCSM polynucleotide of the invention (including nucleic acid
fragments thereof, and nucleic acids encoding soluble NCSM
polypeptides, peptide fragments thereof, and fusion proteins
thereof described herein) and a different antigen or antigen
fragment (or a different co-stimulatory molecule).
[0757] The CD28BP gene is inserted into the polylinker of a pMaxVax
vector as described above, forming the first expression unit. The
nucleic acid sequence of the cancer antigen, here the
polynucleotide encoding the extracellular domain of EpCAM/KSA (or
mutant or variant thereof), is linked to a second mammalian
expression promoter (exemplary promoters include those set forth in
this Example above and elsewhere) and a second poly A signal
(exemplary signals include those set forth in this Example above
and elsewhere) to form the second expression unit. In this Example,
a synthetic poly A (SPA) sequence was made and used. However, one
of skill in the art would understand that other poly A sequences
(e.g., bovine growth hormone (BGH) poly A or SV40 poly A sequence)
can also be used. The synthetic poly A was derived from a sequence
for the rabbit 13-globin poly A (Gen&Dev. 3:1019-1025 (1989).
The sequence fragment was generated by annealing two
oligonucleotides, which contained the respective cloning sites in
the 5' and 3' sequences. The upper strand sequence is:
5'-GATCTGTTTAAACTCTGGCTAATAAAAGATCAGAGCTCTAGACATCTGTGTGTT
GGTTTTTTGTGTGTCTCACTCACAGA-3', and the sequence of the lower
oligonucleotide strand is:
5'-TGAGTGAGACACACAAAAAACCAACACACAGATGTCTAGAGCTCTGATCT
TTTATTAGCCAGAGTTTAAACA-3''.
[0758] The second expression unit can be cloned into 3 different
sites in the construct pMaxVax-CD28BP, both in forward or reverse
orientation: (i) downstream of the first expression unit (e.g., CMV
promoter-CD28BP-SPA polyA, CMVpromoter-CD28BP-BGH polyA, or
CMVpromoter-CD28BP-SV40 polyA) using the single cloning sites
DraIII and AscI in pMaxVax10.1; (ii) between the ColE1 and
Kana.sup.r gene using the single restriction sites NgoMI and NheI;
(iii) between the Kana.sup.r gene and the CMV promoter into the
single EcoRV and BsrGI restriction sites (see vector description
above in this Example). Independent of the location of the second
expression unit it is advisable to add a terminator sequence
downstream of the first expression unit. A consensus terminator
sequence 5'-ATCAAAA/TTAGGAAGA3' is described in Ming-Chei Maa et
al. (1990) JBC 256 (21):12513-12519. In the construct pMaxVax,
CD28BP the sequence can be placed into the single Drain site
downstream of the poly A sequence (e.g., synthetic poly A or SPABGH
poly A sequence) (see FIG. 22B).
[0759] This example describes the cloning strategy of the second
expression unit for location (ii). The second promoter (e.g., a WT
CMV promoter, such as human CMV promoter or a recombinant CMV
promoter with improved expression activity), the EpCAM/KSA cancer
antigen (or mutant or variant thereof), and the second poly A (in
the example, synthetic poly A or SV40 polyA), are isolated from the
respective template plasmids by PCR or assembled from
oligonucleotides (as described above in this Example). The PCR
primers are designed to contain single restriction sites, which
allow for partial site-directed cloning of the three fragments into
the final vector. The 5' forward PCR primer for isolation of the
shuffled CMV promoter contains the single NgoMIV (also called
NgoMI) cloning site. The 3' reverse primer contains the NgoMIV site
and another restriction enzyme site, which does not cut in any of
the other vector units (i.e. AccI, Agel, AvrII, BsU361, MluI,
RsrII, SalI) upstream of it separated by a spacer of at least 10
base pairs. In the example AccI is chosen as the additional cloning
site. The PCR product is digested with NgoMIV followed by gel
purification and cloned into the NgoMIV linearized and gel purified
pMaxVax, CD28BP. The correct orientation of the second CMV promoter
after ligation is determined by PCR from bacterial colonies (as
described in Molecular Cloning, A Laboratory Manual, Sambrook and
Russell) using the 3' reverse primer and any forward primer of
choice located about 500-600 by upstream of the reverse primer in
the CMV promoter sequence. The second promoter containing plasmid
is then digested with AccI and NheI for cloning of the cancer
antigen. The 5' primer for the EpCAM/KSA cancer antigen (or mutant
or variant thereof) contains the single AccI site and the 3' primer
the single NheI site and an additional single restriction site
upstream, Agel, separated by a spacer of at least 10 base pairs.
The PCR product is digested with the enzymes AccI and NheI and
cloned into the equally digested vector. The resulting construct is
digested Agel and NheI for cloning of the SV40 polyA/terminator
fragment. The 5' forward primer for this PCR product contains the
single Agel site and the 3' reverse primer the terminator sequence
followed by the single NheI site. The 5' cloning sequence and the
NheI site are incorporated in the oligonucleotides. The resulting
(e.g., double-stranded) Agel/NheI poly A fragment is then cloned in
the equally digested vector. The cloning strategy is outlined
below.
##STR00001##
An exemplary construct pMaxVax, CD28BP, EpCAM/KSA is shown in FIG.
22B.
[0760] One of skill will understand that a similar procedure can be
used to construct an expression vector comprising a nucleotide
sequence encoding a CTLA-4BP of the invention (in place of the
sequence encoding CD28BP above in FIG. 22A. Such a vector can
comprise a bicistronic vector, if desired, with a second nucleotide
sequence of interest (e.g., encoding an antigen or another
co-stimulatory molecule) included in the position occupied above by
the antigen, as shown in FIG. 22B. One of skill will also
understand the above procedure can be readily adapted to construct
an expression vector comprising different vector components, such
as different promoters, signal sequences, termination sequences,
replication origin sequences, resistant gene or marker
sequences.
Example VI
Enhanced Immune Response Induced by a CD28BP Polypeptide
[0761] This example demonstrates the ability of a CD28BP molecule
of the present invention (or fragment thereof) to enhance an immune
response of a heterologous antigen, such as a tumor-associated
antigen (Ag), such as, e.g., Ep-Cam/KSA (as described in Strand et
al. (1989) Cancer Res. 49:314-317; Szala et al. (1990)
87:3542-3546; Balzar et al. (1999) Mol Med 77:699-712), or a
polypeptide variant, mutant, or derivative of EpCam/KSA polypeptide
(or a nucleotide sequence variant, mutant, or derivative encoding
such. EpCam/KSA polypeptide variant, mutant or derivative,
respectively), or a pathogen antigen (e.g., hepatitis B surface Ag
(HepBsAg)), in cynomolgus monkeys. The EpCam/KSA polypeptide
variant or mutant may comprise, e.g., an amino acid sequence of
EpCam/KSA in which at least one amino acid has been replaced by
another amino acid; the substitution may comprise a conservative
amino acid substitution. The corresponding nucleotide sequence may
comprise, e.g., a substitution of one or more nucleotide residues
such that the EpCam/KSA polypeptide variant or mutant amino acid
sequence is encoded therefrom. In this example, a vector comprising
a nucleotide sequence encoding full-length clone CD28BP-15 is used.
If desired, alternatively a vector comprising a nucleotide sequence
encoding a fragment of CD28BP-15 (e.g., such as an ECD) or encoding
a fusion protein (e.g., ECD-Ig) can be used. For example, a
sequence encoding a soluble NCSM of the invention (e.g.,
CD28BP-15ECD, CD28BP-15-ECD-Ig, or with a trunECD, or the like) can
be used. A vector comprising a nucleotide sequence encoding a WT
hepatitis B surface antigen (hepBsAg) (or fragment thereof) and a
vector comprising a nucleotide sequence encoding Ep-Cam or EpCam
variant or mutant (or a fragment of any of these) is used as the
antigen sequence. The procedure can be adapted to use any NCSM
molecule described herein and/or any antigen of interest,
including, e.g. viral antigens or other cancer antigens described
infra.
[0762] In the following example, separate vectors are prepared that
encode each of EpCam (or mutant or variant thereof), WT hB7-1,
CD28BP-15, and the antigen. A separate control vector is also
prepared. See Example V. However, as noted below and as described
in Example V, a bicistronic vector encoding antigen (e.g., EpCam or
a mutant or variant polypeptide sequence thereof) and B7-1, or
encoding antigen (e.g., EpCam or mutant or variant polypeptide
thereof) and CD28BP-15 can be used alternatively. If desired, a
vector comprising a nucleic acid sequence encoding a fragment of an
NCSM polypeptide having the desired properties can be used, such as
a nucleic acid sequence encoding a signal sequence (of SEQ ID NO:66
or another NCSM molecule or from B7-1) and the ECD of CD28BP-15 (of
SEQ ID NO:66), wherein the ECD has a CD28/CTLA-4 binding affinity
ratio that is at least about equal to or greater than that of B7-1
and/or induces a T cell response that is greater than that induced
by B7-1. Vectors comprising sequences encoding other antigens
and/or NCSM molecules, cytokines, costimulatory sequences, and the
like or other vector elements can be constructed by using the
vector construction procedures described above. One of skill will
readily understand how to modify/adapt these procedures to
construct vectors comprising nucleotide sequences encoding such
NCSM molecules with or without also encoding any of such
antigens.
[0763] In this analysis, five groups of cynomolgus monkeys (3
monkeys per group) are inoculated intradermally (i.d.) (e.g., by a
gene gun or injection with a needle) or intramuscularly using DNA
plasmid expression vectors with either CD28BP-15 alone, hB7.1
alone, antigen (Ag) alone (such as, e.g., EpCam/KSA or a mutant or
variant thereof), CD28BP-15 with Ag or hB7.1 with Ag, each at a
total dose of 1 milligram DNA per inoculation as outlined in Table
8 below. For CD28BP-15, the vector typically comprises a nucleotide
sequence encoding SEQ ID NO:19 or a nucleotide sequence encoding
the polypeptide of SEQ ID NO:66. A DNA plasmid control vector
lacking a nucleic acid insert encoding a CD28BP-15, hB7-1, or Ag is
used to equalize the total amount of DNA used in each injection.
Procedures for constructing the pMaxVax plasmid vector alone
(control vector) and a plasmid vector comprising a nucleotide
sequence encoding CD28BP-15 are described in Example V above.
Similar procedures can be used to construct a separate pMaxVax
vector or the like comprising a nucleotide sequence encoding a
human B7-1, Ag, or HepBsAg, as shown in Table 8. Alternatively,
another plasmid-based mammalian expression vector or a viral vector
can be employed in the following procedure, including any of those
described above in the specification. Immunized animals are
monitored daily for any local and systemic reactions.
TABLE-US-00008 TABLE 8 Dose (mg DNA) Group No. of animals
Immunization for each vector 1 3 CD28BP-15 vector + 0.5 + 0.5
Control vector 2 3 HB7-1 vector + Control 0.5 + 0.5 vector 3 3 Ag
vector + Control 0.5 + 0.5 vector 4 3 CD28BP-15 vector + Ag 0.5 +
0.5 vector 5 3 HB7-1 vector + Ag vector 0.5 + 0.5
[0764] Animals. Five groups of 3 male Cynomolgus monkeys, each
weighing approximately 4 kg (15 total), are used. Animals are
randomly assigned to groups using a number draw. In addition, each
animal is assigned a specific number within that group. Inocula.
Mixtures of plasmid DNA to contain 0.5 mg of each (separate) vector
component as outlined in Table 8 are prepared. Total plasmid DNA
delivered is 1 mg in each case. Each DNA expression plasmid is
diluted in PBS, pH 7.4 from a stock solution to achieve the target
concentration in 1 ml per inoculum.
[0765] (Alternatively, a bicistronic format is used in which the
following plasmid vectors are made and substituted in the
procedure: 1) a plasmid vector comprising a nucleotide sequence
encoding EpCam or mutant or variant polypeptide thereof (total DNA
plasmid dose is 1 mg) (antigen control vector); 2) a plasmid vector
comprising a nucleotide sequence encoding both EpCam (or mutant or
variant thereof) and WT hB7-1 (total DNA plasmid dose is 1 mg)
(antigen/WT hB7-1 control vector) (biscistronic vector that
co-expresses Ag and hB7-1); 3) a plasmid vector comprising a
nucleotide sequence encoding both EpCam (or mutant or variant
thereof) and CD28BP-15 (or fragment thereof, including soluble
form) (total DNA plasmid dose is 1 mg)(bicistronic vector
co-expressing EpCam (or mutant or variant thereof), and CD28BP-15).
The bicistronic vectors are prepared as described for the pMaxVax
bicistronic vector encoding both a CD28BP and EpCam (or mutant or
variant thereof) in Example V above.
[0766] Inoculation. Animals are anaesthetized prior to inoculation.
The backs of the animals are first prepared by shaving the fur and
the animals are inoculated by i.d. or i.m. injection with 1.0 ml of
a total 1 mg DNA plasmid vector(s) as described in Table 8 above
(or alternative amounts described below) at multiple sites. The
monkeys are boosted three times at 3 weekly intervals with the same
inoculation dose or with 0.1 mg Antigen protein (e.g., EpCam
polypeptide or a polypeptide mutant or variant thereof).
[0767] Observation and monitoring. Each inoculation site is
examined every day, beginning at day 1, for any delayed-type
hypersensitivity (DTH) reaction. Animals are observed daily for
signs of systemic reaction to the inoculation. These observations
include, but are not limited to, changes in weight, body
temperature, eating habits, skin and hair, eyes, mucous membranes,
respiratory system, circulatory system, central nervous system,
somatomotor activity, elimination, behavior, and any occurrence of
tremors, convulsions, salivation, diarrhea, lethargy, or coma.
[0768] Collection of blood. Monkeys are bled to obtain 2-5 ml of
whole blood one day prior to immunization and weekly thereafter.
Blood is allowed to clot, serum separated, frozen at -20.degree. C.
until further analysis. On alternate weeks, however, 5-10 ml of
blood is drawn in heparinized tubes for T cell assay analysis.
[0769] Tissue collection. Punch biopsies of the inoculation site
are taken according to standard known procedures once every three
weeks.
[0770] Sample analysis. Antibody titers against each of Ep-Cam (or
mutant or variant thereof) and HepBsAg in the sera of the animals
are determined, respectively, using ELISA assays (Mosolits et al.
(1999) Cancer Immunol. Immunoth 47:315-320; Staib et al. (2001)
Intl. J. Cancer 92:79-87; Chow et al. (1997) J. Virol. 71:169-178).
Furthermore, T cell proliferation in response to one of these
antigens is analyzed by adding 10 g/ml of the antigen to cultures
of 10.sup.5 peripheral blood monocyte cells (PBMC). The cells are
incubated for 3 days and incorporation of .sup.3H-thymidine during
the last 8 hours of culture is measured by scintillation counting
(as described in Punnonen et al. (1994) J. Immunol. 152:1094-1102).
See T cell proliferation methods described above. A higher T cell
proliferative response indicates a more vigorous immune response as
a result of the vaccination.
[0771] Cytokine production, such as, e.g., IFN-gamma, IL-2, IL-4,
IL-5, IL-12, and IL-13 production, is studied in response to the
specific antigen using cytokine specific ELISAs (R&D Systems)
or ELISpot assays (Biosource International, Camarrillo, Calif.),
performed according to the manufacturer's instructions. For
example, enumeration of IFN-gamma secreting cells in single cell
suspension is performed using a kit obtained from Biosource
International (Camarrillo, Calif.) (see manufacturer's
instructions). The following protocol is used. 50 .mu.l of diluted
coating antibody is added to each well followed by the addition of
50 .mu.l of PBS. Each well is incubated overnight at 4.degree. C.
Samples are then aspirated and washed 5 to 10 times with wash
buffer. 200 .mu.l of post-coating solution is added into each well
and wells are incubated 1 hour at 37.degree. C. or overnight at
4.degree. C. The wells are aspirated and not washed. Wells are 100
.mu.l of prestimulated single cell preparation are added into the
wells. The plate is covered with the plate cover and incubated for
5 hours at 37.degree. C. in a humidified atmosphere containing 7%
CO.sub.2. The wells are aspirated, 200 .mu.l ice-cold deionized
water is added, and the plate is placed for 10 min on melting ice.
The wells are washed 10 times with PBS. 100 .mu.l of diluted
biotinylated Antibody solution is added, the plate is covered and
incubated for 1 hour at 37.degree. C. or overnight at 4.degree. C.
The wells are aspirated and washed 5 to 10 times with PBS. 50 .mu.l
of diluted--labeled anti-biotin antibody solution (GABA) is added
to each well. The plate is covered and incubated 1 hour at
37.degree. C. The wells are aspirated and washed 5 to 10 times. 30
.mu.l of activator solution is added to each well. The spot
development is followed by light microscopy. When clear spots have
developed, the reactions are stopped by rinsing the wells with
distilled water. The results are compared between animals immunized
with the antigen with or without CD28BP-15.
[0772] Such plasmid expression vectors encoding CD28BP-15 with and
without an antigen are useful in therapeutic and prophylactic
treatment protocols as described above. Plasmid expression vectors
encoding CD28BP-15 and EpCam/KSA (or mutants or variants of EpCam
polypeptide or nucleotide) are useful in methods for
therapeutically and/or prophylactically treating a variety of
cancers, as described above. Given that the primate model is an
accepted model closely related to human, such methods may be
readily adapted by one of ordinary skill in the art to therapeutic
and/or prophylactic vaccination protocols for humans.
[0773] A similar procedure to that described above can be employed
to assess an ability of a CTLA-4BP of the invention to inhibit an
immune response or inhibit T cell proliferation or CTL responses in
a subject, by substituting a nucleotide sequence encoding a
CTLA-4BP of the invention in place of the nucleotide sequence
encoding CD28BP-15 and using the functional assays for, e.g., T
cell activation. For example, T cell activation can be analyzed by
measuring proliferation, cytokine production, CTL activity or
expression of activation antigens such as IL-2 receptor, CD69 or
HLA-DR molecules, as described above. Vectors that harbor CTLA4-BP
genes that efficiently act through CTLA-4 are useful in inducing,
for example, tolerance and anergy of allergen- or
autoantigen-specific T cells. In some situations, such as in tumor
cells or cells inducing autoimmune reactions, the antigen may
already be present on the surface of the target cell, and the
vectors encoding CTLA-4BP molecules may be transfected in the
absence of additional exogenous antigen gene.
[0774] Boosting. In methods described herein using either separate
vectors encoding each of Ag, hB7-1 or CD28BP, or bicistronic
vectors encoding Ag and CD28BP, or Ag and hB7-1, one or more
additional doses of DNA plasmid vector (e.g., 1 mg) can be
administered subsequently to an animal at one or more subsequent
intervals (e.g., 2 times), respectively enhance or "boost" the
immune response. If desired, following a boosting of the immune
response with such administration of one or more additional DNA
plasmid vector doses, at least one dose of the EpCam protein
(protein dose of from about 0.1 to about 1 mg) ("protein boost) (or
EpCam mutant or variant) can be administered to an animal to
further enhance or "boost" the immune response. Additional protein
boosts can be administered subsequently at desired intervals (e.g.,
after one or more days, one or more weeks, one or more months).
Example VII
Blocking Development of EAE
[0775] The mouse model of Experimental Autoimmune Encephalomyelitis
(EAE) has many similarities with human multiple sclerosis (MS), and
it has been widely used as a model of human MS (see, e.g., Alvord,
G. C. Jr., ed., Experimental Allergic Encephalomyelitis: A Useful
Model for Multiple Sclerosis, Liss, N.Y. (1984)). EAE can be
induced in SJL/F mice by myelin basic protein (MBP) or
proteolipid-protein (PLP) or peptides thereof.
[0776] To demonstrate the efficacy of a CTLA-4BP molecule of the
invention to prevent EAE, the following prophylactic treatment
vaccination protocol is used. DNA expression plasmids encoding
either CTLA-4BP or MBP (or PLP) are codelivered, or the two genes
for CTLA-4BP and MBP (or PLP) are coexpressed in the same vector
and delivered, as follows. In this example, a nucleotide sequence
encoding clone CTLA-4BP 5.times.4 12c is used. Procedures for
constructing the pMaxVax plasmid vector alone (control vector) or
with a nucleotide sequence encoding a CD28BP and/or a second
polypeptide (EpCam or mutant or variant thereof) are described in
Example V above. One of skill can readily adapt such procedures to
construct pMaxVax vectors comprising the nucleotide sequence
encoding a CTLA-4BP and/or MLP (or PLP), expressed alone on
separate vectors or coexpressed on one vector. Alternatively,
another plasmid-based mammalian expression vector or a viral vector
can be used in the following procedure, including any of those
described above in the specification. 100 .mu.g of the DNA plasmid
in 100 .mu.l PBS is injected intramuscularly or intradermally to
SJL/F female mice. A control DNA plasmid lacking the CTLA-4BP, MBP,
or PLP nucleotide sequence is similarly administered to a control
group of mice.
[0777] To induce EAE, mice are injected intradermally with 100
.mu.l rabbit brain myelin basic protein (MPB) at 1 mg/ml in
complete Freund's adjuvant. Mice are analyzed for the onset of EAE
by visually noting tail paralysis followed by hind leg paralysis
(at which point animals are sacrificed for humane reasons).
[0778] The ability of a DNA plasmids encoding CTLA-4BP and/or MBP
(or PIP) to block EAE is demonstrated by the number of mice
developing EAE and the severity of the disease, as compared to mice
that received the control DNA plasmid.
Example VIII
Improved Cell-Based Vaccines for the Treatment of Cancer
[0779] To enhance the immunogenicity of tumor cells used as
cell-based vaccines for the immunotherapeutic or prophylactic
treatment of a variety of cancers, patient tumor cells can be
transfected with a CD28BP nucleic acid (NA) sequence of the present
invention. In this example, the sequence corresponding to clone
CD28BP-15 is used; however, other NA sequences of the invention can
be readily employed. As an example, the specific immunotherapy
involves immunization of melanoma patients with a polyvalent,
irradiated whole cell melanoma cells transfected with a DNA plasmid
encoding CD28BP-15.
[0780] In one such method, a population of tumor cells derived from
a melanoma patient's melanoma tumor cell lines (i.e., cells removed
from the patient) are transfected (e.g., by electroporation) with a
sufficiently effective amount of DNA expression plasmid vector,
pMaxVax, encoding CD28BP-15 (or fragment thereof, e.g.,
CD28BP-15-ECD or expressed soluble CD28BP) that facilitates uptake
and expression of CD28BP-15 polypeptide on the cells; the amount of
DNA plasmid typically constitutes a therapeutically or
prophylactically effective amount or dosage to treat the melanoma
cancer or prevent further development of the cancer. The pMaxVax
plasmid is described in example V above. Or, another plasmid-based
mammalian expression vector, or viral vector, can be used in this
procedure, including those described herein and throughout.
[0781] These transfected tumor cells are inactivated by irradiation
(50 gray) and cryopreserved for used as the cell-based vaccine.
Prior to treatment (delivery to the patient), the cells to be used
as vaccine are thawed and washed 3 times in phosphate-buffered
saline; if desired, the cells to be used as a vaccine are
formulated as a composition with an excipient, such as, e.g., a
pharmaceutically acceptable excipient, e.g., PBS. (In an
alternative format, allogeneic melanoma tumor cells are transfected
with a sufficient amount of pMaxVax DNA plasmid vector encoding
CD28BP-15 (or a fragment thereof, e.g., CD28BP-ECD) for CD28BP-15
expression.) Transfected tumor cells encoding an effective amount
of expressed CD28BP-15 (or a composition comprising such
cells)--either those derived from the specific patient's cell line
or allogeneic cells--are injected intradermally into the specific
patient in auxiliary and inguinal regions in escalating doses once
every 2 weeks for 3 months. The first and second injections of the
vaccine comprise 2.times.10.sup.6 cells, followed by
6.times.10.sup.6 cells for the third and fourth injections, and
then 18.times.10.sup.6 cells for the fifth and sixth
injections.
[0782] Immune responses of each patient are analyzed by measuring
the levels of tumor cell specific Abs and the level of T cell
response against the antigen or antigenic fragment expressed on the
tumor cells by analyzing T cell proliferation in response to tumor
cell lysates and measuring delayed type hypersensitivity (DTH)
reaction. T cell response against the cancer antigen is analyzed
using standard methods described above (see, e.g., Example VI).
Levels of tumor cell specific Abs in the patients' sera are
measured by ELISA using standard protocols (see Colligan; Sambrook;
Rapley and Walker, all supra). To analyze DTH, tumor cell lysates
are injected intradermally into the back of patients. Responses are
evaluated on days 1, 2, 4, and 7 after injection. The mean diameter
of induration is calculated as (greatest diameter+perpendicular
diameter)/2. A positive response is defined as a mean diameter of
induration of 5 mm. Four-millimeter punch biopsies of positive
reactions are performed on selected consenting subjects to analyze
the phenotype of infiltrating cells using flow cytometry
(FACSCalibur flow cytometer and CellQuest software, BDIS) as
described above. The single cell suspensions are then stained
anti-CD3, CD4, CD8, CD14, and CD20 monoclonal antibodies to measure
the percentages of T cells, CD4+ T helper cells, CD8+ cytotoxic T
cells, monocytes and B cells, respectively.
[0783] Estimated statistical survival rates are analyzed by the
non-parametric Kaplan-Meier method (see Kaplan et al., J Am Stat
Assoc (1958) 53:457) (e.g., using the statistical analysis software
JMP (ver. 3.1 for Macintosh; SAS Institute Inc., Cary, N.C.)). The
log-rank test is used to determine the differences in survival of
patients from subgroups defined by different levels of risk
factors. Survival times are defined as the length of time a given
patient remains alive after the diagnosis of metastatic disease to
either a regional site (AJCC Stage IIIA), with regard to skin and
soft tissue metastasis, or a distant site (AJCC Stage IV).
Example IX
B7-1 Polypeptide Variants with Altered Properties
[0784] Sequence analysis of CTLA-4BP molecules exhibiting
preferential binding to CTLA-4 relative to CD28 revealed that many
such molecules showed a substitution of another amino acid for
tyrosine at the amino acid position corresponding to amino acid
position 65 of the full-length amino acid sequence of hB7-1 (SEQ ID
NO:278). These data suggested the amino acid residue at this
position played a different role in the binding of these molecules
to CTLA-4 than to CD28. A polypeptide variant of the hB7-1
polypeptide shown in SEQ ID NO:278 was made which comprised a
substitution of histidine for tyrosine at position 65 of the amino
acid sequence of SEQ ID NO:278, where the amino acid position is
measured from the N-terminus. Position 65 corresponds to position
31 of the mature domain of hB7-1 (SEQ ID NO:278), as measured from
the N-terminus. Specifically, codon TAC of the nucleic acid
sequence of hB7-1 shown in SEQ ID NO:273, corresponding to the
three nucleic acid residues at positions 193-195 of SEQ ID NO:273,
was mutated to codon CAC. Digestion of the expression plasmid
encoding hB7-1 with Pml I and Xcm I removed a 200 base pair (bp)
fragment which included the amino acid at position 65 encoding Tyr
(Tyr65). Using standard molecular biology cloning methods, this
nucleotide fragment was replaced with a corresponding Pml I-Xcm I
DNA nucleotide fragment (200 bp) from the nucleic acid sequence
encoding CTLA-4BP 5.times.4-12c, which encoded histidine at the
amino acid position corresponding to position 65 of hB7-1 (SEQ ID
NO:278). The remaining amino acids encoded by the 200-bp fragment
were otherwise identical between hB7-1 and CTLA4BP 5.times.4 12c.
The B7-1 polypeptide variant (termed "hB7-1-Tyr65His polypeptide
variant") comprised the full-length sequence of SEQ ID NO:278 with
a Tyr65His substitution (mutation). Methods for detecting and/or
measuring expression, binding to CD28-Ig and/or CTLA-4-Ig, and
T-cell proliferation were performed as described above in previous
Examples.
[0785] FIGS. 23A-23B show that the hB7-1-Tyr-65His polypeptide
variant binds to soluble CTLA-4-Ig more preferentially than it does
to soluble CD28-Ig. FIGS. 23A-23B are histograms depicting the
differential binding of full-length hB7-1-Tyr65His variant,
CTLA-4BP 5.times.4-12c (gray histogram), and hB71 gray histogram)
to either soluble CD28-Ig or CTLA-4-Ig. The binding levels are
analyzed by flow cytometry (FACS) as described previously. HEK 293
cells (2.times.10.sup.5 cells) transfected with either the nucleic
acid sequence encoding hB7-1 (SEQ ID NO:278), CTLA-4BP 5.times.4
12c, or hB7-1-Tyr65His polypeptide variant were incubated with 2.5
microgram/milliliter (ug/ml) CTLA-4-Ig or 30 ug/ml CD28-Ig (both of
which are saturating concentrations), and binding was determined by
FACS analysis. Panel A shows that 293 cells expressing hB7-1,
CTLA-4BP 5.times.4-12c, or hB7-1-Tyr65His polypeptide variant bind
CTLA4-Ig in a substantially similar manner. Untransfected or
pcDNA3.1 transfected 293 cells showed no binding to CDLA-4-Ig.
However, as shown in Panel B, the binding of each of hB7-1-Tyr65His
variant and CTLA-4BP 5.times.4-12c polypeptide to CD28-Ig was
dramatically reduced to a level approximating that of untransfected
or pcDNA3.1 transfected 293 cells. Cells expressing hB7-1 showed
strong binding to CD28-Ig.
[0786] In addition to evaluating ligand binding, 293 HEK cells
transfected with pcDNA or with a nucleic acid sequence encoding
hB7-1 (SEQ ID NO:278), hB7-1-Tyr65His polypeptide variant, CTLA-4BP
5.times.4-12c (SEQ ID NO:39) (designated as clone 12c), or
CD28BP-15 (SEQ ID NO:19), and 293 cells alone (with no DNA) were
assayed for their ability to induce human T-cell proliferation (see
FIG. 24). A null response was observed with the negative controls
(293 cells transfected with pcDNA and 293 cells without any DNA)
and a robust proliferative response was observed with
CD28BP-15--about 3-fold higher than cells expressing hB7-1. Cells
expressing the hB7-1-Tyr65His variant and CTLA4-BP 5.times.4-12c
showed proliferation responses virtually identical to those of the
negative control groups, indicating that T cells received little or
no positive co-stimulatory signal. The lack of T cell induced
proliferation by the hB7-1-Tyr65His variant and CTLA-4BP
5.times.4-12c transfectants was not due to a lack of cell surface
expression of these molecules, since binding of these molecules to
CTLA4-Ig was normal (see inserted histogram in FIG. 24). The data
suggest the Tyr65His substitution in hB7-1 is a substitution
(mutation) that results in a polypeptide variant that
preferentially binds to CTLA-4 relative to CD28 and/or induces a
decreased level of T cell proliferation or does not induce T cell
proliferation compared to the level of T cell proliferation induced
by hB7-1, as determined by T cell proliferation analyses, under the
conditions set forth in Example IX (FIGS. 23-24). The polypeptide
variant did not bind CD28-Ig (FIGS. 23A-23B) as did hB7-1, but it
did bind CTLA-4-Ig in a manner that is substantially identical or
equivalent to that of hB7-1; the binding profile of the polypeptide
variant for CTLA-4-Ig was substantially identical or equivalent to
that of hB7-1. The polypeptide variant has a CTLA-4/CD28 binding
affinity ratio that is about equal to or greater than the
CTLA-4/CD28 binding affinity ratio of a hB7-1, under the conditions
described in FIGS. 23-24. Substitution of an amino acid that would
constitute a conservative substitution of His for Tyr at this
position of hB7-1 or substitution of an amino acid different than
His, but having functional or chemical properties similar to His
(Arg, Lys, Pro, Phe, and/or Trp), may produce variants with similar
properties.
Example X
Molecules with Immunosuppressive Properties
[0787] CTLA-4-Ig has been used as an antagonist of CD28 signaling,
because the molecule binds to B7-1 and B7-2 with high affinity and
thereby prevents the interaction of B7-1 and/or B7-2 with CD28
expressed on T cells. CD24-Ig also has been used in clinical trials
to treat psoriasis and has been shown to provide clinical benefits.
To compare CTLA-4-Ig with CD28BP-15-ECD-Ig and CD28BP-15-ECD with
regard to immunoregulation, we examined the effects of these
molecules on an antigen specific memory T cell response. The ECD of
CD28BP-15 (clone 15) comprises the amino acid sequence of at least
about amino acids 35-244 of SEQ ID NO:66.
[0788] Blood samples from three donors were obtained from Stanford
blood bank (Stanford, Calif.) (FIGS. 25A-25C). PBMCs were isolated
from each of these donors' blood by centrifugation over
Histopaque-1077 (Sigma). PBMCs were used at 1.times.10.sup.5
cells/well in 96-well round bottom assay plate and 1 ug/ml of
Tetanus Toxoid (TT, Calbiochem, San Diego, Calif.) was added into
the cultures. Increasing concentrations (ug/ml) of soluble proteins
of CD28BP-15-ECD-Ig (open triangle), CD28BP-15-ECD (close
triangle), WT huB7.1-ECD-Ig (close square), WT huB7.1-ECD (open
square), commercial CTLA-4Ig (R&D Systems) (closed diamond),
and control human IgG antibody (open circle) were added to the
cultures as described above. A non-specific human IgG was used as a
negative control in this Tetanus Toxoid specific response. Assay
plates were incubated for total of 5 days in 200 ul of Yssel's
medium. 1 uCi/well of .sup.3H-thymidine was added during the last 8
hours of incubation prior to being harvested. .sup.3H-thymidine
incorporation is indicative of T cell proliferation as described
previously. The data represent a mean of C.P.M.; each data point
was calculated from triplicate wells. The immunosuppressive effects
of CD28BP-15-ECD-Ig and CD28BP-15-ECD were comparable to or only
slightly less than those of CTLA-4-Ig.
[0789] Because CTLA-4-Ig has previously been shown to provide
clinical benefit in patients with psoriasis, and because the
immunosuppressive effects of CD28BP-15-ECD-Ig and CD28BP-15-ECD
were comparable to or only slightly less than those of CTLA-4-Ig,
these data support the conclusion that CD28BP-15-ECD-Ig and
CD28BP-15-ECD are useful as immunosuppressive agents. Importantly,
because the inhibitory effects of CD28BP-15-ECD-Ig and
CD28BP-15-ECD are likely to be mediated through binding to CD28,
thereby preventing (blocking) B7-1 and/or B7-2 from interacting
with CD28, the interaction of B7-1 and/or B7-2 with CTLA-4 in vivo
during the treatment with CD28BP-15-ECD-Ig or CD28BP-15-ECD is
likely to remain mostly unaffected. While CD28BP-15-ECD-Ig or
CD28BP-15-ECD prevent the signaling through CD28, they have little
or no effect on signaling through CTLA-4. This is in contrast to
CTLA-4-Ig, which binds to B7-1 and/or B7-2, preventing the
interactions of endogenous B7-1/B7-2 with both CD28 and CTLA-4 in
vivo. CD28BP-15-ECD-Ig and CD28BP-15-ECD were found to exhibit
immunosuppressive effects and are likely to be useful in a variety
of methods in which immunosuppression is desirable, including,
e.g., the treatment of autoimmune diseases and transplantation.
[0790] While the foregoing invention has been described in some
detail for purposes of clarity and understanding, it will be clear
to one skilled in the art from a reading of this disclosure that
various changes in form and detail can be made without departing
from the true scope of the invention. It is understood that the
examples and embodiments described herein are for illustrative
purposes only and that various modifications or changes in light
thereof will be suggested to persons skilled in the art and are to
be included within the spirit and purview of this application and
scope of the appended claims. For example, all the techniques and
apparatus described above may be used in various combinations. All
publications, patents, patent applications, and/or other documents
cited in this application are incorporated herein by reference in
their entirety for all purposes to the same extent as if each
individual publication, patent, patent application, and/or other
document were individually indicated to be incorporated herein by
reference in its entirety for all purposes.
TABLE-US-00009 SEQUENCES Clone ID SEQ ID Name Sequence SEQ ID Round
1 ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
1 (R1)
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CD28BP-71
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
(Clone
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA 71)
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTA
GCAGTGAACTGGATTTCAACATGACAAGCAATCACAGCTTCTTGTGTCTTGTCAAGTATGG
AGACTTAACAGTGTCACAGACCTTCTACTGGCAAGAATCCAAACCAACCCCTTCTGCTAAT
CAGCACCTGACCTGGACCATTATTATCCCAGTCTCAGCATTTGGGATTTCTGTGATCATTG
CAGTTATACTAACATGCCTGACCTGCAGAAATGCTGCAATACGCAGACAGAGAAGGGAGAA
TGAAGTGGAAATGCAAAGTTGCTCTCAGTCTCCATGA SEQ ID Round 1
ATGGGCCACACGCTGAGGCCGGGAACTCCACTGCCCAGGTGTCTACACCTCAAGCTCTGCC NO: 2
CD28BP-84
TGCTCCTGGCGCTGGCGGGTCTCCACTTCTCTTCAGGTATCAGCCAGGTCACCAAGTCGGT
(Clone
GAAAGAAATGGCAGCACTGTCCTGTGATTACAACATTTCTATCGATGAACTGGCGAGAATG 84)
CGCATATACTGGCAGAAGGACCAACAGATGGTGCTGAGCATCATCTCTGGGCAAGTGGAAG
TGTGGCCTGAGTACAAGAACCGCACCTTCCCCGACATCATTAACAACCTCTCCCTTATGAT
CCTGGCACTGCGCCTGTCGGACAAGGGCACCTACACCTGCGTGGTTCAGAAGAATGAGAAC
GGGTCTTTCAGACGGGAGCACCTGACCTCCGTGACACTGTCCATCAGAGCTGACTCCCCTG
TCCCTAGCATAACTGACATTGGACATCCCGCCCCTAATGTGAAAAGGATAAGATGCTCCGC
CTCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAAGAACTAAACGCC
GTCAACACGACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCAGCAGTGAACTGG
ATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGGGGAGCTGTCGGT
GTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGATCAGCTTCCATTC
TGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTCTCTACTGCCTGG
CCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGACAGTGGGAACTGA
AAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID Round 1
ATGGGCCACACGCTGAGGCCGGGAACTCCACTGCCCAGGTGTCTACACCTCAAGCTCTGCC NO: 3
CD28BP-
TGCTCTTGGCGCTGGCGGGTCTCCACTTCTCTTCAGGTATCAGCCAGGTCACCAAGTCGGT 118
GAAAGAAATGGCAGCACTGTCCTGTGATTACAACATTTCTATCGATGAACTGGCGAGAATG
(Clone
CGCATATACTGGCAGAAGGACCAACAGATGGTGCTGAGCATCATCTCTGGGCAAGTGGAAG 118)
TGTGGCCTGAGTACAAAAACCGCACCTTCCCCGACATCATTAACAACCTCTCCCTTATGAT
CCTGGCACTGCGCCTGTCGGACAAGGGCACCTACACCTGCGTGGTTCAGAAGAATGAGAAC
GGGTCTTTCAGACGGGAGCACCTGACCTCCGTGACACTGTCCATCAGAGCTGACTTCCCTG
TCCCTAGCATAACTGACATTGGACATCCCGCCCCTAATGTGAAAAGGATAAGATGCTCCGC
CTCTGGAGATTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAAGAACTAAACGCC
GTCAACACGACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCAGCAGTGAACTGG
ATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGGGGAGCTGTCGGT
GTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGATCAGCTTCCATTC
TGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTCTCTACTGCCTGG
CCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGACAGTGGGAACTGA
AAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID Round 1
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO: 4
CD28BP-
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC 126
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
(Clone
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA 126)
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGATTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO: 5
(R2) AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CD28BP-1
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCCGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO: 6
CD28BP-2
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCCCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACCGCCCGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO: 7
CD28BP-3
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO: 8
CD28BP-4
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTGCTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO: 9
CD28BP-5
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAAGGGCACCTACACCTGCGTGGTTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGGCATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
10 CD28BP-6
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGAGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
11 CD28BP-7
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGATGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
12 CD28BP-8
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTAGCATAACTGACATTGGACATCCCGCCCCTAATGTGAAAAGGAT
AAGATGCTCCGCCTCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAA
GAACTAAACGCCGTCAACACGACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCA
GCAGTGAACTGGATTCCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
13 CD28BP-9
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGCGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
14 CD28BP-10
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAGGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
15 CD28BP-11
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACGCATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAAGGGCACCTACACCTGCGTGGTTCAGAAG
AATGAGAACGGGTCTTTCAGACGGGAGCACCTGACCTCCGTGACACTGTCCATCAGAGCTG
ACTTCCCTGTCCCTAGCATAACTGACATTGGACATCCCGCCCCTAATGTGAAAAGGATAAG
ATGCTCCGCCTCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAAGAA
CTAAACGCCGTCAACACGACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCAGCA
GTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGGGGA
GCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGATCAG
CTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTCTCT
ACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGACAGT
GGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
16 CD28BP-12
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
17 CD28BP-13
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACTAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAA
GAACTAAACGCCGTCAACACGACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGCCACACGCTGAGGCCGGGAACTCCACTGCCCAGGTGTCTACACCTCAAGCTCTGCC NO:
18 CD28BP-14
TGCTCTTGGCGCTGGCGGGTCTCCACTTCTCTTCAGGTATCAGCCAGGTCACCAAGTCGGT
GAAAGAAATGGCGGCACTGTCCTGTGATTACAACATTTCTATCGATGAACTGGCGAGAATG
CGCATATACTGGCAGAAGGACCAACAGATGGTGCTGAGCATCATCTCTGGGCAAGTGGAAG
TGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCGTATTGTGAT
CCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAGCCTGTTTTG
AAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAGCTGACTTCC
CTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCTAATTTGCTC
AACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAAGAATTAAAT
GCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTAGCAGTGAAC
TGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGGGGAGCTGTC
GGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGATCAGCTTCCA
TTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTCTCTACTGCC
TGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGACAGTGGGAAC
TGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
19 CD28BP-15
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCCGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
20 CD28BP-16
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCACTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCGCTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
21 CD28BP-17
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAAAACCGCACCTTCCCCGACATCATTAACAACCTCTC
CCTTATGATCCTGGCACTGCGCCTGTCGGACAAGGGCACCTACACCTGCGTGGTTCAGAAG
AATGAGAACGGGTCTTTCAGACGGGAGCACCTGACCTCCGTGACACTGTCCATCAGAGCTG
ACTTCCCTGTCCCTAGCATAACTGACATTGGACATCCCGCCCCTAATGTGAAAAGGATAAG
ATGCTCCGCCTCCGGAGATTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAAGAA
CTAAACGCCGTCAACACGACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCAGCA
GTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGGGGA
GCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGATCAG
CTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGTGGTAGTTCTCT
ACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGACAGT
GGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 1
ATGGGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
22 (R1)
AGCTCTTGGTGCTGGCTGGTCTTTCTCACTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
CTLA4BP-5
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGATGCTTTCAAGCGGGAACACCTGGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 1
ATGGGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAATTTCTTTC NO:
23 CTLA4BP-7
AGCTCTTGGTGCTGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGGGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGATGCTTTCAAGCGAGAACACCTGGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCGCCTCTCCTGGTTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATGCTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCCTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 1
ATGAGCCACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCGTACCTCAAGTTCTTTC NO:
24 CTLA4BP-
AGCTCTTGGTGCTGGCTAGTCTTTCTCACTTCTGTTCAGGTGTTATCCACATGACCAAGGA 11
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGATGCTTTCAAGCGAGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTTCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATGCTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACAACCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCCTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCC
ACTGTTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ACACCCTGTATGA SEQ ID Round 1
ATGGGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
25 CTLA4BP-
AGCTCTTGGTGCTGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA 13
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTAGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCAACTTCTAATATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTTCGGGTTGGAAAATGGGGAAGAAATAAAT
GCCATCAACACAACAGCTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACACCCAATCGCAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGCAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAAGAGCAATGAGAGACTGAGAAGGGAAAGTGT
ACGCCCTGTATGAG SEQ ID Round 1
ATGAGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAATTTCTTTC NO:
26 CTLA4BP-
AGCTCTTGGTGCTGGCTAGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA 27
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCTCAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGAGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCCGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAGCCAATCACAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGGAGAAGGAATGAGACACTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGAATATCACCACCCAAGTGTCCATACCTCAATTTCTTTC NO:
27 CTLA4BP-
AGCTCTTGGTGCTGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACTAAGGA
5x2-10c
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCCGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAGCCAATCACAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAATGAGACACTGAGAAGGGAAAGTGTACG
CCCTGTATGAC SEQ ID Round 2
ATGAGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
28 CTLA4BP-
AGCTCTTGGTGCTGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x2-11d
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGAGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTTCTGGCTGGAAAATGGGGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCGATCGCAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGCAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAAGAGCAATGAGACACTGAGAAGGGAAAGTGT
ACGCCCTGTATGAAA SEQ ID Round 2
ATGAGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCGTACCTCAAGTTCTTTC NO:
29 CTLA4BP-
AGCTCTTGGTGCTGGCTAGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5X2-12F
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACCATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGAGAACACCTAGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCACCTTCTAACATTAAAAGGATAATTTGCTC
AACCTCCGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGGGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCCACTC
CCATCCTGGGCCATTACCTTAATCTCAGCAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGGAGAAGGAATGAGACACTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCGTACCTCAAGTTCTTTC NO:
30 CTLA4BP-
AGCTCTTGGTGCTGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x2-2g
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCAACTTCTAACATTAGAAGGATAATTTGCTC
AACCTCCGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACCGCTTTGCCCCAAGATGCAGAGAGAGAAAGAGCAATGAGAGACTGAGAAGGGAAAGTGT
ACGCCCTGTATGAC SEQ ID Round 2
ATGGGCTACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCGTACCTCAAGTTCTTTC NO:
31 CTLA4BP-
AGCTCTTGGTGCTGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAGGGA
5x2-3c
AGTGAAAGAAGTGGCAACACTGTCCTGTGGCCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTAGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCAACTTCTAATATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGGGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ATGCCCTGTATAAG SEQ ID Round 2
ATGAGCCACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCGTACCTCAAGTTCTTTC NO:
32 CTLA4BP-
AGCTCTTGGTGCTGGCTAGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x2-4c
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCTCAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGGAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGGGAAGAATTAAAT
GGCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAATCGCAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGGAGGAGGAATGAGAGACTGAGAAGGGAAAGTGT
ACACCCTGTATGAG SEQ ID Round-2
ATGAGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAATTTCTTTC NO:
33 CTLA4BP-
GGCTCTTGGTGCTGGCTAGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x2-7b
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGAGAACACCTAGCTGAAGTGACGTTATCAGTCAAAGCTGGCTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAGCCAATCACAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGCAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 2
ATGAGCCACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
34 CTLA4BP-
AGCTCTTGGTGCTGGCTAGTCTTTCTCACTTCTGTTCAGGTGTTATCCACATGACCAAGGA
5x2-8c
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCAGGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTTCTGGCTGGAAAATGGAGAGGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGACCCTGAAACTGAGCTCTATGCTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGCAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ACACCCTGTATGAT SEQ ID Round 2
ATGGGCTACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
35 CTLA4BP-
AGCTCTTGGTGCTGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x3-10e
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGGAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTGGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTTCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATGCTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGCAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAAGAGCAATGAGAGACTGAGAAGGGAAAGTGT
ACACCCTGTATGAT SEQ ID Round 2
ATGAGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
36 CTLA4BP-
AGCTCTTGGTGCTGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x3-11b
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTAGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCTCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTAGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAGCACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTACACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAATCGCAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCCTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGCAATGAGAGACTGAGAAGGGAAAGTGT
ACGCCCTGTATGAA SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCGTACCTCAATTTCTTTC NO:
37 CTLA4BP-
AGCTCTTGGTGCTAGCTGGTCTTTCTCACTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x3-6f
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGGGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGGAGTATGAA
AAAGACGCTTTCAAGCGAGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCAACTTCTAATATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGCTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGCAAATGGAATTTTTGTGATATGCTGCCTGGCCT
ACTGCTTTGCCCCAGGATGCAGAGAGAGAAAGAGCAATGAGAGACTGAGAAGGGAAAGTGT
ACGCCCTGTATGAC SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
38 CTLA4BP-
AGCTCTTGGTGCTGGCTTGTCTTTCTCATCTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x4-11d
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCTCAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAT
AAAGACGCTTTCAAGCGGGAACACCTGGCTGAAGTGACGTTGTCAGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCCGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAGCCAATCACAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCCTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACCGCTTTGCCCCAAGATGCAGAGAGAGAAAGAGCAATGAGAGACTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
39 CTLA4BP-
AGCTCTTGGTGCTGGCTGGTCTTTCTCACTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x4-12c
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATCGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGATGCTTTCAAGCGAGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTTCTGGTTGGAAAATGGGGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGCAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACCGCTTTGCCCCAAGATGCAGAGAGAGAAAGAGCAATGAGACACTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCGTACCTCAAGTTCTTTC NO:
40 CTLA4BP-
AGCTCTTGGTGATGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x4-1f
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGAGAACACCTAGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCAACTTCTAATATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTTCTGGTTGGAAAATGGGGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCCTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ATGCCCTGTATGAG SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
41 CTLA4BP-
AGCTCTTGGTGCTAGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x5-2e
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCTCAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGAGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATGCTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGGAGAAGGAATGAGACACTGAGAAGGGAAAGTGT
ACGCCCTGTATGAC SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
42 CTLA4BP-
AGCTCTTGGTGCTGGCTGGTCTTCCTCATCTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x5-6e
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGATGCTTTCAAGCGGGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCTGAGCCCCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAGCACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACAACCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGCAAATGGAATTTTTGTGATATGCTGCCTGACCC
ACTGTTTTGCCCCAAGATGCAGAGAGAGAAAGAGGAATGAGAGACTGAGAAGGGAAAGTGT
ACGCCCTGTATGAC SEQ ID Round 2
ATGAGCCACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
43 CTLA4BP-
AGCTCCTGGTGCTGGCTGGTCTTTCTCATCTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x6-9d
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGAGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCAACTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAGCCAATCACAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ACGCCCTGTATGAT SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCGTACCTCAATTTCTTTC NO:
44 CTLA4BP-
AGCTCTTGGTGCTGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x8-1f
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTGGCTGAAGTGATGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AGCCTCTGGAGGTTTTCCAGAGCCTCACCTCTTCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATGCTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAGGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCCTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAAGAGCAATGAGAGACTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCGTACCTCAATTTCTTTC NO:
45 CTLA4BP-
AGCTCTTGGTGCTGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x9-12c-
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGAGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCCGGAGGTTTTCCAGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGCTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAAGAGCAATGAGAGACTGAGAAGGGAAAGTGT
ACGCCCTGTATGAG SEQ ID Baboon
ATGGGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
46 B7-1
AGCTCTTGGTGCTGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGATGCTTTCAAGCGAGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTTCTGGTTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAATCACAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCCTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGTTTTGCCCCAAGATGCAGAGAGAGAAGAAGGAATGAGACATTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Orangutan
ATGGGCCACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCATACCTCAATTTCTTTC NO:
47 B7-1
AGCTCTTGGTGCTGGCTAGTCTTTCTCACTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATCCTGGCTCTGCGCCCATCTGACGAGGGCACATATGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTGGCTGAAGTGACGTTATCGGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCAACTTCTAATATTAGAAGGATGATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTCCTGGTTGGAAAATGGAGAAGAATTAAAT
GCCATCAGCACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATGCTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGCAATGAGAGACTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 1
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
48 CD28BP-71
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
(Clone
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE 71)
ELNATNTTLSQDPETKLYMISSELDFNMTSNHSFLCLVKYGDLTVSQTFYWQESKPTPSAN
QHLTWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVEMQSCSQSP SEQ ID Round 1
MGHTLRPGTPLPRCLHLKLCLLLALAGLHFSSGISQVTKSVKEMAALSCDYNISIDELARM NO:
49 CD28BP-84
RIYWQKDQQMVLSIISGQVEVWPEYKNRTFPDIINNLSLMILALRLSDKGTYTCVVQKNEN
(Clone
GSFRREHLTSVTLSIRADSPVPSITDIGHPAPNVKRIRCSASGGFPEPRLAWMEDGEELNA 84)
VNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQLPF
WVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 1
MGHTLRPGTPLPRCLHLKLCLLLALAGLHFSSGISQVTKSVKEMAALSCDYNISIDELARM NO:
50 CD28BP-
RIYWQKDQQMVLSIISGQVEVWPEYKNRTFPDIINNLSLMILALRLSDKGTYTCVVQKNEN 118
GSFRREHLTSVTLSIRADFPVPSITDIGHPAPNVKRIRCSASGDFPEPRLAWMEDGEELNA
VNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQLPF
WVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 1
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
51 CD28BP-
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK 126
PDLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
52 CD28BP-1
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
53 CD28BP-2
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTLSQDPETKLYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYRPACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
54 CD28BP-3
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
55 CD28BP-4
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLCWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
56 CD28BP-5
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDKGTYTCVVQK
PVLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
57 CD28BP-8
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWRSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
58 CD28BP-7
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
59 CD28BP-8
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPSITDIGHPAPNVKRIRCSASGGFPEPRLAWMEDGE
ELNAVNTTVDQDLDTELYSVSSELDSNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
60 CD28BP-9
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWRSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
61 CD28BP-10
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTLSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNASTEEL NO:
62 CD28BP-11
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDKGTYTCVVQK
NENGSFRREHLTSVTLSIRADFPVPSITDIGHPAPNVKRIRCSASGGFPEPRLAWMEDGEE
LNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQ
LPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
63 CD28BP-12
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
64 CD28BP-13
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPEPRLAWMEDGE
ELNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTLRPGTPLPRCLHLKLCLLLALAGLHFSSGISQVTKSVKEMAALSCDYNISIDELARM NO:
65 CD28BP-14
RIYWQKDQQMVLSIISGQVEVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQKPVL
KGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGEELN
ATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQLP
FWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
66 CD28BP-15
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRPSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
67 CD28BP-16
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLAAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
68 CD28BP-17
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTFPDIINNLSLMILALRLSDKGTYTCVVQK
NENGSFRREHLTSVTLSIRADFPVPSITDIGHPAPNVKRIRCSASGDFPEPRLAWMEDGEE
LNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQ
LPFWVIIPVSGALVLTVVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 1
MGHTRRQGISPSKCPYLKFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
69 CTLA4BP-5
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
KDAFKREHLAEVTLSVKADFPTPSISDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPGTELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV SEQ ID Round 1
MGYTRRQGTSPSKCPYLKFFQLLVLAGLSHLCSGVIHVTNEVKEVATLSCGHNVSGEELAQ NO:
70 CTLA4BP-7
TRIYWQKEKKMVLTMMYGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
KDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICLTSGGFPEPRLAWMKDGEELN
AISTTVSQDPGTELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFSWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV SEQ ID Round 1
MSHTRRQGTSPSKCPYLKFFQLLVLASLSHFCSGVIHMTKEVKEVATLSCGHNVSVEELAQ NO:
71 CTLA4BP-
TRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE 11
KDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLFWLENGEELN
AINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLL
PSWAITLISVNGIFVICCLTHCFAPRCRERRRNERLRRESVHPV SEQ ID Round 1
MGHTRRQGISPSKCPYLKFFQLLVLACLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
72 CTLA4BP-
TRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE 13
KDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLFGLENGEEIN
AINTTASQDPETELYTVSSKLDFNMTPNRSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISANGIFVICCLTYCFAPRCRERKSNERLRRESVRPV SEQ ID Round 1
MSHTRRQGISPSKCPYLNFFQLLVLASLSHFCSGVIHVTKEVKEVATLSCGLNVSVEELAQ NO:
73 CTLA4BP-
TRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE 27
KDAFKREHLAEVMLSVKADFPTPSISDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPETELYTVSSKLDFNMTANHSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNETLRRESVRPV SEQ ID Round 2
MGHTRRQGISPPKCPYLNFFQLLVLACLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
74 CTLA4BP-
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x2-10c
KDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPETELYTVSSKLDFNMTANHSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRNETLRRESVRPV SEQ ID Round 2
MSHTRRQGISPSKCPYLKFFQLLVLACLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
75 CTLA4BP-
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x2-11d
KDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLFWLENGEELN
AINTTVSQDPETELYTVSSKLDFNMTTDRSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISANGIFVICCLTYCFAPRCRERKSNETLRRESVRPV SEQ ID Round 2
MSHTRRQGISPSKCPYLKFFQLLVLASLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
76 CTLA4BP-
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5X2-12F
KDAFKREHLAEVTLSVKADFPTPSITDFEIPPSNIKRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNPL
PSWAITLISANGIFVICCLTYCFAPRCRERRRNETLRRESVRPV SEQ ID Round 2
MGHTRRQGTSPSKCPYLKFFQLLVLACLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
77 CTLA4BP-
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x2-2g
KDAFKREHLAEVMLSVKADFPTPSITDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYRFAPRCRERKSNERLRRESVRPV SEQ ID Round 2
MGYTRRQGTSPSKCPYLKFFQLLVLACLSHFCSGVIHVTREVKEVATLSCGHNVSVEELAQ NO:
78 CTLA4BP-
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x2-3c
KDAFKREHLAEVMLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPETGLYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVCPV SEQ ID Round 2
MSHTRRQGTSPSKCPYLKFFQLLVLASLSHFCSGVIHVTKEVKEVATLSCGLNVSVEELAQ NO:
79 CTLA4BP-
TRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLEYE
5x2-4c
KDAFKREHLAEVMLSVKADFPTPSISDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
GINTTVSQDPETELYTVSSKLDFNMTTNRSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVHPV SEQ ID Round 2
MSHTRRQGISPSKCPYLNFFRLLVLASLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
80 CTLA4BP-
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x2-7b
KDAFKREHLAEVTLSVKAGFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPGTELYTVSSKLDFNMTANHSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISANGIFVICCLTYCFAPRCRERRRNERLRRESVRPV SEQ ID Round 2
MSHTRRQGTSPSKCPYLKFFQLLVLASLSHFCSGVIHMTKEVKEVATLSCGHNVSVEELAQ NO:
81 CTLA4BP-
TRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x2-8c
KDAFKQEHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLFWLENGEELN
AINTTVSQDPETELYAVSSKLDFNMTTNHSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISANGIFVICCLTYCFAPRCRERRRNERLRRESVHPV SEQ ID Round 2
MGYTRRQGISPSKCPYLKFFQLLVLACLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
82 CTLA4BP-
TRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLEYE
5x3-10e
KDAFKREHLAEVTLSVKADFPTPSISDFEIPPSNIRRIICSTSGGFPEPHLFWLENGEELN
AINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISANGIFVICCLTYCFAPRCRERKSNERLRRESVHPV SEQ ID Round 2
MSHTRRQGISPSKCPYLKFFQLLVLACLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
83 CTLA4BP-
TRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRSSDEGTYECVVLKYE
5x3-11b
KDAFKREHLAEVTLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
AISTTVSQDPETELYTVSSKLDFNMTTNRSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRSNERLRRESVRPV SEQ ID Round 2
MGHTRRQGISPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
84 CTLA4BP-
TRIYWQKGKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLEYE
5x3-6f
KDAFKREHLAEVMLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTASQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISANGIFVICCLAYCFAPGCRERKSNERLRRESVRPV SEQ ID Round 2
MGHTRRQGISPSKCPYLKFFQLLVLACLSHLCSGVIHVTKEVKEVATLSCGLNVSVEELAQ NO:
85 CTLA4BP-
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYD
5x4-11d
KDAFKREHLAEVTLSVKADFPTPSISDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPETELYTVSSKLDFNMTANHSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYRFAPRCRERKSNERLRRESVRPV SEQ ID Round 2
MGHTRRQGTSPSKCPYLKFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
86 CTLA4BP-
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x4-12c
KDAFKREHLAEVMLSVKADFPTPSISDFEIPPSNIRRIICSTSGGFPEPHLFWLENGEELN
AINTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISANGIFVICCLTYRFAPRCRERKSNETLRRESVRPV SEQ ID Round 2
MGHTRRQGTSPSKCPYLKFFQLLVMACLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
87 CTLA4BP-
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x4-1f
KDAFKREHLAEVMLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLFWLENGEELN
AINTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVCPV SEQ ID Round 2
MGHTRRQGISPSKCPYLKFFQLLVLACLSHFCSGVIHVTKEVKEVATLSCGLNVSVEELAQ NO:
88 CTLA4BP-
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x5-2e
KDAFKREHLAEVMLSVKADFPTPSISDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNETLRRESVRPV SEQ ID Round 2
MGHTRRQGISPSKCPYLKFFQLLVLAGLPHLCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
89 CTLA4BP-
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x5-6e
KDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
AISTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLL
PSWAITLISANGIFVICCLTHCFAPRCRERKRNERLRRESVRPV SEQ ID Round 2
MSHTRRQGTSPSKCPYLKFFQLLVLAGLSHLCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
90 CTLA4BP-
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x6-9d
KDAFKREHLAEVMLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPETELYTVSSKLDFNMTANHSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV SEQ ID Round 2
MGHTRRQGISPSKCPYLNFFQLLVLACLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
91 CTLA4BP-
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x8-1f
KDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSASGGFPEPHLFWLENGEELN
AINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIRYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERKSNERLRRESVRPV SEQ ID Round 2
MGHTRRQGTSPSKCPYLNFFQLLVLACLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
92 CTLA4BP-
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x9-12c
KDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTASQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERKSNERLRRESVRPV SEQ ID Baboon
MGHTRRQGISPSKCPYLKFFQLLVLACLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
93 B7-1
TRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
KDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLFWLENGEELN
AINTTVSQDPGTELYTVSSKLDFNMTTNHSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNETLRRESVRPV SEQ ID Orangutan
MGHTRRQGTSPSKCPYLNFFQLLVLASLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
94 B7-1
TRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
KDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRMICSTSGGFPEPHLSWLENGEELN
AISTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRSNERLRRESVRPV SEQ ID Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
95 CD28A12-5
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCGAAAGGATAGTAAAATGNTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGTACCATCACTGACATGAACGATAACCTCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGATTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTTGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGTGCCCATGCCTCTGGCTCTCTC NO:
96 CD28A4-5*
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACCGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
97 CD28A4-9
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAAAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAOTTTCCCAAGATCCTGAAACCAAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCCGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCTCGGGCTGAGGTA
CCAAGCTTAAGTTNA SEQ ID Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
98 CD28A6-9
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTTGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCCCTC NO:
99 CD28A6-1
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGAAACCAAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATTGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCCGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGATAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
100 CD28A8-4
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTAG SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCCC NO:
101 CD28A8-6
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCCATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGCGTGGTTCAGAAG
AATGAGAACGGGTCTTTCAGACGGGAGCACCTGACCTCCGTGACACTGTCCATCAGAGCTG
ACTTCCCTGTCCCTAGCATAACTGACATTGGACATCCCGCCCCTAATGTGAAAAGGATAAG
ATGCTCCGCCTCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAAGAA
CTAAACGCCGTCAACACAACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCAGCA
GTGAGCTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGGGGA
GCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGATCAG
CTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTCTCT
ACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGACAGT
GGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
102 CD28B2-8
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAAGGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACGAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
103 CD28B4-3
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTA
GCAGTGAACTGGATTTCAACATGACAAGCAATCACAGCTTCTTGTGTCTTGTCAAGTATGG
AGACTTAACAGTGTCACAGACCTTCTACTGGCAAGAATCCAAACCAACCCCTTCTGCTAAT
CAGCACCTGACCTGGACCATTATTATCCCAGTCTCAGCATTTGGGATTTCTGTGATCATTG
CAGTTATACTAACATGCCTGACCTGCAGAAATGCTGCAATACGCAGACAGAGAAGGGAGAA
TGAAGTGGAAATGCAAAGTTGCTCTCAGTCTCCATAG SEQ ID Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
104 CD28B6-3
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGATTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTA
GCAGTGAACTGGATTTCAACATGACAAGCAATCACAGCTTCTTGTGTCTTGTCAAGTATGG
AGACTTAACAGTGTCACAGACCTTCTACTGGCAAGAATCCAAACCAACCCCTTCTGCTAAT
CAGCACCTGACCTGGACCATTATTATCCCAGTCTCAGCATTTGGGATTTCTGTGATCATTG
CAGTTATACTAACATGCCTGACCTGCAGAAATGCTGCAATACGCAGACAGAGAAGGGAGAA
TGAAGTGAAAATGCAAAGTTGCTCTCAGTCTCCATGAG SEQ ID Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
105 CD28B6-6
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAAGGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGACCTCCGTGACACTGTCCATCAGAG
CTGACTTCCCTGTCCCTAGCATAACTGACATTGGACATCCCGCCCCTAATGTGAAAAGGAT
AAGATGCTCCGCCTCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAA
GAACTAAACGCCGTCAACACGACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCA
GCAGTGAACTGGATTTCAATGCGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTGTCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGA SEQ ID Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
106 CD28B8-5*
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCACAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
107 CD28C11-5
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGCGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTAG SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
108 CD28C6-1
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGGTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
109 CD28C7-3
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGATTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTAGCATAACTGACATTGGACATCCCGCCCCTAATGTGAAAAGGAT
AAGATGCTCCGCCTCTGGAGATTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAA
GAACTAAACGCCGTCAACACGACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
110 CD28C8-6
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGGTTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGAG SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
111 CD28C9-5*
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCTGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTNGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTAG SEQ ID
Round 2
ATGGGCCACACGCTGAGGCCGGGAACTCCACTGCCCAGGTGTCTACACCTCAAGCTCTGCC NO:
112 CD28C2-4
TGCTCTTGGCGCTGGCGGGTCTCCACTTCTCTTCAGGTATCAGCCAGGTCACCAAGTCGGT
GAAAGAAATGGCAGCACTGTCCTGTGATTACAACATTTCTATCGATGAACTGGCGAGAATG
CGCATATACTGGCAGAAGGACCAACAGATGGTGCTGAGCATCATCTCTGGGCAAGTGGAGG
TGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCGTATTGTGAT
CCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAGCCTGTTTTG
AAAGGGGCTTATAAACCGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAGCTGACTTCC
CTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCTAATTTGCTC
AACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAAGAATTAAAT
GCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTAGCAGTGAAC
TGGATTTCAACATGACAAGCAATCACAGCTTCTTGTGTCTTGTCAAGTATGGAGACTTAAC
AGTGTCACAGACCTTCTACTGGCAAGAATCCAAACCAACCCCTTCTGCTAATCAGCACCTG
ACCTGGACCATTATTATCCCAGTCTCAGCATTTGGGATTTCTGTGATCATTGCAGTTATAC
TAACATGCCTGACCTGCAGAAATGCTGCAATACGCAGACAGAGAAGGGAGAATGAAGTGGA
AATGCAAAGTTGCTCTCAGTCTCCATAG SEQ ID Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
113 CD28D2-3
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCAGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATCCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACTGATCTTGGAAATCCATCTCCTAATATCAGAAGGCTAATTTG
CTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAAGAATTA
AATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTAGCAGTG
AACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGGGGAGCT
GTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGATCAGCTT
CCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTCTCTACT
GCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGACAGTGGG
AACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
114 CD28D2-9
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
115 CD28D8-9
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
116 CD28D11-1
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGCGTGGTTCAGAAG
AATGAGAACGGGTCTTTCAGACGGGAGCACCTGACCTCCGTGACACTGTCCATCAGAGCTG
ACTTCCCTGTCCCTAGCATAACTGACATTGGACATCCCGCCCCTAATGTGAAAAGGATAAG
ATGCTCCGCCTCTGGAGATTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAAGAA
CTAAACGCCGTCAACACGACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCAGCA
GTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGGGGA
GCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGATCAG
CTTCCATTCTGGGTCATTATCCTAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTCTCT
ACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGACAGT
GGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGAG SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
117 CD28D12-5
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTAGCATAACTGACATTGGACATCCCGCCCCTAATGTGAAAAGGAT
AAGATGCTCCGCCTCTGGAGATTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAA
GAACTAAACGCCGTCAACACGACGGTTTTGGACACGGAGCTCTACAGCGTCAGCAGTGAAC
TGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGGGGAGCTGTC
GGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGATCAGCTTCCA
TTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTCTCTACTGCC
TGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGACAGTGGGAAC
TGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAACCCTCGGGCTGA SEQ ID Round 2
ATGGGTCACACAATGGAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
118 CD28E10-6
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTAGAAAATGGAGAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
119 CD28F7-2
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCCGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAA
GAACTAAACGCCGTCAACACGACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
120 CD28F8-4
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCAGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
121 CD28F10-2
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGATTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTAGCATAACTGACATTGGACATCCCGCCCCTAATGTGAAAAGGAT
AAGATGCTCCGCCTCTGGAGATTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAA
GAACTAAACGCCGTCAACACGACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGAG SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
122 CD28F12-
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC 5*
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGATTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTAGCATAACTGACATTGGACATCCCGCCCCTAATGTGAAAAGGAT
AAGATGCTCCGCCTCTGGAGATTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGGGAA
GAACTAAACGCCGTCAACACGACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGCGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTAG SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
123 CD28G2-8
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTAGCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCCGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
124 CD28G1-5
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAAAACCGCACCTTCCCCGACATCATTAACAACCTCTC
CCTTATGATCCTGGCACTGCGCCTGTCGGACAAGGGCACCTACACCTGCGTGGTTCAGAAG
AATGAGAACGGGTCTTTCAGACGGGAGCACCTGACCTCCGTGACACTGTCCATCAGAGCTG
ACTTCCCTGTCTCTAGCATAACTGACATTGGACATCCCGCCCCTAATGTGAAAAGGATAAG
ATGCTCCGCCTCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAAGAA
CTAAACGCCGTCAACACGACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCAGCA
GTGAACTGGATTTCAATGTGACAAATAACCACAGCATTGTGTGTCTCATCAAATACGGGGA
GCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGATCAG
CTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTCTCT
ACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGACAGT
GGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
125 CD28G1-9
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTAGCATAACTGACATTGGACATCCCGCCCCTAATGTGAAAAGGAT
AAGATGCTCCGCCTCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAA
GAACTAAACGCCGTCAACACGACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
126 CD28H4-3
AGCTCTTGGTGCTCACTGATCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCAAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
127 CD28H11-3
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGCAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTAG SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
128 CD28H6-6
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTAAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAAGAATTAAAT
GCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTAGCAGTGAAC
TGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGGGGAGCTGTC
GGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGATCAGCTTCCA
TTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTCTCTACTGCC
TGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGACAGTGGGAAC
TGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
129 CD28E2-4
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCACTGCGCCTGTCGGACAAGGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
130 CD28B4-5a
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTAG SEQ.ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
131 CD28A2-5
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGATTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTAGCATAACTGACATTGGACATCCCGCCCCTAATGTGAAAAGGAT
AAGATGCTCCGCCTCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAA
GAACTAAACGCCGTCAACACGACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCA
GCAGTGAACTGGATTTCAACATGACAAGCAATCACAGCTTCTTGTGTCTTGTCAAGTATGG
AGACTTAACAGTGTCACAGACCTTCTACTGGCAAGAATCCAAACCAACCCCTTCTGCTAAT
CAGCACCTGACCTGGACCATTATTATCCCAGTCTCAGCATTTGGGATTTCTGTGATCATTG
CAGTTATACTAACATGCCTGACCTGCAGAAATGCTGCAATACGCAGACAGAGAAGGGAGAA
TGAAGGGAAATGCAAAGTGCTCTCAGTCTCCATAGGTACCAAGCTTAAGTTTAACCGC SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
132 CD28B4-5*
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAAGGGCACCTACACCTGCGTGGTTCAGAAG
CCTGATTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTAGCATAACTGACATTGGACATCCCGCCCCTAATGTGAAAAGGAT
AAGATGCTCCGCCTCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAA
GAACTAAACGCCGTCAACACGACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTTCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
133 CD28D5-6
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTA
GCAGTGAACTGGATTTCAACATGACAAGCAATCACAGCTTCTTGTGTCTTGTCAAGTATGG
AGACTTAACAGTGTCACAGTCCTTCTACTGGCAAGAATCCAAACCAACCCCTTCTGCTAAT
CAGCACCTGACCTGGACCATTATTATCCCAGTCTCAGCATTTGGGATTTCTGTGATCATTG
CAGTTATACTAACATGCCTGACCTGCAGAAATGCTGCAATACGCAGACAGAGAAGGGAGAA
TGAAGTGGAAATGCAAAGTTGCTCTCAGTCTCCATGA SEQ ID Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
134 CD28D10-4
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAAGGGCACCTACACCTGCGTGGTTCAGAAG
AATGAGAACGGGTCTTTCAGACGGGAGCACCTGACCTCCGTGACACTGTCCATCAGAGCTG
ACTTCCCTGTCCCTAGCATAACTGACATTGGACATCCCGCCCCTAATGTGAAAAGGATAAG
ATGCTCCGCCTCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAAGAA
CTAAACGCCGTCAACACGACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCAGCA
GTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGGGGA
GCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGATCAG
CTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTCTCT
ACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGACAGT
GGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTAG SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
135 CD28E2-5*
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCACCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCCGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTA
GCAGTGAACTGGATTTCAACATGACAAGCAATCACAGCTTCTTGTGTCTTGTCAAGTATGG
AGACTTAACAGTGTCACAGACCTTCTACTGGCAAGAATCCAAACCAACCCCTTCTGCTAAT
CAGCACCTGACCTGGACCATTATTATCCCAGTCTCAGCATTTGGGATTTCTGTGATCATTG
CAGTTATACTAACATGCCTGACCTGCAGAAATGCTGCAATACGCAGACAGAGAAGGGAGAA
TGAAGTGGAAATGCAAAGTTGCTCTCAGTCTCCATGA SEQ ID Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
136 CD28E5-2
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGATTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCGCAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
137 CD28E8-6
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGAAACCAAGCTCTACATGATTA
GCAGTGAACTGGATTTCAACACGACAAGCAATCACAGCTTCTTGTGTCTTGTCAAGTATGG
AGACTTAACAGTGTCACAGACCTTCTACTGGCAAGAATCCAAACCAACCCCTTCTGCTAAT
CAGCACCTGACCTGGACCATTATTATCCCAGTCTCAGCATTTGGGATTTCTGTGATCATTG
CAGTTATACTAACATGCCTGACCTGCAGAAATGCTGCAATACGCAGACAGAGAAGGGAGAA
TGAAGTGGAAATGCAAAGTTGCTCTCAGTCTCCATGA SEQ ID Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
138 CD28E9-6
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAAGGGCACCTACACCTGTGTTATTCAGAAG
CCTGATTTGAAAGGGGCTTATAAACTGGAGCACCTGGCTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGGCATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
139 CD28F3-1
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGATTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAAAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTA
GCAGTGAACTGGATTTCAACATGACAAGCAATCACAGCTTCTTGTGTCTTGTCAAGTATGG
AGACTTAACAGTGTCACAGACCTTCTACTGGCAAGAATCCAAACCAACCCCTTCTGCTAAT
CAGCACCTGACCTGGACCATTATTATCCCAGTCTCAGCATTTGGGATTTCTGTGATCATTG
CAGTTATACTAACATGCCTGACCTGCAGAAATGCTGCAATACGCAGACAGAGAAGGGAGAA
TGAAGTGGAAATGCAAAGTTGCTCTCAGTCTCCATGA SEQ ID Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
140 CD28F3-5
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGCGTGGTTCAGAAG
AATGAGAACGGGTCTTTCAGACGGGAGCACCTGACCTCCGTGACACTGTCCATCAGAGCTG
ACTTCCCTGTCCCTAGCATAACTGACATTGGACATCCCGCCCCTAATGTGAAAAGGATAAG
ATGCTCCGCCTCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAAGAA
CTAAACGCCGTCAACACGACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCAGCA
GTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGGGGA
GCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGATCAG
CTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTCTCT
ACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGACAGT
GGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGAG SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCCGGCTCTCTC NO:
141 CD28F3-6
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGATTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTA
GCAGTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGG
GGAGCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGAT
CAGCTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTC
TCTACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGAC
AGTGGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID
Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
142 CD28F11-8
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGTTTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTA
GCAGTGAACTGGATTTCAACATGACAAGCAATTTGTGTCTTGTCAAGTATGGAGACTTAAC
AGTGTCACAGACCTTCTACTGGCAAGAATCCAAACCAACCCCTTCTGCTAATCAGCACCTG
ACCTGGACCATTATTATCCCAGTCTCAGCATTTGGGATTTCTGTGATCATTGCAGTTATAC
TAACATGCCTGACCTGCAGAAATGCTGCAATACGCAGACAGAGAAGGGAGAATGAAGTGGA
AATGCAAAGTTGCTCTCAGTCTCCATGA SEQ ID Round 2
ATGAGCCACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCGTACCTCAAGTTCTTTC NO:
143 CTLA4BP
AGTTCTTGGTGCTGGCTAGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACTAAGGA
5x9-d10
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCTCAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGGGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGGAGTATGAA
AAAGATGCTTTCAAGCGAGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCCGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGCTTCCCAAGATCCTGGAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATOTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCC
ACTGTTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGC
ACGCCCTGTATGA SEQ ID Round 2
ATGGGCTACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCGTACCTCAAGTTCTTTC NO:
144 CTLA4BP
AGCTCTTGGTGCTGGCTAGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x6-f6
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCCCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGAGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCCGGAGGTTTTCCTGAGCCTCACCTCTTCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAATCGCAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGCAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACCGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGGCTGAGAAGGGAAAGTGT
ATGCCCTGTATGAG SEQ ID Round 2
ATGGGCTACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
145 CTLA4BP
AGCTCTTGGTGCTGGCTAGTCTTTCCCACTTCTGTTCAGGTGTTATCCACGTGACCAAGAA
5c5-h12
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAATGTGTTGTTCTGAAGTATGAA
AAAGATGCTTTCAAGCGGGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCGATCGCAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCCTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGGGAGATTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 2
ATGAGCCACACACAGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAATTTCTTTC NO:
146 CTLA4BP
AGCTCTTGGTGCTGGCTAGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x5-c10
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGGAGTATGAA
AAAGACGCTTTCAAGCGGGAGCACCTAGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCCCACCTCTTCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAGCACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATGCTGTCAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACAACCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGGAGAAGGAATGAGAGATTGAGAAGGGAAAGTGT
ACACCCTGTATGAG SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
147 CTLA4BP
AGCTCTTGGTGCTGGCTGGTCTTTCTCATCTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x3-e8
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGGAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTAGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCGACTTCTAATATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTTCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAGCCAATCACAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAGGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ATGCCCTGTATAG SEQ ID Round 2
ATGAGCCACATACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAATTTCTTTC NO:
148 CTLA4BP
AGCTCTTGGTGCTGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x3-c4
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCCGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTGGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAAGAACTAAAT
GCCATCAACACAACAGCTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAATCGCAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGTTC
CCATCCTGGGCCATTACCCTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 2
ATGAGCCACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCGTACCTCAAGTTCTTTC NO:
149 CTLA4BP
AGCTCTTGGTGCTGGCTAGTCTTTCTCACTTCTGTTCAGGTGTTATCCACATGACCAAGGA
5x3-c3
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCCCAATGTTTCCGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGATGCTTTCAAGCGAGAACACCTGGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCAACTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCC
ACTGTTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ATGCCCTGTATAG SEQ ID Round 2
ATGAGCCACACACGGAGGCAGGGAATATCATCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
150 CTLA4BP
AGCTCTTGGTGCTGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGAA
5x2-h11
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGGGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTGCAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGCTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTAGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCAACTTCTAATATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTTCTGGTTGGAAAATGGGGAAGAATTAAAT
GCCATCAACACAACAGCTTCCCAAGATCCTGAAACTGAGCTCTATGCTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAAGAGCAATGAGAGACTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 2
ATGGGCTACACACGGAGGCAGGGAACATCACCATCCGAGTGTCCATACCTCAAGTTCTTTC NO:
151 CTLA4BP
AGCTCTTGGTGCTGGCTGGTCTTTCTCACTTCTGTTCAGGTGTTATCCACATGACCAAGGA
5x2-d7
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCTCAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGATGCCTTCAAGCGGGAACACCTGGCTGAAGTGATGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGGGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCCTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGACTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 2
ATGAGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAATTTCTTTC NO:
152 CTLA4BP
GGCTCTTGGTGCTGGCTAGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x2-b7
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGAGAACACCTAGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAGCCAATCACAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGCAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 2
ATGAGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
153 CTLA4BP
AGCTCTTGGTGCTGGCTAGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x2-b1
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGCACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCCGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATACTGGTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAGCTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCCTAATCTCAGCAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGACCCTGAGAAGGGAAAGTGT
ACGCCCTGTATGGGGTACCAAGCTTAAGTTTAAACCGCNNATCAGCC SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
154 CTLA4BP
AGCTCTTGGTGCTGGCTAGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACTAAGGA
5x1-f1
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCTCAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGCACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTAGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCCGGAGGTTTTCCTGAGCCTCACCTCTTCTGGCTGGAAAATGGAGAAGAATTAAAC
GCCATCAACACAACAGCTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAGCCAATCACAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGGAGAAGGAATGAGACACTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 2
ATGGGCTACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCATACCTCAATTTCTTTC NO:
155 CTLA4BP
AGCTCTTGGTGCTAGCTAGTCTTTCTCACTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x1-d7
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTCCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGGGTGTGTTGTTCTGGAGTATGAA
AAAGACGCTTTCAAGCGAGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACCTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTTCTGGTTGGAAAATGGGGAAGAATTAAAT
GCCATCAACACAACAGCTTCCCAAGATCCTGAAACTGAGCTCTATGCTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGCAAATGGAATTTTTGTGATATGCTGCCTGACTT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ACACCCTGTATGA SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
156 CTLA4BP
AGCTCTTGGTGCTGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
2x4-g9
AGTGAAAGAGGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGATAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCAGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGATGCTTTCAAGCAGGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAAGAACTAAAT
GCCATCAGCACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTGTACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAGGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAAGGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGAGGCAGAGAGAGAAAGAGCAATGGGAGACTGAGAAGGGAAAGTGT
ACACCCTGTATGA SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
157 CTLA4BP
AGCTCTTGGTGCTGGCTGGTCTTTCTCACTTCTGTTCAGGTGTTATCCACGTGACTAAGGA
2x4-a6
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGATGCTTTCAAGCGGGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCTGAGCCTCACCTCTTCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAGCACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATGCTGNTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCCTAATCTCGGTAAATGGAATTTTTGTGATATGCTGCCCGACCT
ACTGCTTTGCCCCAAGGTGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ATGCCCTGTATGA SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
158 CTLA4BP
AGCTCTTGGTGCTGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCTACGTGACCAAGGA
2x2-f3
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGATTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATAGGAGTGTGTTGTTCTGAAGTATGAA
AAAGATGCTTTCAAGCGGGAACACCTGGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ATGCCCTGTATGA SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
159 CTLA4BP
AGCTCTTGGTGCTGGCTGGTCTTTCTCACTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
2x2-f12
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGGGTGTGTTGTTCTGGAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATGCTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGCGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCCTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 2
ATGGGCTACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCATACCTCAATTTCTTTC NO:
160 CTLA4BP
AGCTCTTGGTGCTGGCTAGTCTTTCTCACTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
2x1-g8
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCGTTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTGGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAATCGCAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCCTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAAGAGCAATGAGAGACTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 2
ATGGGCTACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
161 CTLA4BP
AGCTCTTGGTGCTGGCTGGTCTTTCTCACTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
2x1-f10
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGATGCTTTCAAGCGGGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTATGCTGTTAGCAGCAAAC
TGGATTTTAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTCTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ATGCCCTGTATGA SEQ ID Round 2
ATGAGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
162 CTLA4BP
AGCTCTTGGTGCTGGCTGGTCTTTCTCACTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
2x1-c9
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGCTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGGAGTATGAA
AAAGATGCTTTCAAGCGGGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCAACTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAAGAACTAAAT
GCCATCAGCACAACAGCTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACTAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCCTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCC
ACTGTTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ATGCCCTGTATGA SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
163 CTLA4BP
AGCTCTTGGTGCTGGCTGGTCTTTCTCACTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
2x1-h12
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCTCAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGCAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAAGAGCAATGAGAGACTGAGAAGGGAAAGTGT
ATGCCCTGTATGA SEQ ID Round 2
ATGGGCTACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
164 CTLA4BP
AGCTCTTGGTGCTGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
2x1-e2
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGATGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGATGCTTTCAAGCGAGAACACCTGGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGGGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTAGGCCATTACCTTAATCTCAGCAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCGAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTAT
ACACCCTGTATGA SEQ ID Round 2
ATGGGCTACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
165 CTLA4BP
AGCTCTTGGTGCTGGCTGGTCTTTCTCATCTCTGTTCAGGTGTTATCCACGTGACTAAGGA
2x1-c4
AGTGAAAGAAGTGGCAACGCTGCCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGATGCTTTCAAGCGGGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTTCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTATGCTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAACTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGGATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
166 CTLA4BP
AGCTCTTGGTGCTGGCTGGTCTTTCTCATCTCTGTTCAGGTGTTATCCACATGACTAAGGA
2x1-b12
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGCTCTGAAGTATGAA
AAAGATGCTTTCAAGCAGGAACACCTGGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAGCCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ATGCCCTGTATGA SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
167 CTLA4BP
AGCTCTTGGGGCTGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
2x2-f1
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCTATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAGGACGCTTTCAAGCGGGAACACCTGGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCAACTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTTCTGGCTGGAAAATGGGGAAGAATTAAAT
GCCATCAACACAACAGCTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAATCGCAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTACTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTCGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 2
ATGAGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
168 CTLA4BP
AGCTCTTGGTGCTGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x4-h1
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGATGCTTTCAAGCGGAAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCAACTTCTAATATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCTGAGCCTCACCTCTTCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGCTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAATCGCAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTAATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGGAGAAGGAATGAGACACTGAGAAGGGAAAGTGT
ACACCCTGTATGA SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
169 CTLA4BP
AGCTCTTGGTGCTGGCTGGTCTTTCTCACTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x4-a1
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGCACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTGGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTTTGAAATTCCAACTTCTAATATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAATCGCAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGGGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 2
ATGAGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
170 CTLA4BP
AGCTCTTGGTGCTGGCTAGTCTTTCTCACTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
5x2-f3
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGCCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAGGTATGAA
AAAGATGCTTTCAAGCGGGAACACCTGGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCAACTTCTAATATTAGAAGGATAATTTGCTC
AACCTCCGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGGGAAGAATTAAAT
GCCATCAACACAACAGCTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAATCGCAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGCAAATGGAATTTTTGTGATATGCTGCCTGACCC
ACTGCTTCGCCCCAAGATGCAGAGAGAGAAAGAGCAATGAGAGACTGAGAAGGGAAAGTGT
ACGCCCTGTATAG SEQ ID Round 2
ATGAGCCACACACGGAGGCAGGGAATATCACCATCCAAGTGTCCGTACCTCAAGTTCTTTC NO:
171 CTLA4BP
AGCTCTTGGTGCTGGCTGGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACTAAGGA
5x2-e12
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCCACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGGCATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTAGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCAACTTCTAATATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCAGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAGCACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTATGCTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAATCGCAGTTTTGTGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACAACCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCCTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ACGCCCTGTATAG SEQ ID Round 2
ATGGGCTACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
172 CTLA4BP
AGCTCTTGGTGCTGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACTAAGGA
2x4-h11
AGTGAAAGAAGTGGCAACACTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGGAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTATGCTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCCTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGGCCT
ACTGCTTTGCCCCAAGATGCAGAGGGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Round 2
ATGGGCCACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCGTACCTCAATTTCTTTC NO:
173 CTLA4BP
AGCTCTTGGTGCTGGCTTGTCTTTCTCACTTCTGTTCAGGTGTTATCCACGTGACTAAGGA
2x3-h2
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGATGCTTTCAAGCGAGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AACCCCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGGGAAGAACTAAAT
GCCATCAGCACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTATGCTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACAACCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCCTAATCTCAGTAAAGGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGGAGAGAGAGAAAGAGCAATGAGAGACTGAGAAGGGAAAGTGT
ACGCCCTGTATAG SEQ ID Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
174 CD28A12-5
TSLRIYWRKDSKMXLAILPGKVQVWPEYKNRTITDMNDNLRIVILALRLSDSGTYTCVIQK
PDLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELLVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKCPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
175 CD28A4-5*
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTLSQDPETKLYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEKL NO:
176 CD28A4-9
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPETKLYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCPACRHVARWKRTRRNEETVGTERLSPIYLGSAQSRAEV PSLSX
SEQ ID Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
177 Cd28A6-9
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFLVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLPQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
178 CD28A6-1
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPETKLYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFRVIIPVSGALVLTAIVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
179 CD28A8-4
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMPSCDYSTSTEEL NO:
180 CD28A8-6
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVVQK
NENGSFRREHLTSVTLSIRADFPVPSITDIGHPAPNVKRIRCSASGGFPEPRLAWMEDGEE
LNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQ
LPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
181 CD28B2-8
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDKGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
182 CD28B4-3
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTLSQDPETKLYMISSELDFNMTSNHSFLCLVKYGDLTVSQTFYWQESKPTPSAN
QHLTWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVEMQSCSQSP SEQ ID Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
183 CD28B6-3
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PDLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTLSQDPETKLYMISSELDFNMTSNHSFLCLVKYGDLTVSQTFYWQESKPTPSAN
QHLTWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVKMQSCSQSP SEQ ID Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
184 CD28B6-6
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDKGTYTCVIQK
PVLKGAYKLEHLTSVTLSIRADFPVPSITDIGHPAPNVKRIRCSASGGFPEPRLAWMEDGE
ELNAVNTTVDQDLDTELYSVSSELDFNATNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIVPVSGALVLTAVVLYCLACRHVAR SEQ ID Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
185 CD28B8-5*
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTLSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWPSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
186 CD28C11-5
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIACLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
187 CD28C6-1
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHGARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
188 CD28C7-3
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PDLKGAYKLEHLTSVRLMIRADFPVPSITDIGHPAPNVKRIRCSASGDFPEPRLAWMEDGE
ELNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
189 CD28C8-6
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELGFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
190 CD28C9-5*
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARXKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTLRPGTPLPRCLHLKLCLLLALAGLHFSSGISQVTKSVKEMAALSCDYNISIDELARM NO:
191 CD28C2-4
RIYWQKDQQMVLSIISGQVEVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQKPVL
KGAYKPEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGEELN
ATNTTLSQDPETKLYMISSELDFNMTSNHSFLCLVKYGDLTVSQTFYWQESKPTPSANQHL
TWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVEMQSCSQSP SEQ ID Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
192 CD28D2-3
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVIQALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTDLGNPSPNIRRLICSTSGGFPRPHLYWLENGEEL
NATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQL
PFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
193 CD28D2-9
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTLSQDPETELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
194 CD28D8-9
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
195 CD28D11-1
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVVQK
NENGSFRREHLTSVTLSIRADFPVPSITDIGHPAPNVKRIRCSASGDFPEPRLAWMEDGEE
LNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQ
LPFWVIILVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
196 CD28D12-5
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPSITDIGHPAPNVKRIRCSASGDFPEPRLAWMEDGE
ELNAVNTTVLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQLP
FWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQPSG SEQ ID
Round 2
MGHTMEWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
197 CD28E10-6
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTLSQDPETELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
198 CD28F7-2
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPEPRLAWMEDGE
ELNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
199 CD28F8-4
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTLSQDPETKLYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
200 CD28F10-2
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PDLKGAYKLEHLTSVRLMIRADFPVPSITDIGHPAPNVKRIRCSASGDFPEPRLAWMEDGE
ELNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
201 CD28F12-
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK 5*
PDLKGAYKLEHLASVRLMIRADFPVPSITDIGHPAPNVKRIRCSASGDFPEPRLAWMEDGE
ELNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
202 CD28G2-8
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPSINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
203 CD28G1-5
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTFPDIINNLSLMILALRLSDKGTYTCVVQK
NENGSFRREHLTSVTLSIRADFPVSSITDIGHPAPNVKRIRCSASGGFPEPRLAWMEDGEE
LNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQ
LPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
204 CD28G1-9
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLTSVRLMIRADFPVPSITDIGHPAPNVKRIRCSASGGFPEPRLAWMEDGE
ELNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTDLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
205 CD28H4-3
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
206 CD28H11-3
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTLSQDPETKLYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAAVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
207 CD28H6-6
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSGFPRPHLYWLENGEELN
ATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQLP
FWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
208 CD28E2-4
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDKGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
209 CD28B4-5a
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
210 CD28A2-5
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PDLKGAYKLEHLASVRLMIRADFPVPSITDIGHPAPNVKRIRCSASGGFPEPRLAWMEDGE
ELNAVNTTVDQDLDTELYSVSSELDFNMTSNHSFLCLVKYGDLTVSQTFYWQESKPTPSAN
QHLTWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEGKCKVLSVSIGTKLKFNR SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
211 CD28B4-5*
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDKGTYTCVVQK
PDLKGAYKLEHLASVRLMIRADFPVPSITDIGHPAPNVKRIRCSASGGFPEPRLAWMEDGE
ELNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
212 CD28D5-6
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTLSQDPETKLYMISSELDFNMTSNHSFLCLVKYGDLTVSQSFYWQESKPTPSAN
QHLTWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVEMQSCSQSP SEQ ID Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
213 CD28D10-4
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDKGTYTCVVQK
NENGSFRREHLTSVTLSIRADFPVPSITDIGHPAPNVKRIRCSASGGFPEPRLAWMEDGEE
LNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQ
LPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGTTPKSVTKRVKETVMLSCDYNTSTEEL NO:
214 CD28E2-5*
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRPSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTLSQDPETKLYMISSELDFNMTSNHSFLCLVKYGDLTVSQTFYWQESKPTPSAN
QHLTWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVEMQSCSQSP SEQ ID Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
215 CD28E5-2
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PDLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTLSQDPETKLYMISSELDFNVTNNRSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
216 CD28E8-6
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPETKLYMISSELDFNTTSNHSFLCLVKYGDLTVSQTFYWQESKPTPSAN
QHLTWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVEMQSCSQSP SEQ ID Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
217 CD28E9-6
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDKGTYTCVIQK
PDLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
218 CD28F3-1
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PDLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGK
ELNATNTTLSQDPETKLYMISSELDFNMTSNHSFLCLVKYGDLTVSQTFYWQESKPTPSAN
QHLTWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVEMQSCSQSP SEQ ID Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
219 CD28F3-5
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVVQK
NENGSFRREHLTSVTLSIRADFPVPSITDIGHPAPNVKRIRCSASGGFPEPRLAWMEDGEE
LNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQ
LPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG
SEQ ID Round 2
MGHTMKWGSLPPKRPCLRLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
220 CD28F3-6
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PDLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTLSQDPETKLYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
221 CD28F11-8
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTLSQDPETKLYMISSELDFNMTSNLCLVKYGDLTVSQTFYWQESKPTPSANQHL
TWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVEMQSCSQSP SEQ ID Round 2
MSHTRRQGTSPSKCPYLKFFQFLVLASLSHFCSGVIHVTKEVKEVATLSCGLNVSVEELAQ NO:
222 CTLA4
TRIYWQKGKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLEYE
5x9-d10
KDAFKREHLAEVMLSVKADFPTPSISDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTASQDPGTELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTHCFAPRCRERRRNERLRRESARPV SEQ ID Round 2
MGYTRRQGTSPSKCPYLKFFQLLVLASLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
223 CTLA4
TPIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x6-f6
KDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLFWLENGEELN
AINTTVSQDPETELYTVSSKLDFNMTTNRSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISANGIFVICCLTYRFAPRCRERRRNERLRRESVCPV SEQ ID Round 2
MGYTRRQGISPSKCPYLKFFQLLVLASLSHFCSGVIHVTKKVKEVATLSCGHNVSVEELAQ NO:
224 CTLA4
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x5-h12
KDAFKREHLAEVMLSVKADFPTPSISDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPGTELYTVSSKLDFNMTTDRSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNGRLRRESVRPV SEQ ID Round 2
MSHTQRQGISPSKCPYLNFFQLLVLASLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
225 CTLA4
TRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLEYE
5x5-c10
KDAFKREHLAEVTLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLFWLENGEELN
AISTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVHPV SEQ ID Round 2
MGHTRRQGTSPSKCPYLKFFQLLVLAGLSHLCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
226 CTLA4
TRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLEYE
5x3-e8
KDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLFWLENGEELN
AINTTVSQDPETELYTVSSKLDFNMTANHSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPGCRERRRNERLRRESVCPV SEQ ID Round 2
MSHIRRQGISPSKCPYLNFFQLLVLACLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
227 CTLA4
TRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x3-c4
KDAFKREHLAEVTLSVKADFPTPSISDFEIPPSNIRRIICSTSGGFPEPRLAWMEDGEELN
AINTTASQDPETELYTVSSKLDFNMTTNRSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLF
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV SEQ ID Round 2
MSHTRRQGTSPSKCPYLKFFQLLVLASLSHFCSGVIHMTKEVKEVATLSCGPNVSVEELAQ NO:
228 CTLA4
TRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5c3-c3
KDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPGTELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTHCFAPRCRERRRNERLRRESVCPV SEQ ID Round 2
MSHTRRQGISSSKCPYLKFFQLLVLACLSHFCSGVIHVTKKVKEVATLSCGHNVSVEELAQ NO:
229 CTLA4
TRIYWQKGKKMVLTMMSGDMNIWPECKNRTIFDITNNLSIVILALRPSDEGTYECAVLKYE
5x2-h11
KDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLFWLENGEELN
AINTTASQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERKSNERLRRESVRPV SEQ ID Round 2
MGYTRRQGTSPSECPYLKFFQLLVLAGLSHFCSGVIHMTKEVKEVATLSCGLNVSVEELAQ NO:
230 CTLA4
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x2-d7
KDAFKREHLAEVMLSVKADFPTPSISDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPETGLYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV SEQ ID Round 2
MSHTRRQGISPSKCPYLNFFRLLVLASLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
231 CTLA4
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x2-b7
KDAFKREHLAEVTLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPGTELYTVSSKLDFNMTANHSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISANGIFVICCLTYCFAPRCRERRRNERLRRESVRPV SEQ ID Round 2
MSHTRRQGISPSKCPYLKFFQLLVLASLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
232 CTLA4
TRIYWQKEKKMVLTMMSGDMNIWPEHKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x2-b1
KDAFKREHLAEVMLSVKADFPTPSISDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPETELYTGSSKLDFNMTTNHSFMCLIKYGHLRVNQTFSWNTPKQEHFPDNLL
PSWAITLISANGIFVICCLTYCFAPRCRERRRNETLRRESVRPVWGTKLKFKPXIS SEQ ID
Round 2
MGHTRRQGISPSKCPYLKFFQLLVLASLSHFCSGVIHVTKEVKEVATLSCGLNVSVEELAQ NO:
233 CTLA4
TRIYWQKEKKMVLTMMSGDMNIWPEHKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x1-f1
KDAFKREHLAEVTLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLFWLENGEELN
AINTTASQDPETELYTVSSKLDFNMTANHSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNETLRRESVRPV SEQ ID Round 2
MGYTRRQGTSPSKCPYLNFFQLLVLASLSHFCSGVIHVTKEVKEVATLSCGHNVPVEELAQ NO:
234 CTLA4
TRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYGCVVLEYE
5x1-d7
KDAFKREHLAEVMLSVKADFPTPSITDLEIPPSNIRRIICSTSGGFPEPHLFWLENGEELN
AINTTASQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISANGIFVICCLTYCFAPRCRERRRNERLRRESVHPV SEQ ID Round 2
MGHTRRQGISPSKCPYLKFFQLLVLACLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
235 CTLA4
TRIYWQKDKKMVLTMMSGDMNIWPEYKNQTIFDITNNLSIVILALRPSDEGTYECVVLKYE
2x4-g9
KDAFKQEHLAEVMLSVKADFPTPSISDFEIPPSNIRRIICSTSGGFPEPRLAWMEDGEELN
AISTTVSQDPGTELCTVSSKLDFNMTTNHSFMCLIRYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVKGIFVICCLTYCFAPRGRERKSNGRLRRESVHPV SEQ ID Round 2
MGHTRRQGTSPSKCPYLKFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
236 CTLA4
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
2x4-a6
KDAFKREHLAEVMLSVKADFPTPSISDFEIPPSNIRRIICSTSGGFPEPHLFWLENGEELN
AISTTVSQDPETELYAXSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCPTYCFAPRCRERRRNERLRRESVCPV SEQ ID Round 2
MGHTRRQGISPSKCPYLKFFQLLVLACLSHFCSGVIYVTKEVKEVATLSCGHNVSVEELAQ NO:
237 CTLA4
TRIYWQKEKKMVLIMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTECVVLKYEK
2x2-f3
DAFKREHLAEVTLSVKADFPTPSISDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELNA
INTTVSQDPGTELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLLP
SWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVCPV SEQ ID Round 2
MGHTRRQGTSPSKCPYLKFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
238 CTLA4
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYGCVVLEYE
2x2-f12
KDAFKREHLAEVMLSVKADFPTPSISDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRANQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV SEQ ID Round 2
MGYTRRQGTSPSKCPYLNFFQLLVLASLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
239 CTLA4
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSVVILALRPSDEGTYECVVLKYE
2x1-g8
KDAFKREHLAEVTLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPGTELYTVSSKLDFNMTTNRSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERKSNERLRRESVRPV SEQ ID Round 2
MGYTRRQGISPSKCPYLKFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
240 CTLA4
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
2x1-f10
KDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPRLAWMEDGEELN
AINTTVSQDPGTELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGISVICCLTYCFAPRCRERRRNERLRRESVCPV SEQ ID Round 2
MSHTRRQGISPSKCPYLKFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSAEELAQ NO:
241 CTLA4
TRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLEYE
2x1-c9
KDAFKREHLAEVMLSVKADFPTPSITDFEIPTSNIRRIICSTSGGFPEPRLAWMEDGEELN
AISTTASQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTHCFAPRCRERRRNERLRRESVCPV SEQ ID Round 2
MGHTRRQGISPSKCPYLKFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGLNVSVEELAQ NO:
242 CTLA4
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
2x1-h12
KDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPGTELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISANGIFVICCLTYCFAPRCRERKSNERLRRESVCPV SEQ ID Round 2
MGYTRRQGISPSKCPYLKFFQLLVLACLSHFCSGVIHVTKEVKEVATLSCGHNVSDEELAQ NO:
243 CTLA4
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
2x1-e2
KDAFKREHLAEVTLSVKADFPTPSISDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPGTELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSAITLISANGIFVICCLTYCFAPRCRERRRNERLRRESIHPV SEQ ID Round 2
MGYTRRQGISPSKCPYLKFFQLLVLAGLSHLCSGVIHVTKEVKEVATLPCGHNVSVEELAQ NO:
244 CTLA4
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
2x1-c4
KDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLFWLENGEELN
AINTTVSQDPGTELYAVSSKLDFNMTTNHNFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV SEQ ID Round 2
MGHTRRQGISPSKCPYLKFFQLLVLAGLSHLCSGVIHMTKEVKEVATLSCGHNVSVEELAQ NO:
245 CTLA4
TRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVALKYE
2x1-b12
KDAFKQEHLAEVTLSVKADFPTPSISDFEIPPSNIRRIICSTSGGFPEPRLAWMEDGEELN
AINTTVSQDPETELYTVSSKLDFNMTANHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVCPV SEQ ID Round 2
MGHTRRQGISPSKCPYLKFFQLLGLACLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
246 CTLA4
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRLSDEGTYECVVLKYE
2x2-f1
KDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLFWLENGEELN
AINTTASQDPETELYTVSSKLDFNMTTNRSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV SEQ ID Round 2
MSHTRRQGISPSKCPYLKFFQLLVLACLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
247 CTLA4
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x4-h1
KDAFKRKHLAEVMLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLFWLENGEELN
AINTTASQDPETELYTVSSKLDFNMTTNRSFVCLIKYGHLRVNQTFNWNTPKQEHFPNNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNETLRRESVHPV SEQ ID Round 2
MGHTRRQGTSPSKCPYLKFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
248 CTLA4
TRIYWQKEKKMVLTMMSGDMNIWPEHKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x4-a1
KDAFKREHLAEVTLSVKADFPTPSITDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPGTELYTVSSKLDFNMTTNRSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV SEQ ID Round 2
MSHTRRQGISPSKCPYLKFFQLLVLASLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
249 CTLA4
TRIYWQKEKKMVLTMMPGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLRYE
5x2-f3
KDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTASQDPETELYTVSSKLDFNMTTNRSFVCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISANGIFVICCLTHCFAPRCRERKSNERLRRESVRPV SEQ ID Round 2
MSHTRRQGISPSKCPYLKFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
250 CTLA4
TRIHWQKEKKMVLTMMSGGMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
5x2-e12
KDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELN
AISTTVSQDPGTELYAVSSKLDFNMTTNRSFVCLIKYGHLRVNQTFNWNTTKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV SEQ ID Round 2
MGYTRRQGTSPSKCPYLKFFQLLVLACLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
251 CTLA4
TRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLEYE
2x4-h11
KDAFKREHLAEVMLSVKADFPTPSISDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPGTELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLAYCFAPRCRGRRRNERLRRESVRPV SEQ ID Round 2
MGHTRRQGTSPSKCPYLNFFQLLVLACLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
252 CTLA4
TRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
2x3-h2
KDAFKREHLAEVMLSVKADFPTPSISDFEIPPSNIRRIICSTPGGFPEPRLAWMEDGEELN
AISTTVSQDPGTELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLL
PSWAITLISVKGIFVICCLTYCFAPRWRERKSNERLRRESVRPV SEQ ID Round 2
ATGGGCCACACGCTGAGGCCGGGAACTCCACTGCCCAGGTGTCTACACCTCAAGCTCTGCC NO:
253 CTLA4
TGCTCTTGGCGCTGGCGGGTCTCCACTTCTCTTCAGGTATCAGCCAGGTCACCAAGTCGGT
A-H3-6
GAAAGAAATGGCAGCACTGTCCTGTGATTACAACATTTCTATCGATGAACTGGCGAGAATG
CGCATATACTGGCAGAAGGACCAACAGATGGTGCTGAGCATCATCTCTGGGCAAGTGGAAG
TGTGGCCTGAGTACAAAAACCGCACCTTCCCCGACATCATTAACAACCTCTCCCTTATGAT
CCTGGCACTGCGCCTGTCGGACAAGGGCACCTACACCTGCGTGGTTCAGAAGAATGAGAAC
GGGTCTTTCAGACGGGAGCACCTGACCTCCGTGACACTGTCCATCAGAGCTGACTTCCCTG
TCCCTAGCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCTAATTTGCTCAAC
CTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAAGAATTAAATGCT
ACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTAGCAGTGAACTGG
ATTTCAACATGACAAGCAATCACAGCTTCTTGTGTCTTGTCAAGTATGGAGACTTAACAGT
GTCACAGACCTTCTACTGGCAAGAATCCAAACCAACCCCTTCTGCTAATCAGCACCTGACC
TGGACCATTATTATCCCAGTCTCAGCATTTGGGATTTCTGTGATCATTGCAGTTATACTAA
CATGCCTGACCTGCAGAAATGCTGCAATACGCAGACAGAGAAGGGAGAATGAAGTGGAAAT
GCAAAGTTGCTCTCAGTCTCCATGAG SEQ ID Round 2
ATGGGTCACACAATGGAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
254 CTLA4
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGCGAC
A-B11-5
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGATTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTA
GCAGTGAACTGGATTTCAACATGACAAGCAATCACAGCTTCTTGTGTCTTGTCAAGTATGG
AGACTTAACAGTGTCACAGACCTTCTACTGGCAAGAATCCAAACCAACCCCTTCTGCTAAT
CAGCACCTGACCTGGACCATTATTATCCCAGTCTCAGCATTTGGGATTTCTGTGATCATTG
CAGTTATACTAACATGCCTGACCTGCAGAAATGCTGCAATACGCAGACAGAGAAGGGAGAA
TGAAGTGGAAATGCAAAGTTGCTCTCAGTCTCCATAG SEQ ID Round 2
ATGGGCCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
255 CTLA4
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
A-E2-6
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGCGTGGTTCAGAAG
AATGAGAACGGGTCTTTCAGACGGGAGCACCTGACCTCCGTGAGGTTAATGATCAGAGCTG
ACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCTAAT
TTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAAGAA
TTAAATGCTACCAACACAACACTGCCCCAAGATCCTGAAACCAAGCTCTACATGATTAGCA
GTGAACTGGATTTCAACATGACAAGCAATCACAGCTTCTTGTGTCTTGTCAAGTATGGAGA
CTTAACAGTGTCACAGACCTTCTACTGGCAAGAATCCAAACCAACCCCTTCTGCTAATCAG
CACCTGACCTGGACCATTATTATCCCAGTCTCAGCATTTGGGATTTCTGTGATCATTGCAG
TTATACTAACATGCCTGACCTGCAGAAATGCTGCAATACGCAGACAGAGAAGGGAGAATGA
AGTGGAAATGCAAAGTTGCTCTCAGTCTCCATGAG SEQ ID Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
256 CTLA4
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
A-F1-6
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAAGGGCACCTACACCTGCGTGGTTCAGAAG
AATGAGAACGGGTCTTTCAGACGGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAGCTG
ACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCTAAT
TTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAAGAA
TTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTAGCA
GTGAACTGGATTTCAACATGACAAGCAATCACAGCTTCTTGTGTCTTGTCAAGTATGGAGA
CTTAACAGTGTCGCAGACCTTCTACTGGCAAGAATCCAAACCAACCCCTTCTGCTAATCAG
CACCTGACCTGGACCATTATTATCCCAGTCTCAGCATTTGGGATTTCTGTGATCATTGCAG
TTATACTAACATGCCTGACCTGCAGAAATGCTGCAATACGCAGACAGAGAAGGGAGAATGA
AGTGGAGATGCAAAGTTGCTCTCAGTCTCCATAG SEQ ID Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
257 CTLA4
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
A-F6-9
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGATTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTA
GCAGTGAACTGGATTTCAACATGACAAGCAATCACAGCTTCTTGTGTCTTGTCAAGTATGG
AGACTTAACAGTGTCACAGACCTTCTACTGGCAAGAATCCAAACCAACCCCTTCTGCTAAT
CAGCACCTGACCTGGACCATTATTATCCCAGTCTCAGCATTTGGGATTTCTGTGATCATTG
CAGTTATACTAACATGCCTGACCTGCAGAAATGCTGCAATACGCAGACAGAGAAGGGAGAA
TGAAGTGGAAATGCAAAGTTGCTCTCAGTCTCCATGA SEQ ID Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
258 CTLA4
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
A-H4-5*
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAAGGGCACCTACACCTGCGTGGTTCAGAAG
AATGAGAACGGGTCTTTCAGACGGGAGCACCTGACCTCCGTGACACTGTCCATCAGAGCTG
ACTTCCCTGTCCCTAGCATAACTGACATTGGACATCCCGCCCCTAATGTGAAAAGGATAAG
ATGCTCCGCCTCTGGAGGTTTTCCAGAGCCTCGCCTCTACTGGTTGGAAAATGGAGAAGAA
TTAAATGCTACCAACACAACAGTTTCCCAAGATCCTGGAACTGAGCTCTACATGATTAGCA
GTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGGGGA
GCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGATCAG
CTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTCTCT
ACTGCCTGGCCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGACAGT
GGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGAG SEQ ID
Round 2
ATGGATCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
259 CTLA4
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
A-B4-6
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAAGGGCACCTACACCTGCGTGGTTCAGAAG
AATGAGAACGGGTCTTTCAGACGGGAGCACCTGACCTCCGTGACACTGTCCATCAGAGCTG
ACTTTCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCTAAT
TTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAAGAA
TTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTAGCA
GTGAACTGGATTTCAACATGACAAGCAATCACAGCTTCTTGTGTCTTGTCAAGTATGGAGA
CTTAACAGTGTCACAGACCTTCTACTGGCAAGAATCCAAACCAACCCCTTCTGCTAATCAG
CACCTGACCTGGACCATTATTATCCCGGTCTCAGCATTTGGGATTTCTGTGATCATTGCAG
TTATACTAACATGCCTGACCTGCAGAAATGCTGCAATACGCAGACAGAGAAGGGAGAATGA
AGTGGAAATGCAAAGTTGCTCTCAGTCTCCATAG SEQ ID Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
260 CTLA4
AGCTCTTGGTGCCCACTGGTCTTTTTTACTTCTGTTCAGGTATCACCCCAAAGAGTGTGAC
A-F10-1
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCGCCTGTCGGACAAGGGCACCTACACCTGCGTGGTTCAGAAG
AATGAGAACGGGTCTTTCAGACGGGAGCACCTGACCTCCGTGACACTGTCCATCAGAGCTG
ACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCTAAT
TTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAAGAA
TTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTAGCA
GTGAACTGGATTTCAACATGACAAGCAATCACAGCTTCTTGTGTCTTGTCAAGTATGGAGA
CTTAACAGTGTCACAGACCCTCTACTGGCAAGAATCCAAACCAACCCCTTCTGCTAATCAG
CACCTGACCTGGACCATTATTATCCCAGTCTCAGCATTTGGGATTTCTGTGATCATTGCAG
TTATACTAACATGCCTGACCTGCAGAAATGCTGCAATACGCAGACAGAGAAGGGAGAATGA
AGTGGAAATGCAAAGTTGCTCTCAGTCTCCATGA SEQ ID Round 2
ATGGGTCACACAGTGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
261 CTLA4
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
A-G8-1
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
TATTGTGATCCTGGCTCTGCCCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGATTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTA
GCAGTGAACTGGATTTCAACATGACAAGCAATCACAGCTTCTTGTGTCTTGTCAAGTATGG
AGACTTAACAGTGTCACAGACCTTCTACTGGCAAGAATCCAAACCAACCCCTTCTGCTAAT
CAGCACCTGACCTGGACCATTATTATCCCAGTCTCAGCATTTGGGATTTCTGTGATCATTG
CAGTTATACTAACATGCCTGACCTGCAGAAATGCTGCAATACGCAGACAGAGAAGGGAGAA
TGAAGTGGAAATGCAAAGTTGCTCTCAGTCTCCATGA SEQ ID Round 2
ATGGGTCACACAATGAAGTGGGGATCACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
262 CTLA4
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC
A-C9-9
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAGCACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAGTACAAAAACCGCACCTTCCCCGACATCATTAACAACCTCTC
CCTTATGATCCTGGCACTGCGCCTGTCGGACAGGGGCACCTACACCTGCGTGGTTCAGAAG
AATGAGAACGGGTCTTTCAGACGGGAGCACCTGACCTCCGTGACACTGTCCATCAGAGCTG
ACTTCCCTGTCCCTAGCATAACTGACATTGGACATCCCGCCCCTAATGTGAAAAGGATAAG
ATGCTCCGCCTCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAAGAA
CTAAACGCCGTCAACACGACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCGGCA
GTGAACTGGATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGGGGA
GCTGTCGGTGTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGATCAG
CTTCCATTCTGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTCTCT
ACTGCCTGGCCCGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGACAGT
GGGAACTGAAAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGAG SEQ ID
Round 2
MGHTLRPGTPLPRCLHLKLCLLLALAGLHFSSGISQVTKSVKEMAALSCDYNISIDELARM NO:
263 CTLA4
RIYWQKDQQMVLSIISGQVEVWPEYKNRTFPDIINNLSLMILALRLSDKGTYTCVVQKNEN
A-H3-6
GSFRREHLTSVTLSIRADFPVPSINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGEELNA
TNTTLSQDPETKLYMISSELDFNMTSNHSFLCLVKYGDLTVSQTFYWQESKPTPSANQHLT
WTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVEMQSCSQSP SEQ ID Round 2
MGHTMEWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSATKRVKETVMLSCDYSTSTEEL NO:
264 CTLA4
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
A-B11-5
PDLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTLSQDPETKLYMISSELDFNMTSNHSFLCLVKYGDLTVSQTFYWQESKPTPSAN
QHLTWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVEMQSCSQSP SEQ ID Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
265 CTLA4
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVVQK
A-E2-6
NENGSFRREHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGEE
LNATNTTLPQDPETKLYMISSELDFNMTSNHSFLCLVKYGDLTVSQTFYWQESKPTPSANQ
HLTWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVEMQSCSQSP SEQ ID Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
266 CTLA4
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDKGTYTCVVQK
A-F1-6
NENGSFRREHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGEE
LNATNTTLSQDPETKLYMISSELDFNMTSNHSFLCLVKYGDLTVSQTFYWQESKPTPSANQ
HLTWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVEMQSCSQSP SEQ ID Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
267 CTLA4-
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
A-F6-9
PDLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTLSQDPETKLYMISSELDFNMTSNHSFLCLVKYGDLTVSQTFYWQESKPTPSAN
QHLTWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVEMQSCSQSP SEQ ID Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
268 CTLA4
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDKGTYTCVVQK
A-H4-5*
NENGSFRREHLTSVTLSIRADFPVPSITDIGHPAPNVKRIRCSASGGFPEPRLYWLENGEE
LNATNTTVSQDPGTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQ
LPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Round 2
MDHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
269 CTLA4
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDKGTYTCVVQK
A-B4-6
NENGSFRREHLTSVTLSIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGEE
LNATNTTLSQDPETKLYMISSELDFNMTSNHSFLCLVKYGDLTVSQTFYWQESKPTPSANQ
HLTWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVEMQSCSQSP SEQ ID Round 2
MGHTMKWGSLPPKRPCLWLSQLLVPTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL
NO: 270 CTLA4
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDKGTYTCVVQK
A-F10-1
NENGSFRREHLTSVTLSIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGEE
LNATNTTLSQDPETKLYMISSELDFNMTSNHSFLCLVKYGDLTVSQTLYWQESKPTPSANQ
HLTWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVEMQSCSQSP SEQ ID Round 2
MGHTVKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
271 CTLA4
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALPLSDSGTYTCVIQK
A-G8-1
PDLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTLSQDPETKLYMISSELDFNMTSNHSFLCLVKYGDLTVSQTFYWQESKPTPSAN
QHLTWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVEMQSCSQSP SEQ ID Round 2
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYSTSTEEL NO:
272 CTLA4
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTFPDIINNLSLMILALRLSDRGTYTCVVQK
A-C9-9
NENGSFRREHLTSVTLSIRADFPVPSITDIGHPAPNVKRIRCSASGGFPEPRLAWMEDGEE
LNAVNTTVDQDLDTELYSVGSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQ
LPFWVIIPVSGALVLTAVVLYCLARRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
Human B7-
ATGGGCCACACACGGAGGCAGGGAACATCACCATCCAAGTGTCCATACCTCAATTTCTTTC NO:
273 1 AGCTCTTGGTGCTGGCTGGTCTTTCTCACTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACTAATAACCTCTCCATTGT
GATCCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGACGCTTTCAAGCGGGAACACCTGGCTGAAGTGACGTTATCAGTCAAAGCTGACTTCC
CTACACCTAGTATATCTGACTTTGAAATTCCAACTTCTAATATTAGAAGGATAATTTGCTC
AACCTCTGGAGGTTTTCCTGAGCCTCACCTCTCCTGGCTGGAAAATGGAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATGCTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAACCACAGCTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAATACAACCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTACCTTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGCTTTGCCCCAAGATGCAGAGAGAGAAGGAGGAATGAGAGATTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Rhesus
ATGGGCCACACACGGAGGCAGGAAATATCACCATCCAAGTGTCCATACCTCAAGTTCTTTC NO:
274 B7-1
AGCTCTTGGTGCTGGCTTGTCTTTCTCATTTCTGTTCAGGTGTTATCCACGTGACCAAGGA
AGTGAAAGAAGTGGCAACGCTGTCCTGTGGTCACAATGTTTCTGTTGAAGAGCTGGCACAA
ACTCGCATCTACTGGCAAAAGGAGAAGAAAATGGTGCTGACTATGATGTCTGGGGACATGA
ATATATGGCCCGAGTACAAGAACCGGACCATCTTTGATATCACAAATAACCTCTCCATTGT
GATTCTGGCTCTGCGCCCATCTGACGAGGGCACATACGAGTGTGTTGTTCTGAAGTATGAA
AAAGATGCTTTCAAGCGGGAACACCTGGCTGAAGTGATGTTATCCGTCAAAGCTGACTTCC
CTACACCTAGTATAACTGACTCTGAAATTCCACCTTCTAACATTAGAAGGATAATTTGCTC
AAACTCTGGAGGTTTTCCAGAGCCTCACCTCTCCTGGTTGGAAAATGGAGAAGAATTAAAT
GCCATCAGCACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTATACTGTTAGCAGCAAAC
TGGATTTCAATATGACAACCAATCACAGTTTCATGTGTCTCATCAAGTATGGACATTTAAG
AGTGAATCAGACCTTCAACTGGAACACACCCAAGCAAGAGCATTTTCCTGATAACCTGCTC
CCATCCTGGGCCATTATCCTAATCTCAGTAAATGGAATTTTTGTGATATGCTGCCTGACCT
ACTGTTTTGCCCCAAGGTGCAGAGAGAGAAGAAGGAATGAGACATTGAGAAGGGAAAGTGT
ACGCCCTGTATGA SEQ ID Bovine
ATGGGTCACACAATGAAGTGGGGAACACTACCACCCAAGCGCCCATGCCTCTGGCTCTCTC NO:
275 B7-1
AGCTCTTGGTGCTCACTGGTCTTTTTTACTTCTGTTCAGGCATCACCCCAAAGAGTGTGAC (cow)
CAAAAGAGTGAAAGAAACAGTAATGCTATCCTGTGATTACAACACATCCACTGAAGAACTG
ACAAGCCTTCGGATCTATTGGCAAAAGGATAGTAAAATGGTGCTGGCCATCCTGCCTGGAA
AAGTGCAGGTGTGGCCTGAATACAAGAACCGCACCATCACTGACATGAACGATAACCCCCG
CATTGTGATCCTGGCTCTGCGCCTGTCGGACAGTGGCACCTACACCTGTGTTATTCAGAAG
CCTGATTTGAAAGGGGCTTATAAACTGGAGCACCTGACTTCCGTGAGGTTAATGATCAGAG
CTGACTTCCCTGTCCCTACCATAAATGATCTTGGAAATCCATCTCCTAATATCAGAAGGCT
AATTTGCTCAACCTCTGGAGGTTTTCCAAGGCCCCACCTCTACTGGTTGGAAAATGGAGAA
GAATTAAATGCTACCAACACAACACTGTCCCAAGATCCTGAAACCAAGCTCTACATGATTA
GCAGTGAACTGGATTTCAACATGACAAGCAATCACAGCTTCTTGTGTCTTGTCAAGTATGG
AGACTTAACAGTGTCACAGACCTTCTACTGGCAAGAATCCAAACCAACCCCTTCTGCTAAT
CAGCACCTGACCTGGACCATTATTATCCCAGTCTCAGCATTTGGGATTTCTGTGATCATTG
CAGTTATACTAACATGCCTGACCTGCAGAAATGCTGCAATACGCAGACAGAGAAGGGAGAA
TGAAGTGGAAATGGAAAGTTGCTCTCAGTCTCCA SEQ ID Rabbit
ATGGGCCACACGCTGAGGCCGGGAACTCCACTGCCCAGGTGTCTACACCTCAAGCTCTGCC NO:
276 B7-1
TGCTCTTGGCGCTGGCGGGTCTCCACTTCTCTTCAGGTATCAGCCAGGTCACCAAGTCGGT
GAAAGAAATGGCAGCACTGTCCTGTGATTACAACATTTCTATCGATGAACTGGCGAGAATG
CGCATATACTGGCAGAAGGACCAACAGATGGTGCTGAGCATCATCTCTGGGCAAGTGGAAG
TGTGGCCTGAGTACAAGAACCGCACCTTCCCCGACATCATTAACAACCTCTCCCTTATGAT
CCTGGCACTGCGCCTGTCGGACAAGGGCACCTACACCTGCGTGGTTCAGAAGAATGAGAAC
GGGTCTTTCAGACGGGAGCACCTGACCTCCGTGACACTGTCCATCAGAGCTGACTTCCCTG
TCCCTAGCATAACTGACATTGGACATCCCGACCCTAATGTGAAAAGGATAAGATGCTCCGC
CTCTGGAGGTTTTCCAGAGCCTCGCCTCGCCTGGATGGAAGATGGAGAAGAACTAAACGCC
GTCAACACGACGGTTGACCAGGATTTGGACACGGAGCTCTACAGCGTCAGCAGTGAACTGG
ATTTCAATGTGACAAATAACCACAGCATCGTGTGTCTCATCAAATACGGGGAGCTGTCGGT
GTCACAGATCTTCCCTTGGAGCAAACCCAAGCAGGAGCCTCCCATTGATCAGCTTCCATTC
TGGGTCATTATCCCAGTAAGTGGTGCTTTGGTGCTCACTGCGGTAGTTCTCTACTGCCTGG
CCTGCAGACATGTTGCGAGGTGGAAAAGAACAAGAAGGAATGAAGAGACAGTGGGAACTGA
AAGGCTGTCCCCTATCTACTTAGGCTCTGCGCAATCCTCGGGCTGA SEQ ID Cat B7-1
ATGGGTCACGCAGCAAAGTGGAAAACACCACTACTGAAGCACCCATATCCCAAGCTCTTTC NO:
277 CGCTCTTGATGCTAGCTAGTCTTTTTTACTTCTGTTCAGGTATCATCCAGGTGAACAAGAC
AGTGGAAGAAGTAGCAGTACTATCCTGTGATTACAACATTTCCACCAAAGAACTGACGGAA
ATTCGAATCTATTGGCAAAAGGATGATGAAATGGTGTTGGCTGTCATGTCTGGCAAAGTAC
AAGTGTGGCCCAAGTACAAGAACCGCACATTCACTGACGTCACCGATAACCACTCCATTGT
GATCATGGCTCTGCGCCTGTCAGACAATGGCAAATACACTTGTATTATTCAAAAGATTGAA
AAAGGGTCTTACAAAGTGAAACACCTGACTTCGGTGATGTTATTGGTCAGAGCTGACTTCC
CTGTCCCTAGTATAACTGATCTTGGAAATCCATCTCATAACATCAAAAGGATAATGTGCTT
AACTTCTGGAGGTTTTCCAAAGCCTCACCTCTCCTGGCTGGAAAATGAAGAAGAATTAAAT
GCCATCAACACAACAGTTTCCCAAGATCCTGAAACTGAGCTCTACACTATTAGCAGTGAAC
TGGATTTCAATATGACAAACAACCATAGCTTCCTGTGTCTTGTCAAGTATGGAAACTTACT
AGTATCACAGATCTTCAACTGGCAAAAATCAGAGCCACAGCCTTCTAATAATCAGCTCTGG
ATCATTATCCTGAGCTCAGTAGTAAGTGGGATTGTTGTGATCACTGCACTTACCTTAAGAT
GCCTAGTCCACAGACCTGCTGCAAGGTGGAGACAAAGAGAAATGGGGAGAGCGCGGAAATG
GAAAAGATCTCACCTGTCTACATAGATTCTGCAGAACCACTGTATGCAGAGCATCTGGAGG
TAGCCTCTTTAGCTCTTCTCTACTAG SEQ ID Human B7-
MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
278 1 (signal
TRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
sequence
KDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELN
under-
AINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLL
lined) PSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV SEQ ID Rhesus
MGHTRRQGISPSKCPYLKFFQLLVLACLSHLCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
279 B7-1
TRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
KDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPRLSWLENGEELN
AISTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTHCFAPRCRERRRNETLRRESVRPV SEQ ID Bovine
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
280 B7-1
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PDLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTLSQDPETKLYMISSELDFNMTSNHSFLCLVKYGDLTVSQTFYWQESKPTPSAN
QHLTWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVEMQSCSQSP SEQ ID Rabbit
MGHTLRPGTPLPRCLHLKLCLLLALAGLHFSSGISQVTKSVKEMAALSCDYNISIDELARM NO:
281 B7-1
RIYWQKDQQMVLSIISGQVEVWPEYKNRTFPDIINNLSLMILALRLSDKGTYTCVVQKNEN
GSFRREHLTSVTLSIRADFPVPSITDIGHPAPNVKRIRCSASGGFPEPRLAWMEDGEELNA
VNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQLPF
WVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID Cat
B7-1 MGHAAKWKTPLLKHPYPKLFPLLMLASLFYFCSGIIQVNKTVEEVAVLSCDYNISTKELTE
NO: 282
IRIYWQKDDEMVLAVMSGKVQVWPKYKNRTFTDVTDNHSIVIMALRLSDNGKYTCIIQKIE
KGSYKVKHLTSVMLLVRADFPVPSITDLGNPSHNIKRTMCLTSGGFPKPHLSWLENEEELN
AINTTVSQDPETELYTISSELDFNMTNNHSFLCLVKYGNLLVSQIFNWQKSEPQPSNNQLW
IIILSSVVSGIVVITALTLRCLVHRPAARWRQREMGRARKWKRSHLST SEQ ID CD28BP
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
283 Consensus
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGE
ELNATNTTVSQDPDTELYMISSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
CD28BP
MGHTMXWXSLPPKXPCLXXXQLLVLTXLFYFCSGITPKSVTKRVKETVMLSCDYXTSTEXL NO:
284 CGformC
TSLRIYWXKDSKMVLAILPGKVQVWPEYKNRTITDMNDNXRIVIXALRXSDXGTYTCVXQK
PXLKGAYKLEHLXSVRLMIRADFPVPXXXDLGNPSPNIRRLICSXXXGFPRPHLXWLENGE
ELNATNTTXSQDPXTXLYMISSELXFNVTNNXSIXCLIKYGELXVSQIFPWSKPKQEPPID
QLPFXVIIPVSGALVLXAXVLYXXACRHXARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
CD28BP
MGHTMKWRSLPPKRPCLWPSQLLVLTDLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
285 CG1c
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRPSDKGTYTCVVQK
PVLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLCWLENGE
ELNATNTTVSQDPGTELYMISSELGFNVTNNHSIACLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLAAVVLYRPACRHGARWKRTRRNEETVGTERLSPIYLGSAQSSG SEQ ID
CTLA4BP
MGHTRRQGISPSKCPYLKFFQLLVLACLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQ NO:
286 Consensus
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
KDAFKREHLAEVMLSVKADFPTPSISDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELN
AINTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV SEQ ID CTLA4BP
MGHTRRQGTSPXKCPYLKFFQLLVXACLXHLCSGVIHVTXEVKEVATLSCGLNVSVEELAQ NO:
287 CGform
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYX
KDAFKRXHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSXSGGFPEPHLFWLENGEELN
AINTTVSQDPETXLYTVSSKLDFNMTANHSFMCLIXYGHLRVNQTFNWNTPKQEHFPXNLL
PSWAITLISANGIFVICCLTYRFAPRCRERKSNETLRRESVCPV SEQ ID CTLA4BP
MGHTRRQGTSPPECPYLKFFQLLVMACLPHLCSGVIHVTREVKEVATLPCGLNVSVEELAQ NO:
288 CG1
TPIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYD
KDAFKQKHLAEVMLSVKADFPTPSITDFEIPPSNIKRIICSASGGFPEPHLFGLENGEEIN
AINTTVSQDPETGLYTVSSKLDFNMTADHNFMCLIRYGHLRVNQTFNWNTPKQEHFPNNPL
PSWAITLISANGIFVICCPTYRFAPGCRERKSNETLRRESVCPV SEQ ID CTLA4BP
MGHTRRQGTSPSKCPYLKFFQLLVLACLSHLCSGVIHVTKEVKEVATLSCGLNVSVEELAQ NO:
289 CG2
TRIHWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE
KDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLFWLENGEELN
AINTTVSQDPETELYTVSSKLDFNMTANHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLL
PSWAITLISANGIFVICCLTYRFAPRCRERKSNETLRRESVCPV SEQ ID CD28BP
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMXSCDYXXSTEEL NO:
290 CGformD
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDXGTYTCVXQK
XXXXGXXXXEHLXSVXLXIRADFPVPSITDIGHPAPNVKRIRCSASGXFPEPRLAWMEDGE
ELNAVNTTVXXXLDTELYSVSSELDXNXTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIXXVSGALVLTAVVLYCLACRHVAR SEQ ID CD28BP
MGHTMKWGSLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNASTEEL NO:
291 CG1d
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PVLKGAYKLEHLASVRLMIRADFPVPSITDIGHPAPNVKRIRCSASGDFPEPRLAWMEDGE
ELNAVNTTVDQDLDTELYSVSSELDSNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIILVSGALVLTAVVLYCLACRHVAR SEQ ID CD28BP
MGHTMKWGXLPPKRPCLWLSQLLVLTGLFYFCSGXTPKSVTKRVKETVMLSCDYXTSTEEL NO:
292 CGformB
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRXSDSGTYTCVIQK
PXLKGAYKLEHLXSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGX
ELNATNTTXSQDPETKLYMISSELDFNXTSNXXXLCLVKYGDLTVSQXFYWQESKPTPSAN
QHLTWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVXMXSCSQSP SEQ ID CD28BP
MGHTMKWGTLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEEL NO:
293 CG1b
TSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVIQK
PDLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLENGK
ELNATNTTLSQDPETKLYMISSELDFNMTSNHSFLCLVKYGDLTVSQTFYWQESKPTPSAN
QHLTWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVKMESCSQSP
Sequence CWU 0 SQTB SEQUENCE LISTING The patent application
contains a lengthy "Sequence Listing" section. A copy of the
"Sequence Listing" is available in electronic form from the USPTO
web site
(http://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20100261660A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
0 SQTB SEQUENCE LISTING The patent application contains a lengthy
"Sequence Listing" section. A copy of the "Sequence Listing" is
available in electronic form from the USPTO web site
(http://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20100261660A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
* * * * *
References