U.S. patent application number 12/676310 was filed with the patent office on 2010-10-14 for peptides derivatized with a-b-c-d- and their therapeutical use.
This patent application is currently assigned to Novo nordisk A/S. Invention is credited to Patrick William Garibay, Thomas Kruse, Jesper Lau, Soren Ostergaard, Steffen Reedtz-Runge, Lauge Schaffer, Jane Spetzler, Henning Thogersen.
Application Number | 20100261637 12/676310 |
Document ID | / |
Family ID | 40042665 |
Filed Date | 2010-10-14 |
United States Patent
Application |
20100261637 |
Kind Code |
A1 |
Spetzler; Jane ; et
al. |
October 14, 2010 |
PEPTIDES DERIVATIZED WITH A-B-C-D- AND THEIR THERAPEUTICAL USE
Abstract
The invention relates to protracted peptide derivatives such as
Glucagon-Like Peptide-1 (GLP-1), exendin-4, and analogues thereof,
as well as therapeutic uses thereof. The peptide derivative of the
invention comprises a peptide wherein at least one amino acid
residue is derivatized with A-B-C-, or A-B-C-D-. These compounds
are useful in the treatment or prevention of diabetes type 2 and
related diseases. The compounds are potent, have a low ratio of
binding affinity to the GLP-1 receptor in the presence of high/low
albumin concentrations, have long half-lives, and have a high
affinity of binding to albumin, all of which is of potential
relevance for the overall aim of achieving long-acting, stable and
active GLP-1 derivatives with a potential for once weekly
administration.
Inventors: |
Spetzler; Jane; (Bronshoj,
DK) ; Schaffer; Lauge; (Lyngby, DK) ; Lau;
Jesper; (Farum, DK) ; Kruse; Thomas; (Herlev,
DK) ; Garibay; Patrick William; (Holte, DK) ;
Ostergaard; Soren; (Bronshoj, DK) ; Reedtz-Runge;
Steffen; (Frederiksberg, DK) ; Thogersen;
Henning; (Farum, DK) |
Correspondence
Address: |
NOVO NORDISK, INC.;INTELLECTUAL PROPERTY DEPARTMENT
100 COLLEGE ROAD WEST
PRINCETON
NJ
08540
US
|
Assignee: |
Novo nordisk A/S
Bagsvaerd
DK
|
Family ID: |
40042665 |
Appl. No.: |
12/676310 |
Filed: |
September 5, 2008 |
PCT Filed: |
September 5, 2008 |
PCT NO: |
PCT/EP2008/061830 |
371 Date: |
June 3, 2010 |
Current U.S.
Class: |
514/1.9 ;
514/4.8; 514/7.2; 530/324 |
Current CPC
Class: |
A61K 47/56 20170801;
C07K 14/001 20130101; C07K 14/605 20130101; A61K 38/00 20130101;
A61P 1/04 20180101; A61P 25/28 20180101; A61P 9/00 20180101; C07K
14/575 20130101; A61K 38/16 20130101; A61K 47/543 20170801; A61P
9/10 20180101; C07K 14/00 20130101; A61K 38/17 20130101; A61K 38/22
20130101; A61P 3/06 20180101; A61K 47/54 20170801; A61P 9/12
20180101; A61K 38/26 20130101; A61K 47/545 20170801; A61K 47/50
20170801; A61K 47/51 20170801; A61K 47/60 20170801; A61P 1/00
20180101; A61P 3/00 20180101; A61P 3/10 20180101; A61K 47/542
20170801; A61P 3/04 20180101; C07K 14/57563 20130101 |
Class at
Publication: |
514/1.9 ;
530/324; 514/7.2; 514/4.8 |
International
Class: |
A61K 38/26 20060101
A61K038/26; C07K 14/00 20060101 C07K014/00; A61P 3/10 20060101
A61P003/10; A61P 3/04 20060101 A61P003/04; A61P 9/10 20060101
A61P009/10 |
Foreign Application Data
Date |
Code |
Application Number |
Sep 5, 2007 |
EP |
07115741.6 |
Jan 28, 2008 |
EP |
08101011.8 |
Claims
1. A peptide derivative comprising a peptide wherein at least one
amino acid residue is derivatized with A-B-C-D- wherein A- is
##STR00111## wherein R is lower linear or branched alkyl, p is
selected from the group consisting of 10, 11, 12, 13 and 14, and d
is selected from the group consisting of 0, 1, 2, 3, 4 and 5, and
-B- is selected from the group consisting of ##STR00112## wherein x
is selected from the group consisting of 0, 1, 2, 3 and 4, and y is
selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9,
10, 11 and 12, or A is ##STR00113## wherein n is selected from the
group consisting of 14, 15, 16 17, 18 and 19, and B is selected
from the group consisting of ##STR00114## wherein x is selected
from the group consisting of 0, 1, 2, 3 and 4, and -C- is selected
from the group consisting of ##STR00115## wherein b and e are each
independently selected from the group consisting of 0, 1 and 2, and
c and f are each independently selected from the group consisting
of 0, 1 and 2 with the proviso that b is 1 or 2 when c is 0, or b
is 0 when c is 1 or 2, and e is 1 or 2 when f is 0, or e is 0 when
f is 1 or 2, and -D- is attached to said amino acid residue and is
a linker, represents a bond, or is absent.
2. The derivative according to claim 1, wherein at least one amino
acid residue is derivatized with A-B-C-.
3. The derivative according to claim 1, wherein said peptide is a
GLP-1 peptide selected from GLP-1(7-37) and an analogue of
GLP-1(7-37), wherein, in said peptide, at least one amino acid
residue is derivatised with A-B-C-, or A-B-C-D-.
4. The derivative according to claim 3, wherein the derivatised
amino acid residue comprises an amino group.
5. The derivative according to claim 4, wherein the derivatised
amino acid residue is lysine.
6. The derivative according to claim 5, wherein the linker
comprises at least 5 non-hydrogen atoms, 30-50% of which are either
N or O.
7. The derivative according to claim 6, wherein D is selected from
the group consisting of ##STR00116## wherein k is selected from the
group consisting of 0, 1, 2, 3, 4, 5, 11 and 27, and m is selected
from the group consisting of 0, 1, 2, 3, 4, 5 and 6, and D is
attached to the amino acid residue in the end depicted with *.
8. The derivative according to claim 1, wherein said GLP-1 analogue
comprises an amino acid sequence according to formula (I):
TABLE-US-00015 Formula (I) (SE0 ID No: 2)
Xaa.sub.7-Xaa.sub.8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Xaa.sub.16-Ser-
Xaa.sub.18-Xaa.sub.19-Xaa.sub.20-Glu-Xaa.sub.22-Xaa.sub.23-Ala-Xaa.sub.25--
Xaa.sub.26-
Xaa.sub.27-Phe-Ile-Xaa.sub.30-Trp-Leu-Xaa.sub.33-Xaa.sub.34-Xaa.sub.35-
Xaa.sub.36-Xaa.sub.37-Xaa.sub.38-Xaa.sub.39-Xaa.sub.40-Xaa.sub.41-Xaa.sub.-
42-Xaa.sub.43- Xaa.sub.44-Xaa.sub.45-Xaa.sub.46
wherein Xaa.sub.7 is L-histidine, D-histidine, desamino-histidine,
2-amino-histidine, .beta.-hydroxy-histidine, homohistidine,
Na-acetyl-histidine, .alpha.-fluoromethyl-histidine,
.alpha.-methyl-histidine, 2(3H-imidazol-4-yl)acetyl,
3-pyridylalanine, 2-pyridylalanine or 4-pyridylalanine; Xaa.sub.s
is Ala, Gly, Val, Leu, Ile, Lys, Aib, (1-aminocyclopropyl)
carboxylic acid, (1-aminocyclobutyl) carboxylic acid,
(1-aminocyclopentyl) carboxylic acid, (1-aminocyclohexyl)
carboxylic acid, (1-aminocycloheptyl) carboxylic acid, or
(1-aminocyclooctyl) carboxylic acid; Xaa.sub.16 is Val, or Leu;
Xaa.sub.18 is Ser, Lys, or Arg; Xaa.sub.19 is Tyr, or Gln;
Xaa.sub.20 is Leu, Met, or Lys; Xaa.sub.22 is Gly, Glu, or Aib;
Xaa.sub.23 is Gln, Glu, Lys, or Arg; Xaa.sub.25 is Ala, or Val;
Xaa.sub.26 is Lys, Glu, or Arg; Xaa.sub.27 is Glu, or Leu;
Xaa.sub.30 is Ala, Glu, Lys, or Arg; Xaa.sub.33 is Val,
Thr(O-benzyl), or Lys; Xaa.sub.34 is Lys, Glu, Gln, Asn, or Arg;
Xaa.sub.35 is Gly, Aib, or absent; Xaa.sub.36 is Arg, Gly, Lys, or
absent; Xaa.sub.37 is Gly, Ala, Glu, Pro, Lys, epsilon-amino-Lys,
amide or is absent; Xaa.sub.38 is Lys, Ser, amide, or is absent;
Xaa.sub.39 is Ser, Lys, amide, or is absent; Xaa.sub.40 is Gly,
amide, or is absent; Xaa.sub.41 is Ala, amide, or is absent;
Xaa.sub.42 is Pro, amide, or is absent; Xaa.sub.43 is Pro, amide,
or is absent; Xaa.sub.44 is Pro, amide, or is absent; Xaa.sub.45 is
Ser, amide, or is absent; Xaa.sub.46 is amide, or is absent;
provided that if Xaa.sub.38, Xaa.sub.39, Xaa.sub.40, Xaa.sub.41,
Xaa.sub.42, Xaa.sub.43, Xaa.sub.44, Xaa.sub.45 or Xaa.sub.46 is
absent then each amino acid residue downstream is also absent.
9. The derivative according to claim 1, wherein said GLP-1 analogue
comprises an amino acid sequence according to formula (II):
TABLE-US-00016 Formula (II) (SE0 ID No: 3)
Xaa.sub.7-Xaa.sub.8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-
Xaa.sub.18-Tyr-Leu-Glu-Xaa.sub.22-Xaa.sub.23-Ala-Ala-Xaa.sub.26-Glu-
Phe-Ile-Xaa.sub.30-Trp-Leu-Val-Xaa.sub.34-Xaa.sub.35-Xaa.sub.36-Xaa.sub.37-
- Xaa.sub.38
wherein Xaa.sub.7 is L-histidine, D-histidine, desamino-histidine,
2-amino-histidine, .beta.-hydroxy-histidine, homohistidine,
N.sup..alpha.-acetyl-histidine, .alpha.-fluoromethyl-histidine,
.alpha.-methyl-histidine, 2(3H-imidazol-4-yl)acetyl,
3-pyridylalanine, 2-pyridylalanine or 4-pyridylalanine; Xaa.sub.8
is Ala, Gly, Val, Leu, Ile, Lys, Aib, (1-aminocyclopropyl)
carboxylic acid, (1-aminocyclobutyl) carboxylic acid,
(1-aminocyclopentyl) carboxylic acid, (1-aminocyclohexyl)
carboxylic acid, (1-aminocycloheptyl) carboxylic acid, or
(1-aminocyclooctyl) carboxylic acid; Xaa.sub.18 is Ser, Lys, or
Arg; Xaa.sub.22 is Gly, Glu, or Aib; Xaa.sub.23 is Gln, Glu, Lys,
or Arg; Xaa.sub.26 is Lys, Glu, or Arg; Xaa.sub.30 is Ala, Glu,
Lys, or Arg; Xaa.sub.34 is Lys, Glu, Gln, or Arg; Xaa.sub.35 is
Gly, Aib, or absent; Xaa.sub.36 is Arg, Lys, or absent; Xaa.sub.37
is Gly, Ala, Glu, Pro, Lys, or epsilon-amino-Lys; Xaa.sub.38 is
Lys, amide, or is absent.
10. The derivative according to claim 1, wherein said GLP-1
analogue comprises an amino acid sequence according to formula
(III) which is derivatised in position 18, 23, 26, 30, 31, 34, 36,
37 or 38: TABLE-US-00017 Formula (III) (SE0 ID No: 6)
Xaa.sub.7-Xaa.sub.8-Xaa.sub.9-Gly-Thr-Phe-Thr-Ser-Asp-Xaa.sub.16-Ser-
Xaa.sub.18-Tyr-Leu-Glu-Glu-Xaa.sub.23-Ala-Xaa.sub.25-Arg-Xaa.sub.27-
Phe-Ile-Xaa.sub.30-Trp-Leu-Xaa.sub.33-Xaa.sub.34-Xaa.sub.35-Xaa.sub.36-
Xaa.sub.37-Xaa.sub.38-Xaa.sub.39
wherein Xaa.sub.7-Xaa.sub.8 is 2(3H-imidazol-4-yl)acetyl-alanine,
L-histidine-Aib, desamino-histidine-alanine, or
desamino-histidine-Aib; Xaa.sub.9 is Glu or a Glu derivative such
as alpha,alpha dimethyl-Glu; Xaa.sub.16 is Val, or Leu; Xaa.sub.18
is Ser, Lys, or Arg; Xaa.sub.19 is Tyr, or Gln; Xaa.sub.23 is Gln,
Glu, Lys, or Arg; Xaa.sub.25 is Ala, or Val; Xaa.sub.27 is Glu, or
Leu; Xaa.sub.30 is Ala, Glu, Lys, Arg, or absent; Xaa.sub.33 is
Val, Thr(O-benzyl), or Lys; Xaa.sub.34 is Lys, Glu, Gln, Asn, or
Arg; Xaa.sub.35 is Gly, Aib, or absent; Xaa.sub.36 is Arg, Lys, or
absent; Xaa.sub.37 is Gly, Aib, Pro, epsilon-amino-Lys, or absent
Xaa.sub.38 is Lys, Glu, or absent Xaa.sub.39 is amide, or is
absent; provided that if Xaa.sub.37 is absent then Xaa.sub.38 is
also absent.
11. The derivative according to claim 1, wherein the GLP-1 peptide
comprises an amino acid sequence according to formula (IV) which is
derivatised with an albumin binding residue in position 18, 23, 26,
30, 31, 34, 36, 37, or 38: TABLE-US-00018 Formula (IV) (SE0 ID No:
7) Xaa.sub.7-Xaa.sub.8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-
Xaa.sub.18-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Arg-Glu-Phe-Ile-
Xaa.sub.30-Trp-Leu-Xaa.sub.33-Xaa.sub.34-Xaa.sub.35-Xaa.sub.36-Xaa.sub.37--
Xaa.sub.38- Xaa.sub.39
wherein Xaa.sub.7 is L-histidine, D-histidine, desamino-histidine,
2-amino-histidine, .beta.-hydroxy-histidine, homohistidine,
N.sup..alpha.-acetyl-histidine, .alpha.-fluoromethyl-histidine,
.alpha.-methyl-histidine, 2(3H-imidazol-4-yl)acetyl,
3-pyridylalanine, 2-pyridylalanine or 4-pyridylalanine; Xaa.sub.8
is Ala, Gly, Val, Leu, Ile, Lys, Aib, (1-aminocyclopropyl)
carboxylic acid, (1-aminocyclobutyl) carboxylic acid,
(1-aminocyclopentyl) carboxylic acid, (1-aminocyclohexyl)
carboxylic acid, (1-aminocycloheptyl) carboxylic acid, or
(1-aminocyclooctyl) carboxylic acid; Xaa.sub.18 is Ser, Lys or Arg;
Xaa.sub.30 is Ala, Glu, Lys or Arg; Xaa.sub.33 is Val or Lys;
Xaa.sub.34 is Lys, Glu, Gln, or Arg; Xaa.sub.35 is Gly, Aib, or
absent; Xaa.sub.36 is Arg, Lys, or absent; Xaa.sub.37 is Gly, Aib,
Pro, epsilon-amino-Lys, or absent; Xaa.sub.38 is Lys, or absent;
and Xaa.sub.39 is amide or is absent.
12. The derivative according to claim 11, wherein Xaa.sub.38 is
absent.
13. The derivative according to claim 11, wherein Xaa.sub.37 and
Xaa.sub.38 are both absent.
14. The derivative according to claim 11, wherein Xaa.sub.7 is
desamino-histidine.
15. The derivative according to claim 11, wherein Xaa.sub.8 is
Aib.
16. The derivative according to claim 1, which is selected from the
following: N-.epsilon..sup.37
{2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(19-carboxynonadecanoyl)piperidine-4--
carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethoxy]ethoxy}acet-
yl
[desaminoHis.sup.7,Glu.sup.22,Arg.sup.26,Arg.sup.34,Lys.sup.37]GLP-1(7--
37)amide;
N-.epsilon..sup.20-{2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(19-carbo-
xynonadecanoyl)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}ac-
etylamino)ethoxy]ethoxy}acetyl
[Aib.sup.2,Leu.sup.14,Lys.sup.20,Gln.sup.28,Ser(O-benzyl).sup.39]exendin--
4 (1-39)amide; N-.epsilon..sup.26
{2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(19-carboxynonadecanoyl)piperidine-4--
carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethoxy]ethoxy}acet-
yl [desaminoHis.sup.7,Arg.sup.34]GLP-1-(7-37);
N-epsilon37{2-[2-(2-{2-[2-((S)-3-carboxy-3-{[1-(19-carboxynonadecanoyl)pi-
peridine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethoxy]-
ethoxy}acetyl [Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide;
N-epsilon23-[2-(2-[2-(2-[2-(2-((R)-3-[1-(17-Carboxyheptadecanoylamino)pip-
eridin-4-ylcarbonylamino]-3-(carboxypropionylamino)ethoxy)ethoxy]acetylami-
no)ethoxy]ethoxy)acetyl] [Aib8,Arg26,Arg34]GLP-1-(7-37);
N-epsilon37-[2-(2-[2-(2-[2-(2-((R)-3-[1-(17-Carboxyheptadecanoyl)piperidi-
n-4-ylcarbonylamino]3-carboxypropionylamino)ethoxy)ethoxy]acetylamino)etho-
xy]ethoxy)acetyl] [DesaminoHis 7,Glu22,Arg26,Arg
34,Phe(m-CF3)28]GLP-1-(7-37)amide;
[DesaminoHis7,Glu22,Arg26,Arg34]GLP-1-(7-37)-Lys(2-{2-[2-(2-{2-[2-((S)-4--
Carboxy-4-{[1-(19-carboxynonadecanoyl)piperidine-4-carbonyl]amino}butyryla-
mino)ethoxy]ethoxy}acetylamino)ethoxy]ethoxy}acetyl);
N-.epsilon..sup.20({2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(17-carboxyheptade-
canoyl)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamin-
o)ethoxy]ethoxy}acetyl)
[Aib.sup.8,Lys.sup.20,Arg.sup.26,Glu.sup.30,Thr(O-benzyl).sup.33]GLP-1-(7-
-37)amide; N-epsilon30
{2-[2-(2-{2-[2-((S)-3-carboxy-3-{[1-(19-carboxynonadecanoyl)piperidine-4--
carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethoxy]ethoxy}acet-
yl [Aib8,Glu22,Arg26,Lys30]GLP-1-(7-37); N-epsilon31
{2-[2-(2-{2-[2-((S)-3-carboxy-3-{[1-(19-carboxynonadecanoyl)piperidine-4--
carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethoxy]ethoxy}acet-
yl [Aib8,Glu22,Arg26,Lys 31]GLP-1-(7-37);
N-.epsilon..sup.20({2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(17-carboxyheptade-
canoyl)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamin-
o)ethoxy]ethoxy}acetyl)
[Aib.sup.8,Lys.sup.20,Arg.sup.26,2-Naphtylalanine.sup.28,
Glu.sup.30]GLP-1(7-37)amide; [Aib8,Glu22,Arg26,
Arg34]GLP-1-(7-37)Lys[2-(2-[2-(2-[2-(2-((S)-4-[1-[19-Carboxynonadecanoyl]-
piperidine-4-carbonylamino]-4-carboxybutyrylamino)ethoxy)ethoxy]acetylamin-
o)ethoxy]ethoxy)acetyl]amide;
N-.epsilon..sup.20({2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(17-carboxyheptade-
canoyl)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamin-
o)ethoxy]ethoxy}acetyl)
[Aib.sup.8,Lys.sup.20,Arg.sup.26,2-Naphtylalanine.sup.12,Glu.sup.30]GLP-1-
-(7-37)amide;
[DesaminoHis7,Glu22,Arg26,Arg34]GLP-1-(7-37)Lys[2-(2-[2-(2-[2-(2-((S)-4-[-
1-[19-Carboxynonadecanoyl]piperidine-4-carbonylamino]-4-carboxybutyrylamin-
o)ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl]amide
N-epsilon31-(2-{2-[2-(2-{2-[2-((S)-3-Carboxy-3-{[1-(19-carboxynonadecanoy-
l)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)eth-
oxy]ethoxy}acetyl) [Aib 8,Glu22,Arg26,Lys31,Arg34]GLP-1-(7-37);
N-epsilon26-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonadecanoylamino)meth-
yl]cyclohexanecarbonyl}amino)butyryl][Aib8,Arg34]GLP-1-(7-37);
N-epsilon26-{4-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonadecanoylamino)m-
ethyl]cyclohexanecarbonyl}amino)butyrylamino]butyryl}
[Aib8,Arg34]GLP-1-(7-37);
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonadecanoyla-
mino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)acetyl]
[Aib8,Arg34]GLP-1-(7-37);
N-epsilon26-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-37)-amide;
N-epsilon18-{2-(2-(2-(2-[2-(2-[(S)-4-Carboxy-4-({4-[(19-carboxynonadecano-
ylamino)methyl]cyclohexanecarbonyl}amino)butanoylamino]ethoxy)ethoxy]acety-
l)ethoxy)ethoxy)acetyl} [Aib8,Lys18,Arg26,Arg34]GLP-1(7-37)
N-.epsilon..sup.20-[2-(2-[2-(2-[2-(2-((S)-4-[trans-4-([19-Carboxynonadeca-
noylamino]methyl)cyclohexylcarbonylamino]-4-carboxybutanoylamino)ethoxy)et-
hoxy]acetylamino)ethoxy]ethoxy)acetyl] [desaminoHis.sup.1,
Lys.sup.20,Ser(O-benzyl).sup.33,Ser(O-benzyl).sup.39]exendin
(1-39);
[Aib8,Glu22,Arg26,Arg34]GLP-1-(7-37)Lys[2-(2-[2-(2-[2-(2-(S)-3-[4-([19-Ca-
rboxynonadecanoylamino]methyl)cyclohexylcarbonylamino]-3-carboxypropionyla-
mino)ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl]amide;
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl]
[Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide;
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide;
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({4-[(trans-19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37)amide;
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37);
[DesaminoHis7,Glu22,Arg26,Arg34]GLP-1-(7-37)Lys[2-(2-{2-[2-(2-{2-[4-Carbo-
xy-4-({trans-4-[(19-carboxynonadecanoylamino)methyl]cyclohexanecarbonyl}am-
ino)butyrylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl]-amide;
[desaminoHis.sup.7,Arg.sup.26,Arg.sup.34]GLP-1-(7-37)Lys[2-(2-[2-(2-[2-(2-
-((R)-3-[trans-4-((9-Carboxynonadecanoylamino]methyl)cyclohexylcarbonylami-
no]3-carboxypropionylamino)ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl]-
amide;
N-epsilon26[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({4-[(19-carboxynonad-
ecanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)a-
cetylamino]ethoxy}ethoxy)acetyl [Aib8,Lys 26]GLP-1 (7-37)amide;
N-epsilon26[2-(2-[2-(2-[2-(2-((S)-2-[trans-4-((9-Carboxynonadecanoylamino-
]methyl)cyclohexylcarbonylamino]-4-carboxybutanoylamino)ethoxy)ethoxy]acet-
ylamino)ethoxy]ethoxy)acetyl] [Aib8, Lys26]GLP-1(7-37)amide;
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37);
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Glu22,Arg26,Glu30,Arg34,Lys37]GLP-1-(7-37);
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{4-[4-(16-(1H-tetr-
azol-5-yl)-hexadecanoylsulfamoyl)butyrylamino]-butyrylamino}butyrylamino)b-
utyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-37);
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-37);
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)bu-
tyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-37);
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{4-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]butyrylamino}butyrylamino)but-
yrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-34);
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]-dodecanoylamino}butyrylamin-
o)butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-34);
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)bu-
tyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-34);
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-35);
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)bu-
tyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-35);
N-epsilon26[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1H-tetra-
zol-5-yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)but-
yrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-36)amide;
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)bu-
tyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-35);
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Lys33,Arg34]GLP-1-(7-34);
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-36)amide;
N-epsilon26[2-(2-{2-[2-(2-{2-[2-(2-{2-[2-(2-{2-[2-(2-{2-[2-(2-{2-[(S)-4-C-
arboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tetrazol-5-yl)hexadecanoylsulfamo-
yl)butyrylamino]dodecanoylamino}butyrylamino)butyrylamino]ethoxy}ethoxy)ac-
etylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethox-
y)acetylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl]
[Aib8,Lys26,Arg34]GLP-1-(7-36)amide;
[Aib8,Glu22,Arg26,Arg34]GLP-1-(7-37)Lys[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-c-
arboxy-4-{12-[4-(16-(1H-tetrazol-5-yl)hexadecanoylsulfamoyl)butyrylamino]d-
odecanoylamino}-butyrylamino)butyrylamino]ethoxy}ethoxy)acetyl]amide;
N-epsilon20-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl]
[Aib8,Lys20,Glu22,Arg26,Glu30,Pro37]GLP-1-(7-37)amide;
N-epsilon37-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl]
[Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide;
N-epsilon37-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide;
N-epsilon37-[[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-te-
trazol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamin-
o)butyrylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37)amide;
[Aib8,Glu22,Arg26,Glu30,Pro37]GLP-1-(7-37)Lys[2-(2-{2-[4-Carboxy-4-(4-car-
boxy-4-{4-[4-(16-1H-tetrazol-5-yl-hexadecanoylsulfamoyl)butyrylamino]butyr-
ylamino}butyrylamino)butyrylamino]ethoxy}ethoxy)acetyl];
[Aib8,Glu22,Arg26,Glu30,Pro37]GLP-1-((7-37)Lys
(2-(2-(3-(2-(2-(2-(2-(2-(2-(2-(2-(2-(2-(2-(2-[4-(S)-carboxy-4-(4-(S)-carb-
oxy-4-(4-{4-[16-(Tetrazol-5-yl)hexadecanoylsulfamoyl]butanoylamino}butanoy-
lamino) butyrylamino)butyrylamino];
ethoxy)ethoxy)ethoxy)ethoxy)ethoxy)ethoxy)ethoxy)ethoxy)ethoxy)ethoxy)eth-
oxy)ethoxy)propionylamino)ethoxy)ethoxy) peptide;
N-alpha37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonade-
canoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)ac-
etylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Glu22,Arg26,Arg34,epsilon-Lys37]GLP-1-(7-37);
N-alpha8-[2-(4-imidazolyl)acetyl]N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Car-
boxy-4-({trans-4-[(19-carboxynonadecanoylamino)methyl]cyclohexanecarbonyl}-
amino)butyrylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl]
[Glu22,Arg26,Arg34,Lys37]GLP-1-(8-37);
[DesaminoHis7,Glu22,Arg26,34]-GLP-1(7-37)-Lys-(2-{2-[2-((S)-4-carboxy-4-{-
[1-(19-carboxynonadecanoyl)piperidine-4-carbonyl]amino}butyrylamino)ethoxy-
]ethoxy}acetyl) peptide;
[DesaminoHis7,Glu22,Arg26,34]-GLP-1(7-37)-Lys-[2-(2-{2-[2-(2-{2-[4-Carbox-
y-4-({-4-[(19-carboxynonadecanoylamino)methyl]cyclohexanecarbonyl}amino)bu-
tyrylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl] peptide;
[DesaminoHis7,Glu22,Arg26,34]-GLP-1(7-37)-Lys((S)-4-carboxy-4-(2-{2-[2-((-
S)-4-carboxy-4-{[1-(19-carboxynonadecanoyl)piperidine-4-carbonyl]amino}but-
yrylamino)ethoxy]ethoxy}acetylamino)butyryl) peptide;
[DesaminoHis7,Glu22,Arg26,34]-GLP-1(7-37)-Lys-(2-(2-{2-[(S)-4-carboxy-4-(-
2-{2-[2-((S)-4-carboxy-4-{[1-(19-carboxynonadecanoyl)piperidine-4-carbonyl-
]amino}butyrylamino)ethoxy]ethoxy}acetylamino)butyrylamino]ethoxy}ethoxy)a-
cetyl) peptide;
[DesaminoHis7,Arg26,34]-GLP-1(7-37)-Lys(2-{2-[2-(2-{2-[2-(S)-4-Carboxy-4--
{[1-(19-carboxynonadecanoyl)piperidine-4-carbonyl]amino}butyrylamino)ethox-
y]ethoxy}acetylamino)ethoxy]ethoxy}acetyl) peptide;
N-epsilon37-(2-{2-[2-(2-{2-[2-((S)-4-Carboxy-4-{[1-(19-carboxynonadecanoy-
l)piperidine-4-carbonyl]amino}butyrylamino)ethoxy]ethoxy}acetylamino)ethox-
y]ethoxy}acetyl) [DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37);
N-epsilon37-((S)-4-Carboxy-4-{[1-(19-carboxy-nonadecanoyl)-piperidine-4-c-
arbonyl]-amino}-butyryl)
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37);
[DesaminoHis7,Glu22,Arg26,34]-GLP-1(7-37)-Lys-((S)-4-Carboxy-4-{[1-(19-ca-
rboxy-nonadecanoyl)-piperidine-4-carbonyl]-amino}-butyryl) peptide;
N-epsilon26-[2-(2-{2-[(R)-4-Carboxy-4-((R)-4-carboxy-4-{12-[4-(16-1H-tetr-
azol-5-yl-hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino)-
butyrylamino]ethoxy}ethoxy)acetyl]-[Aib8,Arg34]GLP-1(7-37);
N-epsilon37-{2-[2-(2-{(S)-4-[(S)-4-(12-{-4-[16-(2-tert-Butyl-2H-tetrazol--
5-yl)-hexadecanoylsulfamoyl]butyrylamino}dodecanoylamino)-4-carboxybutyryl-
amino]-4-carboxybutyrylamino}ethoxy)ethoxy]acetyl}
[DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1(7-37);
N-epsilon37-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37);
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl]
[Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37);
[ImPr.sup.7,Arg.sup.26,34,Glu.sup.22]GLP-1-(7-37)Lys[2-(2-[2-(4-((S)-4-(S-
)-4-(12-[4-(16-1H-tetrazol-5-ylhexadecanoylsulfamoyl)butyrylamino]dodecano-
ylamino)-4-carboxybutyrylamino)-4-carboxybutyrylamino)ethoxy]ethoxy)acetyl-
]-amid;
N-epsilon36-[2-(2-[2-(2-[2-(2-((R)-3-[trans-4-((9-Carboxynonadecan-
oylamino]methyl)cyclohexylcarbonylamino]3-carboxypropionylamino)ethoxy)eth-
oxy]acetylamino)ethoxy]ethoxy)acetyl]
[Aib8,Glu22,Gln34]GLP-1-(7-37);
N-epsilon26-[2-(2-[2-(2-[2-(2-((R)-3-[trans-4-((9-Carboxynonadecanoylamin-
o]methyl)cyclohexylcarbonylamino]3-carboxypropionylamino)ethoxy)ethoxy]ace-
tylamino)ethoxy]ethoxy)acetyl] [Aib8, Glu22,Gln34]GLP-1-(7-37);
N-epsilon18-[2-(2-[2-(2-[2-(2-((R)-3-[trans-4-((9-Carboxynonadecanoylamin-
o]methyl)cyclohexylcarbonylamino]3-carboxypropionylamino)ethoxy)ethoxy]ace-
tylamino)ethoxy]ethoxy)acetyl]
[Aib8,22,35,Lys18,Arg26,34]GLP-1-(7-37); and
N-epsilon18-[2-(2-[2-(2-[2-(2-((R)-3-[trans-4-((9-Carboxynonadecanoyl-
amino]methyl)cyclohexylcarbonylamino]3-carboxypropionylamino)ethoxy)ethoxy-
]acetylamino)ethoxy]ethoxy)acetyl] [Aib8,Lys18,
Glu22,Gln34]GLP-1-(7-37).
17. A pharmaceutical composition comprising a derivative according
to claim 1 or a pharmaceutically acceptable salt, amide, alkyl, or
ester thereof, and a pharmaceutically acceptable excipient.
18-20. (canceled)
21. A method of treating hyperglycemia, type 2 diabetes, impaired
glucose tolerance, type 1 diabetes, obesity, hypertension, syndrome
X, dyslipidemia, cognitive disorders, atheroschlerosis, myocardial
infarction, coronary heart disease and other cardiovascular
disorders, stroke, inflammatory bowel syndrome, dyspepsia and
gastric ulcers in a subject in need of such treatment, the method
comprising administering to the subject a therapeutically effective
amount of a pharmaceutical composition according to claim 17.
Description
FIELD OF THE INVENTION
[0001] This invention relates to the field of therapeutic peptides,
i.e. to new protracted peptides derivatized with A-B-C-D, and their
therapeutical use. Examples of therapeutic peptides of particular
relevance for the present invention are Glucagon-Like Peptide-1
(GLP-1) and exendin-4, as well as analogues thereof.
BACKGROUND OF THE INVENTION
[0002] A range of different approaches have been used for modifying
the structure of therapeutical peptides such as GLP-1 and exendin-4
in order to provide a longer duration of action in vivo. For
example, WO 2006/097538, WO 2006/097536, WO 2006/037810,
WO2006005667, WO 2005/027978. WO 98/08871 and US 2001/0011071
describe various GLP-1 analogues and derivatives thereof.
[0003] Many diabetes patients particularly in the type 2 diabetes
segment are subject to so-called "needle-phobia", i.e. a
substantial fear of injecting themselves. In the type 2 diabetes
segment most patients are treated with oral hypoglycemic agents,
and since GLP-1 compounds are expected to be an injectable
pharmaceutical product these patients will be administered, the
fear of injections may become a serious obstacle for the widespread
use of the clinically very promising compounds. Thus, there is a
need to develop new compounds which can be administered less than
once daily, e.g. once every second or third day preferably once
weekly, while retaining an acceptable clinical profile or
optionally via non invasive administration such as pulmonary,
nasal, sublingual, buccal or oral administration.
[0004] One object of the invention is to provide long acting, i.e.
having an administration regimen as described above, peptide
derivatives, such as derivatives of GLP-1, exendin-4, or analogues
thereof.
[0005] Another object of this invention is to provide peptide
derivatives such as derivatives of GLP-1, exendin-4, or analogues
thereof with high potency (receptor affinity) in order to reduce
the therapeutic dose used for example for once weekly s.c. dosing
or alternatively for non-invasive delivery.
[0006] A further object is to provide derivatives of GLP-1 or
analogues thereof for which the affinity to the GLP-1 receptor is
only partly decreased when comparing the affinity in the presence
of very low concentration of human albumin to the affinity in the
presence of a higher concentration of human albumin. The shift in
binding affinity is preferably low.
[0007] Another object of this invention is to provide peptide
derivatives such as derivatives of GLP-1 or analogues thereof with
high albumin binding affinity which protects the peptide for
proteolytic degradation and reduce renal clearance of the
peptide.
[0008] Potency, in particular the ratio of binding affinity to the
GLP-1 receptor in the presence of low and high albumin
concentrations, half-life, and binding affinity to albumin are
properties of potential relevance for an overall object of
achieving long-acting, stable and of course therapeutically active
peptide derivatives such as GLP-1 derivatives with a potential for
once weekly administration.
[0009] The peptide derivatives of the invention are preferably
chemically, physically and enzymatically stable.
SUMMARY OF THE INVENTION
[0010] The present invention relates to a peptide derivative
comprising a peptide wherein at least one amino acid residue is
derivatized with A-B-C-D-, wherein A- is
##STR00001##
wherein R is lower linear or branched alkyl such as isobutyl, p is
selected from the group consisting of 10, 11, 12, 13 and 14, and d
is selected from the group consisting of 0, 1, 2, 3, 4 and 5, and
-B- is selected from the group consisting of
##STR00002##
wherein x is selected from the group consisting of 0, 1, 2, 3 and
4, and y is selected from the group consisting of 1, 2, 3, 4, 5, 6,
7, 8, 9, 10, 11 and 12,
or A is
##STR00003##
[0011] wherein n is selected from the group consisting of 14, 15,
16 17, 18 and 19, and B is selected from the group consisting
of
##STR00004##
wherein x is selected from the group consisting of 0, 1, 2, 3 and
4, and -C- is selected from the group consisting of
##STR00005##
wherein b and e are each independently selected from the group
consisting of 0, 1 and 2, and c and f are each independently
selected from the group consisting of 0, 1 and 2 with the proviso
that b is 1 or 2 when c is 0, or b is 0 when c is 1 or 2, and e is
1 or 2 when f is 0, or e is 0 when f is 1 or 2, and -D- is attached
to said amino acid residue and is a linker, represents a bond, or
is absent.
[0012] The invention also relates to compositions and uses of these
peptide derivatives.
DESCRIPTION OF THE INVENTION
Definitions and Particular Embodiments
[0013] In the present specification, the following terms have the
indicated meaning: The term "polypeptide" and "peptide" as used
herein means a compound composed of at least five constituent amino
acids connected by peptide bonds. The constituent amino acids may
be from the group of the amino acids encoded by the genetic code
and they may be natural amino acids which are not encoded by the
genetic code, as well as synthetic amino acids. Natural amino acids
which are not encoded by the genetic code are e.g.,
.gamma.-carboxyglutamate, ornithine, phosphoserine, D-alanine and
D-glutamine. Synthetic amino acids comprise amino acids
manufactured by chemical synthesis, i.e. D-isomers of the amino
acids encoded by the genetic code such as D-alanine and D-leucine,
Aib (.alpha.-aminoisobutyric acid), Abu (.alpha.-aminobutyric
acid), Tle (tert-butylglycine), .beta.-alanine, 3-aminomethyl
benzoic acid, anthranilic acid.
[0014] The 22 proteogenic amino acids are: Alanine, Arginine,
Asparagine, Aspartic acid, Cysteine, Cystine, Glutamine, Glutamic
acid, Glycine, Histidine, Hydroxyproline, Isoleucine, Leucine,
Lysine, Methionine, Phenylalanine, Proline, Serine, Threonine,
Tryptophan, Tyrosine, Valine.
[0015] Thus a non-proteogenic amino acid (which may also be
designated a non-natural amino acid) is a moiety which can be
incorporated into a peptide via peptide bonds but is not a
proteogenic amino acid. Examples are .gamma.-carboxyglutamate,
ornithine, phosphoserine, the D-amino acids such as D-alanine and
D-glutamine, Synthetic non-proteogenic amino acids comprise amino
acids manufactured by chemical synthesis, i.e. D-isomers of the
amino acids encoded by the genetic code such as D-alanine and
D-leucine, Aib (.alpha.-aminoisobutyric acid), Abu
(.alpha.-aminobutyric acid), Tle (tert-butylglycine), 3-aminomethyl
benzoic acid, anthranilic acid, des-amino-histidine (abbreviated
DesaminoHis, alternative name imidazopropionic acid, abbreviated
Impr), the beta analogs of amino acids such as .beta.-alanine etc.,
D-histidine, 2-amino-histidine, .beta.-hydroxy-histidine,
homohistidine, N.sup..alpha.-acetyl-histidine,
.alpha.-fluoromethyl-histidine, .alpha.-methyl-histidine,
.alpha.,.alpha.-dimethyl-glutamic acid, m-CF3-phenylalanine
(abbreviated m-CF3-Phe), alpha,alpha-diaminopropionic acid
(abbreviated Dap), 2-naphthyl-threonine (abbreviated 2-naphthyl-Thr
or -T), 3-pyridylalanine, 2-pyridylalanine or 4-pyridylalanine,
(1-aminocyclopropyl) carboxylic acid, (1-aminocyclobutyl)
carboxylic acid, (1-aminocyclopentyl) carboxylic acid,
(1-aminocyclohexyl) carboxylic acid, (1-aminocycloheptyl)
carboxylic acid, or (1-aminocyclooctyl) carboxylic acid.
[0016] The term epsilon-amino-Lys (or epsilon-Lys) is intended to
indicate that a lysine residue is bound to a peptide such as
GLP-1(7-37) peptide or an analogue thereof via its epsilon amino
group, not (as is usually the case) via its alpha amino group (see
e.g. the compound of Example 53).
[0017] The term "analogue" as used herein referring to a
polypeptide means a modified peptide wherein one or more amino acid
residues of the peptide have been substituted by other amino acid
residues and/or wherein one or more amino acid residues have been
deleted from the peptide and or wherein one or more amino acid
residues have been added to the peptide. Such addition or deletion
of amino acid residues can take place at the N-terminal of the
peptide and/or at the C-terminal of the peptide.
[0018] A simple system is often used to describe analogues: For
example [Arg.sup.34]GLP-1(7-37)Lys designates a GLP-1(7-37)
analogue wherein the naturally occurring lysine at position 34 has
been substituted with arginine and wherein a lysine has been added
to the terminal amino acid residue, i.e. to the Gly.sup.37.
[0019] All amino acids for which the optical isomer is not stated
is to be understood to mean the L-isomer.
[0020] In a particular embodiment of the peptide derivative of the
invention, the linker D is absent, meaning the peptide is
derivatized with A-B-C- only.
[0021] In another particular embodiment, the linker D is included
and comprises at least 5, 8, 10, 19, 20, 29, 41, or at least 60
non-hydrogen atoms.
[0022] In a still further particular embodiment, 30-50% (such as
34, 38, 40, 41, or 42%) of the non-hydrogen atoms of the linker are
constituted by N or O atoms.
Functional Properties
[0023] A number of peptide derivatives of the invention have been
synthesized and tested as described in the experimental part.
[0024] The peptide derivatives of the invention have several
advantageous and beneficial properties as explained in the
following, by reference to the Examples.
[0025] In a first aspect, the peptide derivative of the invention
has a protracted profile of action, which makes it potentially
suitable for less-frequently-than-once-daily administration,
preferably with a potential for once-weekly, or even less frequent,
administration. The profile of action can be evaluated in
pharmacokinetic experiments with laboratory animals such as mice or
pigs. Suitable experiments are found in Example 73 (minipigs) and
Example 77 (mice) of the present application.
[0026] As described in minipig Example 73, (i) the peptide
derivative may be administered s.c. or i.v., preferably s.c.; (ii)
the pigs are preferably Gottingen minipigs, preferably about 5
months old and weighing 8-10 kg; (iii) the animals are preferably
fasting before administration, preferably as described; (iv) the
injection is preferably given as indicated; (v) the number of
animals tested is preferably as indicated; (vi) the dosage is
preferably as indicated; and/or (vii) blood samples are also
preferably taken, collected, and assayed as indicated in this
Example.
[0027] Pharmacokinetic experiments like the one in Example 73
result in a plasma concentration profile of the compound in
question versus time, on the basis of which the half-life, T1/2,
may be determined.
[0028] In a first particular embodiment, the half-life of a
peptide, such as a GLP-1, derivative of the invention, after s.c.
administration in minipigs, is above 18 hours, preferably above 24
hours, more preferably above 28 hours, even more preferably above
30 hours, most preferably above 32 hours.
[0029] In a second particular embodiment, the half-life of the
peptide derivative of the invention, after s.c. administration in
minipigs, is above 32 hours, preferably above 34 hours, more
preferably above 36 hours, even more preferably above 38 hours,
most preferably above 40 hours.
[0030] In a third particular embodiment, the half-life of the
peptide derivative of the invention, after s.c. administration in
minipigs, is above 45 hours, preferably above 50 hours, more
preferably above 55 hours, even more preferably above 60 hours,
most preferably above 65 hours.
[0031] In a fourth particular embodiment, the half-life of the
peptide derivative of the invention, after s.c. administration in
minipigs, is above 45 hours, preferably above 50 hours, more
preferably above 55 hours, even more preferably above 60 hours,
most preferably above 65 hours.
[0032] In a fifth particular embodiment, the half-life of the
peptide derivative of the invention, after s.c. administration in
minipigs, is above 70 hours, preferably above 75 hours, more
preferably above 80 hours, even more preferably above 85 hours,
most preferably above 90 hours.
[0033] In a sixth particular embodiment, the half-life of the
peptide derivative of the invention, after s.c. administration in
minipigs, is above 92 hours, preferably above 94 hours, more
preferably above 96 hours, even more preferably above 98 hours,
most preferably above 100 hours.
[0034] Accordingly, exemplary half-life intervals (time indicated
in hours, h) of the peptide derivative of the invention, determined
in minipigs by s.c. administration, are: 20-100, 30-100, 40-100,
50-100, 60-100, 70-100, 80-100, or 90-100 (hours).
[0035] The half-life of a peptide derivative such as a GLP-1
derivative of the invention may also be determined in a
dose-response study in db/db mice, e.g. as described in Example 77.
As described in this Example, (i) the mice are preferably from
Taconic; (ii) of 10-12 weeks of age; (iii) have free access to
standard feed such as Altromin 1324 and tap water; (iv) are kept at
24 dgC; (v) being acclimatised for 1 week; (vi) allocated into 7
groups (preferably n=6) based on matching mean blood glucose
values; (vii) receive treatment as described in the example; (viii)
being dosed as described; (ix) blood glucose is assessed according
to a scheme as described, preferably assayed as described; and/or
(x) the half-life determined based on the blood glucose vs. time
determinations, preferably as described in the example.
[0036] In a first particular embodiment, the half-life of a peptide
derivative such as a GLP-1 derivative of the invention, after s.c.
administration in db/db mice, is above 10 hours, preferably above
11 hours, more preferably above 12 hours, even more preferably
above 13 hours, most preferably above 14 hours.
[0037] In a second particular embodiment, the half-life of a
peptide derivative of the invention, after s.c. administration in
db/db mice, is above 15 hours, preferably above 16 hours, more
preferably above 17 hours, even more preferably above 18 hours,
most preferably above 19 hours.
[0038] In a third particular embodiment, the half-life of a peptide
derivative of the invention, after s.c. administration in db/db
mice, is above 20 hours, preferably above 21 hours, more preferably
above 22 hours, even more preferably above 23 hours, most
preferably above 24 hours.
[0039] In a fourth particular embodiment, the half-life of a
peptide derivative of the invention, after s.c. administration in
db/db mice, is above 25 hours, preferably above 26 hours, more
preferably above 27 hours, even more preferably above 28 hours,
most preferably above 29 hours.
[0040] In a fifth particular embodiment, the half-life of a peptide
derivative of the invention, after s.c. administration in db/db
mice, is above 30 hours, preferably above 31 hours, more preferably
above 32 hours, even more preferably above 33 hours, most
preferably above 34 hours.
[0041] Accordingly, exemplary half-life intervals (time indicated
in hours, h) of the peptide derivative of the invention, assayed in
db/db mice by s.c. administration, are: 5-35, 10-35, 15-35, 20-35,
or 25-35 (hours).
[0042] In a second aspect, the peptide derivative of the invention
has an acceptable, preferably a high potency (at its receptor). The
potency of an insulinotropic agent such as the GLP-1 derivative of
the invention may be determined by calculating the EC.sub.50 value
from the dose-response curve as described in Example 74.
[0043] The term "insulinotropic agent" as used herein means a
derivative which is an agonist of the human GLP-1 receptor, i.e. a
derivative which stimulates the formation of cAMP in a suitable
medium containing the human GLP-1 receptor (one such medium
disclosed below).
[0044] In particular embodiments, (i) baby hamster kidney (BHK)
cells expressing the cloned human GLP-1 receptor are used,
preferably BHK-467-12A, more preferably BHK-467-12A (tk-ts13); (ii)
the cells are grown in DMEM media with the addition of 100 IU/mL
penicillin, 100 .mu.g/mL streptomycin (1% Pen/Strep), 5% fetal calf
serum (FCS) and 0.5 mg/mL Geneticin G-418 (Life Technologies),
preferably at 5% CO.sub.2; (iii) the cells, preferably at
approximately 80% confluence, are washed twice in phosphate
buffered saline (PBS); (iv) the cells are harvested with an aqueous
solution of the tetrasodium salt of ethylenediaminetetraacetic
acid, such as Versene; (v) plasma membranes are prepared from the
cells by homogenisation, preferably in buffer 1; (vi) the
homogenate is centrifuged, e.g. at 48,000.times.g for 15 min at
4.degree. C.; and/or (vii) the pellet is suspended by
homogenization in buffer 2; Steps (vi) and (viii) are preferably
repeated, e.g. one or two times more.
[0045] The functional receptor assay may be carried out as
described in Example 74 by measuring cyclic AMP (cAMP) as a
response to stimulation by the insulinotropic agent. cAMP formed is
preferably quantified by the AlphaScreen.TM. cAMP Kit (Perkin Elmer
Life Sciences). Incubations may be carried out in half-area 96-well
microtiter plates in a total volume of 50 .mu.L buffer 3 (50 mM
Tris-HCI, 5 mM HEPES, 10 mM MgCl.sub.2, pH 7.4) and with the
following additions: 1 mM ATP, 1 .mu.M GTP, 0.5 mM
3-isobutyl-1-methylxanthine (IBMX), 0.01% Tween-20, 0.1% BSA, 6
.mu.g membrane preparation, 15 .mu.g/mL acceptor beads, 20 .mu.g/mL
donor beads preincubated with 6 nM biotinyl-cAMP. Derivatives to be
tested for agonist activity are preferably dissolved and diluted in
buffer 3. GTP is freshly prepared for each experiment. The plate is
incubated in the dark with slow agitation for three hours at room
temperature followed by counting in the Fusion.TM. instrument
(Perkin Elmer Life Sciences). Concentration-response curves are
plotted for the individual derivatives and EC.sub.50 values
estimated using a four-parameter logistic model with Prism,
preferably in version 4.0, or 5.0, (GraphPad, Carlsbad,
Calif.).
[0046] In a first particular embodiment, the GLP-1 derivative of
the invention has a potency (EC.sub.50 in nM), as determined using
the cAMP assay, below 4.00, preferably below 3.50, more preferably
below 3.00, even more preferably below 2.50, and most preferably
below 2.00 (nM).
[0047] In a second particular embodiment, the GLP-1 derivative of
the invention has a potency (EC.sub.50 in nM), as determined using
the cAMP assay, below 1.80, preferably below 1.60, more preferably
below 1.40, even more preferably below 1.20, and most preferably
below 1.00 (nM).
[0048] In a third particular embodiment, the GLP-1 derivative of
the invention has a potency (EC.sub.50 in nM), as determined using
the cAMP assay, below 0.80, preferably below 0.60, more preferably
below 0.40, even more preferably below 0.20, and most preferably
below 0.10 (nM).
[0049] In a fourth particular embodiment, the GLP-1 derivative of
the invention has a potency (EC.sub.50 in nM), as determined using
the cAMP assay, below 0.090, preferably below 0.080, more
preferably below 0.070, even more preferably below 0.060, and most
preferably below 0.050 (nM).
[0050] In a fifth particular embodiment, the GLP-1 derivative of
the invention has a potency (EC.sub.50 in nM), as determined using
the cAMP assay, below 0.040, preferably below 0.030, more
preferably below 0.020, and most preferably below 0.010 (nM).
[0051] Accordingly, exemplary ranges of potency (EC.sub.50 in nM,
as determined using the cAMP assay) of GLP-1 derivatives of the
invention are 0.010-2.00, 0.010-1.80, 0.010-1.60, 0.010-1.40,
0.010-1.20, 0.010-1.00, 0.010-0.80, 0.010-0.60, 0.010-0.40,
0.010-0.30, 0.010-0.20, 0.010-0.10, and 0.010-0.90 (nM), preferably
0.010-0.40, 0.010-0.30, 0.010-0.20, 0.010-0.10, and 0.010-0.90
(nM).
[0052] In a sixth particular embodiment, the GLP-1 derivative of
the invention can bind to albumin and the GLP-1 receptor
simultaneously. For example, the GLP-1 derivative of the invention
may bind to the GLP-1 receptor with an affinity below 100 nM,
preferable below 30 nM in the presence of 2% albumin.
[0053] In a third aspect, the GLP-1 derivative of the invention has
an affinity to the GLP-1 receptor which is only partly decreased
when comparing the affinity in the presence of very low
concentration (e.g. 0.005% to 0.2%) of human albumin to the
affinity in the presence of 2% human albumin (high/low). The shift
in binding affinity under these conditions is preferably less than
100 fold, more preferably below 50 fold, even more preferably below
30 fold and most preferably below 10 fold. The binding affinity at
the receptor in a high and low concentration of human albumin may
be determined as described in Example 75.
[0054] In a first particular embodiment, the GLP-1 derivative of
the invention has a ratio of [(IC.sub.50/nM) high
HSA]/[(IC.sub.50/nM) ultralow HSA] of below 500, preferably below
400, more preferably below 300, even more preferably below 200, and
most preferably below 100.
[0055] In a second particular embodiment, the GLP-1 derivative of
the invention has a ratio of [(IC.sub.50/nM) high
HSA]/[(IC.sub.50/nM) ultralow HSA] of below 90, preferably below
80, more preferably below 70, even more preferably below 69, and
most preferably below 50.
[0056] In a third particular embodiment, the GLP-1 derivative of
the invention has a ratio of [(IC.sub.50/nM) high
HSA]/[(IC.sub.50/nM) ultralow HSA] of below 40, preferably below
35, more preferably below 30, even more preferably below 25, and
most preferably below 20.
[0057] In a fourth particular embodiment, the GLP-1 derivative of
the invention has a ratio of [(IC.sub.50/nM) high
HSA]/[(IC.sub.50/nM) ultralow HSA] of below 15, preferably below
10, more preferably below 8, even more preferably below 5, and most
preferably below 4.
[0058] Accordingly, exemplary ranges for the ratio of
[(IC.sub.50/nM) high HSA]/[(IC.sub.50/nM) ultralow HSA] are 2-500,
2-300, 2-100, 2-50, 2-30, 2-20, and 2-10.
[0059] In a fourth aspect, the peptide derivative of the invention
has a high albumin binding affinity. The albumin refers to human
serum albumin (HSA), and the affinity may be determined as
described in Example 76.
[0060] The affinities of the GLP-1 derivatives for human serum
albumin (HSA) may be measured by a competition scintillation
proximity assay (SPA), preferably by (i) incubating
streptavidin-SPA beads (such as GE Healthcare RPNQ0009) with
biotinylated HSA, e.g. for 5 hours; (ii) washing the beads with
buffer; (iii) mixing the beads mixed with an .sup.125I-labeled
acylated GLP-1 analogue, such as
N-epsilon26-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-(17-carboxy-heptadecanoyla-
mino)butyrylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl][A
ib8,.sup.125I-Tyr19,Arg34]GLP-1(7-37) or
N-epsilon37-[2-(2-[2-((S)-4-((S)-4-(12-[4-(16-(1H-tetrazol-5-yl)hexadecan-
oylsulfamoyl)butyrylamino]dodecanoylamino)-4-carboxybutyrylamino)-4-carbox-
ybutyrylamino)ethoxy]ethoxy)acetyl][Aib8,.sup.125I-Tyr19,Glu22,Arg26,34,Ly-
s37]GLP-1(7-37)-NH.sub.2, preferably in a buffer containing 100 mM
Hepes, 100 mM NaCl, 10 mM MgSO.sub.4, 0.025% Tween-20, pH 7.4; (iv)
transferring the mixture into the wells of a scintillation counter
such as Perkin Elmer Optiplate-96 6005290 (100 .mu.l per well),
using suitable volumes such as 100 .mu.l of a suitable dilution
series of the GLP-1 derivative to be measured, preferably in the
same buffer; (v) centrifuging the plates after a suitable
incubation time such as 20 hours, preferably with gentle rocking,
more preferably at room temperature; (vi) counting the plates, e.g.
on a TopCounter; and/or (vii) plotting bound cpm as a function of
GLP-1 derivative concentration. The EC.sub.50 value of the
competition curve is preferably used as a measure of the affinity
of the derivative for HSA. The HSA binding affinity may also be
expressed as K.sub.d apparent (K.sub.d for Dissociation Equilibrium
Constant).
[0061] In a first particular embodiment, the albumin binding
affinity (i.e. the EC.sub.50 value (in nM) of the competition
curve, as measured using the assay of Example 76), is below 3000,
preferably below 2500, more preferably below 2000, even more
preferably below 800, and most preferably below 600 (nM).
[0062] In a second particular embodiment, the albumin binding
affinity (i.e. the EC.sub.50 value (in nM) of the competition
curve, as measured using the assay of Example 76), is below 500,
preferably below 400, more preferably below 300, even more
preferably below 200, and most preferably below 100 (nM).
[0063] Accordingly, exemplary ranges of albumin binding affinity
(EC50 in nM) of the GLP-1 derivative of the invention are: 1-3000,
1-2500, 1-2000, 100-2000, 200-2000, 400-1500, 600-1500, and
800-1500 (nM).
Additional Definitions and Particular Embodiments
[0064] Examples of other peptides which may be derivatised
according to the invention is a therapeutic peptide with a molar
weight of less than 100 kDa, less than 50 kDa, or less than 10
kDa.
[0065] Examples of other peptides which can be derivatised
according to the invention is Exendine 4, human growth hormone,
human insulin, coagulation factors including factor VII, factor
VIII, factor IX, factor X, factor XIII, parathyroid hormone, uman
follicle stimulating hormone, platelet-derived growth factor
(PDGF), transforming growth factor .alpha. (TGF-.alpha.),
transforming growth factor .beta. (TGF-.beta.), epidermal growth
factor (EGF), vascular endothelial growth factor (VEGF), a
somatomedin such as insulin growth factor I (IGF-I), insulin growth
factor II (IFG-II), erythropoietin (EPO), thrombopoietin (TPO) or
angiopoietin, interferon, pro-urokinase, urokinase, tissue
plasminogen activator (t-PA), plasminogen activator inhibitor 1,
plasminogen activator inhibitor 2, von Willebrandt factor, a
cytokine, e.g. an interleukin such as interleukin (IL) 1, IL-1Ra,
IL-2, IL-4, IL-5, IL-6, IL-9, IL-11, IL-12, IL-13, IL-15, IL-16,
IL-17, IL-18, IL-20 or IL-21, a colony stimulating factor (CFS)
such as GM-CSF, stem cell factor, a tumor necrosis factor such as
TNF-.alpha., lymphotoxin-.alpha., lymphotoxin-.beta., CD40L, or
CD30L, a protease inhibitor e.g. aprotinin, an enzyme such as
superoxide dismutase, asparaginase, arginase, arginine deaminase,
adenosine deaminase, ribonuclease, catalase, uricase, bilirubin
oxidase, trypsin, papain, alkaline phosphatase,
.beta.-glucoronidase, purine nucleoside phosphorylase or
batroxobin, an opioid, e.g. endorphins, enkephalins or non-natural
opioids, a hormone or neuropeptide, e.g. calcitonin, glucagon,
gastrins, adrenocorticotropic hormone (ACTH), cholecystokinins,
lutenizing hormone, gonadotropin-releasing hormone, chorionic
gonadotropin, corticotrophin-releasing factor, vasopressin,
oxytocin, antidiuretic hormones, thyroid-stimulating hormone,
thyrotropin-releasing hormone, relaxin, prolactin, peptide YY, Y2
receptor agonists, Y4 receptor agonists, mixed Y2/Y4 receptor
agonists, neuropeptide Y, pancreatic polypeptide, leptin, CART
(cocaine and amphetamine regulated transcript), a CART related
peptide, perilipin, natriuretic peptides, adrenomedullin,
endothelin, secretin, amylin, vasoactive intestinal peptide (VIP),
pituitary adenylate cyclase activating polypeptide (PACAP),
bombesin, bombesin-like peptides, thymosin, heparin-binding
protein, soluble CD4, hypothalmic releasing factor, melanotonins
and analogs thereof, hematide and analogs thereof.
[0066] The term "each amino acid residue downstream" as used herein
refers to each amino acids positioned towards the C-terminal
relative to a specific amino acid. As an example Lys34, Gly35 and
Arg36 and Gly37 are each amino acid residues downstream of Val33 in
GLP-1(7-37).
[0067] In one aspect of the invention, the C-terminal of the
derivative according to the invention may be terminated as either
an acid or amide. In a preferred aspect, the C-terminal of the
derivative of the invention is an amide. In another preferred
aspect, the C-terminal of the derivative of the invention is an
acid.
[0068] In embodiments of the invention a maximum of 17 amino acids
have been modified. In embodiments of the invention a maximum of 15
amino acids have been modified. In embodiments of the invention a
maximum of 10 amino acids have been modified. In embodiments of the
invention a maximum of 8 amino acids have been modified. In
embodiments of the invention a maximum of 7 amino acids have been
modified. In embodiments of the invention a maximum of 6 amino
acids have been modified. In embodiments of the invention a maximum
of 5 amino acids have been modified. In embodiments of the
invention a maximum of 4 amino acids have been modified. In
embodiments of the invention a maximum of 3 amino acids have been
modified. In embodiments of the invention a maximum of 2 amino
acids have been modified. In embodiments of the invention 1 amino
acid has been modified.
[0069] The term "derivative" as used herein in relation to a
peptide means a chemically modified peptide or an analogue thereof,
wherein at least one substituent is not present in the unmodified
peptide or an analogue thereof, i.e. a peptide which has been
covalently modified. Typical modifications are amides,
carbohydrates, alkyl groups, acyl groups, esters and the like. An
example of a derivative of an analogue of GLP-1(7-37) according to
the invention is
N-epsilon37{2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(19-carboxynonadecanoyl)pi-
peridine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethoxy]-
ethoxy}acetyl[desaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1(7-37)amide
wherein the naturally occurring Gly in position 37 has been
substituted with lysine which has been derivatised at N-epsilon37
with
{2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(19-carboxynonadecanoyl)piperidine-4--
carbon
yl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethoxy]ethoxy}ace-
tyl (structure 1)
##STR00006##
and wherein the naturally occurring histidine in position 7 has
been substituted with desaminoHis and the naturally occurring
glycine in pos 22 has been substituted with glutamate and lysine in
position 26 and 34 has been substituted with arginine.
[0070] The term "GLP-1 peptide" as used herein means GLP-1(7-37)
(SEQ ID No 1) or a GLP-1(7-37) analogue thereof.
[0071] In one aspect of the invention, the GLP-1 peptide is
selected from the group consisting of
[desaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1(7-37)amide,
[desaminoHis7,Arg34]GLP-1-(7-37),
[Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide,
[DesaminoHis7,Glu22 Arg26,Arg
34,Phe(m-CF3)28]GLP-1-(7-37)amide,
[DesaminoHis7,Glu22,Arg26,Arg34]GLP-1-(7-37)-Lys,
[DesaminoHis7,Glu22,Arg26,Arg34]GLP-1-(7-37)-Lys,
[0072] [desaminoHis7,Arg26,Arg34]GLP-1-(7-37)-Lys,
[DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide,
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37)amide,
[DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37),
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37),
[DesaminoHis7,Glu22,Arg26,Glu30,Arg34,Lys37]GLP-1-(7-37),
[0073]
[Aib8,Lys20,Arg26,Glu30,Thr(O-benzyl)33]GLP-1-(7-37)amide,
[Aib8,Glu22,Arg26,Lys30]GLP-1-(7-37), [Aib8,Glu22,Arg26,Lys
31]GLP-1-(7-37),
[0074]
[Aib8,Lys20,Arg26,2-Naphtylalanine28,Glu30]GLP-1(7-37)amide,
[Aib8,Glu22,Arg26,Arg34]GLP-1-(7-37)-Lys,
[0075] [Aib8,Lys20,Arg
26,2-Naphtylalanine12,Glu30]GLP-1-(7-37)amide,
[Aib8,Glu22,Arg26,Lys31,Arg34]GLP-1-(7-37),
[Aib8,Arg34]GLP-1-(7-37),
[0076] [Aib8,Arg34]GLP-1-(7-37)-amide,
[Aib8,Lys18,Arg26,Arg34]GLP-1(7-37),
[0077] [Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide, [Aib8,Lys
26]GLP-1(7-37)amide,
[Aib8,Arg34]GLP-1-(7-34),
[Aib8,Arg34]GLP-1-(7-35),
[Aib8,Lys33,Arg34]GLP-1-(7-34),
[0078] [Aib8,Arg34]GLP-1-(7-36)amide,
[Aib8,Lys26,Arg34]GLP-1-(7-36)amide,
[Aib8,Glu22,Arg26,Arg34]GLP-1-(7-37)Lys,
[0079] [Aib8,Lys20,Glu22,Arg26,Glu30,Pro37]GLP-1-(7-37)amide,
[Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide,
[DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide,
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37)amide,
Aib8,Glu22,Arg26,Glu30,Pro37]GLP-1-(7-37)Lys,
[Aib8,Glu22,Arg26,Glu30,Pro37]GLP-1-((7-37)Lys, and
[Aib8,Arg26,Arg34]GLP-1-(7-37).
[0080] In one aspect of the invention, the GLP-1 peptide is Arg18,
Leu20, Gln34, Lys33
(N.epsilon.-(.gamma.-aminobutyroyl(N.alpha.-hexadecanoyl)))
Exendin-4-(7-45)-amide or Arg33, Leu20, Gln34, Lys18
(N.epsilon.-(.gamma.-aminobutyroyl(N.alpha.-hexadecanoyl)))
Exendin-4-(7-45)-amide.
[0081] The term "derivative" as used herein in relation to a
peptide means a chemically modified peptide or an analogue thereof,
wherein at least one substituent is not present in the unmodified
peptide or an analogue thereof, i.e. a peptide which has been
covalently modified. Typical modifications are amides,
carbohydrates, alkyl groups, acyl groups, esters and the like.
[0082] Any amino acid position in the peptide e.g. the GLP-1
peptide may be derivatised. In one aspect of the invention, the
amino acid residue which is derivatised comprises an amino group.
In one aspect, the derivatised amino acid residue comprises an
amino group. In a further aspect, the derivatised amino acid
residue comprises a primary amino group in a side chain. In a
further aspect, the derivatised amino acid residue is lysine. In
one aspect of the invention, the derivatised amino acid residue is
cysteine. In one aspect of the invention, one amino acid residue is
derivatised. In yet a further aspect of the invention, the
derivative according to the invention is only derivatised in one
position, e.g. only one amino acid residue is derivatised.
[0083] Examples of amino acid residues comprising an amino group is
lysine, ornithine, Epsilon-N-alkylated lysine such as Epsilon-N
methylLysine, O-aminoethylserine, O-aminopropylserine or longer O
alkylated serines containing a primary or secondary amino group in
the side chain. In a further aspect of the invention, the
derivatised amino acid residue comprises a primary amino group in a
side chain. Examples of amino acid residues comprising a primary
amino group is lysine ornithine, O-aminoethylserine,
O-aminopropylserine or longer O alkylated serines containing a
primary amino group in the side chain.
[0084] In one embodiment the derivative of the GLP-1 peptide
according to the invention is an insulinotropic agent.
[0085] The term "insulinotropic agent" as used herein means a
derivative which is an agonist of the human GLP-1 receptor, i.e. a
derivative which stimulates the formation of cAMP in a suitable
medium containing the human GLP-1 receptor (one such medium
disclosed below). The potency of an insulinotropic agent is
determined by calculating the EC.sub.50 value from the
dose-response curve as described below.
[0086] Baby hamster kidney (BHK) cells expressing the cloned human
GLP-1 receptor (BHK-467-12A) are grown in DMEM media with the
addition of 100 IU/mL penicillin, 100 .mu.g/mL streptomycin, 5%
fetal calf serum and 0.5 mg/mL Geneticin G-418 (Life Technologies).
The cells are washed twice in phosphate buffered saline and
harvested with Versene. Plasma membranes are prepared from the
cells by homogenisation with an Ultraturrax in buffer 1 (20 mM
HEPES-Na, 10 mM EDTA, pH 7.4). The homogenate is centrifuged at
48,000.times.g for 15 min at 4.degree. C. The pellet is suspended
by homogenization in buffer 2 (20 mM HEPES-Na, 0.1 mM EDTA, pH
7.4), then centrifuged at 48,000.times.g for 15 min at 4.degree. C.
The washing procedure is repeated one more time. The final pellet
is suspended in buffer 2 and used immediately for assays or stored
at -80.degree. C.
[0087] The functional receptor assay is carried out by measuring
cyclic AMP (cAMP) as a response to stimulation by the
insulinotropic agent. cAMP formed is quantified by the
AlphaScreen.TM. cAMP Kit (Perkin Elmer Life Sciences). Incubations
are carried out in half-area 96-well microtiter plates in a total
volume of 50 .mu.L buffer 3 (50 mM Tris-HCI, 5 mM HEPES, 10 mM
MgCl.sub.2, pH 7.4) and with the following additions: 1 mM ATP, 1
.mu.M GTP, 0.5 mM 3-isobutyl-1-methylxanthine (IBMX), 0.01%
Tween-20, 0.1% BSA, 6 .mu.g membrane preparation, 15 .mu.g/mL
acceptor beads, 20 .mu.g/mL donor beads preincubated with 6 nM
biotinyl-cAMP. Derivatives to be tested for agonist activity are
dissolved and diluted in buffer 3. GTP is freshly prepared for each
experiment. The plate is incubated in the dark with slow agitation
for three hours at room temperature followed by counting in the
Fusion.TM. instrument (Perkin Elmer Life Sciences).
Concentration-response curves are plotted for the individual
derivatives and EC.sub.50 values estimated using a four-parameter
logistic model with Prism v. 4.0 (GraphPad, Carlsbad, Calif.).
[0088] The term "DPP-IV protected" as used herein referring to a
polypeptide means a polypeptide which has been chemically modified
in order to render said derivative resistant to the plasma
peptidase dipeptidyl aminopeptidase-4 (DPP-IV). The DPP-IV enzyme
in plasma is known to be involved in the degradation of several
peptide hormones, e.g. GLP-1, GLP-2, Exendin-4 etc. Thus, a
considerable effort is being made to develop analogues and
derivatives of the polypeptides susceptible to DPP-IV mediated
hydrolysis in order to reduce the rate of degradation by
DPP-IV.
[0089] In one aspect of the invention, the GLP-1 peptide is a DPPIV
protected GLP-1 peptide.
[0090] In one aspect of the invention, the said GLP-1 peptide is
stabilised against DPP-IV degradation relatively to the stability
of liraglutide
[0091] In one embodiment a derivative according to the invention is
a DPP-IV protected derivative which is more resistant to DPP-IV
than liraglutide.
[0092] Resistance of a peptide to degradation by dipeptidyl
aminopeptidase IV is determined by the following degradation
assay:
[0093] Aliquots of the peptide (5 nmol) are incubated at 37.degree.
C. with 1 .mu.L of purified dipeptidyl aminopeptidase IV
corresponding to an enzymatic activity of 5 mU for 10-180 minutes
in 100 .mu.L of 0.1 M triethylamine-HCl buffer, pH 7.4. Enzymatic
reactions are terminated by the addition of 5 .mu.L of 10%
trifluoroacetic acid, and the peptide degradation products are
separated and quantified using HPLC analysis. One method for
performing this analysis is: The mixtures are applied onto a Vydac
C18 widepore (30 nm pores, 5 .mu.m particles) 250.times.4.6 mm
column and eluted at a flow rate of 1 ml/min with linear stepwise
gradients of acetonitrile in 0.1% trifluoroacetic acid (0%
acetonitrile for 3 min, 0-24% acetonitrile for 17 min, 24-48%
acetonitrile for 1 min) according to Siegel et al., Regul. Pept.
1999; 79:93-102 and Mentlein et al. Eur. J. Biochem. 1993;
214:829-35. Peptides and their degradation products may be
monitored by their absorbance at 220 nm (peptide bonds) or 280 nm
(aromatic amino acids), and are quantified by integration of their
peak areas related to those of standards. The rate of hydrolysis of
a peptide by dipeptidyl aminopeptidase IV is estimated at
incubation times which result in less than 10% of the peptide being
hydrolysed.
[0094] Alternatively, the resistance of a peptide to degradation by
dipeptidyl aminopeptidase IV is determined by the following
degradation assay:
[0095] Aliquots of the peptide (4 nmol) are incubated at 37.degree.
C. with 10.9 mU of purified dipeptidyl aminopeptidase IV for 22
hours in 40 .mu.L of 0.085 M Tris-HCl buffer, pH 8.0, in presence
or absence of 1.6% human serum albumin. After 0, 4, and 22 hours
samples of 10 .mu.l are taken and enzymatic reactions are
terminated by mixing with 100 .mu.l of 1% trifluoroacetic acid. The
peptide degradation products are separated and quantified using
HPLC analysis. One method for performing this analysis is: The
mixtures are applied onto an Agilent Zorbax 300SB-C18 (5 .mu.m
particles) 150.times.2.1 mm column and eluted at a flow rate of 0.5
ml/min with a linear gradient from 0.1% trifluoroacetic acid to
100% acetonitrile with 0.07% TFA in 30 minutes. Peptides and their
degradation products are monitored by their absorbance at 214 nm,
and are quantified by integration of their peak areas. The
stability of a peptide against dipeptidyl aminopeptidase IV is
determined as the peak area of the intact peptide relative to the
sum of the peak areas of the intact peptide and the degradation
product lacking the two aminoterminal amino acids after
cleavage.
[0096] The term "pharmaceutically acceptable" as used herein means
suited for normal pharmaceutical applications, i.e. giving rise to
no serious adverse events in patients etc.
[0097] The term "excipient" as used herein means the chemical
compounds which are normally added to pharmaceutical compositions,
e.g. buffers, tonicity agents, preservatives and the like.
[0098] The term "effective amount" as used herein means a dosage
which is sufficient to be effective for the treatment of the
patient compared with no treatment.
[0099] The term "pharmaceutical composition" as used herein means a
product comprising an active derivative according to the invention
together with pharmaceutical excipients such as buffer,
preservative, and optionally a tonicity modifier and/or a
stabilizer. Thus a pharmaceutical composition is also known in the
art as a pharmaceutical formulation.
[0100] The term "treatment of a disease" as used herein means the
management and care of a patient having developed the disease,
condition or disorder. The purpose of treatment is to combat the
disease, condition or disorder. Treatment includes the
administration of the active derivative according to the invention
to eliminate or control the disease, condition or disorder as well
as to alleviate the symptoms or complications associated with the
disease, condition or disorder.
[0101] In another aspect, the present invention relates to a
derivative of a GLP-1 peptide that can bind to albumin and the
GLP-1 receptor simultaneously.
[0102] In another aspect the present invention relates to a
derivative of a GLP-1 peptide that bind to the GLP-1 receptor with
an affinity below 100 nM, preferable below 30 nM in the presence of
2% albumin.
[0103] In another aspect, the present invention relates to a
derivative of a GLP-1 peptide which affinity to the GLP-1 receptor
is only partly decreased when comparing the affinity in the
presence of very low concentration (e.g. 0.005% to 0.2%) of human
albumin to the affinity in the presence of 2% human albumin. The
shift in binding affinity under these conditions is less than 50
fold, preferable below 30 fold and more preferable below 10
fold.
[0104] In another aspect the present invention relates to a
derivative of a GLP-1 peptide which is stable against the chemical
degradation normally seen with exendin-4--especially oxidation and
deamidation.
[0105] In another aspect, the present invention relates to a
derivative of a GLP-1 peptide which has a high potency at the
receptor. For very strong albumin binding analogues with albumin
binding affinity below 100 nM, the GLP-1 potency is better than 3
micro molar and preferable the potency is better than 1 micromolar
in the cAMP assay.
[0106] For strong albumin binding derivatives with albumin binding
affinity below 500 nM, the GLP-1 potency is better than 1 micro
molar and preferable the potency is better than 0.2 micromolar in
the cAMP assay.
[0107] In another aspect, the present invention relates to a
derivative of a GLP-1 peptide which has high albumin binding
affinity. The derivatives of this invention have an albumin binding
affinity that is below 1 micromolar. More preferable the
derivatives of this invention has an albumin binding affinity that
is below 500 nM and even more preferable below 200 nM or even below
100 nM.
[0108] The albumin binding affinity can be measured using the
following assay:
Albumin Binding Assay:
[0109] The affinities of the GLP-1 derivatives for human serum
albumin (HSA) are measured by a competition scintillation proximity
assay (SPA). Streptavidin-SPA beads (GE Healthcare RPNQ0009) are
incubated with biotinylated HSA for 5 hours. The beads are washed
with buffer to remove unbound HSA. The beads are mixed with an
.sup.125I-labeled acylated GLP-1 analogue such as
N-epsilon26-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-(17-carboxy-heptadecanoyla-
mino)butyrylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl][A
ib8,.sup.125I-Tyr19,Arg34]GLP-1(7-37) or
N-epsilon37-[2-(2-[2-((S)-4-((S)-4-(12-[4-(16-(1H-tetrazol-5-yl)hexadecan-
oylsulfamoyl)butyrylamino]dodecanoylamino)-4-carboxybutyrylamino)-4-carbox-
ybutyrylamino)ethoxy]ethoxy)acetyl][Aib8,.sup.125I-Tyr19,Glu22,Arg26,34,Ly-
s37]GLP-1(7-37)-NH2 in a buffer containing 100 mM Hepes, 100 mM
NaCl, 10 mM MgSO.sub.4, 0.025% Tween-20, pH 7.4. The mixture is
pipetted into the wells of a Perkin Elmer Optiplate-96 6005290 (100
.mu.l per well) and 100 .mu.l of a dilution series of the GLP-1
derivative to be measured is added in the same buffer. After 20
hours of gentle rocking at room temperature the plates are
centrifuged and counted on a TopCounter. Bound cpm are plotted as a
function of GLP-1 derivative concentration end the EC50 value of
the competition curve is used as a measure of the affinity of the
derivative for HSA.
[0110] In another aspect, the present invention relates to a GLP-1
peptide derivative with high affinity binding to the isolated
N-terminal extracellular domain of the GLP-1R receptor (nGLP-1R).
The affinity is measured by the ability to displace
.sup.125I-Exendin-4(9-39) from binding to nGLP-1R. In this assay
Exendin-4 binds nGLP-1R with an IC.sub.50 value of 5 nM,
GLP-1(7-37) binds nGLP-1R with an IC.sub.50 value of 1120 nM and
liraglutide binds nGLP-1R with an IC.sub.50 value of 1000 nM. In
one aspect, the derivatives of this invention binds nGLP-1R with an
IC.sub.50 value lower than that of liraglutide. More preferable the
derivatives of this invention binds nGLP-1R with an IC.sub.50 value
lower than 100 nM and even more preferable below 10 nM or even
below 5 nM.
[0111] The binding to nGLP-1R is measured in the following assay:
the protein nGLP-1R is prepared as described previously (Runge et
al 2007), biotinylated and immobilized on streptavidin-coated SPA
beads. The nGLP1R in 0.1M NaHCO.sub.3 is biotinylated using 75
.mu.g BNHS (Sigma H1759) to 1 mg protein. The biotinylated nGLP1R
is subsequently dialyzed against PBS. All reagents and derivatives
are diluted in PBS with 0.05% v/v Tween 20. The binding assay is
carried out in 96 well OptiPlates (PerkinElmer 6005290) in a final
volume of 200 .mu.l. Each well contains 2 mg streptavidin coated
SPA beads (PerkinElmer RPNQ007), 0.1 pmol biotinylated nGLP1R, 50
pCi .sup.125I-Exendin (9-39) and test peptide in final
concentrations ranging from 1000 nM to 0.064 nM. The plates are
incubated on a shaker at RT for 3 hours. The SPA particles are spun
down by centrifugation for 10 min at 1500 rpm and the plates are
counted in a TopCount-NXT (PerkinElmer).
[0112] In another aspect, the present invention relates to a
derivative of a GLP-1 peptide which has substantially improved
terminal half-life in rodent and in a non-rodent model relative to
liraglutide.
[0113] In one aspect of this invention, the terminal half-life in
rodent or in a non-rodent model is improved at least 3 fold
relative to liraglutide.
[0114] In another aspect of this invention, the terminal half-life
in a non-rodent model is improved at least 6 fold relative to
liraglutide.
[0115] In another aspect, the present invention relates to a
derivative of a GLP-1 peptide which has an in vivo half-life of at
least 10 hrs after i.v. administration to rats.
[0116] In another aspect, the present invention relates to a
derivative of a GLP-1 peptide which has an in vivo half-life of at
least 50 hrs after s.c. administration to mini pigs, and preferable
an in vivo half-life of at least 80 hrs after s.c. administration
to mini pigs.
[0117] In another aspect, the present invention relates to a
derivative of a GLP-1 peptide which can be formulated into
particles suitable for pulmonary administration.
[0118] In another aspect, the present invention relates to a
derivative of a GLP-1 peptide which is chemically and physically
stable at neutral pH, most preferably in the range 6-8.
[0119] In another aspect, the present invention relates to a
derivative of a GLP-1 peptide which has little or no tendency to
aggregate. In one aspect the aggregation tendency is significantly
improved relatively to the aggregation tendency of liraglutide when
tested in a thioflavin assay.
[0120] In another aspect, the present invention relates to a
derivative of a GLP-1 peptide which is suitable for pulmonal
delivery. This may be with regard to physical or chemical aspects
which are useful for a pulmonal formulation. Alternatively, the
derivatives are stable against degradation by enzymes in the
airways and lungs.
[0121] In embodiments of the invention a combination of the above
features is achieved.
[0122] The term "albumin binding moiety" as used herein means a
residue which binds non-covalently to human serum albumin. The
albumin binding residue attached to the therapeutic polypeptide
typically has an albumin binding affinity that is below 1
micromolar, preferable below 500 nM and even more preferable below
200 nM or even below 100 nM.
[0123] A range of albumin binding residues are known among linear
and branched lipohophillic moieties containing 4-40 carbon atoms
having a distal acidic group.
[0124] The term "hydrophilic linker" as used herein means a spacer
that separates a peptide and an albumin binding residue with a
chemical moiety which comprises at least 5 non-hydrogen atoms where
30-50% of these are either N or O.
[0125] In the formulas below the terminal bonds from the attached
groups are to be regarded as attachment bonds and not ending in
methylene groups unless stated.
Compositions and Pharmaceutical Uses
[0126] Another object of the present invention is to provide a
pharmaceutical formulation comprising a derivative according to the
present invention which is present in a concentration from 0.1
mg/ml to 25 mg/ml, and wherein said formulation has a pH from 3.0
to 9.0. The formulation may further comprise a buffer system,
preservative(s), tonicity agent(s), chelating agent(s), stabilizers
and surfactants.
[0127] In one embodiment of the invention, the pharmaceutical
formulation is an aqueous formulation, i.e. formulation comprising
water. Such formulation is typically a solution or a
suspension.
[0128] In a further embodiment of the invention, the pharmaceutical
formulation is an aqueous solution.
[0129] The term "aqueous formulation" is defined as a formulation
comprising at least 50% w/w water. Likewise, the term "aqueous
solution" is defined as a solution comprising at least 50% w/w
water, and the term "aqueous suspension" is defined as a suspension
comprising at least 50% w/w water.
[0130] In another embodiment, the pharmaceutical formulation is a
freeze-dried formulation, whereto the physician or the patient adds
solvents and/or diluents prior to use.
[0131] In another embodiment, the pharmaceutical formulation is a
dried formulation (e.g. freeze-dried or spray-dried) ready for use
without any prior dissolution.
[0132] In a further aspect, the invention relates to a
pharmaceutical formulation comprising an aqueous solution of a
derivative according to the present invention, and a buffer,
wherein said derivative is present in a concentration from 0.1
mg/ml or above, and wherein said formulation has a pH from about
3.0 to about 9.0.
[0133] In another embodiment of the invention, the pH of the
formulation is from about 7.0 to about 9.5. In another embodiment
of the invention, the pH of the formulation is from about 3.0 to
about 7.0. In another embodiment of the invention, the pH of the
formulation is from about 5.0 to about 7.5. In another embodiment
of the invention, the pH of the formulation is from about 7.5 to
about 9.0. In another embodiment of the invention, the pH of the
formulation is from about 7.5 to about 8.5. In another embodiment
of the invention, the pH of the formulation is from about 6.0 to
about 7.5. In another embodiment of the invention, the pH of the
formulation is from about 6.0 to about 7.0. In another embodiment,
the pharmaceutical formulation is from 8.0 to 8.5.
[0134] In an embodiment of the invention, each administered dose
contains from 0.01 mg-10 mg of active derivative. In an embodiment,
the dose administered contains more than 0.05 mg active derivative.
In an embodiment, the dose administered contains more than 0.1 mg
active derivative. In an embodiment, the dose administered contains
up to 10 mg active derivative. In an embodiment, the dose
administered contains up to 9 mg active derivative. In an
embodiment, the dose administered contains up to 8 mg active
derivative. In an embodiment, the dose administered contains up to
7 mg active derivative. In an embodiment, the dose administered
contains up to 6 mg active derivative. In an embodiment, the dose
administered contains up to 5 mg active derivative. In an
embodiment, the dose administered contains from 0.2 mg to 5 mg
active derivative.
[0135] In a further embodiment of the invention, the buffer is
selected from the group consisting of sodium acetate, sodium
carbonate, citrate, glycylglycine, histidine, glycine, lysine,
arginine, sodium dihydrogen phosphate, disodium hydrogen phosphate,
sodium phosphate, and tris(hydroxymethyl)-aminomethan, bicine,
tricine, malic acid, succinate, maleic acid, fumaric acid, tartaric
acid, aspartic acid or mixtures thereof. Each one of these specific
buffers constitutes an alternative embodiment of the invention.
[0136] In a further embodiment of the invention, the formulation
further comprises a pharmaceutically acceptable preservative. In a
further embodiment of the invention the preservative is selected
from the group consisting of phenol, o-cresol, m-cresol, p-cresol,
methyl p-hydroxybenzoate, propyl p-hydroxybenzoate,
2-phenoxyethanol, butyl p-hydroxybenzoate, 2-phenylethanol, benzyl
alcohol, chlorobutanol, and thiomerosal, bronopol, benzoic acid,
imidurea, chlorohexidine, sodium dehydroacetate, chlorocresol,
ethyl p-hydroxybenzoate, benzethonium chloride, chlorphenesine
(3p-chlorphenoxypropane-1,2-diol) or mixtures thereof. In an
embodiment, the preservative is phenol or m-cresol. In a further
embodiment of the invention, the preservative is present in a
concentration from 0.1 mg/ml to 20 mg/ml. In a further embodiment
of the invention, the preservative is present in a concentration
from 0.1 mg/ml to 5 mg/ml. In a further embodiment of the
invention, the preservative is present in a concentration from 5
mg/ml to 10 mg/ml. In a further embodiment of the invention, the
preservative is present in a concentration from 10 mg/ml to 20
mg/ml. Each one of these specific preservatives constitutes an
alternative embodiment of the invention. The use of a preservative
in pharmaceutical compositions is well-known to the skilled person.
For convenience reference is made to Remington: The Science and
Practice of Pharmacy, 19.sup.th edition, 1995.
[0137] In a further embodiment of the invention, the formulation
further comprises an isotonic agent. In a further embodiment of the
invention, the isotonic agent is selected from the group consisting
of a salt (e.g. sodium chloride), a sugar or sugar alcohol, an
amino acid (e.g. L-glycine, L-histidine, arginine, lysine,
isoleucine, aspartic acid, tryptophan, threonine), an alditol (e.g.
glycerol (glycerine), 1,2-propanediol (propyleneglycol),
1,3-propanediol, 1,3-butanediol) polyethyleneglycol (e.g. PEG400),
or mixtures thereof. In an embodiment, the isotonicity agent is
propyleneglycol. Any sugar such as mono-, di-, or polysaccharides,
or water-soluble glucans, including for example fructose, glucose,
mannose, sorbose, xylose, maltose, lactose, sucrose, trehalose,
dextran, pullulan, dextrin, cyclodextrin, alfa and beta HPCD,
soluble starch, hydroxyethyl starch and carboxymethylcellulose-Na
may be used. In one embodiment, the sugar additive is sucrose.
Sugar alcohol is defined as a C4-C8 hydrocarbon having at least one
--OH group and includes, for example, mannitol, sorbitol, inositol,
galactitol, dulcitol, xylitol, and arabitol. In one embodiment, the
sugar alcohol additive is mannitol. The sugars or sugar alcohols
mentioned above may be used individually or in combination. There
is no fixed limit to the amount used, as long as the sugar or sugar
alcohol is soluble in the liquid preparation and does not adversely
effect the stabilizing effects achieved using the methods of the
invention. In one embodiment, the sugar or sugar alcohol
concentration is between about 1 mg/ml and about 150 mg/ml. In a
further embodiment of the invention, the isotonic agent is present
in a concentration from 1 mg/ml to 50 mg/ml. In a further
embodiment of the invention, the isotonic agent is present in a
concentration from 1 mg/ml to 7 mg/ml. In an embodiment of the
invention, the isotonic agent is present in a concentration from 5
mg/ml to 7 mg/ml. In a further embodiment of the invention, the
isotonic agent is present in a concentration from 8 mg/ml to 24
mg/ml. In a further embodiment of the invention, the isotonic agent
is present in a concentration from 25 mg/ml to 50 mg/ml. Each one
of these specific isotonic agents constitutes an alternative
embodiment of the invention. The use of an isotonic agent in
pharmaceutical compositions is well-known to the skilled person.
For convenience reference is made to Remington: The Science and
Practice of Pharmacy, 19.sup.th edition, 1995.
[0138] In a further embodiment of the invention, the formulation
further comprises a chelating agent. In a further embodiment of the
invention the chelating agent is selected from salts of
ethylenediaminetetraacetic acid (EDTA), citric acid, and aspartic
acid, and mixtures thereof. In a further embodiment of the
invention the chelating agent is present in a concentration from
0.1 mg/ml to 5 mg/ml. In a further embodiment of the invention the
chelating agent is present in a concentration from 0.1 mg/ml to 2
mg/ml. In a further embodiment of the invention the chelating agent
is present in a concentration from 2 mg/ml to 5 mg/ml. Each one of
these specific chelating agents constitutes an alternative
embodiment of the invention. The use of a chelating agent in
pharmaceutical compositions is well-known to the skilled person.
For convenience reference is made to Remington: The Science and
Practice of Pharmacy, 19.sup.th edition, 1995.
[0139] In a further embodiment of the invention, the formulation
further comprises a stabilizer. The use of a stabilizer in
pharmaceutical compositions is well-known to the skilled person.
For convenience reference is made to Remington: The Science and
Practice of Pharmacy, 19.sup.th edition, 1995.
[0140] More particularly, compositions of the invention are
stabilized liquid pharmaceutical compositions whose therapeutically
active components include a polypeptide that possibly exhibits
aggregate formation during storage in liquid pharmaceutical
formulations.
[0141] By "aggregate formation" is intended a physical interaction
between the polypeptide molecules that results in formation of
oligomers, which may remain soluble, or large visible aggregates
that precipitate from the solution. By "during storage" is intended
a liquid pharmaceutical composition or formulation once prepared,
is not immediately administered to a subject. Rather, following
preparation, it is packaged for storage, either in a liquid form,
in a frozen state, or in a dried form for later reconstitution into
a liquid form or other form suitable for administration to a
subject. By "dried form" is intended the liquid pharmaceutical
composition or formulation is dried either by freeze drying (i.e.,
lyophilization; see, for example, Williams and Polli (1984) J.
Parenteral Sci. Technol. 38:48-59), spray drying (see Masters
(1991) in Spray-Drying Handbook (5th ed; Longman Scientific and
Technical, Essez, U.K.), pp. 491-676; Broadhead et al. (1992) Drug
Devel. Ind. Pharm. 18:1169-1206; and Mumenthaler et al. (1994)
Pharm. Res. 11:12-20), or air drying (Carpenter and Crowe (1988)
Cryobiology 25:459-470; and Roser (1991) Biopharm. 4:47-53).
Aggregate formation by a polypeptide during storage of a liquid
pharmaceutical composition can adversely affect biological activity
of that polypeptide, resulting in loss of therapeutic efficacy of
the pharmaceutical composition. Furthermore, aggregate formation
may cause other problems such as blockage of tubing, membranes, or
pumps when the polypeptide-containing pharmaceutical composition is
administered using an infusion system.
[0142] The pharmaceutical compositions of the invention may further
comprise an amount of an amino acid base sufficient to decrease
aggregate formation by the polypeptide during storage of the
composition. By "amino acid base" is intended an amino acid or a
combination of amino acids, where any given amino acid is present
either in its free base form or in its salt form. Where a
combination of amino acids is used, all of the amino acids may be
present in their free base forms, all may be present in their salt
forms, or some may be present in their free base forms while others
are present in their salt forms. In one embodiment, amino acids to
use in preparing the compositions of the invention are those
carrying a charged side chain, such as arginine, lysine, aspartic
acid, and glutamic acid. Any stereoisomer (i.e., L, D, or a mixture
thereof) of a particular amino acid (e.g. methionine, histidine,
imidazole, arginine, lysine, isoleucine, aspartic acid, tryptophan,
threonine and mixtures thereof) or combinations of these
stereoisomers, may be present in the pharmaceutical compositions of
the invention so long as the particular amino acid is present
either in its free base form or its salt form. In one embodiment
the L-stereoisomer is used. Compositions of the invention may also
be formulated with analogues of these amino acids. By "amino acid
analogue" is intended a derivative of the naturally occurring amino
acid that brings about the desired effect of decreasing aggregate
formation by the polypeptide during storage of the liquid
pharmaceutical compositions of the invention. Suitable arginine
analogues include, for example, aminoguanidine, ornithine and
N-monoethyl L-arginine, suitable methionine analogues include
ethionine and buthionine and suitable cysteine analogues include
S-methyl-L cysteine. As with the other amino acids, the amino acid
analogues are incorporated into the compositions in either their
free base form or their salt form. In a further embodiment of the
invention the amino acids or amino acid analogues are used in a
concentration, which is sufficient to prevent or delay aggregation
of the protein.
[0143] In a further embodiment of the invention, methionine (or
other sulphuric amino acids or amino acid analogous) may be added
to inhibit oxidation of methionine residues to methionine sulfoxide
when the polypeptide acting as the therapeutic agent is a
polypeptide comprising at least one methionine residue susceptible
to such oxidation. By "inhibit" is intended minimal accumulation of
methionine oxidized species over time. Inhibiting methionine
oxidation results in greater retention of the polypeptide in its
proper molecular form. Any stereoisomer of methionine (L or D) or
combinations thereof can be used. The amount to be added should be
an amount sufficient to inhibit oxidation of the methionine
residues such that the amount of methionine sulfoxide is acceptable
to regulatory agencies. Typically, this means that the composition
contains no more than about 10% to about 30% methionine sulfoxide.
Generally, this can be achieved by adding methionine such that the
ratio of methionine added to methionine residues ranges from about
1:1 to about 1000:1, such as 10:1 to about 100:1.
[0144] In a further embodiment of the invention, the formulation
further comprises a stabilizer selected from the group of high
molecular weight polymers or low molecular compounds.
[0145] In a further embodiment of the invention the stabilizer is
selected from polyethylene glycol (e.g. PEG 3350), polyvinyl
alcohol (PVA), polyvinylpyrrolidone, carboxy-/hydroxycellulose or
derivates thereof (e.g. HPC, HPC-SL, HPC-L and HPMC),
cyclodextrins, sulphur-containing substances as monothioglycerol,
thioglycolic acid and 2-methylthioethanol, and different salts
(e.g. sodium chloride). Each one of these specific stabilizers
constitutes an alternative embodiment of the invention.
[0146] The pharmaceutical compositions may also comprise additional
stabilizing agents, which further enhance stability of a
therapeutically active polypeptide therein.
[0147] Stabilizing agents of particular interest to the present
invention include, but are not limited to, methionine and EDTA,
which protect the polypeptide against methionine oxidation, and a
nonionic surfactant, which protects the polypeptide against
aggregation associated with freeze-thawing or mechanical
shearing.
[0148] In a further embodiment of the invention, the formulation
further comprises a surfactant. In another embodiment of the
invention, the pharmaceutical composition comprises two different
surfactants. The term "Surfactant" as used herein refers to any
molecules or ions that are comprised of a water-soluble
(hydrophilic) part, the head, and a fat-soluble (lipophilic)
segment. Surfactants accumulate preferably at interfaces, which the
hydrophilic part is orientated towards the water (hydrophilic
phase) and the lipophilic part towards the oil- or hydrophobic
phase (i.e. glass, air, oil etc.). The concentration at which
surfactants begin to form micelles is known as the critical micelle
concentration or CMC. Furthermore, surfactants lower the surface
tension of a liquid. Surfactants are also known as amphipathic
compounds. The term "Detergent" is a synonym used for surfactants
in general.
Anionic surfactants may be selected from the group of:
Chenodeoxycholic acid, Chenodeoxycholic acid sodium salt, Cholic
acid, Dehydrocholic acid, Deoxycholic acid, Deoxycholic acid methyl
ester, Digitonin, Digitoxigenin, N,N-Dimethyldodecylamine N-oxide,
Docusate sodium, Glycochenodeoxycholic acid sodium, Glycocholic
acid hydrate, Glycodeoxycholic acid monohydrate, Glycodeoxycholic
acid sodium salt, Glycodeoxycholic acid sodium salt,
Glycolithocholic acid 3-sulfate disodium salt, Glycolithocholic
acid ethyl ester, N-Lauroylsarcosine sodium salt,
N-Lauroylsarcosine sodium salt, N-Lauroylsarcosine,
N-Lauroylsarcosine, Lithium dodecyl sulfate, Lugol,
1-Octanesulfonic acid sodium salt, 1-Octanesulfonic acid sodium
salt, Sodium 1-butanesulfonate, Sodium 1-decanesulfonate, Sodium
1-dodecanesulfonate, Sodium 1-heptanesulfonate, Sodium
1-heptanesulfonate, Sodium 1-nonanesulfonate, Sodium
1-propanesulfonate monohydrate, Sodium 2-bromoethanesulfonate,
Sodium cholate hydrate, ox or sheep bile, Sodium cholate hydrate,
Sodium choleate, Sodium deoxycholate, Sodium dodecyl sulfate,
Sodium dodecyl sulfate, Sodium hexanesulfonate, Sodium octyl
sulfate, Sodium pentanesulfonate, Sodium taurocholate,
Taurochenodeoxycholic acid sodium salt, Taurodeoxycholic acid
sodium salt monohydrate, Taurolithocholic acid 3-sulfate disodium
salt, Tauroursodeoxycholic acid sodium salt, Trizma.RTM. dodecyl
sulfate, DSS (docusate sodium, CAS registry no [577-11-7]),
docusate calcium, CAS registry no [128-49-4]), docusate potassium,
CAS registry no [749-09-0]), SDS (sodium dodecyl sulfate or sodium
lauryl sulfate), Dodecylphosphocholine (FOS-Choline-12),
Decylphosphocholine (FOS-Choline-10), Nonylphosphocholine
(FOS-Choline-9), dipalmitoyl phosphatidic acid, sodium caprylate,
and/or Ursodeoxycholic acid. Cationic surfactants may be selected
from the group of: Alkyltrimethylammonium bromide Benzalkonium
chloride, Benzalkonium chloride, Benzyldimethylhexadecylammonium
chloride, Benzyldimethyltetradecylammonium chloride,
Benzyltrimethylammonium tetrachloroiodate,
Dimethyldioctadecylammonium bromide, Dodecylethyldimethylammonium
bromide, Dodecyltrimethylammonium bromide, Dodecyltrimethylammonium
bromide, Ethylhexadecyldimethylammonium bromide,
Hexadecyltrimethylammonium bromide, Hexadecyltrimethylammonium
bromide, Polyoxyethylene(10)-N-tallow-1,3-diaminopropane,
Thonzonium bromide, and/or Trimethyl(tetradecyl)ammonium bromide.
Nonionic surfactants may be selected from the group of: BigCHAP,
Bis(polyethylene glycol bis[imidazoyl carbonyl]), block copolymers
as polyethyleneoxide/polypropyleneoxide block copolymers such as
poloxamers, poloxamer 188 and poloxamer 407, Brij.RTM. 35,
Brij.RTM. 56, Brij.RTM. 72, Brij.RTM. 76, Brij.RTM. 92V, Brij.RTM.
97, Brij.RTM. 58P, Cremophor.RTM. EL, Decaethylene glycol
monododecyl ether, N-Decanoyl-N-methylglucamine,
n-Dodecanoyl-N-methylglucamide, alkyl-polyglucosides, ethoxylated
castor oil, Heptaethylene glycol monodecyl ether, Heptaethylene
glycol monododecyl ether, Heptaethylene glycol monotetradecyl
ether, Hexaethylene glycol monododecyl ether, Hexaethylene glycol
monohexadecyl ether, Hexaethylene glycol monooctadecyl ether,
Hexaethylene glycol monotetradecyl ether, Igepal CA-630, Igepal
CA-630, Methyl-6-O--(N-heptylcarbamoyl)-beta-D-glucopyranoside,
Nonaethylene glycol monododecyl ether,
N-Nonanoyl-N-methylglucamine, N-Nonanoyl-N-methylglucamine,
Octaethylene glycol monodecyl ether, Octaethylene glycol
monododecyl ether, Octaethylene glycol monohexadecyl ether,
Octaethylene glycol monooctadecyl ether, Octaethylene glycol
monotetradecyl ether, Octyl-.beta.-D-glucopyranoside, Pentaethylene
glycol monodecyl ether, Pentaethylene glycol monododecyl ether,
Pentaethylene glycol monohexadecyl ether, Pentaethylene glycol
monohexyl ether, Pentaethylene glycol monooctadecyl ether,
Pentaethylene glycol monooctyl ether, Polyethylene glycol
diglycidyl ether, Polyethylene glycol ether W-1, Polyoxyethylene 10
tridecyl ether, Polyoxyethylene 100 stearate, Polyoxyethylene 20
isohexadecyl ether, Polyoxyethylene 20 oleyl ether, Polyoxyethylene
40 stearate, Polyoxyethylene 50 stearate, Polyoxyethylene 8
stearate, Polyoxyethylene bis(imidazolyl carbonyl), Polyoxyethylene
25 propylene glycol stearate, Saponin from Quillaja bark, Span.RTM.
20, Span.RTM. 40, Span.RTM. 60, Span.RTM. 65, Span.RTM. 80,
Span.RTM. 85, Tergitol, Type 15-S-12, Tergitol, Type 15-S-30,
Tergitol, Type 15-S-5, Tergitol, Type 15-S-7, Tergitol, Type
15-S-9, Tergitol, Type NP-10, Tergitol, Type NP-4, Tergitol, Type
NP-40, Tergitol, Type NP-7, Tergitol, Type NP-9,
Tetradecyl-.beta.-D-maltoside, Tetraethylene glycol monodecyl
ether, Tetraethylene glycol monododecyl ether, Tetraethylene glycol
monotetradecyl ether, Triethylene glycol monodecyl ether,
Triethylene glycol monododecyl ether, Triethylene glycol
monohexadecyl ether, Triethylene glycol monooctyl ether,
Triethylene glycol monotetradecyl ether, Triton CF-21, Triton
CF-32, Triton DF-12, Triton DF-16, Triton GR-5M, Triton QS-15,
Triton QS-44, Triton X-100, Triton X-102, Triton X-15, Triton
X-151, Triton X-200, Triton X-207, Triton.RTM. X-100, Triton.RTM.
X-114, Triton.RTM. X-165 solution, Triton.RTM. X-305 solution,
Triton.RTM. X-405, Triton.RTM. X-45, Triton.RTM. X-705-70,
TWEEN.RTM. 20, TWEEN.RTM. 40, TWEEN.RTM. 60, TWEEN.RTM. 6,
TWEEN.RTM. 65, TWEEN.RTM. 80, TWEEN.RTM. 81, TWEEN.RTM. 85,
Tyloxapol, sphingophospholipids (sphingomyelin), and
sphingoglycolipids (ceramides, gangliosides), phospholipids, and/or
n-Undecyl .beta.-D-glucopyranoside. Zwitterionic surfactants may be
selected from the group of: CHAPS, CHAPSO,
3-(Decyldimethylammonio)propanesulfonate inner salt,
3-(Dodecyldimethylammonio)-propanesulfonate inner salt,
3-(Dodecyldimethylammonio)propanesulfonate inner salt,
3-(N,N-Dimethylmyristylammonio)propanesulfonate,
3-(N,N-Dimethyloctadecyl-ammonio)propanesulfonate,
3-(N,N-Dimethyloctylammonio)propanesulfonate inner salt,
3-(N,N-Dimethylpalmitylammonio)propanesulfonate,
N-alkyl-N,N-dimethylammonio-1-propanesulfonates,
3-cholamido-1-propyldimethylammonio-1-propanesulfonate,
Dodecylphosphocholine, myristoyl lysophosphatidylcholine,
Zwittergent 3-12
(N-dodecyl-N,N-dimethyl-3-ammonio-1-propanesulfonate), Zwittergent
3-10 (3-(Decyldimethyl-ammonio)propanesulfonate inner salt),
Zwittergent 3-08 (3-(Octyldimethyl-ammonio)pro-panesulfonate),
glycerophospholipids (lecithins, kephalins, phosphatidyl serine),
glyceroglycolipids (galactopyranoside), alkyl, alkoxyl (alkyl
ester), alkoxy (alkyl ether)--derivatives of lysophosphatidyl and
phosphatidylcholines, e.g. lauroyl and myristoyl derivatives of
lysophosphatidylcholine, dipalmitoylphosphatidylcholine, and
modifications of the polar head group, that is cholines,
ethanolamines, phosphatidic acid, serines, threonines, glycerol,
inositol, lysophosphatidylserine and lysophosphatidylthreonine,
acylcarnitines and derivatives, N.sup.beta-acylated derivatives of
lysine, arginine or histidine, or side-chain acylated derivatives
of lysine or arginine, N.sup.beta-acylated derivatives of
dipeptides comprising any combination of lysine, arginine or
histidine and a neutral or acidic amino acid, N.sup.beta-acylated
derivative of a tripeptide comprising any combination of a neutral
amino acid and two charged amino acids, or the surfactant may be
selected from the group of imidazoline derivatives, long-chain
fatty acids and salts thereof C.sub.6-C.sub.12 (eg. oleic acid and
caprylic acid),
N-Hexadecyl-N,N-dimethyl-3-ammonio-1-propanesulfonate, anionic
(alkyl-aryl-sulphonates) monovalent surfactants, palmitoyl
lysophosphatidyl-L-serine, lysophospholipids (e.g.
1-acyl-sn-glycero-3-phosphate esters of ethanolamine, choline,
serine or threonine), or mixtures thereof.
[0149] The term "alkyl-polyglucosides" as used herein in relates to
an straight or branched C.sub.5-20-alkyl, -alkenyl or -alkynyl
chain which is substituted by one or more glucoside moieties such
as maltoside, saccharide etc. Embodiments of these
alkyl-polyglucosides include C.sub.6-18-alkyl-polyglucosides.
Specific embodiments of these alkyl-polyglucosides includes the
even numbered carbon-chains such as C.sub.6, C.sub.8, C.sub.10,
C.sub.12, C.sub.14, C.sub.16, C.sub.18 and C.sub.20 alkyl chain.
Specific embodiments of the glucoside moieties include pyranoside,
glucopyranoside, maltoside, maltotrioside and sucrose. In
embodiments of the invention, less than 6 glucosid moieties are
attached to the alkyl group. In embodiments of the invention, less
than 5 glucosid moieties are attached to the alkyl group. In
embodiments of the invention, less than 4 glucosid moieties are
attached to the alkyl group. In embodiments of the invention, less
than 3 glucosid moieties are attached to the alkyl group. In
embodiments of the invention, less than 2 glucosid moieties are
attached to the alkyl group. Specific embodiments of
alkyl-polyglucosides are alkyl glucosides such n-decyl
.beta.-D-glucopyranoside, decyl .beta.-D-maltopyranoside, dodecyl
.beta.-D-glucopyranoside, n-dodecyl .beta.-D-maltoside, n-dodecyl
.beta.-D-maltoside, n-dodecyl .beta.-D-maltoside, tetradecyl
.beta.-D-glucopyranoside, decyl .beta.-D-maltoside, hexadecyl
.beta.-D-maltoside, decyl .beta.-D-maltotrioside, dodecyl
.beta.-D-maltotrioside, tetradecyl .beta.-D-maltotrioside,
hexadecyl .beta.-D-maltotrioside, n-dodecyl-sucrose,
n-decyl-sucrose, sucrose monocaprate, sucrose monolaurate, sucrose
monomyristate, and sucrose monopalmitate.
[0150] The use of a surfactant in pharmaceutical compositions is
well-known to the skilled person. For convenience reference is made
to Remington: The Science and Practice of Pharmacy, 19.sup.th
edition, 1995.
[0151] In a further embodiment of the invention, the formulation
further comprises protease inhibitors such as EDTA (ethylenediamine
tetraacetic acid) and benzamidineHCl, but other commercially
available protease inhibitors may also be used. The use of a
protease inhibitor is particular useful in pharmaceutical
compositions comprising zymogens of proteases in order to inhibit
autocatalysis.
[0152] It is possible that other ingredients may be present in the
peptide pharmaceutical formulation of the present invention. Such
additional ingredients may include wetting agents, emulsifiers,
antioxidants, bulking agents, tonicity modifiers, chelating agents,
metal ions, oleaginous vehicles, proteins (e.g., human serum
albumin, gelatine or proteins) and a zwitterion (e.g., an amino
acid such as betaine, taurine, arginine, glycine, lysine and
histidine). Such additional ingredients, of course, should not
adversely affect the overall stability of the pharmaceutical
formulation of the present invention.
[0153] Pharmaceutical compositions containing a derivative
according to the present invention may be administered to a patient
in need of such treatment at several sites, for example, at topical
sites, for example, skin and mucosal sites, at sites which bypass
absorption, for example, administration in an artery, in a vein, in
the heart, and at sites which involve absorption, for example,
administration in the skin, under the skin, in a muscle or in the
abdomen.
[0154] Administration of pharmaceutical compositions according to
the invention may be through several routes of administration, for
example, lingual, sublingual, buccal, in the mouth, oral, in the
stomach and intestine, nasal, pulmonary, for example, through the
bronchioles and alveoli or a combination thereof, epidermal,
dermal, transdermal, vaginal, rectal, ocular, for examples through
the conjunctiva, uretal, and parenteral to patients in need of such
a treatment.
[0155] Compositions of the current invention may be administered in
several dosage forms, for example, as solutions, suspensions,
emulsions, microemulsions, multiple emulsion, foams, salves,
pastes, plasters, ointments, tablets, coated tablets, chewing gum,
rinses, capsules, for example, hard gelatine capsules and soft
gelatine capsules, suppositories, rectal capsules, drops, gels,
sprays, powder, aerosols, inhalants, eye drops, ophthalmic
ointments, ophthalmic rinses, vaginal pessaries, vaginal rings,
vaginal ointments, injection solution, in situ transforming
solutions, for example in situ gelling, in situ setting, in situ
precipitating, in situ crystallization, infusion solution, and
implants. Compositions of the invention may further be compounded
in, or attached to, for example through covalent, hydrophobic and
electrostatic interactions, a drug carrier, drug delivery system
and advanced drug delivery system in order to further enhance
stability of the derivative of the present invention, increase
bioavailability, increase solubility, decrease adverse effects,
achieve chronotherapy well known to those skilled in the art, and
increase patient compliance or any combination thereof. Examples of
carriers, drug delivery systems and advanced drug delivery systems
include, but are not limited to, polymers, for example cellulose
and derivatives, polysaccharides, for example dextran and
derivatives, starch and derivatives, poly(vinyl alcohol), acrylate
and methacrylate polymers, polylactic and polyglycolic acid and
block co-polymers thereof, polyethylene glycols, carrier proteins,
for example albumin, gels, for example, thermogelling systems, for
example block co-polymeric systems well known to those skilled in
the art, micelles, liposomes, microspheres, nanoparticulates,
liquid crystals and dispersions thereof, L2 phase and dispersions
there of, well known to those skilled in the art of phase behaviour
in lipid-water systems, polymeric micelles, multiple emulsions,
self-emulsifying, self-microemulsifying, cyclodextrins and
derivatives thereof, and dendrimers.
[0156] Compositions of the current invention are useful in the
formulation of solids, semisolids, powder and solutions for
pulmonary administration of derivatives of the present invention,
using, for example a metered dose inhaler, dry powder inhaler and a
nebulizer, all being devices well known to those skilled in the
art.
[0157] Compositions of the current invention are specifically
useful in the formulation of controlled, sustained, protracting,
retarded, and slow release drug delivery systems. More
specifically, but not limited to, compositions are useful in
formulation of parenteral controlled release and sustained release
systems (both systems leading to a many-fold reduction in number of
administrations), well known to those skilled in the art. Even more
preferably, are controlled release and sustained release systems
administered subcutaneous. Without limiting the scope of the
invention, examples of useful controlled release system and
compositions are hydrogels, oleaginous gels, liquid crystals,
polymeric micelles, microspheres, nanoparticles,
[0158] Methods to produce controlled release systems useful for
compositions of the current invention include, but are not limited
to, crystallization, condensation, co-crystallization,
precipitation, co-precipitation, emulsification, dispersion, high
pressure homogenisation, encapsulation, spray drying,
microencapsulating, coacervation, phase separation, solvent
evaporation to produce microspheres, extrusion and supercritical
fluid processes. General reference is made to Handbook of
Pharmaceutical Controlled Release (Wise, D. L., ed. Marcel Dekker,
New York, 2000) and Drug and the Pharmaceutical Sciences vol. 99:
Protein Formulation and Delivery (MacNally, E. J., ed. Marcel
Dekker, New York, 2000).
[0159] Parenteral administration may be performed by subcutaneous,
intramuscular, intraperitoneal or intravenous injection by means of
a syringe, optionally a pen-like syringe. Alternatively, parenteral
administration can be performed by means of an infusion pump. A
further option is a composition which may be a solution or
suspension or a powder for the administration of the derivative of
the present invention in the form of a nasal or pulmonal liquid or
powder spray. As a still further option, the pharmaceutical
compositions containing the derivative of the invention can also be
adapted to transdermal administration, e.g. by needle-free
injection or from a patch, optionally an iontophoretic patch, or
transmucosal, e.g. buccal, administration.
[0160] The derivatives of the present invention can be administered
via the pulmonary route in a vehicle, as a solution, suspension or
dry powder using any of known types of devices suitable for
pulmonary drug delivery. Examples of these comprise, but are not
limited to, the three general types of aerosol-generating for
pulmonary drug delivery, and may include jet or ultrasonic
nebulizers, metered-dose inhalers, or dry powder inhalers (Cf. Yu
J, Chien Y W. Pulmonary drug delivery: Physiologic and mechanistic
aspects. Crit. Rev Ther Drug Carr Sys 14(4) (1997) 395-453).
[0161] Based on standardised testing methodology, the aerodynamic
diameter (d.sub.a) of a particle is defined as the geometric
equivalent diameter of a reference standard spherical particle of
unit density (1 g/cm.sup.3). In the simplest case, for spherical
particles, d.sub.a is related to a reference diameter (d) as a
function of the square root of the density ratio as described
by:
[0162] Modifications to this relationship occur for non-spherical
particles (cf. Edwards D A, Ben-Jebria A, Langer R. Recent advances
in pulmonary drug delivery using large, porous inhaled particles. J
Appl Physiol 84(2) (1998) 379-385). The terms "MMAD" and "MMEAD"
are well-described and known to the art (cf. Edwards D A,
Ben-Jebria A, Langer R and represents a measure of the median value
of an aerodynamic particle size distribution. Recent advances in
pulmonary drug delivery using large, porous inhaled particles. J
Appl Physiol 84(2) (1998) 379-385). Mass median aerodynamic
diameter (MMAD) and mass median effective aerodynamic diameter
(MMEAD) are used inter-changeably, are statistical parameters, and
empirically describe the size of aerosol particles in relation to
their potential to deposit in the lungs, independent of actual
shape, size, or density (cf. Edwards D A, Ben-Jebria A, Langer R.
Recent advances in pulmonary drug delivery using large, porous
inhaled particles. J Appl Physiol 84(2) (1998) 379-385). MMAD is
normally calculated from the measurement made with impactors, an
instrument that measures the particle inertial behaviour in air. In
a further embodiment, the formulation could be aerosolized by any
known aerosolisation technology, such as nebulisation, to achieve a
MMAD of aerosol particles less than 10 .mu.m, more preferably
between 1-5 .mu.m, and most preferably between 1-3 .mu.m. The
preferred particle size is based on the most effective size for
delivery of drug to the deep lung, where protein is optimally
absorbed (cf. Edwards D A, Ben-Jebria A, Langer A, Recent advances
in pulmonary drug delivery using large, porous inhaled particles. J
Appl Physiol 84(2) (1998) 379-385).
[0163] Deep lung deposition of the pulmonal formulations comprising
the derivative of the present invention may optional be further
optimized by using modifications of the inhalation techniques, for
example, but not limited to: slow inhalation flow (eg. 30 L/min),
breath holding and timing of actuation.
[0164] The term "stabilized formulation" refers to a formulation
with increased physical stability, increased chemical stability or
increased physical and chemical stability.
[0165] The term "physical stability" of the protein formulation as
used herein refers to the tendency of the protein to form
biologically inactive and/or insoluble aggregates of the protein as
a result of exposure of the protein to thermo-mechanical stresses
and/or interaction with interfaces and surfaces that are
destabilizing, such as hydrophobic surfaces and interfaces.
Physical stability of the aqueous protein formulations is evaluated
by means of visual inspection and/or turbidity measurements after
exposing the formulation filled in suitable containers (e.g.
cartridges or vials) to mechanical/physical stress (e.g. agitation)
at different temperatures for various time periods. Visual
inspection of the formulations is performed in a sharp focused
light with a dark background. The turbidity of the formulation is
characterized by a visual score ranking the degree of turbidity for
instance on a scale from 0 to 3 (a formulation showing no turbidity
corresponds to a visual score 0, and a formulation showing visual
turbidity in daylight corresponds to visual score 3). A formulation
is classified physical unstable with respect to protein
aggregation, when it shows visual turbidity in daylight.
Alternatively, the turbidity of the formulation can be evaluated by
simple turbidity measurements well-known to the skilled person.
Physical stability of the aqueous protein formulations can also be
evaluated by using a spectroscopic agent or probe of the
conformational status of the protein. The probe is preferably a
small molecule that preferentially binds to a non-native conformer
of the protein. One example of a small molecular spectroscopic
probe of protein structure is Thioflavin T. Thioflavin T is a
fluorescent dye that has been widely used for the detection of
amyloid fibrils. In the presence of fibrils, and perhaps other
protein configurations as well, Thioflavin T gives rise to a new
excitation maximum at about 450 nm and enhanced emission at about
482 nm when bound to a fibril protein form. Unbound Thioflavin T is
essentially non-fluorescent at the wavelengths.
[0166] Other small molecules can be used as probes of the changes
in protein structure from native to non-native states. For instance
the "hydrophobic patch" probes that bind preferentially to exposed
hydrophobic patches of a protein. The hydrophobic patches are
generally buried within the tertiary structure of a protein in its
native state, but become exposed as a protein begins to unfold or
denature. Examples of these small molecular, spectroscopic probes
are aromatic, hydrophobic dyes, such as anthracene, acridine,
phenanthroline or the like. Other spectroscopic probes are
metal-amino acid complexes, such as cobalt metal complexes of
hydrophobic amino acids, such as phenylalanine, leucine,
isoleucine, methionine, and valine, or the like.
[0167] The term "chemical stability" of the protein formulation as
used herein refers to chemical covalent changes in the protein
structure leading to formation of chemical degradation products
with potential less biological potency and/or potential increased
immunogenic properties compared to the native protein structure.
Various chemical degradation products can be formed depending on
the type and nature of the native protein and the environment to
which the protein is exposed. Elimination of chemical degradation
can most probably not be completely avoided and increasing amounts
of chemical degradation products is often seen during storage and
use of the protein formulation as well-known by the person skilled
in the art. Most proteins are prone to deamidation, a process in
which the side chain amide group in glutaminyl or asparaginyl
residues is hydrolysed to form a free carboxylic acid. Other
degradations pathways involves formation of high molecular weight
transformation products where two or more protein molecules are
covalently bound to each other through transamidation and/or
disulfide interactions leading to formation of covalently bound
dimer, oligomer and polymer degradation products (Stability of
Protein Pharmaceuticals, Ahern. T. J. & Manning M. C., Plenum
Press, New York 1992). Oxidation (of for instance methionine
residues) can be mentioned as another variant of chemical
degradation. The chemical stability of the protein formulation can
be evaluated by measuring the amount of the chemical degradation
products at various time-points after exposure to different
environmental conditions (the formation of degradation products can
often be accelerated by for instance increasing temperature). The
amount of each individual degradation product is often determined
by separation of the degradation products depending on molecule
size and/or charge using various chromatography techniques (e.g.
SEC-HPLC and/or RP-HPLC).
[0168] Hence, as outlined above, a "stabilized formulation" refers
to a formulation with increased physical stability, increased
chemical stability or increased physical and chemical stability. In
general, a formulation must be stable during use and storage (in
compliance with recommended use and storage conditions) until the
expiration date is reached.
[0169] In one embodiment of the invention, the pharmaceutical
formulation comprising the derivative of the present invention is
stable for more than 6 weeks of usage and for more than 3 years of
storage.
[0170] In another embodiment of the invention, the pharmaceutical
formulation comprising the derivative of the present invention is
stable for more than 4 weeks of usage and for more than 3 years of
storage.
[0171] In a further embodiment of the invention, the pharmaceutical
formulation comprising the derivative of the present invention is
stable for more than 4 weeks of usage and for more than two years
of storage.
[0172] In an even further embodiment of the invention, the
pharmaceutical formulation comprising the derivative of the present
invention is stable for more than 2 weeks of usage and for more
than two years of storage.
[0173] In another aspect, the present invention relates to the use
of a derivative according to the invention for the preparation of a
medicament.
[0174] In one embodiment, a derivative according to the invention
is used for the preparation of a medicament for the treatment or
prevention of hyperglycemia, type 2 diabetes, impaired glucose
tolerance, type 1 diabetes, obesity, hypertension, syndrome X,
dyslipidemia, cognitive disorders, atheroschlerosis, myocardial
infarction, stroke, coronary heart disease and other cardiovascular
disorders, inflammatory bowel syndrome, dyspepsia and gastric
ulcers.
[0175] In another embodiment, a derivative according to the
invention is used for the preparation of a medicament for delaying
or preventing disease progression in type 2 diabetes.
[0176] In another embodiment, a derivative according to the
invention is used for the preparation of a medicament for
decreasing food intake, decreasing .beta.-cell apoptosis,
increasing .beta.-cell function and .beta.-cell mass, and/or for
restoring glucose sensitivity to .beta.-cells.
[0177] In one aspect of the invention, a method for increasing the
time of action in a patient of a peptide, such as a GLP-1 peptide,
characterised in that said peptide such as a GLP-1(7-37) peptide is
derivatised with A-B-C-D- as disclosed herein, is provided.
[0178] In one aspect of the invention, a method for increasing the
time of action in a patient of a peptide, such as a GLP-1 peptide
to more than about 40 hours, characterised in that said peptide
such as a GLP-1(7-37) peptide is derivatised with A-B-C-D- as
disclosed herein, is provided.
[0179] In one aspect of the invention, a pharmaceutical composition
comprising a derivative according to the invention, and a
pharmaceutically acceptable excipient, is provided.
[0180] In one aspect of the invention, the pharmaceutical
composition according to the invention is suited for parenteral
administration.
[0181] In a further aspect of the invention, the use of a
derivative according to the invention for the preparation of a
medicament, is provided.
[0182] In yet a further aspect of the invention, the use of a
derivative according to the invention for the preparation of a
medicament for the treatment or prevention of hyperglycemia, type 2
diabetes, impaired glucose tolerance, type 1 diabetes, obesity,
hypertension, syndrome X, dyslipidemia, cognitive disorders,
atheroschlerosis, myocardial infarction, coronary heart disease and
other cardiovascular disorders, stroke, inflammatory bowel
syndrome, dyspepsia and gastric ulcers, is provided.
[0183] In yet a further aspect of the invention, the use of a
derivative according to the invention for the preparation of a
medicament for delaying or preventing disease progression in type 2
diabetes, is provided.
[0184] The treatment with a derivative according to the present
invention may also be combined with a second or more
pharmacologically active substances, e.g. selected from
antidiabetic agents, antiobesity agents, appetite regulating
agents, antihypertensive agents, agents for the treatment and/or
prevention of complications resulting from or associated with
diabetes and agents for the treatment and/or prevention of
complications and disorders resulting from or associated with
obesity. Examples of these pharmacologically active substances are:
Insulin, sulphonylureas, biguanides, meglitinides, glucosidase
inhibitors, glucagon antagonists, DPP-IV (dipeptidyl peptidase-IV)
inhibitors, inhibitors of hepatic enzymes involved in stimulation
of gluconeogenesis and/or glycogenolysis, glucose uptake
modulators, compounds modifying the lipid metabolism such as
antihyperlipidemic agents as HMG CoA inhibitors (statins), Gastric
Inhibitory Polypeptides (GIP analogs), compounds lowering food
intake, RXR agonists and agents acting on the ATP-dependent
potassium channel of the .beta.-cells; Cholestyramine, colestipol,
clofibrate, gemfibrozil, lovastatin, pravastatin, simvastatin,
probucol, dextrothyroxine, neteglinide, repaglinide;
.beta.-blockers such as alprenolol, atenolol, timolol, pindolol,
propranolol and metoprolol, ACE (angiotensin converting enzyme)
inhibitors such as benazepril, captopril, enalapril, fosinopril,
lisinopril, alatriopril, quinapril and ramipril, calcium channel
blockers such as nifedipine, felodipine, nicardipine, isradipine,
nimodipine, diltiazem and verapamil, and .alpha.-blockers such as
doxazosin, urapidil, prazosin and terazosin; CART (cocaine
amphetamine regulated transcript) agonists, NPY (neuropeptide Y)
antagonists, PYY agonists, Y2 receptor agonists, Y4 receptor
agonists, mixed Y2/Y4 receptor agonists, MC4 (melanocortin 4)
agonists, orexin antagonists, TNF (tumor necrosis factor) agonists,
CRF (corticotropin releasing factor) agonists, CRF BP
(corticotropin releasing factor binding protein) antagonists,
urocortin agonists, .beta.3 agonists, oxyntomodulin and analogues,
MSH (melanocyte-stimulating hormone) agonists, MCH
(melanocyte-concentrating hormone) antagonists, CCK
(cholecystokinin) agonists, serotonin re-uptake inhibitors,
serotonin and noradrenaline re-uptake inhibitors, mixed serotonin
and noradrenergic compounds, 5HT (serotonin) agonists, bombesin
agonists, galanin antagonists, growth hormone, growth hormone
releasing compounds, TRH (thyreotropin releasing hormone) agonists,
UCP 2 or 3 (uncoupling protein 2 or 3) modulators, leptin agonists,
DA agonists (bromocriptin, doprexin), lipase/amylase inhibitors,
RXR (retinoid X receptor) modulators, TR .beta. agonists; histamine
H3 antagonists, Gastric Inhibitory Polypeptide agonists or
antagonists (GIP analogs), gastrin and gastrin analogs.
[0185] The treatment with a derivative according to this invention
may also be combined with surgery--a surgery that influence the
glucose levels and/or lipid homeostasis such as gastric banding or
gastric bypass.
[0186] It should be understood that any suitable combination of the
derivatives according to the invention with one or more of the
above-mentioned compounds and optionally one or more further
pharmacologically active substances are considered to be within the
scope of the present invention.
Method of Manufacturing Peptides and Analogues Thereof.
[0187] Depending on the sequence the analogues of this invention
can be produced by a method which comprises culturing a host cell
containing a DNA sequence encoding the polypeptide and capable of
expressing the polypeptide in a suitable nutrient medium under
conditions permitting the expression of the peptide, after which
the resulting peptide is recovered from the culture.
[0188] The medium used to culture the cells may be any conventional
medium suitable for growing the host cells, such as minimal or
complex media containing appropriate supplements. Suitable media
are available from commercial suppliers or may be prepared
according to published recipes (e.g. in catalogues of the American
Type Culture Collection). The peptide produced by the cells may
then be recovered from the culture medium by conventional
procedures including separating the host cells from the medium by
centrifugation or filtration, precipitating the proteinaceous
components of the supernatant or filtrate by means of a salt, e.g.
ammonium sulphate, purification by a variety of chromatographic
procedures, e.g. ion exchange chromatography, gel filtration
chromatography, affinity chromatography, or the like, dependent on
the type of peptide in question.
[0189] The DNA sequence encoding the therapeutic polypeptide may
suitably be of genomic or cDNA origin, for instance obtained by
preparing a genomic or cDNA library and screening for DNA sequences
coding for all or part of the polypeptide by hybridisation using
synthetic oligonucleotide probes in accordance with standard
techniques (see, for example, Sambrook, J, Fritsch, E F and
Maniatis, T, Molecular Cloning: A Laboratory Manual, Cold Spring
Harbor Laboratory Press, New York, 1989). The DNA sequence encoding
the polypeptide may also be prepared synthetically by established
standard methods, e.g. the phosphoamidite method described by
Beaucage and Caruthers, Tetrahedron Letters 22 (1981), 1859-1869,
or the method described by Matthes et al., EMBO Journal 3 (1984),
801-805. The DNA sequence may also be prepared by polymerase chain
reaction using specific primers, for instance as described in U.S.
Pat. No. 4,683,202 or Saiki et al., Science 239 (1988),
487-491.
[0190] The DNA sequence may be inserted into any vector which may
conveniently be subjected to recombinant DNA procedures, and the
choice of vector will often depend on the host cell into which it
is to be introduced. Thus, the vector may be an autonomously
replicating vector, i.e. a vector which exists as an
extrachromosomal entity, the replication of which is independent of
chromosomal replication, e.g. a plasmid. Alternatively, the vector
may be one which, when introduced into a host cell, is integrated
into the host cell genome and replicated together with the
chromosome(s) into which it has been integrated.
[0191] The vector is preferably an expression vector in which the
DNA sequence encoding the peptide is operably linked to additional
segments required for transcription of the DNA, such as a promoter.
The promoter may be any DNA sequence which shows transcriptional
activity in the host cell of choice and may be derived from genes
encoding proteins either homologous or heterologous to the host
cell. Examples of suitable promoters for directing the
transcription of the DNA encoding the peptide of the invention in a
variety of host cells are well-known in the art, cf. for instance
Sambrook et al., supra.
[0192] The DNA sequence encoding the peptide may also, if
necessary, be operably connected to a suitable terminator,
polyadenylation signals, transcriptional enhancer sequences, and
translational enhancer sequences. The recombinant vector of the
invention may further comprise a DNA sequence enabling the vector
to replicate in the host cell in question.
[0193] The vector may also comprise a selectable marker, e.g. a
gene the product of which complements a defect in the host cell or
one which confers resistance to a drug, e.g. ampicillin, kanamycin,
tetracyclin, chloramphenicol, neomycin, hygromycin or
methotrexate.
[0194] To direct a parent peptide of the present invention into the
secretory pathway of the host cells, a secretory signal sequence
(also known as a leader sequence, prepro sequence or pre sequence)
may be provided in the recombinant vector. The secretory signal
sequence is joined to the DNA sequence encoding the peptide in the
correct reading frame. Secretory signal sequences are commonly
positioned 5' to the DNA sequence encoding the peptide. The
secretory signal sequence may be that normally associated with the
peptide or may be from a gene encoding another secreted protein.
The procedures used to ligate the DNA sequences coding for the
present peptide, the promoter and optionally the terminator and/or
secretory signal sequence, respectively, and to insert them into
suitable vectors containing the information necessary for
replication, are well-known to persons skilled in the art (cf., for
instance, Sambrook et al., supra).
[0195] The host cell into which the DNA sequence or the recombinant
vector is introduced may be any cell which is capable of producing
the present peptide and includes bacteria, yeast, fungi and higher
eukaryotic cells. Examples of suitable host cells well-known and
used in the art are, without limitation, E. coli, Saccharomyces
cerevisiae, or mammalian BHK or CHO cell lines.
EMBODIMENTS ACCORDING TO THE INVENTION
[0196] 1. A peptide derivative comprising a peptide wherein at
least one amino acid residue is derivatized with A-B-C-D- wherein
[0197] A- is
[0197] ##STR00007## [0198] wherein p is selected from the group
consisting of 10, 11, 12, 13 and 14, and d is selected from the
group consisting of 0, 1, 2, 3, 4 and 5, and [0199] -B- is selected
from the group consisting of
[0199] ##STR00008## [0200] wherein x is selected from the group
consisting of 0, 1, 2, 3 and 4, and y is selected from the group
consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 and 12, [0201] or A
is
[0201] ##STR00009## [0202] wherein n is selected from the group
consisting of 14, 15, 16 17, 18 and 19, and B is selected from the
group consisting of
[0202] ##STR00010## [0203] wherein x is selected from the group
consisting of 0, 1, 2, 3 and 4, and [0204] -C- is selected from the
group consisting of
[0204] ##STR00011## [0205] wherein b and e are each independently
selected from the group consisting of 0, 1 and 2, and c and f are
each independently selected from the group consisting of 0, 1 and 2
with the proviso that b is 1 or 2 when c is 0, or b is 0 when c is
1 or 2, and e is 1 or 2 when f is 0, or e is 0 when f is 1 or 2,
and [0206] -D- is attached to said amino acid residue and is a
linker. [0207] 2. The derivative according to embodiment 1, wherein
said peptide is a GLP-1 peptide selected from GLP-1(7-37) and an
analogue of GLP-1(7-37), wherein, in said peptide, at least one
amino acid residue is derivatised with A-B-C-D-. [0208] 3. The
derivative according to any one of embodiments 1-2, wherein the
derivatised amino acid residue comprises an amino group. [0209] 4.
The derivative according to any one of embodiments 1-4, wherein the
derivatised amino acid residue is lysine. [0210] 5. The derivative
according to any of the embodiments 1-4, wherein D is selected from
the group consisting of
##STR00012##
[0210] (preferably no. 1, 3, 4, 5, and 6 of these structures, i.e.
excluding no. 2), [0211] wherein k is selected from the group
consisting of 0, 1, 2, 3, 4, 5, 11 and 27, and m is selected from
the group consisting of 0, 1, 2, 3, 4, 5 and 6, and D is attached
to the amino acid residue in the end depicted with *. [0212] 6. The
derivative according to any one of the embodiments 1-5, wherein
said GLP-1 analogue comprises the amino acid sequence of the
formula (I):
TABLE-US-00001 [0212] Formula (I) (SEQ ID No: 2)
Xaa.sub.7-Xaa.sub.8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Xaa.sub.16-Ser-
Xaa.sub.18-Xaa.sub.19-Xaa.sub.20-Glu-Xaa.sub.22-Xaa.sub.23-Ala-Xaa.sub.25--
Xaa.sub.26-
Xaa.sub.27-Phe-Ile-Xaa.sub.30-Trp-Leu-Xaa.sub.33-Xaa.sub.34-Xaa.sub.35-
Xaa.sub.36-Xaa.sub.37-Xaa.sub.38-Xaa.sub.39-Xaa.sub.40-Xaa.sub.41-Xaa.sub.-
42-Xaa.sub.43- Xaa.sub.44-Xaa.sub.45-Xaa.sub.46
[0213] wherein [0214] Xaa.sub.7 is L-histidine, D-histidine,
desamino-histidine, 2-amino-histidine, .beta.-hydroxy-histidine,
homohistidine, N.alpha.-acetyl-histidine,
.alpha.-fluoromethyl-histidine, .alpha.-methyl-histidine,
3-pyridylalanine, 2-pyridylalanine or 4-pyridylalanine; [0215]
Xaa.sub.8 is Ala, Gly, Val, Leu, Ile, Lys, Aib,
(1-aminocyclopropyl) carboxylic acid, (1-aminocyclobutyl)
carboxylic acid, (1-aminocyclopentyl) carboxylic acid,
(1-aminocyclohexyl) carboxylic acid, (1-aminocycloheptyl)
carboxylic acid, or (1-aminocyclooctyl) carboxylic acid; [0216]
Xaa.sub.16 is Val or Leu; [0217] Xaa.sub.18 is Ser, Lys or Arg;
[0218] Xaa.sub.19 is Tyr or Gln; [0219] Xaa.sub.20 is Leu, Met, or
Lys, preferably Leu or Met; [0220] Xaa.sub.22 is Gly, Glu or Aib;
[0221] Xaa.sub.23 is Gln, Glu, Lys or Arg; [0222] Xaa.sub.25 is Ala
or Val; [0223] Xaa.sub.26 is Lys, Glu or Arg; [0224] Xaa.sub.27 is
Glu or Leu; [0225] Xaa.sub.30 is Ala, Glu, Lys, or Arg, preferably
Ala, Glu, or Arg; [0226] Xaa.sub.33 is Val or Lys; [0227]
Xaa.sub.34 is Lys, Glu, Asn or Arg; [0228] Xaa.sub.35 is Gly or
Aib; [0229] Xaa.sub.36 is Arg, Gly or Lys; [0230] Xaa.sub.37 is
Gly, Ala, Glu, Pro, Lys, amide or is absent; [0231] Xaa.sub.38 is
Lys, Ser, amide or is absent. [0232] Xaa.sub.39 is Ser, Lys, amide
or is absent; [0233] Xaa.sub.40 is Gly, amide or is absent; [0234]
Xaa.sub.41 is Ala, amide or is absent; [0235] Xaa.sub.42 is Pro,
amide or is absent; [0236] Xaa.sub.43 is Pro, amide or is absent;
[0237] Xaa.sub.44 is Pro, amide or is absent; [0238] Xaa.sub.45 is
Ser, amide or is absent; [0239] Xaa.sub.46 is amide or is absent;
[0240] provided that if Xaa.sub.38, Xaa.sub.39, Xaa.sub.40,
Xaa.sub.41, Xaa.sub.42, Xaa.sub.43, Xaa.sub.44, Xaa.sub.45 or
Xaa.sub.46 is absent then each amino acid residue downstream is
also absent. [0241] 7. The derivative according to any one of the
embodiments 1-5, wherein said GLP-1 analogue comprises the amino
acid sequence of the formula (II):
TABLE-US-00002 [0241] Formula (II) (SE0 ID No: 3)
Xaa.sub.7-Xaa.sub.8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-
Xaa.sub.18-Tyr-Leu-Glu-Xaa.sub.22-Xaa.sub.23-Ala-Ala-Xaa.sub.26-Glu-
Phe-Ile-Xaa.sub.30-Trp-Leu-Val-Xaa.sub.34-Xaa.sub.35-Xaa.sub.36-Xaa.sub.37-
- Xaa.sub.38
[0242] wherein [0243] Xaa.sub.7 is L-histidine, D-histidine,
desamino-histidine, 2-amino-histidine, .beta.-hydroxy-histidine,
homohistidine, N.sup..alpha.-acetyl-histidine,
.alpha.-fluoromethyl-histidine, .alpha.-methyl-histidine,
3-pyridylalanine, 2-pyridylalanine or 4-pyridylalanine; [0244]
Xaa.sub.8 is Ala, Gly, Val, Leu, Ile, Lys, Aib,
(1-aminocyclopropyl) carboxylic acid, (1-aminocyclobutyl)
carboxylic acid, (1-aminocyclopentyl) carboxylic acid,
(1-aminocyclohexyl) carboxylic acid, (1-aminocycloheptyl)
carboxylic acid, or (1-aminocyclooctyl) carboxylic acid; [0245]
Xaa.sub.18 is Ser, Lys or Arg; [0246] Xaa.sub.22 is Gly, Glu or
Aib; [0247] Xaa.sub.23 is Gln, Glu, Lys or Arg; [0248] Xaa.sub.26
is Lys, Glu or Arg; [0249] Xaa.sub.30 is Ala, Glu, Lys, or Arg,
preferably Ala, Glu, or Arg; [0250] Xaa.sub.34 is Lys, Glu or Arg;
[0251] Xaa.sub.35 is Gly or Aib; [0252] Xaa.sub.36 is Arg or Lys;
[0253] Xaa.sub.37 is Gly, Ala, Glu or Lys; [0254] Xaa.sub.38 is
Lys, amide or is absent. [0255] 8. The derivative according to any
one of the embodiments 1-5, wherein said GLP-1 analogue comprises
the amino acid sequence of the formula (III) which is derivatised
in position 18, 23, 34, 36, 37 or 38:
TABLE-US-00003 [0255] Formula (III) (SE0 ID No: 6)
Xaa.sub.7-Xaa.sub.8-Xaa.sub.9-Gly-Thr-Phe-Thr-Ser-Asp-Xaa.sub.16-Ser-
Xaa.sub.18-Tyr-Leu-Glu-Glu-Xaa.sub.23-Ala-Xaa.sub.25-Arg-Xaa.sub.27-
Phe-Ile-Xaa.sub.30-Trp-Leu-Xaa.sub.33-Xaa.sub.34-Xaa.sub.35-Xaa.sub.36-
Xaa.sub.37-Xaa.sub.38-Xaa.sub.39
[0256] wherein [0257] Xaa.sub.7-Xaa.sub.8 is L-histidine-Aib,
desamino-histidine-alanine or desamino-histidine-Aib [0258]
Xaa.sub.9 is Glu or a Glu derivative such as alpha, alpha
dimethyl-Glu [0259] Xaa.sub.16 is Val or Leu; [0260] Xaa.sub.18 is
Ser, Lys, or Arg; [0261] Xaa.sub.19 is Tyr or Gln; [0262]
Xaa.sub.23 is Gln, Glu, Lys or Arg; [0263] Xaa.sub.25 is Ala or
Val; [0264] Xaa.sub.27 is Glu or Leu; [0265] Xaa.sub.30 is Ala,
Glu, Arg or absent; [0266] Xaa.sub.33 is Val, or Lys; [0267]
Xaa.sub.34 is Lys, Glu, Asn or Arg; [0268] Xaa.sub.35 is Gly or
Aib; [0269] Xaa.sub.36 is Arg or Lys, [0270] Xaa.sub.37 is Gly, Aib
or absent [0271] Xaa.sub.38 is Lys, Glu or absent [0272] Xaa.sub.39
is amide or is absent; [0273] provided that if Xaa.sub.37 is absent
then Xaa.sub.38 is also absent. [0274] 9. The derivative according
to any one of the embodiments 1-5, wherein the GLP-1 peptide
comprises the amino acid sequence of formula (IV) which is
derivatised with an albumin binding residue in position 18, 23, 34,
36, 37 or 38:
TABLE-US-00004 [0274] Formula (IV) (SE0 ID No: 7)
Xaa.sub.7-Xaa.sub.8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-
Xaa.sub.18-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Arg-Glu-Phe-Ile-
Xaa.sub.30-Trp-Leu-Xaa.sub.33-Xaa.sub.34-Xaa.sub.35-Xaa.sub.36-Xaa.sub.37--
Xaa.sub.38- Xaa.sub.39
[0275] wherein [0276] Xaa.sub.7 is L-histidine, D-histidine,
desamino-histidine, 2-amino-histidine, .beta.-hydroxy-histidine,
homohistidine, N.sup..alpha.-acetyl-histidine,
.alpha.-fluoromethyl-histidine, .alpha.-methyl-histidine,
3-pyridylalanine, 2-pyridylalanine or 4-pyridylalanine; [0277]
Xaa.sub.8 is Ala, Gly, Val, Leu, Ile, Lys, Aib,
(1-aminocyclopropyl) carboxylic acid, (1-aminocyclobutyl)
carboxylic acid, (1-aminocyclopentyl) carboxylic acid,
(1-aminocyclohexyl) carboxylic acid, (1-aminocycloheptyl)
carboxylic acid, or (1-aminocyclooctyl) carboxylic acid; [0278]
Xaa.sub.18 is Ser, Lys or Arg; [0279] Xaa.sub.30 is Ala, Glu, Lys,
Arg or absent, preferably Ala, Glu, or Arg; [0280] Xaa.sub.33 is
Val or Lys; [0281] Xaa.sub.34 is Lys, Glu or Arg; [0282] Xaa.sub.35
is Gly or Aib; [0283] Xaa.sub.36 is Arg or Lys, [0284] Xaa.sub.37
is Gly, Aib or absent, [0285] Xaa.sub.38 is Lys or absent, and
[0286] Xaa.sub.39 is amide or is absent. [0287] 10. The derivative
according to any one of the embodiments 1-9, wherein Xaa.sub.38 is
absent. [0288] 11. The derivative according to any one of the
embodiments 1-10, wherein Xaa.sub.37 and Xaa.sub.38 are both
absent. [0289] 12. The derivative according to any one of the
embodiments 1-11, wherein Xaa.sub.7 is desamino-histidine. [0290]
13. The derivative according to any one of the embodiments 1-12,
wherein Xaa.sub.8 is Aib [0291] 14. A pharmaceutical composition
comprising a derivative according to any one of embodiments 1-13,
and a pharmaceutically acceptable excipient. [0292] 15. A
derivative according to any one of the embodiments 1-13 for use in
the treatment or prevention of hyperglycemia, type 2 diabetes,
impaired glucose tolerance, type 1 diabetes, obesity, hypertension,
syndrome X, dyslipidemia, cognitive disorders, atheroschlerosis,
myocardial infarction, coronary heart disease and other
cardiovascular disorders, stroke, inflammatory bowel syndrome,
dyspepsia and gastric ulcers.
[0293] The amino acid sequence of human GLP-1(7-37) is included in
the Sequence Listing as SEQ ID No 1, and SEQ ID Nos 2-3 and 6-7 are
examples of GLP-1(7-37) analogues for use in derivatives according
to the invention. In the Sequence Listing the numbering of
GLP-1(7-37) and the analogues thereof starts with amino acid
residue no. 1. Accordingly, e.g., position 1 of SEQ ID No 1 is
equivalent to position 7 of GLP-1(7-37) (His), position 16 of SEQ
ID No 1 is equivalent to position 22 of GLP-1(7-37) (Gly), and
position 20 of SEQ ID No 1 is equivalent to position 26 of
GLP-1(7-37) (Lys)--and vice versa for the other positions and the
other sequences.
[0294] Accordingly, the invention also provides, e.g. in above
embodiment 6, a peptide derivative wherein the GLP-1(7-37) analogue
comprises the amino acid sequence of the formula (I) (SEQ ID NO: 2)
wherein:
Xaa.sub.7 (position no. 1 in SEQ ID NO: 2) is L-histidine,
D-histidine, desamino-histidine, 2-amino-histidine,
.beta.-hydroxy-histidine, homohistidine, Na-acetyl-histidine,
.alpha.-fluoromethyl-histidine, .alpha.-methyl-histidine,
3-pyridylalanine, 2-pyridylalanine or 4-pyridylalanine; Xaa.sub.8
(position no. 2 in SEQ ID NO: 2) is Ala, Gly, Val, Leu, Ile, Lys,
Aib, (1-aminocyclopropyl) carboxylic acid, (1-aminocyclobutyl)
carboxylic acid, (1-aminocyclopentyl) carboxylic acid,
(1-aminocyclohexyl) carboxylic acid, (1-aminocycloheptyl)
carboxylic acid, or (1-aminocyclooctyl) carboxylic acid; Xaa.sub.16
(position no. 10 in SEQ ID NO: 2) is Val or Leu; Xaa.sub.18
(position no. 12 in SEQ ID NO: 2) is Ser, Lys or Arg; Xaa.sub.19
(position no. 13 in SEQ ID NO: 2) is Tyr or Gln; Xaa.sub.20
(position no. 14 in SEQ ID NO: 2) is Leu, Met or Lys; Xaa.sub.22
(position no. 16 in SEQ ID NO: 2) is Gly, Glu or Aib; Xaa.sub.23
(position no. 17 in SEQ ID NO: 2) is Gln, Glu, Lys or Arg;
Xaa.sub.25 (position no. 19 in SEQ ID NO: 2) is Ala or Val;
Xaa.sub.26 (position no. 20 in SEQ ID NO: 2) is Lys, Glu or Arg;
Xaa.sub.27 (position no. 21 in SEQ ID NO: 2) is Glu or Leu;
Xaa.sub.30 (position no. 24 in SEQ ID NO: 2) is Ala, Glu, Lys or
Arg; Xaa.sub.33 (position no. 27 in SEQ ID NO: 2) is Val or Lys;
Xaa.sub.34 (position no. 28 in SEQ ID NO: 2) is Lys, Glu, Asn or
Arg; Xaa.sub.35 (position no. 29 in SEQ ID NO: 2) is Gly or Aib;
Xaa.sub.36 (position no. 30 in SEQ ID NO: 2) is Arg, Gly or Lys;
Xaa.sub.37 (position no. 31 in SEQ ID NO: 2) is Gly, Ala, Glu, Pro,
Lys, amide or is absent; Xaa.sub.38 (position no. 32 in SEQ ID NO:
2) is Lys, Ser, amide or is absent. Xaa.sub.39 (position no. 33 in
SEQ ID NO: 2) is Ser, Lys, amide or is absent; Xaa.sub.40 (position
no. 34 in SEQ ID NO: 2) is Gly, amide or is absent; Xaa.sub.41
(position no. 35 in SEQ ID NO: 2) is Ala, amide or is absent;
Xaa.sub.42 (position no. 36 in SEQ ID NO: 2) is Pro, amide or is
absent; Xaa.sub.43 (position no. 37 in SEQ ID NO: 2) is Pro, amide
or is absent; Xaa.sub.44 (position no. 38 in SEQ ID NO: 2) is Pro,
amide or is absent; Xaa.sub.45 (position no. 39 in SEQ ID NO: 2) is
Ser, amide or is absent; Xaa.sub.46 (position no. 40 in SEQ ID NO:
2) is amide or is absent; provided that if Xaa.sub.38, Xaa.sub.39,
Xaa.sub.40, Xaa.sub.41, Xaa.sub.42, Xaa.sub.43, Xaa.sub.44,
Xaa.sub.45 or Xaa.sub.46 (position no. 32 to 40 in SEQ ID NO: 2,
respectively) is absent then each amino acid residue downstream is
also absent.
[0295] The invention furthermore provides additional derivatives,
methods and uses thereof, and pharmaceutical compositions with a
content thereof corresponding to any of the claims and particular
embodiments according to the invention, in which corresponding
position numbering amendments have been made as explained above,
and shown above for the derivative of embodiment 6. For example, in
claims 7-13 of the priority application (above embodiments 7-13)
relating to particular derivatives of the invention in which the
GLP-1 analogue comprises the amino acid sequence of formulas (II,
III, and IV) (SEQ ID NOs. 3, 6, and 7, respectively), the position
numbering may be amended as explained above to refer to the
respective SEQ ID NOs instead of to the formulas.
[0296] Additional embodiments of the invention are: [0297] 8a. A
GLP-1 derivative which comprises the amino acid sequence of the
formula (I):
TABLE-US-00005 [0297] Formula (I) (SE0 ID No: 2)
Xaa.sub.7-Xaa.sub.8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Xaa.sub.16-Ser-
Xaa.sub.18-Xaa.sub.19-Xaa.sub.20-Glu-Xaa.sub.22-Xaa.sub.23-Ala-Xaa.sub.25--
Xaa.sub.26-
Xaa.sub.27-Phe-Ile-Xaa.sub.30-Trp-Leu-Xaa.sub.33-Xaa.sub.34-Xaa.sub.35-
Xaa.sub.36-Xaa.sub.37-Xaa.sub.38-Xaa.sub.39-Xaa.sub.40-Xaa.sub.41-Xaa.sub.-
42-Xaa.sub.43- Xaa.sub.44-Xaa.sub.45-Xaa.sub.46
[0298] wherein [0299] Xaa.sub.7 is L-histidine, D-histidine,
desamino-histidine, 2-amino-histidine, .beta.-hydroxy-histidine,
homohistidine, Na-acetyl-histidine, .alpha.-fluoromethyl-histidine,
.alpha.-methyl-histidine, 2(3H-imidazol-4-yl)acetyl,
3-pyridylalanine, 2-pyridylalanine or 4-pyridylalanine; [0300]
Xaa.sub.8 is Ala, Gly, Val, Leu, Ile, Lys, Aib,
(1-aminocyclopropyl) carboxylic acid, (1-aminocyclobutyl)
carboxylic acid, (1-aminocyclopentyl) carboxylic acid,
(1-aminocyclohexyl) carboxylic acid, (1-aminocycloheptyl)
carboxylic acid, or (1-aminocyclooctyl) carboxylic acid; [0301]
Xaa.sub.16 is Val, or Leu; [0302] Xaa.sub.18 is Ser, Lys, or Arg;
[0303] Xaa.sub.19 is Tyr, or Gln; [0304] Xaa.sub.20 is Leu, Met, or
Lys; [0305] Xaa.sub.22 is Gly, Glu, or Aib; [0306] Xaa.sub.23 is
Gln, Glu, Lys, or Arg; [0307] Xaa.sub.25 is Ala, or Val; [0308]
Xaa.sub.26 is Lys, Glu, or Arg; [0309] Xaa.sub.27 is Glu, or Leu;
[0310] Xaa.sub.30 is Ala, Glu, Lys, or Arg; [0311] Xaa.sub.33 is
Val, Thr(O-benzyl), or Lys; [0312] Xaa.sub.34 is Lys, Glu, Gln,
Asn, or Arg; [0313] Xaa.sub.35 is Gly, Aib, or absent; [0314]
Xaa.sub.36 is Arg, Gly, Lys, or absent; [0315] Xaa.sub.37 is Gly,
Ala, Glu, Pro, Lys, epsilon-amino-Lys, amide or is absent; [0316]
Xaa.sub.38 is Lys, Ser, amide, or is absent; [0317] Xaa.sub.39 is
Ser, Lys, amide, or is absent; [0318] Xaa.sub.40 is Gly, amide, or
is absent; [0319] Xaa.sub.41 is Ala, amide, or is absent; [0320]
Xaa.sub.42 is Pro, amide, or is absent; [0321] Xaa.sub.43 is Pro,
amide, or is absent; [0322] Xaa.sub.44 is Pro, amide, or is absent;
[0323] Xaa.sub.45 is Ser, amide, or is absent; [0324] Xaa.sub.46 is
amide, or is absent; [0325] provided that if Xaa.sub.38,
Xaa.sub.39, Xaa.sub.40, Xaa.sub.41, Xaa.sub.42, Xaa.sub.43,
Xaa.sub.44, Xaa.sub.45 or Xaa.sub.46 is absent then each amino acid
residue downstream is also absent. [0326] 9a. A GLP-1 derivative
which comprises the amino acid sequence of the formula (II):
TABLE-US-00006 [0326] Formula (II) (SE0 ID No: 3)
Xaa.sub.7-Xaa.sub.8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-
Xaa.sub.18-Tyr-Leu-Glu-Xaa.sub.22-Xaa.sub.23-Ala-Ala-Xaa.sub.26-Glu-
Phe-Ile-Xaa.sub.30-Trp-Leu-Val-Xaa.sub.34-Xaa.sub.35-Xaa.sub.36-Xaa.sub.37-
- Xaa.sub.38
[0327] wherein [0328] Xaa.sub.7 is L-histidine, D-histidine,
desamino-histidine, 2-amino-histidine, .beta.-hydroxy-histidine,
homohistidine, N.sup..alpha.-acetyl-histidine,
.alpha.-fluoromethyl-histidine, .alpha.-methyl-histidine,
2(3H-imidazol-4-yl)acetyl, 3-pyridylalanine, 2-pyridylalanine or
4-pyridylalanine; [0329] Xaa.sub.8 is Ala, Gly, Val, Leu, Ile, Lys,
Aib, (1-aminocyclopropyl) carboxylic acid, (1-aminocyclobutyl)
carboxylic acid, (1-aminocyclopentyl) carboxylic acid,
(1-aminocyclohexyl) carboxylic acid, (1-aminocycloheptyl)
carboxylic acid, or (1-aminocyclooctyl) carboxylic acid; [0330]
Xaa.sub.18 is Ser, Lys, or Arg; [0331] Xaa.sub.22 is Gly, Glu, or
Aib; [0332] Xaa.sub.23 is Gln, Glu, Lys, or Arg; [0333] Xaa.sub.26
is Lys, Glu, or Arg; [0334] Xaa.sub.30 is Ala, Glu, Lys, or Arg;
[0335] Xaa.sub.34 is Lys, Glu, Gln, or Arg; [0336] Xaa.sub.35 is
Gly, Aib, or absent; [0337] Xaa.sub.36 is Arg, Lys, or absent;
[0338] Xaa.sub.37 is Gly, Ala, Glu, Pro, Lys, or epsilon-amino-Lys;
[0339] Xaa.sub.38 is Lys, amide, or is absent. [0340] 10a. The
GLP-1 derivative, preferably according to any one of the
embodiments 8a-9a, wherein said GLP-1 analogue comprises the amino
acid sequence of the formula (III) which is derivatised in position
18, 23, 26, 30, 31, 34, 36, 37 or 38:
TABLE-US-00007 [0340] Formula (III) (SE0 ID No: 6)
Xaa.sub.7-Xaa.sub.8-Xaa.sub.9-Gly-Thr-Phe-Thr-Ser-Asp-Xaa.sub.16-Ser-
Xaa.sub.18-Tyr-Leu-Glu-Glu-Xaa.sub.23-Ala-Xaa.sub.25-Arg-Xaa.sub.27-
Phe-Ile-Xaa.sub.30-Trp-Leu-Xaa.sub.33-Xaa.sub.34-Xaa.sub.35-Xaa.sub.36-
Xaa.sub.37-Xaa.sub.38-Xaa.sub.39
[0341] wherein [0342] Xaa.sub.7-Xaa.sub.8 is
2(3H-imidazol-4-yl)acetyl-alanine, L-histidine-Aib,
desamino-histidine-alanine, or desamino-histidine-Aib; [0343]
Xaa.sub.9 is Glu or a Glu derivative such as alpha, alpha
dimethyl-Glu; [0344] Xaa.sub.16 is Val, or Leu; [0345] Xaa.sub.18
is Ser, Lys, or Arg; [0346] Xaa.sub.19 is Tyr, or Gln; [0347]
Xaa.sub.23 is Gln, Glu, Lys, or Arg; [0348] Xaa.sub.25 is Ala, or
Val; [0349] Xaa.sub.27 is Glu, or Leu; [0350] Xaa.sub.30 is Ala,
Glu, Lys, Arg, or absent; [0351] Xaa.sub.33 is Val, Thr(O-benzyl),
or Lys; [0352] Xaa.sub.34 is Lys, Glu, Gln, Asn, or Arg; [0353]
Xaa.sub.35 is Gly, Aib, or absent; [0354] Xaa.sub.36 is Arg, Lys,
or absent; [0355] Xaa.sub.37 is Gly, Aib, Pro, epsilon-amino-Lys,
or absent [0356] Xaa.sub.38 is Lys, Glu, or absent [0357]
Xaa.sub.39 is amide, or is absent; [0358] provided that if
Xaa.sub.37 is absent then Xaa.sub.38 is also absent. [0359] 11a. A
GLP-1 derivative which comprises the amino acid sequence of formula
(IV) which is derivatised with an albumin binding residue in
position 18, 23, 26, 30, 31, 34, 36, 37, or 38:
TABLE-US-00008 [0359] Formula (IV) (SE0 ID No: 7)
Xaa.sub.7-Xaa.sub.8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-
Xaa.sub.18-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Arg-Glu-Phe-Ile-
Xaa.sub.30-Trp-Leu-Xaa.sub.33-Xaa.sub.34-Xaa.sub.35-Xaa.sub.36-Xaa.sub.37--
Xaa.sub.38- Xaa.sub.39
[0360] wherein [0361] Xaa.sub.7 is L-histidine, D-histidine,
desamino-histidine, 2-amino-histidine, .beta.-hydroxy-histidine,
homohistidine, N.sup..alpha.-acetyl-histidine,
.alpha.-fluoromethyl-histidine, .alpha.-methyl-histidine,
2(3H-imidazol-4-yl)acetyl, 3-pyridylalanine, 2-pyridylalanine or
4-pyridylalanine; [0362] Xaa.sub.8 is Ala, Gly, Val, Leu, Ile, Lys,
Aib, (1-aminocyclopropyl) carboxylic acid, (1-aminocyclobutyl)
carboxylic acid, (1-aminocyclopentyl) carboxylic acid,
(1-aminocyclohexyl) carboxylic acid, (1-aminocycloheptyl)
carboxylic acid, or (1-aminocyclooctyl) carboxylic acid; [0363]
Xaa.sub.18 is Ser, Lys or Arg; [0364] Xaa.sub.30 is Ala, Glu, Lys
or Arg; [0365] Xaa.sub.33 is Val or Lys; [0366] Xaa.sub.34 is Lys,
Glu, Gln, or Arg; [0367] Xaa.sub.35 is Gly, Aib, or absent; [0368]
Xaa.sub.36 is Arg, Lys, or absent; [0369] Xaa.sub.37 is Gly, Aib,
Pro, epsilon-amino-Lys, or absent; [0370] Xaa.sub.38 is Lys, or
absent; and [0371] Xaa.sub.39 is amide or is absent. [0372] 12a.
The derivative according to any one of the embodiments 8a-11a,
wherein Xaa.sub.38 is absent. [0373] 13a. The derivative according
to any one of the embodiments 8a-12a, wherein Xaa.sub.37 and
Xaa.sub.38 are both absent. [0374] 14a. The derivative according to
any one of the embodiments 8a-13a, wherein Xaa.sub.7 is
desamino-histidine. [0375] 15a. The derivative according to any one
of the embodiments 8a-14a, wherein Xaa.sub.8 is Aib. [0376] 16a. A
GLP-1 derivative, which is selected from the following: [0377]
N-.epsilon..sup.37{2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(19-carboxynonadeca-
noyl)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)-
ethoxy]ethoxy}acetyl
[desaminoHis.sup.7,Glu.sup.22,Arg.sup.26,Arg.sup.34,Lys.sup.37]GLP-1(7-37-
)amide; [0378]
N-.epsilon..sup.20-{2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(19-carboxynonadec-
anoyl)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino-
)ethoxy]ethoxy}acetyl
[Aib.sup.2,Leu.sup.14,Lys.sup.20,Gln.sup.28,Ser(O-benzyl).sup.39]exendin--
4(1-39)amide; [0379]
N-.epsilon..sup.26{2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(19-carboxynonadeca-
noyl)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)-
ethoxy]ethoxy}acetyl [desaminoHis.sup.7,Arg.sup.34]GLP-1-(7-37);
[0380]
N-epsilon37{2-[2-(2-{2-[2-((S)-3-carboxy-3-{[1-(19-carboxynonadecanoyl)pi-
peridine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethoxy]-
ethoxy}acetyl [Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide;
[0381]
N-epsilon23-[2-(2-[2-(2-[2-(2-((R)-3-[1-(17-Carboxyheptadecanoylamino)pip-
eridin-4-ylcarbonylamino]-3-(carboxypropionylamino)ethoxy)ethoxy]acetylami-
no)ethoxy]ethoxy)acetyl] [Aib8,Arg26,Arg34]GLP-1-(7-37); [0382]
N-epsilon37-[2-(2-[2-(2-[2-(2-((R)-3-[1-(17-Carboxyheptadecanoyl)piperidi-
n-4-ylcarbonylamino]3-carboxypropionylamino)ethoxy)ethoxy]acetylamino)etho-
xy]ethoxy)acetyl] [DesaminoHis 7,Glu22 Arg26,Arg
34,Phe(m-CF3)28]GLP-1-(7-37)amide; [0383]
[DesaminoHis7,Glu22,Arg26,Arg34]GLP-1-(7-37)-Lys(2-{2-[2-(2-{2-[2-((S)-4--
Carboxy-4-{[1-(19-carboxynonadecanoyl)piperidine-4-carbonyl]amino}butyryla-
mino)ethoxy]ethoxy}acetylamino)ethoxy]ethoxy}acetyl); [0384]
N-.epsilon..sup.20({2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(17-carboxyheptade-
canoyl)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamin-
o)ethoxy]ethoxy}acetyl)
[Aib.sup.8,Lys.sup.20,Arg.sup.26,Glu.sup.30,Thr(O-benzyl).sup.33]GLP-1-(7-
-37)amide; [0385]
N-epsilon30{2-[2-(2-{2-[2-((S)-3-carboxy-3-{[1-(19-carboxynonadecanoyl)pi-
peridine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethoxy]-
ethoxy}acetyl [Aib8,Glu22,Arg26,Lys30]GLP-1-(7-37); [0386]
N-epsilon31{2-[2-(2-{2-[2-((S)-3-carboxy-3-{[1-(19-carboxynonadecanoyl)pi-
peridine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethoxy]-
ethoxy}acetyl [Aib8,Glu22,Arg26,Lys 31]GLP-1-(7-37); [0387]
N-.epsilon..sup.20({2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(17-carboxyheptade-
canoyl)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamin-
o)ethoxy]ethoxy}acetyl)
[Aib.sup.8,Lys.sup.20,Arg.sup.26,2-Naphtylalanine.sup.28,
Glu.sup.30]GLP-1(7-37)amide; [0388]
[Aib8,Glu22,Arg26,Arg34]GLP-1-(7-37)Lys[2-(2-[2-(2-[2-(2-((S)-4-[1-[19-Ca-
rboxynonadecanoyl]piperidine-4-carbonylamino]-4-carboxybutyrylamino)ethoxy-
)ethoxy]acetylamino)ethoxy]ethoxy)acetyl]amide; [0389]
N-.epsilon..sup.20({2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(17-carboxyheptade-
canoyl)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamin-
o)ethoxy]ethoxy}acetyl)
[Aib.sup.8,Lys.sup.20,Arg.sup.26,2-Naphtylalanine.sup.12,Glu.sup.30]GLP-1-
-(7-37)amide; [0390]
[DesaminoHis7,Glu22,Arg26,Arg34]GLP-1-(7-37)Lys[2-(2-[2-(2-[2-(2-((S)-4-[-
1-[19-Carboxynonadecanoyl]piperidine-4-carbonylamino]-4-carboxybutyrylamin-
o)ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl]amide [0391]
N-epsilon31-(2-{2-[2-(2-{2-[2-((S)-3-Carboxy-3-{[1-(19-carboxy-nonadecano-
yl)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)et-
hoxy]ethoxy}acetyl) [Aib 8,Glu22,Arg26,Lys31,Arg34]GLP-1-(7-37);
[0392]
N-epsilon26-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonadecanoylamino)meth-
yl]cyclohexanecarbonyl}amino)butyryl][Aib8,Arg34]GLP-1-(7-37);
[0393]
N-epsilon26-{4-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonadecanoylamino)m-
ethyl]cyclohexanecarbonyl}amino)butyrylamino]butyryl}
[Aib8,Arg34]GLP-1-(7-37); [0394]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonadecanoyla-
mino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)acetyl]
[Aib8,Arg34]GLP-1-(7-37); [0395]
N-epsilon26-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-37)-amide;
[0396] N-epsilon
18-{2-(2-(2-(2-[2-(2-[(S)-4-Carboxy-4-({4-[(19-carboxynonadecan-
oylamino)methyl]cyclohexanecarbonyl}amino)butanoylamino]ethoxy)ethoxy]acet-
yl)ethoxy)ethoxy)acetyl} [Aib8,Lys18,Arg26,Arg34]GLP-1(7-37) [0397]
N-.epsilon..sup.20-[2-(2-[2-(2-[2-(2-((S)-4-[trans-4-([19-Carboxynonadeca-
noylamino]methyl)cyclohexylcarbonylamino]-4-carboxybutanoylamino)ethoxy)et-
hoxy]acetylamino)ethoxy]ethoxy)acetyl]
[desaminoHis.sup.1,Lys.sup.20,Ser(O-benzyl).sup.33,Ser(O-benzyl).sup.39]e-
xendin (1-39); [0398]
[Aib8,Glu22,Arg26,Arg34]GLP-1-(7-37)Lys[2-(2-[2-(2-[2-(2-((S)-3-[4-([19-C-
arboxynonadecanoylamino]methyl)cyclohexylcarbonylamino]-3-carboxypropionyl-
amino)ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl]amide; [0399]
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl]
[Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide; [0400]
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide; [0401]
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({4-[(trans-19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37)amide; [0402]
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37); [0403]
[DesaminoHis7,Glu22,Arg26,Arg34]GLP-1-(7-37)Lys[2-(2-{2-[2-(2-{2-[4-Carbo-
xy-4-({trans-4-[(19-carboxynonadecanoylamino)methyl]cyclohexanecarbonyl}am-
ino)butyrylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl]amide;
[0404]
[desaminoHis.sup.7,Arg.sup.26,Arg.sup.34]GLP-1-(7-37)Lys[2-(2-[2-(-
2-[2-(2-((R)-3-[trans-4-((9-Carboxynonadecanoylamino]methyl)cyclohexylcarb-
onylamino]3-carboxypropionylamino)ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)-
acetyl]amide; [0405]
N-epsilon26[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({4-[(19-carboxynonadecanoy-
lamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)acetyla-
mino]ethoxy}ethoxy)acetyl [Aib8,Lys 26]GLP-1 (7-37)amide; [0406]
N-epsilon26[2-(2-[2-(2-[2-(2-((S)-2-[trans-4-((9-Carboxynonadecanoylamino-
]methyl)
cyclohexylcarbonylamino]-4-carboxybutanoylamino)ethoxy)ethoxy]ace-
tylamino)ethoxy]ethoxy)acetyl] [Aib8,Lys26]GLP-1(7-37)amide; [0407]
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37); [0408]
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Glu22,Arg26,Glu30,Arg34,Lys37]GLP-1-(7-37); [0409]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{4-[4-(16-(1H-tetr-
azol-5-yl)-hexadecanoylsulfamoyl)butyrylamino]-butyrylamino}butyrylamino)b-
utyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-37); [0410]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-37);
[0411]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)bu-
tyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-37); [0412]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{4-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]butyrylamino}butyrylamino)but-
yrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-34); [0413]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]-dodecanoylamino}butyrylamin-
o)butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-34);
[0414]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)bu-
tyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-34); [0415]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-35);
[0416]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)bu-
tyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-35); [0417]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)bu-
tyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-36)amide;
[0418]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)bu-
tyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-35); [0419]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Lys33,Arg34]GLP-1-(7-34);
[0420]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-36)amide;
[0421]
N-epsilon26-[2-(2-{2-[2-(2-{2-[2-(2-{2-[2-(2-{2-[2-(2-{2-[2-(2-{2-[(S)-4--
Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tetrazol-5-yl)hexadecanoylsulfam-
oyl)butyrylamino]dodecanoylamino}butyrylamino)butyrylamino]ethoxy}ethoxy)a-
cetylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetylamino]ethoxy}etho-
xy)acetylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl]
[Aib8,Lys26,Arg34]GLP-1-(7-36)amide; [0422]
[Aib8,Glu22,Arg26,Arg34]GLP-1-(7-37)Lys[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-c-
arboxy-4-{12-[4-(16-(1H-tetrazol-5-yl)hexadecanoylsulfamoyl)butyrylamino]d-
odecanoylamino}-butyrylamino)butyrylamino]ethoxy}ethoxy)acetyl]amide;
[0423]
N-epsilon20-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16--
(1H-tetrazol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyr-
ylamino)butyrylamino]ethoxy}ethoxy)acetyl]
[Aib8,Lys20,Glu22,Arg26,Glu30,Pro37]GLP-1-(7-37)amide; [0424]
N-epsilon37-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl]
[Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide; [0425]
N-epsilon37-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide; [0426]
N-epsilon37-[[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-te-
trazol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamin-
o)butyrylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37)amide; [0427]
[Aib8,Glu22,Arg26,Glu30,Pro37]GLP-1-(7-37)Lys[2-(2-{2-[4-Carboxy-4-(4-car-
boxy-4-{4-[4-(16-1H-tetrazol-5-yl-hexadecanoylsulfamoyl)butyrylamino]butyr-
ylamino}butyrylamino)butyrylamino]ethoxy}ethoxy)acetyl]; [0428]
[Aib8,Glu22,Arg26,Glu30,Pro37]GLP-1-((7-37)Lys
(2-(2-(3-(2-(2-(2-(2-(2-(2-(2-(2-(2-(2-(2-(2-[4-(S)-carboxy-4-(4-(S)-carb-
oxy-4-(4-{4-[16-(Tetrazol-5-yl)hexadecanoylsulfamoyl]butanoylamino}butanoy-
lamino) butyrylamino)butyrylamino];
ethoxy)ethoxy)ethoxy)ethoxy)ethoxy)ethoxy)ethoxy)ethoxy)ethoxy)ethoxy)eth-
oxy)ethoxy)propionylamino)ethoxy)ethoxy) peptide; [0429]
N-alpha37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonade-
canoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)ac-
etylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Glu22,Arg26,Arg34,epsilon-Lys37]GLP-1-(7-37); [0430]
N-alpha8-[2-(4-imidazolyl)acetyl]N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Car-
boxy-4-({trans-4-[(19-carboxynonadecanoylamino)methyl]cyclohexanecarbonyl}-
amino)butyrylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl]
[Glu22,Arg26,Arg34,Lys37]GLP-1-(8-37); [0431]
[DesaminoHis7,Glu22,Arg26,34]-GLP-1(7-37)-Lys-(2-{2-[2-((S)-4-carboxy-4-{-
[1-(19-carboxynonadecanoyl)piperidine-4-carbonyl]amino}butyrylamino)ethoxy-
]ethoxy}acetyl) peptide; [0432]
[DesaminoHis7,Glu22,Arg26,34]-GLP-1(7-37)-Lys-[2-(2-{2-[2-(2-{2-[4-Carbox-
y-4-({4-[(19-carboxynonadecanoylamino)methyl]cyclohexanecarbonyl}amino)but-
yrylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl] peptide;
[0433]
[DesaminoHis7,Glu22,Arg26,34]-GLP-1(7-37)-Lys((S)-4-carboxy-4-(2-{2-[2-((-
S)-4-carboxy-4-{[1-(19-carboxynonadecanoyl)piperidine-4-carbonyl]amino}but-
yrylamino)ethoxy]ethoxy}acetylamino)butyryl) peptide; [0434]
[DesaminoHis7,Glu22,Arg26,34]-GLP-1(7-37)-Lys-(2-(2-{2-[(S)-4-carboxy-4-(-
2-{2-[2-((S)-4-carboxy-4-{[1-(19-carboxynonadecanoyl)piperidine-4-carbonyl-
]amino}butyrylamino)ethoxy]ethoxy}acetylamino)butyrylamino]ethoxy}ethoxy)a-
cetyl) peptide; [0435]
[DesaminoHis7,Arg26,34]-GLP-1(7-37)-Lys(2-{2-[2-(2-{2-[2-((S)-4-Carboxy-4-
-{[1-(19-carboxynonadecanoyl)piperidine-4-carbonyl]amino}butyrylamino)etho-
xy]ethoxy}acetylamino)ethoxy]ethoxy}acetyl) peptide;
[0436]
N-epsilon37-(2-{2-[2-(2-{2-[2-((S)-4-Carboxy-4-{[1-(19-carboxynona-
decanoyl)piperidine-4-carbonyl]amino}butyrylamino)ethoxy]ethoxy}acetylamin-
o)ethoxy]ethoxy}acetyl)
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37); [0437]
N-epsilon37-((S)-4-Carboxy-4-{[1-(19-carboxy-nonadecanoyl)-piperid-
ine-4-carbonyl]-amino}-butyryl)
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37); [0438]
[DesaminoHis7,Glu22,Arg26,34]-GLP-1(7-37)-Lys-((S)-4-Carboxy-4-{[1-(19-ca-
rboxy-nonadecanoyl)-piperidine-4-carbonyl]-amino}-butyryl) peptide;
[0439]
N-epsilon26-[2-(2-{2-[(R)-4-Carboxy-4-((R)-4-carboxy-4-{12-[4-(16-1H-tetr-
azol-5-yl-hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino)-
butyrylamino]ethoxy}ethoxy)acetyl]-[Aib8,Arg34]GLP-1(7-37); [0440]
N-epsilon37-{2-[2-(2-{(S)-4-[(S)-4-(12-{4-[16-(2-tert-Butyl-2H-tetrazol-5-
-yl)-hexadecanoylsulfamoyl]butyrylamino}dodecanoylamino)-4-carboxybutyryla-
mino]-4-carboxybutyrylamino}ethoxy)ethoxy]acetyl}
[DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1 (7-37); [0441]
N-epsilon37-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37); [0442]
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl]
[Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37); [0443]
[ImPr.sup.7,Arg.sup.26,34,Glu.sup.22]GLP-1-(7-37)Lys[2-(2-[2-((S)-4-((S)--
4-(12-[4-(16-1H-tetrazol-5-ylhexadecanoylsulfamoyl)butyrylamino]dodecanoyl-
amino)-4-carboxybutyrylamino)-4-carboxybutyrylamino)ethoxy]ethoxy)acetyl]--
amid; [0444]
N-epsilon36-[2-(2-[2-(2-[2-(2-((R)-3-[trans-4-((9-Carboxynonadecanoylamin-
o]methyl)cyclohexylcarbonylamino]3-carboxypropionylamino)ethoxy)ethoxy]ace-
tylamino)ethoxy]ethoxy)acetyl] [Aib8,Glu22,Gln34]GLP-1-(7-37);
[0445]
N-epsilon26-[2-(2-[2-(2-[2-(2-((R)-3-[trans-4-((9-Carboxynonadecanoylamin-
o]methyl)cyclohexylcarbonylamino]3-carboxypropionylamino)ethoxy)ethoxy]ace-
tylamino)ethoxy]ethoxy)acetyl] [Aib8,Glu22,Gln34]GLP-1-(7-37);
[0446] N-epsilon
18-[2-(2-[2-(2-[2-(2-((R)-3-[trans-4-((9-Carboxynonadecanoylami-
no]methyl)cyclohexylcarbonylamino]3-carboxypropionylamino)ethoxy)ethoxy]ac-
etylamino)ethoxy]ethoxy)acetyl]
[Aib8,22,35,Lys18,Arg26,34]GLP-1-(7-37); and [0447] N-epsilon
18-[2-(2-[2-(2-[2-(2-((R)-3-[trans-4-((9-Carboxynonadecanoylamino]methyl)-
cyclohexylcarbonylamino]3-carboxypropionylamino)ethoxy)ethoxy]acetylamino)-
ethoxy]ethoxy)acetyl] [Aib8,Lys18,Glu22,Gln34]GLP-1-(7-37).
ADDITIONAL EMBODIMENTS ACCORDING TO THE INVENTION
[0447] [0448] 1. A peptide derivative comprising a peptide wherein
at least one amino acid residue is derivatized with A-B-C-D- [0449]
wherein A- is
[0449] ##STR00013## [0450] wherein p is selected from the group
consisting of 10, 11, 12, 13 and 14, and d is selected from the
group consisting of 0, 1, 2, 3, 4 and 5, and [0451] -B- is selected
from the group consisting of
[0451] ##STR00014## [0452] wherein x is selected from the group
consisting of 0, 1, 2, 3 and 4, and y is selected from the group
consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 and 12, [0453] or A
is
[0453] ##STR00015## [0454] wherein n is selected from the group
consisting of 14, 15, 16 17, 18 and 19, and B is selected from the
group consisting of
[0454] ##STR00016## [0455] wherein x is selected from the group
consisting of 0, 1, 2, 3 and 4, and [0456] -C- is selected from the
group consisting of
[0456] ##STR00017## [0457] wherein b and e are each independently
selected from the group consisting of 0, 1 and 2, and c and f are
each independently selected from the group consisting of 0, 1 and 2
with the proviso that b is 1 or 2 when c is 0, or b is 0 when c is
1 or 2, and e is 1 or 2 when f is 0, or e is 0 when f is 1 or 2,
and [0458] -D- is attached to said amino acid residue and is a
linker. [0459] 2. The derivative according to embodiment 1, wherein
said peptide is a GLP-1 peptide selected from GLP-1(7-37) and an
analogue of GLP-1(7-37), wherein, in said peptide, at least one
amino acid residue is derivatised with A-B-C-D-. [0460] 3. The
derivative according to any one of embodiments 1-2, wherein the
derivatised amino acid residue comprises an amino group. [0461] 4.
The derivative according to any one of embodiments 1-3, wherein the
derivatised amino acid residue comprises a primary amino group in a
side chain. [0462] 5. The derivative according to any one of
embodiments 1-4, wherein the derivatised amino acid residue is
lysine. [0463] 6. The derivative according to any one of
embodiments 1-5, wherein only one amino acid residue is
derivatised. [0464] 7. The derivative according to any one of
embodiments 1-6, wherein A- is
[0464] ##STR00018## [0465] 8. The derivative according to any of
the embodiments 1-7, wherein n is selected from the group
consisting of 15 and 17, and more preferred is 17. [0466] 9. The
derivative according to any one of the embodiments 1-6, wherein A-
is
[0466] ##STR00019## [0467] 10. The derivative according to any of
the embodiments 1-6 and 9, wherein p is selected from the group
consisting of 12, 13, and 14 and more preferred is 13. [0468] 11.
The derivative according to any of the embodiments 1-6 and 9-10,
wherein d is selected from the group consisting of 0, 1, 2, 3 and
4, more preferred 0, 1 and 2 and most preferred 1. [0469] 12. The
derivative according to any of the embodiments 1-6 and 9-11,
wherein d is selected from the group consisting of 0, 1 and 2 and p
is selected from the group consisting of 12, 13 or 14, more
preferred d is selected from the group consisting of 1 and 2 and p
is selected from the group consisting of 13 and 14, and most
preferred d is 1 and p is 13. [0470] 13. The derivative according
to any of the embodiments 1-12, wherein -B- is
[0470] ##STR00020## [0471] 14. The derivative according to any of
the embodiments 1-12, wherein -B- is
[0471] ##STR00021## [0472] 15. The derivative according to any of
the embodiments 1-12, wherein -B- is
[0472] ##STR00022## [0473] 16. The derivative according to any of
the embodiments 1-12, wherein -B- is
[0473] ##STR00023## [0474] 17. The derivative according to any of
the embodiments 1-12 and 16, wherein x is selected from the group
consisting of 0, 1 and 2, more preferred x is selected from the
group consisting of 0 and 1 and most preferred x is 1. [0475] 18.
The derivative according to any of the embodiments 1-6 and 9-12,
wherein -B- is
[0475] ##STR00024## [0476] 19. The derivative according to any of
the embodiments 1-6 and 9-13, wherein y is selected from the group
consisting of 2, 3, 4, 5, 6, 7, 8, 9 and 10 and more preferred y is
selected from the group consisting of 2, 3, 4, 5, 6, 7, and 8.
[0477] 20. The derivative according to any of the embodiments 1-19,
wherein -C- is
[0477] ##STR00025## [0478] 21. The derivative according to
embodiment 20, wherein c is selected from the group consisting of 0
and 1 and b is selected from the group consisting of 1 and 2, more
preferred b is 1 and c is 0. [0479] 22. The derivative according to
any of the embodiments 1-19, wherein -C- is
[0479] ##STR00026## [0480] 23. The derivative according to
embodiment 22, wherein f is selected from the group consisting of 0
and 1 and e is selected from the group consisting of 1 and 2, more
preferred e is 1 and f is 0. [0481] 24. The derivative according to
any of the embodiments 1-19, wherein -C- is
[0481] ##STR00027## [0482] 25. The derivative according to any of
the embodiments 1-24, wherein D is selected from the group
consisting of
[0482] ##STR00028## [0483] wherein k is selected from the group
consisting of 0, 1, 2, 3, 4, 5, 11 and 27, and m is selected from
the group consisting of 0, 1, 2, 3, 4, 5 and 6, and D is attached
to the amino acid residue in the end depicted with *. [0484] 26.
The derivative according to any of the embodiments 1-25, wherein
-D- is
[0484] ##STR00029## [0485] 27. The derivative according to any of
the embodiments 25-26, wherein k is selected from the group
consisting of 1, 2, 3, 11 and 27 and more preferred k is 1. [0486]
28. The derivative according to any of the embodiments 25-27,
wherein m is selected from the group consisting of 0, 1, 2, 3, and
4 and more preferred m is selected from the group consisting of 0,
1 and 2. [0487] 29. The derivative according to embodiment 29,
wherein m is selected from the group consisting of 0, 1, 2, 3, and
4 and more preferred m is selected from the group consisting of 0,
1 and 2. [0488] 30. The derivative according to any of the
embodiments 1-25, wherein -D- is
[0488] ##STR00030## [0489] 31. The derivative according to
embodiment 31, wherein m is selected from the group consisting of
0, 1, 2, 3, and 4 and more preferred m is selected from the group
consisting of 0, 1 and 2. [0490] 32. The derivative according to
any of the embodiments 1-25, wherein -D- is
[0490] ##STR00031## [0491] 33. The derivative according to
embodiment 33, wherein m is selected from the group consisting of
0, 1, 2, 3, and 4 and more preferred m is selected from the group
consisting of 0, 1 and 2. [0492] 34. The derivative according to
any of the embodiments 1-25, wherein -D- is
[0492] ##STR00032## [0493] 35. The derivative according to
embodiment 35, wherein m is selected from the group consisting of
0, 1, 2, 3, and 4 and more preferred m is selected from the group
consisting of 0, 1 and 2. [0494] 36. A derivative according to any
of the embodiments 1-25, wherein -D- is
[0494] ##STR00033## [0495] 37. The derivative according to
embodiment 37, wherein m is selected from the group consisting of
0, 1, 2, 3, and 4 and more preferred m is selected from the group
consisting of 0, 1 and 2. [0496] 38. The derivative according to
any of the embodiments 1-38, wherein A-B-C-D- is selected and
combined from
[0496] ##STR00034## [0497] 39. The derivative according to any of
the embodiments 1-38, wherein A-B-C-D- is selected and combined
from
[0497] ##STR00035## ##STR00036## [0498] 40. The derivative
according to any of the embodiments 1-40, wherein A-B-C-D- is
selected from the group consisting of
[0498] ##STR00037## ##STR00038## [0499] 41. The derivative
according to any one of the above embodiments, wherein said GLP-1
analogue comprises the amino acid sequence of the formula (I):
TABLE-US-00009 [0499] Formula (I) (SE0 ID No: 2)
Xaa.sub.7-Xaa.sub.8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Xaa.sub.16-Ser-
Xaa.sub.18-Xaa.sub.19-Xaa.sub.20-Glu-Xaa.sub.22-Xaa.sub.23-Ala-Xaa.sub.25--
Xaa.sub.26-
Xaa.sub.27-Phe-Ile-Xaa.sub.30-Trp-Leu-Xaa.sub.33-Xaa.sub.34-Xaa.sub.35-
Xaa.sub.36-Xaa.sub.37-Xaa.sub.38-Xaa.sub.39-Xaa.sub.40-Xaa.sub.41-Xaa.sub.-
42-Xaa.sub.43- Xaa.sub.44-Xaa.sub.45-Xaa.sub.46
[0500] wherein [0501] Xaa.sub.7 is L-histidine, D-histidine,
desamino-histidine, 2-amino-histidine, .beta.-hydroxy-histidine,
homohistidine, N.alpha.-acetyl-histidine,
.alpha.-fluoromethyl-histidine, .alpha.-methyl-histidine,
3-pyridylalanine, 2-pyridylalanine or 4-pyridylalanine; [0502]
Xaa.sub.8 is Ala, Gly, Val, Leu, Ile, Lys, Aib,
(1-aminocyclopropyl) carboxylic acid, (1-aminocyclobutyl)
carboxylic acid, (1-aminocyclopentyl) carboxylic acid,
(1-aminocyclohexyl) carboxylic acid, (1-aminocycloheptyl)
carboxylic acid, or (1-aminocyclooctyl) carboxylic acid; [0503]
Xaa.sub.16 is Val or Leu; [0504] Xaa.sub.18 is Ser, Lys or Arg;
[0505] Xaa.sub.19 is Tyr or Gln; [0506] Xaa.sub.20 is Leu, Met or
Lys; [0507] Xaa.sub.22 is Gly, Glu or Aib; [0508] Xaa.sub.23 is
Gln, Glu, Lys or Arg; [0509] Xaa.sub.25 is Ala or Val; [0510]
Xaa.sub.26 is Lys, Glu or Arg; [0511] Xaa.sub.27 is Glu or Leu;
[0512] Xaa.sub.30 is Ala, Glu, Lys or Arg; [0513] Xaa.sub.33 is Val
or Lys; [0514] Xaa.sub.34 is Lys, Glu, Asn or Arg; [0515]
Xaa.sub.35 is Gly or Aib; [0516] Xaa.sub.36 is Arg, Gly or Lys;
[0517] Xaa.sub.37 is Gly, Ala, Glu, Pro, Lys, amide or is absent;
[0518] Xaa.sub.38 is Lys, Ser, amide or is absent. [0519]
Xaa.sub.39 is Ser, Lys, amide or is absent; [0520] Xaa.sub.40 is
Gly, amide or is absent; [0521] Xaa.sub.41 is Ala, amide or is
absent; [0522] Xaa.sub.42 is Pro, amide or is absent; [0523]
Xaa.sub.43 is Pro, amide or is absent; [0524] Xaa.sub.44 is Pro,
amide or is absent; [0525] Xaa.sub.45 is Ser, amide or is absent;
[0526] Xaa.sub.46 is amide or is absent; [0527] provided that if
Xaa.sub.38, Xaa.sub.39, Xaa.sub.40, Xaa.sub.41, Xaa.sub.42,
Xaa.sub.43, Xaa.sub.44, Xaa.sub.45 or Xaa.sub.46 is absent then
each amino acid residue downstream is also absent. [0528] 42. The
derivative according to any one of the above embodiments, wherein
said GLP-1 analogue comprises the amino acid sequence of the
formula (II):
TABLE-US-00010 [0528] Formula (II) (SE0 ID No: 3)
Xaa.sub.7-Xaa.sub.8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-
Xaa.sub.18-Tyr-Leu-Glu-Xaa.sub.22-Xaa.sub.23-Ala-Ala-Xaa.sub.26-Glu-
Phe-Ile-Xaa.sub.30-Trp-Leu-Val-Xaa.sub.34-Xaa.sub.35-Xaa.sub.36-Xaa.sub.37-
- Xaa.sub.38
[0529] wherein [0530] Xaa.sub.7 is L-histidine, D-histidine,
desamino-histidine, 2-amino-histidine, .beta.-hydroxy-histidine,
homohistidine, N.sup..alpha.-acetyl-histidine,
.alpha.-fluoromethyl-histidine, .alpha.-methyl-histidine,
3-pyridylalanine, 2-pyridylalanine or 4-pyridylalanine; [0531]
Xaa.sub.8 is Ala, Gly, Val, Leu, Ile, Lys, Aib,
(1-aminocyclopropyl) carboxylic acid, (1-aminocyclobutyl)
carboxylic acid, (1-aminocyclopentyl) carboxylic acid,
(1-aminocyclohexyl) carboxylic acid, (1-aminocycloheptyl)
carboxylic acid, or (1-aminocyclooctyl) carboxylic acid; [0532]
Xaa.sub.18 is Ser, Lys or Arg; [0533] Xaa.sub.22 is Gly, Glu or
Aib; [0534] Xaa.sub.23 is Gln, Glu, Lys or Arg; [0535] Xaa.sub.26
is Lys, Glu or Arg; [0536] Xaa.sub.30 is Ala, Glu, Lys or Arg;
[0537] Xaa.sub.34 is Lys, Glu or Arg; [0538] Xaa.sub.35 is Gly or
Aib; [0539] Xaa.sub.36 is Arg or Lys; [0540] Xaa.sub.37 is Gly,
Ala, Glu or Lys; [0541] Xaa.sub.38 is Lys, amide or is absent.
[0542] 43. The derivative according to any one of the above
embodiments, wherein said GLP-1 peptide is GLP-1(A-B) wherein A is
an integer from 1 to 7 and B is an integer from 38 to 45, and
optionally have one or more substitutions, which GLP-1 peptide is
derivatised via a hydrophilic spacer to the C-terminal amino acid
residue and, optionally, also derivatised to one of the other amino
acid residues. [0543] 44. The derivative to any one of the above
embodiments, wherein said GLP-1 peptide is selected from
GLP-1(7-35), GLP-1(7-36), GLP-1(7-36)-amide, GLP-1(7-37),
GLP-1(7-38), GLP-1(7-39), GLP-1(7-40), and GLP-1(7-41), and
optionally have one or more substitutions. [0544] 45. The
derivative according to any of the embodiments 1-45, which is a
derivative of GLP-1(7-37) (SEQ ID No 1). [0545] 46. The derivative
according to any of the embodiments 1-45, which is a derivative of
an analogue of GLP-1(7-37) (SEQ ID No 1). [0546] 47. The derivative
according embodiment 47, wherein said GLP-1 analogue comprises no
more than fifteen amino acid residues which have been substituted,
added or deleted as compared to GLP-1(7-37) (SEQ ID No. 1). [0547]
48. The derivative according to embodiment 47, wherein said GLP-1
analogue comprises no more than ten amino acid residues which have
been substituted, added or deleted as compared to GLP-1(7-37) (SEQ
ID No. 1). [0548] 49. The derivative according to embodiment 47,
wherein said GLP-1 analogue comprises no more than six amino acid
residues which have been substituted, added or deleted as compared
to GLP-1(7-37) (SEQ ID No. 1). [0549] 50. The derivative according
to embodiment 47, wherein said GLP-1 analogue comprises no more
than four amino acid residues which have been substituted, added or
deleted as compared to GLP-1(7-37) (SEQ ID No. 1). [0550] 51. The
derivative according to embodiment 51, wherein said GLP-1 analogue
comprises no more than 4 amino acid residues which are not encoded
by the genetic code. [0551] 52. The derivative according to
embodiment 47, wherein said GLP-1 analogue comprises no more than 3
amino acid residues which have been substituted, added or deleted
as compared to GLP-1(7-37) (SEQ ID No. 1). [0552] 53. The
derivative according to embodiment 53, wherein said GLP-1 analogue
comprises no more than 3 amino acid residues which are not encoded
by the genetic code. [0553] 54. The derivative according to any one
of the above embodiments, wherein said GLP-1 peptide comprises only
one lysine residue which has been derivatised. [0554] 55. The
derivative according to any one of the above embodiments, wherein
said GLP-1 peptide is a DPPIV protected GLP-1 peptide. [0555] 56.
The derivative according to any one of the above embodiments,
wherein said GLP-1 peptide is DPPIV stabilised. [0556] 57. The
derivative according to any one of the above embodiments, wherein
said GLP-1 peptide comprises an Aib residue in position 8. [0557]
58. The derivative according to any one of the above embodiments,
wherein the amino acid residue in position 7 of said GLP-1 peptide
is selected from the group consisting of D-histidine,
desamino-histidine, 2-amino-histidine, .beta.-hydroxy-histidine,
homohistidine, N.alpha.-acetyl-histidine,
.alpha.-fluoromethyl-histidine, .alpha.-methyl-histidine,
3-pyridylalanine, 2-pyridylalanine and 4-pyridylalanine. [0558] 59.
The derivative according to any one of the above embodiments,
wherein said GLP-1 peptide is selected from the group consisting of
Arg.sup.34GLP-1(7-37), Lys.sup.38Arg.sup.26,34GLP-1(7-38),
Lys.sup.38Arg.sup.26,34GLP-1(7-38)-OH,
Lys.sup.36Arg.sup.26,34GLP-1(7-36), Aib.sup.8,22,35GLP-1(7-37),
Aib.sup.8,35GLP-1(7-37), Aib.sup.8,22GLP-1(7-37),
Aib.sup.8,22,35Arg.sup.26,34LyS.sup.38GLP-1(7-38),
Aib.sup.8,35Arg.sup.26,34Lys.sup.38GLP-1(7-38),
Aib.sup.8,22Arg.sup.26,34Lys.sup.38GLP-1(7-38),
Aib.sup.8,22,35Arg.sup.26,34Lys.sup.38GLP-1(7-38),
Aib.sup.8,35Arg.sup.26,34Lys.sup.38GLP-1(7-38),
Aib.sup.8,22,35Arg.sup.26LyS.sup.38GLP-1(7-38),
Aib.sup.8,35Arg.sup.26LyS.sup.38GLP-1(7-38),
Aib.sup.8,22Arg.sup.26Lys.sup.38GLP-1(7-38),
Aib.sup.8,22,35Arg.sup.34LyS.sup.38GLP-1(7-38),
Aib.sup.8,35Arg.sup.34Lys.sup.38GLP-1(7-38),
Aib.sup.8,22Arg.sup.34Lys.sup.38GLP-1(7-38),
Aib.sup.8,22,35Ala.sup.37Lys.sup.38GLP-1(7-38),
Aib.sup.8,35Ala.sup.37Lys.sup.38GLP-1(7-38),
Aib.sup.8,22Ala.sup.37Lys.sup.38GLP-1(7-38),
Aib.sup.8,22,35Lys.sup.37GLP-1(7-37),
Aib.sup.8,35Lys.sup.37GLP-1(7-37) and
Aib.sup.8,22Lys.sup.37GLP-1(7-38). [0559] 60. The derivative
according to any one of the above embodiments, wherein said GLP-1
peptide is exendin-4 (SEQ ID NO 4). [0560] 61. The derivative
according to any one of the above embodiments, wherein said GLP-1
peptide is ZP-10, i.e.
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-amide (SEQ ID NO 5).
[0561] 62. The derivative according to any one of the above
embodiments, wherein said GLP-1 peptide is
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGX, wherein X=P or Y, or a fragment or
an analogue thereof. [0562] 63. The derivative according to any one
of the above embodiments, wherein said GLP-1 peptide is Arg18,
Leu20, Gln34, Lys33
(N.epsilon.-(.gamma.-aminobutyroyl(N.alpha.-hexadecanoyl)))
Exendin-4-(7-45)-amide or Arg33, Leu20, Gln34, Lys18
(N.epsilon.-(.gamma.-aminobutyroyl(N.alpha.-hexadecanoyl)))
Exendin-4-(7-45)-amide. [0563] 64. The derivative according to any
one of the above embodiments, wherein said GLP-1 analogue comprises
the amino acid sequence of the formula (III) which is derivatised
in position 18, 23, 34, 36, 37 or 38:
TABLE-US-00011 [0563] Formula (III) (SE0 ID No: 6)
Xaa.sub.7-Xaa.sub.8-Xaa.sub.9-Gly-Thr-Phe-Thr-Ser-Asp-Xaa.sub.16-Ser-
Xaa.sub.18-Tyr-Leu-Glu-Glu-Xaa.sub.23-Ala-Xaa.sub.25-Arg-Xaa.sub.27-
Phe-Ile-Xaa.sub.30-Trp-Leu-Xaa.sub.33-Xaa.sub.34-Xaa.sub.35-Xaa.sub.36-
Xaa.sub.37-Xaa.sub.38-Xaa.sub.39
[0564] wherein [0565] Xaa.sub.7-Xaa.sub.8 is L-histidine-Aib,
desamino-histidine-alanine or desamino-histidine-Aib [0566]
Xaa.sub.9 is Glu or a Glu derivative such as alpha,alpha
dimethyl-Glu [0567] Xaa.sub.16 is Val or Leu; [0568] Xaa.sub.18 is
Ser, Lys, or Arg; [0569] Xaa.sub.19 is Tyr or Gln; [0570]
Xaa.sub.23 is Gln, Glu, Lys or Arg; [0571] Xaa.sub.25 is Ala or
Val; [0572] Xaa.sub.27 is Glu or Leu; [0573] Xaa.sub.30 is Ala,
Glu, Lys, Arg or absent; [0574] Xaa.sub.33 is Val, or Lys; [0575]
Xaa.sub.34 is Lys, Glu, Asn or Arg; [0576] Xaa.sub.35 is Gly or
Aib; [0577] Xaa.sub.36 is Arg or Lys, [0578] Xaa.sub.37 is Gly, Aib
or absent [0579] Xaa.sub.38 is Lys, Glu or absent [0580] Xaa.sub.39
is amide or is absent; [0581] provided that if Xaa.sub.37 is absent
then Xaa.sub.38 is also absent. [0582] 65. The derivative according
to any one of the above embodiments, wherein the GLP-1 peptide
comprises the amino acid sequence of formula (IV) which is
derivatised with an albumin binding residue in position 18, 23, 34,
36, 37 or 38:
TABLE-US-00012 [0582] Formula (IV) (SE0 ID No: 7)
Xaa.sub.7-Xaa.sub.8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-
Xaa.sub.18-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Arg-Glu-Phe-Ile-
Xaa.sub.30-Trp-Leu-Xaa.sub.33-Xaa.sub.34-Xaa.sub.35-Xaa.sub.36-Xaa.sub.37--
Xaa.sub.38- Xaa.sub.39
[0583] wherein [0584] Xaa.sub.7 is L-histidine, D-histidine,
desamino-histidine, 2-amino-histidine, .beta.-hydroxy-histidine,
homohistidine, N.sup..alpha.-acetyl-histidine,
.alpha.-fluoromethyl-histidine, .alpha.-methyl-histidine,
3-pyridylalanine, 2-pyridylalanine or 4-pyridylalanine; [0585]
Xaa.sub.8 is Ala, Gly, Val, Leu, Ile, Lys, Aib,
(1-aminocyclopropyl) carboxylic acid, (1-aminocyclobutyl)
carboxylic acid, (1-aminocyclopentyl) carboxylic acid,
(1-aminocyclohexyl) carboxylic acid, (1-aminocycloheptyl)
carboxylic acid, or (1-aminocyclooctyl) carboxylic acid; [0586]
Xaa.sub.18 is Ser, Lys or Arg; [0587] Xaa.sub.30 is Ala, Glu, Lys
or Arg; [0588] Xaa33 is Val or Lys; [0589] Xaa34 is Lys, Glu or
Arg; [0590] Xaa35 is Gly or Aib; [0591] Xaa36 is Arg or Lys, [0592]
Xaa37 is Gly, Aib or absent, [0593] Xaa38 is Lys or absent, and
[0594] Xaa39 is amide or is absent. [0595] 66. The derivative
according to any one of the above embodiments 65-66, wherein
Xaa.sub.38 is absent. [0596] 67. The derivative according to any
one of the above embodiments 65-67, wherein Xaa.sub.37 and
Xaa.sub.38 are both absent. [0597] 68. The derivative according to
any one of the above embodiments 65-68, wherein 2 amino acids are
substituted compared to GLP-1(7-37). [0598] 69. The derivative
according to any one of the above embodiments 65-68, wherein 3
amino acids are substituted compared to GLP-1(7-37). [0599] 70. The
derivative according to any one of the above embodiments 65-68,
wherein 4 amino acids are substituted compared to GLP-1(7-37).
[0600] 71. The derivative according to any one of the above
embodiments 65-68, wherein 5 amino acids are substituted compared
to GLP-1(7-37). [0601] 72. The derivative according to any one of
the above embodiments 65-68, wherein 6 amino acids are substituted
compared to GLP-1(7-37). [0602] 73. The derivative according to any
one of the above embodiments 65-73, wherein Xaa.sub.7 is
desamino-histidine. [0603] 74. The derivative according to any one
of the above embodiments 65-74, wherein Xaa.sub.8 is Aib [0604] 75.
The derivative according to any of the above embodiments, which is
selected from the group consisting of [0605]
N-epsilon37{2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(19-carboxynonadecanoyl)pi-
peridine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethoxy]-
ethoxy}acetyl
[desaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1(7-37)amide; [0606]
N-epsilon20-{2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(19-carboxynonadec-
anoyl)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino-
)ethoxy]ethoxy}acetyl
[Aib2,Leu14,Lys20,Gln28,Ser(O-Benzyl)39]exendin-4 (1-39)amide;
[0607]
N-epsilon26{2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(19-carboxynonadecanoyl)pi-
peridine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethoxy]-
ethoxy}acetyl [desaminoHis7,Arg34]GLP-1-(7-37); [0608]
N-epsilon37{2-[2-(2-{2-[2-((S)-3-carboxy-3-{[1-(19-carboxynonadecanoyl)pi-
peridine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethoxy]-
ethoxy}acetyl [Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide;
[0609]
N-epsilon23-[2-(2-[2-(2-[2-(2-((R)-3-[1-(17-Carboxyheptadecanoylamino)pip-
eridin-4-ylcarbonylamino]-3-(carboxypropionylamino)ethoxy)ethoxy]acetylami-
no)ethoxy]ethoxy)acetyl] [Aib8,Arg 26,Arg34]GLP-1-(7-37); [0610]
N-epsilon37-[2-(2-[2-(2-[2-(2-((R)-3-[1-(17-Carboxyheptadecanoyl)piperidi-
n-4-ylcarbonylamino]3-carboxypropionylamino)ethoxy)ethoxy]acetylamino)etho-
xy]ethoxy)acetyl] [DesaminoHis7,Glu22 Arg26,Arg
34,Phe(m-CF3)28]GLP-1-(7-37)amide; [0611]
[DesaminoHis7,Glu22,Arg26,Arg34]GLP-1-(7-37)-Lys(2-{2-[2-(2-{2-[2-((S)-4--
Carboxy-4-{[1-(19-carboxynonadecanoyl)piperidine-4-carbonyl]amino}butyryla-
mino)ethoxy]ethoxy}acetylamino)ethoxy]ethoxy}acetyl); [0612]
N-epsilon20({2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(17-carboxyheptadecanoyl)-
piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethox-
y]ethoxy}acetyl)
[Aib8,Lys20,Arg26,Glu30,Thr(O-benzyl)33]GLP-1-(7-37) amide [0613]
N-epsilon30{2-[2-(2-{2-[2-((S)-3-carboxy-3-{[1-(19-carboxynonadecanoyl)pi-
peridine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethoxy]-
ethoxy}acetyl [Aib8,Glu22,Arg26,Lys30]GLP-1-(7-37); [0614]
N-epsilon31{2-[2-(2-{2-[2-((S)-3-carboxy-3-{[1-(19-carboxynonadecanoyl)pi-
peridine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethoxy]-
ethoxy}acetyl [Aib8,Glu22,Arg26,Lys 31]GLP-1-(7-37); [0615]
N-epsilon20({2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(17-carboxyheptadecanoyl)-
piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethox-
y]ethoxy}acetyl)
[Aib8,Lys20,Arg26,2-Naphtylalanine28,Glu30]GLP-1(7-37)amide; [0616]
[Aib8,Glu22,Arg26,Arg34]GLP-1-(7-37)Lys[2-(2-[2-(2-[2-(2-((S)-4-[1-[19-Ca-
rboxynonadecanoyl]piperidine-4-carbonylamino]-4-carboxybutyrylamino)ethoxy-
)ethoxy]acetylamino)ethoxy]ethoxy)acetyl]amide; [0617]
N-epsilon20({2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(17-carboxyheptadecanoyl)-
piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethox-
y]ethoxy}acetyl) [Aib8,Lys20,Arg
26,2-Naphtylalanine12,Glu30]GLP-1-(7-37)amide; [0618]
[DesaminoHis7,Glu22,Arg26,Arg34]GLP-1-(7-37)Lys[2-(2-[2-(2-[2-(2-((S)-4-[-
1-[19-Carboxynonadecanoyl]piperidine-4-carbonylamino]-4-carboxybutyrylamin-
o)ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl]amide; [0619]
N-epsilon31-(2-{2-[2-(2-{2-[2-((S)-3-Carboxy-3-{[1-(19-carboxynonadecanoy-
l)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)eth-
oxy]ethoxy}acetyl)[Aib8,Glu22,Arg26,Lys31,Arg34]GLP-1-(7-37);
[0620]
N-epsilon26-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonadecanoylamino)meth-
yl]cyclohexanecarbonyl}amino)butyryl][Aib8,Arg34]GLP-1-(7-37);
[0621]
N-epsilon26-{4-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonadecanoylamino)m-
ethyl]cyclohexanecarbonyl}amino)butyrylamino]butyryl}[Aib8,Arg34]GLP-1-(7--
37); [0622]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonadecanoyla-
mino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)acetyl]
[Aib8,Arg34]GLP-1-(7-37); [0623]
N-epsilon26-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-37)amide;
[0624]
N-epsilon18-{2-(2-(2-(2-[2-(2-[(S)-4-Carboxy-4-({4-[(19-carboxynonadecano-
ylamino)methyl]cyclohexanecarbonyl}amino)butanoylamino]ethoxy)ethoxy]acety-
l)ethoxy)ethoxy)acetyl} [Aib8,Lys18,Arg26,Arg34]GLP-1(7-37); [0625]
N-epsilon20-[2-(2-[2-(2-[2-(2-((S)-4-[trans-4-([19-Carboxynonadecanoylami-
no]methyl)cyclohexylcarbonylamino]-4-carboxybutanoylamino)ethoxy)ethoxy]ac-
etylamino)ethoxy]ethoxy)acetyl][desaminoHis1,Lys20,Ser(O-benzyl)33,Ser(O-b-
enzyl)33]exendin (1-39); [0626]
[Aib8,Glu22,Arg26,Arg34]GLP-1-(7-37)Lys[2-(2-[2-(2-[2-(2-((S)-3-[4-([19-C-
arboxynonadecanoylamino]methyl)cyclohexylcarbonylamino]-3-carboxypropionyl-
amino)ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl]amide; [0627]
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl]
[Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide; [0628]
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide; [0629]
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({4-[(trans-19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37)amide; [0630]
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37); [0631]
[DesaminoHis7,Glu22,Arg26,Arg34]GLP-1-(7-37)Lys[2-(2-{2-[2-(2-{2-[4-Carbo-
xy-4-({trans-4-[(19-carboxynonadecanoylamino)methyl]cyclohexanecarbonyl}am-
ino)butyrylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl]amide;
[0632]
[desaminoHis7,Arg26,Arg34]GLP-1-(7-37)Lys[2-(2-[2-(2-[2-(2-((R)-3--
[trans-4-((9-Carboxynonadecanoylamino]methyl)cyclohexylcarbonylamino]3-car-
boxypropionylamino)ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl]amide;
[0633]
N-epsilon26[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl[Aib8,Lys 26]GLP-1(7-37)amide;
[0634]
N-epsilon26[2-(2-[2-(2-[2-(2-((S)-2-[trans-4-((9-Carboxynonadecanoylamino-
]methyl)cyclohexylcarbonylamino]-4-carboxybutanoylamino)ethoxy)ethoxy]acet-
ylamino)ethoxy]ethoxy)acetyl] [Aib8,Lys26]GLP-1(7-37)amide; [0635]
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37); [0636]
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Glu22,Arg26,Glu30,Arg34,Lys37]GLP-1-(7-37); [0637]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{4-[4-(16-(1H-tetr-
azol-5-yl)-hexadecanoylsulfamoyl)butyrylamino]-butyrylamino}butyrylamino)b-
utyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-37); [0638]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-37);
[0639]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)bu-
tyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-37); [0640]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{4-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]butyrylamino}butyrylamino)but-
yrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-34); [0641]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]-dodecanoylamino}butyrylamin-
o)butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-34);
[0642]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)bu-
tyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-34); [0643]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-35);
[0644]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)bu-
tyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-35); [0645]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)bu-
tyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-36)amide;
[0646]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)bu-
tyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-35); [0647]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Lys33,Arg34]GLP-1-(7-34);
[0648]
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-36)amide;
[0649]
N-epsilon26-[2-(2-{2-[2-(2-{2-[2-(2-{2-[2-(2-{2-[2-(2-{2-[2-(2-{2-[(S)-4--
Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tetrazol-5-yl)hexadecanoylsulfam-
oyl)butyrylamino]dodecanoylamino}butyrylamino)butyrylamino]ethoxy}ethoxy)a-
cetylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetylamino]ethoxy}etho-
xy)acetylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl]
[Aib8,Lys26,Arg34]GLP-1-(7-36)amide; [0650]
[Aib8,Glu22,Arg26,Arg34]GLP-1-(7-37)Lys[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-c-
arboxy-4-{12-[4-(16-(1H-tetrazol-5-yl)hexadecanoylsulfamoyl)butyrylamino]d-
odecanoylamino}-butyrylamino)butyrylamino]ethoxy}ethoxy)acetyl]amide;
[0651]
N-epsilon20-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16--
(1H-tetrazol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyr-
ylamino)butyrylamino]ethoxy}ethoxy)acetyl]
[Aib8,Lys20,Glu22,Arg26,Glu30,Pro37]GLP-1-(7-37)amide; [0652]
N-epsilon37-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl]
[Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide; [0653]
N-epsilon37-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide; [0654]
N-epsilon37-[[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-te-
trazol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamin-
o)butyrylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37)amide; [0655]
[Aib8,Glu22,Arg26,Glu30,Pro37]GLP-1-(7-37)Lys[2-(2-{2-[4-Carboxy-4-(4-car-
boxy-4-{4-[4-(16-1H-tetrazol-5-yl-hexadecanoylsulfamoyl)butyrylamino]butyr-
ylamino}butyrylamino)butyrylamino]ethoxy}ethoxy)acetyl]; and [0656]
[Aib8,Glu22,Arg26,Glu30,Pro37]GLP-1-((7-37)Lys
(2-(2-(3-(2-(2-(2-(2-(2-(2-(2-(2-(2-(2-(2-(2-[4-(S)-carboxy-4-(4-(S)-carb-
oxy-4-(4-{4-[16-(Tetrazol-5-yl)hexadecanoylsulfamoyl]butanoylamino}butanoy-
lamino)
butyrylamino)butyrylamino]ethoxy)ethoxy)ethoxy)ethoxy)ethoxy)ethox-
y)ethoxy)ethoxy)ethoxy)ethoxy)ethoxy)ethoxy)propionylamino)ethoxy)ethoxy)
peptide. [0657] 76. A method for increasing the time of action in a
patient of a GLP-1 peptide, characterised in that a GLP-1(7-37)
peptide or an analogue thereof is derivatised with A-B-C-D- as
disclosed in any of the preceding embodiments. [0658] 77. A method
for increasing the time of action in a patient of a GLP-1 peptide
to more than about 40 hours, characterised in that a GLP-1(7-37)
peptide or an analogue thereof is derivatised with A-B-C-D- as
disclosed in any of the preceding embodiments. [0659] 78. A
pharmaceutical composition comprising a derivative according to any
one of embodiments 1-76, and a pharmaceutically acceptable
excipient. [0660] 79. The pharmaceutical composition according to
embodiment 1-76, which is suited for parenteral administration.
[0661] 80. Use of a derivative according to any one of the
embodiments 1-76 for the preparation of a medicament. [0662] 81.
Use of a derivative according to any one of the embodiments 1-76
for the preparation of a medicament for the treatment or prevention
of hyperglycemia, type 2 diabetes, impaired glucose tolerance, type
1 diabetes, obesity, hypertension, syndrome X, dyslipidemia,
cognitive disorders, atheroschlerosis, myocardial infarction,
coronary heart disease and other cardiovascular disorders, stroke,
inflammatory bowel syndrome, dyspepsia and gastric ulcers.
[0663] 82. Use of a derivative according to any one of the
embodiments 1-76 for the preparation of a medicament for delaying
or preventing disease progression in type 2 diabetes. [0664] 83.
Use of a derivative according to any one of the embodiments 1-76
for the preparation of a medicament for decreasing food intake,
decreasing .beta.-cell apoptosis, increasing .beta.-cell function
and .beta.-cell mass, and/or for restoring glucose sensitivity to
.beta.-cells. [0665] 84. A derivative according to any one of the
claims 1-76 for use in the treatment or prevention of
hyperglycemia, type 2 diabetes, impaired glucose tolerance, type 1
diabetes, obesity, hypertension, syndrome X, dyslipidemia,
cognitive disorders, atheroschlerosis, myocardial infarction,
coronary heart disease and other cardiovascular disorders, stroke,
inflammatory bowel syndrome, dyspepsia and gastric ulcers.
[0666] All references, including publications, patent applications
and patents, cited herein are hereby incorporated by reference to
the same extent as if each reference was individually and
specifically indicated to be incorporated by reference and was set
forth in its entirety herein.
[0667] All headings and sub-headings are used herein for
convenience only and should not be construed as limiting the
invention in any way,
[0668] Any combination of the above-described elements in all
possible variations thereof is encompassed by the invention unless
otherwise indicated herein or otherwise clearly contradicted by
context.
[0669] The terms "a" and "an" and "the" and similar referents as
used in the context of describing the invention are to be construed
to cover both the singular and the plural, unless otherwise
indicated herein or clearly contradicted by context.
[0670] Recitation of ranges of values herein are merely intended to
serve as a shorthand method of referring individually to each
separate value falling within the range, unless otherwise indicated
herein, and each separate value is incorporated into the
specification as if it were individually recited herein. Unless
otherwise stated, all exact values provided herein are
representative of corresponding approximate values (e.g., all exact
exemplary values provided with respect to a particular factor or
measurement can be considered to also provide a corresponding
approximate measurement, modified by "about," where
appropriate).
[0671] All methods described herein can be performed in any
suitable order unless otherwise indicated herein or otherwise
clearly contradicted by context.
[0672] The use of any and all examples, or exemplary language
(e.g., "such as") provided herein, is intended merely to better
illuminate the invention and does not pose a limitation on the
scope of the invention unless otherwise indicated. No language in
the specification should be construed as indicating any element is
essential to the practice of the invention unless as much is
explicitly stated.
[0673] The citation and incorporation of patent documents herein is
done for convenience only and does not reflect any view of the
validity, patentability and/or enforceability of such patent
documents,
[0674] The description herein of any aspect or embodiment of the
invention using terms such as "comprising", "having", "including"
or "containing" with reference to an element or elements is
intended to provide support for a similar aspect or embodiment of
the invention that "consists of", "consists essentially of", or
"substantially comprises" that particular element or elements,
unless otherwise stated or clearly contradicted by context (e.g., a
formulation described herein as comprising a particular element
should be understood as also describing a formulation consisting of
that element, unless otherwise stated or clearly contradicted by
context).
[0675] This invention includes all modifications and equivalents of
the subject matter recited in the aspects or claims presented
herein to the maximum extent permitted by applicable law.
[0676] The present invention is further illustrated in the
following representative methods and examples which are, however,
not intended to limit the scope of the invention in any way.
[0677] The features disclosed in the foregoing description and in
the following examples may, both separately and in any combination
thereof, be material for realising the invention in diverse forms
thereof.
EXAMPLES
Abbreviations Used
[0678] r.t: Room temperature DIPEA: diisopropylethylamine H.sub.2O:
water CH.sub.3CN: acetonitrile DMF: NN dimethylformamide HBTU:
2-(1H-Benzotriazol-1-yl-)-1,1,3,3 tetramethyluronium
hexafluorophosphate Fmoc: 9H-fluoren-9-ylmethoxycarbonyl Boc: tert
butyloxycarbonyl OtBu: tert butyl ester tBu: tert butyl Trt:
triphenylmethyl Pmc: 2,2,5,7,8-Pentamethyl-chroman-6-sulfonyl Dde:
1-(4,4-Dimethyl-2,6-dioxocyclohexylidene)ethyl ivDde:
1-(4,4-Dimethyl-2,6-dioxocyclohexylidene)-3-methylbutyl Mtt:
4-methyltrityl Mmt: 4-methoxytrityl DCM: dichloromethane TIS:
triisopropylsilane) TFA: trifluoroacetic acid Et.sub.2O:
diethylether
NMP: 1-Methyl-pyrrolidin-2-one
DIPEA: Diisopropylethylamine
[0679] HOAt: 1-Hydroxy-7-azabenzotriazole
HOBt: 1-Hydroxybenzotriazole
DIC: Diisopropylcarbodiimide
[0680] DBU: 1,8-diazabicycli-[5,4,0]undecene-7 MW: Molecular
weight
A: Synthesis of Resin Bound Peptide
SPPS Method A.
[0681] The protected peptidyl resin was synthesized according to
the Fmoc strategy on an Applied Biosystems 433 peptide synthesizer
in 0.25 mmol or 1.0 mmol scale using the manufacturer supplied
FastMoc UV protocols which employ HBTU
(2-(1H-Benzotriazol-1-yl-)-1,1,3,3 tetramethyluronium
hexafluorophosphate) or HATU
(O-(7-azabenzotriazol-1-yl)-1,1,3,3-tetramethyluronium
hexafluorophosphate) mediated couplings in NMP
(N-methylpyrrolidone), and UV monitoring of the deprotection of the
Fmoc protection group. The starting resin used for the synthesis of
the peptide amides was Rink-Amide resin and either Wang or
chlorotrityl resin was used for peptides with a carboxy C-terminal.
The protected amino acid derivatives used were standard Fmoc-amino
acids (supplied from e.g. Anaspec, or Novabiochem) supplied in
preweighed cartridges suitable for the ABI433A synthesizer with the
exception of unnatural aminoacids such as Fmoc-Aib-OH
(Fmoc-aminoisobutyric acid). The N terminal amino acid was Boc
protected at the alpha amino group (e.g. Boc-His(Boc)OH was used
for peptides with His at the N-terminal). The epsilon amino group
of lysine in position 26 was either protected with Mtt, Mmt, Dde,
ivDde, or Boc, depending on the route for attachment of the albumin
binding moiety and spacer. The synthesis of the peptides may in
some cases be improved by the use of dipeptides protected on the
dipeptide amide bond with a group that can be cleaved under acidic
conditions such but not limited to 2-Fmoc-oxy-4-methoxybenzyl or
2,4,6-trimethoxybenzyl. In cases where a serine or a threonine is
present in the peptide, the use of pseudoproline dipeptides may be
used (see e.g. catalogue from Novobiochem 2002/2003 or newer
version, or W. R. Sampson (1999), J. Pep. Sci. 5, 403.
SPPS Method B:
[0682] One alternative method (method B) of peptide synthesis was
by Fmoc chemistry on a microwave-based Liberty peptide synthesizer
(CEM Corp., North Carolina). The resin was Tentagel S RAM with a
loading of 0.24 mmol/g. The coupling chemistry was DIC/HOAt in NMP
using amino acid solutions of 0.3 M in NMP and a molar excess of
8-10 fold. Coupling conditions was 5 minutes at up to 70.degree. C.
Deprotection was with 5% piperidine in NMP at up to 70.degree. C.
When a chemical modification of a lysine side chain was desired,
the lysine was incorporated as Lys(Mtt). The Mtt group was removed
by suspending the resin in neat hexafluoroisopropanol for 20
minutes followed by washing with DCM and NMP. The chemical
modification of the lysine was performed either by manual synthesis
or by one or more automated steps on the Liberty followed by a
manual coupling. Another method of peptide synthesis was by Fmoc
chemistry on an ABI 433 with HBTU coupling. After synthesis the
resin was washed with DCM and dried, and the peptide was cleaved
from the resin by a 2 hour treatment with TFA/TIS/water
(92.5/5/2.5) followed by precipitation with diethylether. the
peptide was redissolved in 30% acetic acid or similar solvent and
purified by standard RP-HPLC on a C18 column using
acetonitrile/TFA. The identity of the peptide was confirmed by
MALDI-MS.
SPPS Method C
[0683] The protected peptidyl resin was synthesized according to
the Fmoc strategy on an Advanced ChemTech Synthesiser (APEX 348)
0.25 mmol scale using the manufacturer supplied protocols which
employ DIC (dicyclohexylcarbodiimide) and HOBt
(1-Hydroxybenzotriazole) mediated couplings in NMP
(N-methylpyrrolidone. The starting resin used for the synthesis of
the peptide amides was Rink-Amide resin and either Wang or
chlorotrityl resin was used for peptides with a carboxy C-terminal.
The protected amino acid derivatives used were standard Fmoc-amino
acids (supplied from e.g. Anaspec, or Novabiochem. The N terminal
amino acid was Boc protected at the alpha amino group (e.g.
Boc-His(Boc)OH was used for peptides with His at the N-terminal).
The epsilon amino group of lysine in position 26 was either
protected with Mtt, Mmt, Dde, ivDde, or Boc, depending on the route
for attachment of the albumin binding moiety and spacer. The
synthesis of the peptides may in some cases be improved by the use
of dipeptides, e.g., pseudoprolines from Novabiochem,
Fmoc-Ser(tbu)-.PSI.Ser(Me,Me)-OH, see e.g. catalogue from
Novobiochem 2002/2003 or newer version, or W. R. Sampson (1999), J.
Pep. Sci. 5, 403
Procedure for Removal of ivDde or Dde-Protection.
[0684] The resin (0.25 mmol) was placed in a manual
shaker/filtration apparatus and treated with 2% hydrazine in
N-methylpyrrolidone (20 ml, 2.times.12 min) to remove the Dde or
ivDde group and wash with N-methylpyrrolidone (4.times.20 ml).
Procedure for Removal of Mtt or Mmt-Protection.
[0685] The resin (0.25 mmol) was placed in a manual
shaker/filtration apparatus and treated with 2% TFA and 2-3% TIS in
DCM (20 ml, 5-10 min repeated 6-12 times) to remove the Mtt or Mmt
group and wash with DCM (2.times.20 ml), 10% MeOH and 5% DIPEA in
DCM (2.times.20 ml) and N-methylpyrrolidone (4.times.20 ml).
Alternative Procedure for Removal of Mtt-Protection:
[0686] The resin was placed in a syringe and treated with
hexafluoroisopropanol for 2.times.10 min to remove the Mtt group.
The resin was then washed with DCM and NMP as described above.
Procedure for Attachment of Sidechains to Lysine Residue.
[0687] The albumin binding residue (B-U- sidechain of formula I)
can be attached to the peptide either by acylation to resin bound
peptide or acylation in solution to the unprotected peptide using
standard acylating reagent such as but not limited to DIC,
HOBt/DIC, HOAt/DIC, or HBTU.
Attachment to Resin Bound Peptide:
Route I
[0688] Activated (active ester or symmetric anhydride) albumin
binding residue (A-B)-sidechain of formula I) such as
octadecanedioic acid mono-(2,5-dioxo-pyrrolidin-1-yl) ester (Ebashi
et al. EP511600, 4 molar equivalents relative to resin bound
peptide) was dissolved in NMP (25 mL), added to the resin and
shaken overnight at room temperature. The reaction mixture was
filtered and the resin was washed extensively with NMP,
dichloromethane, 2-propanol, methanol and diethyl ether.
Route II
[0689] The albumin binding residue (A-(B)- sidechain of formula I)
was dissolved in N-methyl pyrrolidone/methylene chloride (1:1, 10
ml). The activating reagent such as hydroxybenzotriazole (HOBt) (4
molar equivalents relative to resin) and diisopropylcarbodiimide (4
molar equivalents relative to resin) was added and the solution was
stirred for 15 min. The solution was added to the resin and
diisopropylethylamine (4 molar equivalents relative to resin) was
added. The resin was shaken 2 to 24 hours at room temperature. The
resin was washed with N-methyl pyrrolidone (2.times.20 ml),
N-methylpyrrolidone/Methylene chloride (1:1) (2.times.20 ml) and
methylene chloride (2.times.20 ml).
Route III
[0690] Activated (active ester or symmetric anhydride) albumin
binding residue (A-B- sidechain of formula I) such as
octadecanedioic acid mono-(2,5-dioxo-pyrrolidin-1-yl) ester Ebashi
et al. EP511600, 1-1.5 molar equivalents relative to the peptide
was dissolved in an organic solvent such as acetonitrile, THF, DMF,
DMSO or in a mixture of water/organic solvent (1-2 ml) and added to
a solution of the peptide in water (10-20 ml) together with 10
molar equivalents of DIPEA. In case of protecting groups on the
albumin binding residue such as tert.-butyl, the reaction mixture
was lyophilized 0/N and the isolated crude peptide deprotected
afterwards--in case of a tert-butyl group the peptide was dissolved
in a mixture of trifluoroacetic acid, water and triisopropylsilane
(90:5:5). After for 30 min the mixture was, evaporated in vacuo and
the finale peptide purified by preparative HPLC.
[0691] Procedure for removal of Fmoc-protection: The resin (0.25
mmol) was placed in a filter flask in a manual shaking apparatus
and treated with N-methyl pyrrolidone/methylene chloride (1:1)
(2.times.20 ml) and with N-methylpyrrolidone (1.times.20 ml), a
solution of 20% piperidine in N-methylpyrrolidone (3.times.20 ml,
10 min each). The resin was washed with N-methylpyrrolidone
(2.times.20 ml), N-methylpyrrolidone/Methylene chloride (1:1)
(2.times.20 ml) and methylene chloride (2.times.20 ml).
Procedure for Cleaving the Peptide Off the Resin:
[0692] The peptide was cleaved from the resin by stirring for 180
min at room temperature with a mixture of trifluoroacetic acid,
water and triisopropylsilane (95:2.5:2.5 to 92:4:4). The cleavage
mixture was filtered and the filtrate was concentrated to an oil by
a stream of nitrogen. The crude peptide was precipitated from this
oil with 45 ml diethyl ether and washed 1 to 3 times with 45 ml
diethyl ether.
[0693] Purification: The crude peptide was purified by
semipreparative HPLC on a 20 mm.times.250 mm column packed with
either 5.mu. or 7.mu. C-18 silica. Depending on the peptide one or
two purification systems were used.
TFA: After drying the crude peptide was dissolved in 5 ml 50%
acetic acid H.sub.2O and diluted to 20 ml with H.sub.2O and
injected on the column which then was eluted with a gradient of
40-60% CH.sub.3CN in 0.1% TFA 10 ml/min during 50 min at 40.degree.
C. The peptide containing fractions were collected. The purified
peptide was lyophilized after dilution of the eluate with water.
Ammonium sulphate: The column was equilibrated with 40% CH.sub.3CN
in 0.05M (NH.sub.4).sub.2SO.sub.4, which was adjusted to pH 2.5
with concentrated H.sub.2SO.sub.4. After drying the crude peptide
was dissolved in 5 ml 50% acetic acid H.sub.2O and diluted to 20 ml
with H.sub.2O and injected on the column which then was eluted with
a gradient of 40%-60% CH.sub.3CN in 0.05M (NH.sub.4).sub.2SO.sub.4,
pH 2.5 at 10 ml/min during 50 min at 40.degree. C. The peptide
containing fractions were collected and diluted with 3 volumes of
H.sub.2O and passed through a Sep-Pak.RTM. C18 cartridge (Waters
part. #:51910) which has been equilibrated with 0.1% TFA. It was
then eluted with 70% CH.sub.3CN containing 0.1% TFA and the
purified peptide was isolated by lyophilisation after dilution of
the eluate with water.
[0694] The final product obtained was characterised by analytical
RP-HPLC (retention time) and by LCMS
[0695] The RP-HPLC analysis may be performed using UV detection at
214 nm and e.g. a Vydac 218TP54 4.6 mm.times.250 mm 5.mu. C-18
silica column (The Separations Group, Hesperia, USA) and eluted at
e.g. 1 ml/min at 42.degree. C. Most often one of following specific
conditions were used:
Method 03_A1.sub.--1
[0696] HPLC (Method 03_A1.sub.--1): The RP-analysis was performed
using a Waters 2690 systems fitted with a Waters 996 diode array
detector. UV detections were collected at 214, 254, 276, and 301 nm
on a 218TP54 4.6 mm.times.250 mm 5.mu. C-18 silica column (The
Seperations Group, Hesperia), which was eluted at 1 ml/min at
42.degree. C. The column was equilibrated with 10% of a 0.5 M
ammonium sulfate, which was adjusted to pH 2.5 with 4M sulfuric
acid. After injection, the sample was eluted by a gradient of 0% to
60% acetonitrile in the same aqueous buffer during 50 min.
Method 03_B1.sub.--2
[0697] HPLC (Method 03_B1.sub.--2): The RP-analysis was performed
using a Waters 2690 systems fitted with a Waters 996 diode array
detector. UV detections were collected at 214, 254, 276, and 301 nm
on a Zorbax 300SB C-18 (4.5.times.150 mm, 5.mu., which was eluted
at 0.5 ml/min at 42.degree. C. The column was equilibrated with an
aqueous solution of TFA in water (0.1%). After injection, the
sample was eluted by a gradient of 0% to 60% acetonitrile (+0.1%
TFA) in an aqueous solution of TFA in water (0.1%) during 50
min.
Method 02_B1.sub.--1
[0698] HPLC (Method 02_B1.sub.--1): The RP-analyses was performed
using a Alliance Waters 2695 system fitted with a Waters 2487
dualband detector. UV detections at 214 nm and 254 nm were
collected using a Vydac 218TP53, C18, 300 .ANG., 5 um, 3.2
mm.times.250 mm column, 42.degree. C. Eluted with a linear gradient
of 0-60% acetonitrile, 95-35% water and 5% trifluoroacetic acid
(1.0%) in water over 50 minutes at a flow-rate of 0.50 ml/min.
Method 01_B4.sub.--2
[0699] HPLC (Method 01_B4.sub.--2): RP-analyses was performed using
a Waters 600S system fitted with a Waters 996 diode array detector.
UV detections at 214 nm and 254 nm were collected using a
Symmetry300 C18, 5 um, 3.9 mm.times.150 mm column, 42.degree. C.
Eluted with a linear gradient of 5-95% acetonitrile, 90-0% water,
and 5% trifluoroacetic acid (1.0%) in water over 15 minutes at a
flow-rate of 1.0 min/min.
Method 02_B4.sub.--4
[0700] HPLC (Method 02_B4.sub.--4): The RP-analyses was performed
using a Alliance Waters 2695 system fitted with a Waters 2487
dualband detector. UV detections at 214 nm and 254 nm were
collected using a Symmetry300 C18, 5 um, 3.9 mm.times.150 mm
column, 42.degree. C. Eluted with a linear gradient of 5-95%
acetonitrile, 90-0% water, and 5% trifluoroacetic acid (1.0%) in
water over 15 minutes at a flow-rate of 1.0 min/min.
Method 02_B6.sub.--1
[0701] HPLC (Method 02_B6.sub.--1): The RP-analyses was performed
using a Alliance Waters 2695 system fitted with a Waters 2487
dualband detector. UV detections at 214 nm and 254 nm were
collected using a Vydac 218TP53, C18, 300 .ANG., 5 um, 3.2
mm.times.250 mm column, 42.degree. C. Eluted with a linear gradient
of 0-90% acetonitrile, 95-5% water, and 5% trifluoroacetic acid
(1.0%) in water over 50 minutes at a flow-rate of 0.50 ml/min.
Method 03_B6.sub.--1
[0702] HPLC (Method 03_B1.sub.--1): The RP-analysis was performed
using a Waters 2690 systems fitted with a Waters 996 diode array
detector. UV detections were collected at 214, 254, 276, and 301 nm
on a 218TP54 4.6 mm.times.250 mm 5.mu. C-18 silica column (The
Seperations Group, Hesperia), which was eluted at 1 ml/min at
42.degree. C. The column was equilibrated with 5% acetonitrile
(+0.1% TFA) in an aqueous solution of TFA in water (0.1%). After
injection, the sample was eluted by a gradient of 0% to 90%
acetonitrile (+0.1% TFA) in an aqueous solution of TFA in water
(0.1%) during 50 min.
[0703] Alternatively a preparative gradient elution can be
performed as indicated above and the percentage of acetonitrile
where the compound elutes is noted. Identity is confirmed by
MALDI.
[0704] The following instrumentation was used:
[0705] LCMS was performed on a setup consisting of Sciex API 100
Single quadropole mass spectrometer, Perkin Elmer Series 200 Quard
pump, Perkin Elmer Series 200 autosampler, Applied Biosystems 785A
UV detector, Sedex 75 evaporative light scattering detector
[0706] The instrument control and data acquisition were done by the
Sciex Sample control software running on a Windows 2000
computer.
[0707] The HPLC pump is connected to two eluent reservoirs
containing:
A: 0.05% Trifluoro acetic acid in water B: 0.05% Trifluoro acetic
acid in acetonitrile
[0708] The analysis is performed at room temperature by injecting
an appropriate volume of the sample (preferably 20 .mu.l) onto the
column which is eluted with a gradient of acetonitrile.
[0709] The HPLC conditions, detector settings and mass spectrometer
settings used are giving in the following table.
Column: Waters Xterra MS C-18.times.3 mm id 5 .mu.m
[0710] Gradient: 5%-90% acetonitrile linear during 7.5 min at 1.5
ml/min Detection: 210 nm (analogue output from DAD) ELS (analogue
output from ELS), 40.degree. C. MS ionisation mode API-ES
[0711] Alternatively LCMS was performed on a setup consisting of
Hewlett Packard series 1100 G1312A Bin Pump, Hewlett Packard series
1100 Column compartment, Hewlett Packard series 1100 G1315A DAD
diode array detector, Hewlett Packard series 1100 MSD and Sedere 75
Evaporative Light Scattering detector controlled by HP Chemstation
software. The HPLC pump is connected to two eluent reservoirs
containing:
A: 10 mM NH.sub.4OH in water B: 10 mM NH.sub.4OH in 90%
acetonitrile
[0712] The analysis was performed at 23.degree. C. by injecting an
appropriate volume of the sample (preferably 20 .mu.l) onto the
column which is eluted with a gradient of A and B.
[0713] The HPLC conditions, detector settings and mass spectrometer
settings used are giving in the following table.
Column Waters Xterra MS C-18.times.3 mm id 5 .mu.m
[0714] Gradient 5%-100% acetonitrile linear during 6.5 min at 1.5
ml/min Detection 210 nm (analogue output from DAD) ELS (analogue
output from ELS) MS ionisation mode API-ES. Scan 100-1000 amu step
0.1 amu
MALDI-MS:
[0715] Molecular weights of the peptides were determined using
matrix-assisted laser desorption time of flight mass spectroscopy
(MALDI-MS), recorded on a Microflex (Bruker). A matrix of
.alpha.-cyano-4-hydroxy cinnamic acid was used.
Analytical HPLC Conditions (Method I):
[0716] Equilibration of the column (Xterra TM MS C18, 5 um,
4.6.times.150 mm Column, P7N 186 000490) with 0.1% TFA/H.sub.2O and
elution by a gradient of 0% CH.sub.3CN/0.1% TFA/H.sub.2O to 60%
CH.sub.3CN/0.1% TFA/H.sub.2O during 25 min followed by a gradient
from 60% to 100% over 5 min.
[0717] In the examples of this invention the nomenclature and
structurally graphics is meant as:
[0718] One letter symbols for the natural amino acids is used, e.g.
H is L-histidine, A is L-alanine ect. Three letter abbreviations
for amino acids may also be uses, e.g. His is L-histidine, Ala is
L-alanine ect. For non natural amino acids three letter
abbreviations are used, such as Aib for aminoisobutyric acid. The
position of the amino acids may either be indicated with a number
in superscript after the amino acid symbols such as Lys.sup.37, or
as Lys37. The N-terminal amino group may be symbolised either as
NH.sub.2 or as H. The C-terminal carboxylic group may be symbolised
either as --OH or as --COOH. The C-terminal amide group is
symbolised as --NH.sub.2
[0719] The Sub-Structures
##STR00039##
both means His-Aib-Glu-Gly-Thr-Phe.
[0720] The epsilon amino group of Lysine may be described either as
the greek symbol .epsilon. or spelled "epsilon".
[0721] The structures in the examples below are in several cases a
combination of one letter symbols for the naturally amino acids
combined with the three letter abbreviation Aib for aminoisobutyric
acid. In several cases some of the amino acids are shown in
expanded full structure. Thus lysine that has been derivatised may
be shown as the expanded full structures in example 1 where the
lysine in position 38 is expanded. The nitrogen (with indicated H)
between arginine in position 37 and the expanded lysine in position
38 is thus the nitrogen of the peptide bond connecting the two
amino acids in example 1 According to the procedure above, the
following derivatives were prepared as non-limiting examples of the
invention:
Example 1
N-.epsilon..sup.37{2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(19-carboxynonadecan-
oyl)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)e-
thoxy]ethoxy}acetyl
[desaminoHis.sup.7,Glu.sup.22,Arg.sup.26,Arg.sup.34,Lys.sup.37]GLP-1(7-37-
)amide
##STR00040##
[0723] Preparation method: A
[0724] HPLC method B6
[0725] RT=35.49 min
[0726] LCMS: m/z=1096.2 (M+3H).sup.3+
[0727] Calculated MW=4380.0
Example 2
N-.epsilon..sup.20-{2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(19-carboxynonadeca-
noyl)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)-
ethoxy]ethoxy}acetyl
[Aib.sup.2,Leu.sup.14,Lys.sup.20,Gln.sup.28,Ser(O-benzyl).sup.39]exendin--
4 (1-39)amide
##STR00041##
[0729] Preparation method: A
[0730] HPLC method B6:
[0731] RT=37.63 min
[0732] LCMS: m/z=1705.9 (M+3H).sup.3+
[0733] Calculated MW=5113.9
Example 3
N-.epsilon..sup.26{2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(19-carboxynonadecan-
oyl)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)e-
thoxy]ethoxy}acetyl [desaminoHis.sup.7,Arg.sup.34]GLP-1-(7-37)
##STR00042##
[0735] Preparation method: A
[0736] HPLC method B6:
[0737] RT=36.45 min
[0738] LCMS: m/z=1404.3 (M+3H).sup.3+
[0739] Calculated MW=4209.8
Example 4
N-epsilon37{2-[2-(2-{2-[2-((S)-3-carboxy-3-{[1-(19-carboxynonadecanoyl)pip-
eridine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethoxy]e-
thoxy}acetyl [Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide
##STR00043##
[0741] Preparation method: B
[0742] The peptide was eluted at 66% acetonitrile.
[0743] Structure confirmed by MALDI-MS
[0744] Calculated MW=4409.1
Example 5
N-epsilon23-[2-(2-[2-(2-[2-(2-((R)-3-[1-(17-Carboxyheptadecanoylamino)pipe-
ridin-4-ylcarbonylamino]-3-(carboxypropionylamino)ethoxy)ethoxy]acetylamin-
o)ethoxy]ethoxy)acetyl] [Aib8,Arg26,Arg34]GLP-1-(7-37)
##STR00044##
[0746] Preparation method: A
[0747] HPLC method 02_B6.sub.--4:
[0748] RT=9.32 min
[0749] LCMS: m/z=(M+3H).sup.3+ 1413.8
[0750] Calculated MW=4238.8
Example 6
N-epsilon37-[2-(2-[2-(2-[2-(2-((R)-3-[1-(17-Carboxyheptadecanoyl)piperidin-
-4-ylcarbonylamino]3-carboxypropionylamino)ethoxy)ethoxy]acetylamino)ethox-
y]ethoxy)acetyl] [DesaminoHis 7,Glu22 Arg26,Arg
34,Phe(m-CF3)28]GLP-1-(7-37)amide
##STR00045##
[0752] Preparation method: A
[0753] HPLC method 01_B6.sub.--2:
[0754] RT=11.92 min
[0755] LCMS: m/z=1474.8 (M+3H).sup.3+
[0756] Calculated MW=4420.0
Example 7
[DesaminoHis7,Glu22,Arg26,Arg34]GLP-1-(7-37)-Lys(2-{2-[2-(2-{2-[2-((S)-4-C-
arboxy-4-{[1-(19-carboxynonadecanoyl)piperidine-4-carbonyl]amino}butyrylam-
ino)ethoxy]ethoxy}acetylamino)ethoxy]ethoxy}acetyl)
##STR00046##
[0758] Preparation method: B
[0759] The peptide was prepared similar to method A, though using a
CEM Liberty peptide synthesizer, and starting with
fmoc-Lys(mtt)-wang resin. The N-terminal amine was protected with a
Boc group. Mtt was removed from the lysine using
hexafluoro-2-propanol, and the side chain was prepared using
fmoc-chemistry on a CEM Liberty peptide synthesizer.
[0760] HPLC method 03_B6.sub.--1:
[0761] RT=35.50 min
[0762] LCMS: m/z=1114.0 (M+4H).sup.4+
[0763] Calculated (M)=4452.1
Example 8
N-.epsilon..sup.20({2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(17-carboxyheptadec-
anoyl)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino-
)ethoxy]ethoxy}acetyl)
[Aib.sup.8,Lys.sup.20,Arg.sup.26,Glu.sup.30,Thr(O-benzyl).sup.33]GLP-1-(7-
-37)amide
##STR00047##
[0765] Preparation method: A
[0766] HPLC method B6:
[0767] RT=32.49 min
[0768] LCMS: m/z=1459.0 (M+3H).sup.3+
[0769] Calculated MW=4375.0
Example 9
N-epsilon30{2-[2-(2-{2-[2-((S)-3-carboxy-3-{[1-(19-carboxynonadecanoyl)pip-
eridine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethoxy]e-
thoxy}acetyl [Aib8,Glu22,Arg26,Lys30]GLP-1-(7-37)
##STR00048##
[0771] Preparation method: The peptide was prepared on an Apex396
from Advanced Chemtech and the final product was characterized by
analytical HPLC and MALDI-MS.
[0772] HPLC (method I): see the description above
[0773] RT=27.6 min
[0774] MALDI-MS: 4367.9
Example 10
N-epsilon31{2-[2-(2-{2-[2-((S)-3-carboxy-3-{[1-(19-carboxynonadecanoyl)pip-
eridine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethoxy]e-
thoxy}acetyl [Aib8,Glu22,Arg26,Lys 31]GLP-1-(7-37)
##STR00049##
[0776] Preparation method: The peptide was prepared on an Apex396
from Advanced Chemtech and the final product was characterized by
analytical HPLC and MALDI-MS.
[0777] HPLC (method A): see the description above
[0778] RT=28.4 min
[0779] MALDI-MS: 4252.5
Example 11
N-.epsilon..sup.20({2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(17-carboxyheptadec-
anoyl)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino-
)ethoxy]ethoxy}acetyl)
[Aib.sup.8,Lys.sup.20,Arg.sup.26,2-Naphtylalanine.sup.28,Glu.sup.30]GLP-1-
(7-37)amide
##STR00050##
[0781] Preparation method: A
[0782] HPLC method B6:
[0783] RT=32.31 min
[0784] LCMS: m/z=1445.0 (M+3H).sup.3+
[0785] Calculated MW=4332.9
Example 12
[Aib8,Glu22,Arg26,Arg34]GLP-1-(7-37)Lys[2-(2-[2-(2-[2-(2-((S)-4-[1-[19-Car-
boxynonadecanoyl]piperidine-4-carbonylamino]-4-carboxybutyrylamino)ethoxy)-
ethoxy]acetylamino)ethoxy]ethoxy)acetyl]amide
##STR00051##
[0787] Preparation method: A
[0788] HPLC method 2_B4.sub.--4:
[0789] RT=9.73 min
[0790] LCMS: m/z=(M/3)+1=1494.9 and (M/4)+1=1120.9; (Sciex100
API)
[0791] Calculated MW=4480.1
Example 13
N-.epsilon..sup.20({2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1-(17-carboxyheptadec-
anoyl)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino-
)ethoxy]ethoxy}acetyl)
[Aib.sup.8,Lys.sup.20,Arg.sup.26,2-Naphtylalanine.sup.12,Glu.sup.30]GLP-1-
-(7-37)amide
##STR00052##
[0793] Preparation method: A
[0794] HPLC method B6:
[0795] RT=30.70 min
[0796] LCMS: m/z=1084.0 (M+4H).sup.4+
[0797] Calculated MW=4332.9
Example 14
[DesaminoHis7,Glu22,Arg26,Arg34]GLP-1-(7-37)Lys[2-(2-[2-(2-[2-(2-((S)-4-[1-
-[19-Carboxynonadecanoyl]piperidine-4-carbonylamino]-4-carboxybutyrylamino-
)ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl]amide
##STR00053##
[0799] Preparation method: A, and Example 72
[0800] HPLC method 2_B6.sub.--4:
[0801] RT=9.95 min
[0802] LCMS: m/z=1484. (M+3H).sup.3+
[0803] Calculated MW=4451.1
Example 15
N-epsilon31-(2-{2-[2-(2-{2-[2-((S)-3-Carboxy-3-{[1-(19-carboxynonadecanoyl-
)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)etho-
xy]ethoxy}acetyl) [Aib 8,Glu22,Arg26,Lys31,Arg34]GLP-1-(7-37)
##STR00054##
[0805] Preparation method: B, and Example 72
[0806] The peptide was eluted at 66% acetonitrile.
[0807] Structure confirmed by MALDI-MS
[0808] Calculated MW=4280.9
Example 16
N-epsilon26-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonadecanoylamino)methy-
l]cyclohexanecarbonyl}amino)butyryl] [Aib8,Arg34]GLP-1-(7-37)
##STR00055##
[0810] Preparation method: B, and Example 72
[0811] The peptide was eluted at 69% acetonitrile.
[0812] Structure confirmed by MALDI-MS
[0813] Calculated MW=3990.6
Example 17
N-epsilon26-{4-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonadecanoylamino)me-
thyl]cyclohexanecarbonyl}amino)butyrylamino]butyryl}
[Aib8,Arg34]GLP-1-(7-37)
##STR00056##
[0815] Preparation method: B
[0816] The peptide was eluted at 70% acetonitrile.
[0817] Structure confirmed by MALDI-MS
[0818] Calculated MW=4075.7
Example 18
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonadecanoylam-
ino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)acetyl]
[Aib8,Arg34]GLP-1-(7-37)
##STR00057##
[0820] Preparation method: B, and Example 72
[0821] The peptide was eluted at 68% acetonitrile.
[0822] Structure confirmed by MALDI-MS
[0823] Calculated MW=4135.8
Example 19
N-epsilon26-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonad-
ecanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)a-
cetylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-37)-amide
##STR00058##
[0825] Preparation method: B, and Example 72
[0826] The peptide was eluted at 70% acetonitrile.
[0827] Structure confirmed by MALDI-MS
[0828] Calculated MW=4279.9
Example 20
N-epsilon18-{2-(2-(2-(2-[2-(2-[(S)-4-Carboxy-4-({4-[(19-carboxynonadecanoy-
lamino)methyl]cyclohexanecarbonyl}amino)butanoylamino]ethoxy)ethoxy]acetyl-
)ethoxy)ethoxy)acetyl} [Aib8,Lys18,Arg26,Arg34]GLP-1(7-37)
##STR00059##
[0830] Preparation method: The peptide was prepared on an Apex396
from Advanced Chemtech and the final product was characterized by
analytical HPLC and MALDI-MS.
[0831] HPLC (method B6):
[0832] RT=34.1 min
[0833] LCMS: m/z=XX (M+4H).sup.4+: 1088
[0834] Calculated MW=4350.0
Example 21
N-.epsilon..sup.20-[2-(2-[2-(2-[2-(2-((S)-4-[trans-4-([19-Carboxynonadecan-
oylamino]methyl)cyclohexylcarbonylamino]-4-carboxybutanoylamino)ethoxy)eth-
oxy]acetylamino)ethoxy]ethoxy)acetyl][desaminoHis.sup.1,Lys.sup.20,Ser(O-b-
enzyl).sup.33,Ser(O-benzyl).sup.39]exendin (1-39)
##STR00060##
[0836] Preparation method: A
[0837] HPLC method B6:
[0838] RT=39.22 min
[0839] LCMS: m/z=1736.9 (M+3H).sup.3+
[0840] Calculated MW=5207.0
Example 22
[Aib8,Glu22,Arg26,Arg34]GLP-1-(7-37)Lys[2-(2-[2-(2-[2-(2-((S)-3-[4-([19-Ca-
rboxynonadecanoylamino]methyl)cyclohexylcarbonylamino]-3-carboxypropionyla-
mino)ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl]amide
##STR00061##
[0842] Preparation method: B
[0843] The peptide was eluted at 68% acetonitrile.
[0844] Structure confirmed by MALDI-MS
[0845] Calculated MW=4494.2
Example 23
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonad-
ecanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)a-
cetylamino]ethoxy}ethoxy)acetyl]
[Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide
##STR00062##
[0847] Preparation method: B
[0848] The peptide was eluted at 67% acetonitrile.
[0849] Structure confirmed by MALDI-MS
[0850] Calculated MW=4451.1
Example 24
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonad-
ecanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)a-
cetylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide
##STR00063##
[0852] Preparation method: B
[0853] The peptide was eluted at 68% acetonitrile.
[0854] Structure confirmed by MALDI-MS
[0855] Calculated MW=4422.1
Example 25
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({4-[(trans-19-carboxynonad-
ecanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)a-
cetylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37)amide
##STR00064##
[0857] Preparation method: B
[0858] The peptide was eluted at 68% acetonitrile.
[0859] Structure confirmed by MALDI-MS
[0860] Calculated MW=4350.0
Example 26
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonad-
ecanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)a-
cetylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)
##STR00065##
[0862] Preparation method: B
[0863] The peptide was eluted at 69% acetonitrile.
[0864] Structure confirmed by MALDI-MS
[0865] Calculated MW=4423.1
Example 27
[DesaminoHis7,Glu22,Arg26,Arg34]GLP-1-(7-37)Lys[2-(2-{2-[2-(2-{2-[4-Carbox-
y-4-({trans-4-[(19-carboxynonadecanoylamino)methyl]cyclohexanecarbonyl}ami-
no)butyrylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl]-amide
##STR00066##
[0867] Preparation method: B
[0868] The peptide was eluted at 68% acetonitrile.
[0869] Structure confirmed by MALDI-MS
[0870] Calculated MW=4479.1
Example 28
[desaminoHis.sup.7,Arg.sup.26,Arg.sup.34]GLP-1-(7-37)Lys[2-(2-[2-(2-[2-(2--
((R)-3-[trans-4-((9-Carboxynonadecanoylamino]methyl)cyclohexylcarbonylamin-
o]3-carboxypropionylamino)ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl]a-
mide
##STR00067##
[0872] Preparation method: A
[0873] HPLC method B6:
[0874] RT=35.25 min
[0875] LCMS: m/z=1469.0 (M+3H).sup.3+
[0876] Calculated MW=4407.1
Example 29
N-epsilon26[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({4-[(19-carboxynonadecanoyl-
amino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)acetylam-
ino]ethoxy}ethoxy)acetyl [Aib8,Lys 26]GLP-1(7-37)amide
##STR00068##
[0878] Preparation method: Method C
[0879] HPLC method 01_B4.sub.--2:
[0880] RT=11.26 min
[0881] LCMS: m/z=XX (M+4H).sup.4+1071
[0882] Calculated MW=4279.9
Example 30
N-epsilon26[2-(2-[2-(2-[2-(2-((S)-2-[trans-4-((9-Carboxynonadecanoylamino]-
methyl)cyclohexylcarbonylamino]-4-carboxybutanoylamino)ethoxy)ethoxy]acety-
lamino)ethoxy]ethoxy)acetyl] [Aib8,Lys26]GLP-1(7-37)amide
##STR00069##
[0884] Preparation method: Method C
[0885] HPLC method 01_B4.sub.--2:
[0886] RT=11.11 min
[0887] LCMS: m/z=XX (M+4H).sup.4+1103
[0888] Calculated MW=4409.1
Example 31
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonad-
ecanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)a-
cetylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37)
##STR00070##
[0890] Preparation method: B
[0891] The peptide was eluted at 71% acetonitrile.
[0892] Structure confirmed by MALDI-MS
[0893] Calculated MW=4351.0
Example 32
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonad-
ecanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)a-
cetylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Glu22,Arg26,Glu30,Arg34,Lys37]GLP-1-(7-37)
##STR00071##
[0895] Preparation method: B
[0896] The peptide was eluted at 68% acetonitrile.
[0897] Structure confirmed by MALDI-MS
[0898] Calculated MW=4481.1
Example 33
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{4-[4-(16-(1H-tetra-
zol-5-yl)-hexadecanoylsulfamoyl)butyrylamino]-butyrylamino}butyrylamino)bu-
tyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-37)
##STR00072##
[0900] Preparation method: B
[0901] The peptide was eluted at 62% acetonitrile.
[0902] Structure confirmed by MALDI-MS
[0903] Calculated MW=4341.9
Example 34
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino)-
butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-37)
##STR00073##
[0905] Preparation method: B
[0906] The peptide was eluted at 65% acetonitrile.
[0907] Structure confirmed by MALDI-MS
[0908] Calculated MW=4454.1
Example 35
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1H-tetra-
zol-5-yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)but-
yrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-37)
##STR00074##
[0910] Preparation method: B
[0911] The peptide was eluted at 62% acetonitrile.
[0912] Structure confirmed by MALDI-MS
[0913] Calculated MW=4370.0
Example 36
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{4-[4-(16-(1H-tetra-
zol-5-yl)hexadecanoylsulfamoyl)butyrylamino]butyrylamino}butyrylamino)buty-
rylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-34)
##STR00075##
[0915] Preparation method: B
[0916] The peptide was eluted at 66% acetonitrile.
[0917] Structure confirmed by MALDI-MS
[0918] Calculated MW=4071.6
Example 37
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]-dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-34)
##STR00076##
[0920] Preparation method: B
[0921] The peptide was eluted at 68% acetonitrile.
[0922] Structure confirmed by MALDI-MS
[0923] Calculated MW=4183.8
Example 38
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1H-tetra-
zol-5-yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)but-
yrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-34)
##STR00077##
[0925] Preparation method: B
[0926] The peptide was eluted at 67% acetonitrile.
[0927] Structure confirmed by MALDI-MS
[0928] Calculated MW=4099.7
Example 39
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino)-
butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-35)
##STR00078##
[0930] Preparation method: B
[0931] The peptide was eluted at 70% acetonitrile.
[0932] Structure confirmed by MALDI-MS
[0933] Calculated MW=4240.9
Example 40
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1H-tetra-
zol-5-yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)but-
yrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-35)
##STR00079##
[0935] Preparation method: B
[0936] The peptide was eluted at 66% acetonitrile.
[0937] Structure confirmed by MALDI-MS
[0938] Calculated MW=4156.7
Example 41
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1H-tetra-
zol-5-yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)but-
yrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-36)amide
##STR00080##
[0940] Preparation method: B
[0941] The peptide was eluted at 66% acetonitrile.
[0942] Structure confirmed by MALDI-MS
[0943] Calculated MW=4311.9
Example 42
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1H-tetra-
zol-5-yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)but-
yrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-35)
##STR00081##
[0945] Preparation method: B
[0946] The peptide was eluted at 66% acetonitrile.
[0947] Structure confirmed by MALDI-MS
[0948] Calculated MW=4128.7
Example 43
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino)-
butyrylamino]ethoxy}ethoxy)acetyl]
[Aib8,Lys33,Arg34]GLP-1-(7-34)
##STR00082##
[0950] Preparation method: B
[0951] The peptide was eluted at 68% acetonitrile.
[0952] Structure confirmed by MALDI-MS
[0953] Calculated MW=4113.7
Example 44
N-epsilon26-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino)-
butyrylamino]ethoxy}ethoxy)acetyl]
[Aib8,Arg34]GLP-1-(7-36)amide
##STR00083##
[0955] Preparation method: B
[0956] The peptide was eluted at 66% acetonitrile.
[0957] Structure confirmed by MALDI-MS
[0958] Calculated MW=4396.1
Example 45
N-epsilon26-[2-(2-{2-[2-(2-{2-[2-(2-{2-[2-(2-{2-[2-(2-{2-[2-(2-{2-[(S)-4-C-
arboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tetrazol-5-yl)hexadecanoylsulfamo-
yl)butyrylamino]dodecanoylamino}butyrylamino)butyrylamino]ethoxy}ethoxy)ac-
etylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethox-
y)acetylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl]
[Aib8,Lys26,Arg34]GLP-1-(7-36)amide
##STR00084##
[0960] Preparation method: B
[0961] The peptide was eluted at 65% acetonitrile.
[0962] Structure confirmed by MALDI-MS
[0963] Calculated MW=5121.9
Example 46
[Aib8,Glu22,Arg26,Arg34]GLP-1-(7-37)Lys[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-ca-
rboxy-4-{12-[4-(16-(1H-tetrazol-5-yl)hexadecanoylsulfamoyl)butyrylamino]do-
decanoylamino}-butyrylamino)butyrylamino]ethoxy}ethoxy)acetyl]amide
##STR00085##
[0965] Preparation method: B
[0966] The peptide was eluted at 65% acetonitrile.
[0967] Structure confirmed by MALDI-MS
[0968] Calculated MW=4681.4
Example 47
N-epsilon20-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino)-
butyrylamino]ethoxy}ethoxy)acetyl]
[Aib8,Lys20,Glu22,Arg26,Glu30,Pro37]GLP-1-(7-37)amide
##STR00086##
[0970] Preparation method: B
[0971] The peptide was eluted at 62% acetonitrile.
[0972] Structure confirmed by MALDI-MS
[0973] Calculated MW=4638.3
Example 48
N-epsilon37-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino)-
butyrylamino]ethoxy}ethoxy)acetyl]
[Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide
##STR00087##
[0975] Preparation method: B
[0976] The peptide was eluted at 69% acetonitrile.
[0977] Structure confirmed by MALDI-MS
[0978] Calculated MW=4624.3
Example 49
N-epsilon37-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino)-
butyrylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide
##STR00088##
[0980] Preparation method: B
[0981] The peptide was eluted at 65% acetonitrile.
[0982] Structure confirmed by MALDI-MS
[0983] Calculated MW=4595.3
Example 50
N-epsilon37-[[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tet-
razol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino-
)butyrylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Arg26,Arg34,Lys371GLP-1-(7-37)amide
##STR00089##
[0985] Preparation method: B
[0986] The peptide was eluted at 66% acetonitrile.
[0987] Structure confirmed by MALDI-MS
[0988] Calculated MW=4523.2
Example 51
[Aib8,Glu22,Arg26,Glu30,Pro37]GLP-1-(7-37)Lys[2-(2-{2-[4-Carboxy-4-(4-carb-
oxy-4-{4-[4-(16-1H-tetrazol-5-yl-hexadecanoylsulfamoyl)butyrylamino]butyry-
lamino}butyrylamino)butyrylamino]ethoxy}ethoxy)acetyl]
##STR00090##
[0990] Preparation method: Method A except that the peptide was
prepared on an Apex396 from Advanced Chemtech using a molar excess
of 8-10 fold amino acid, DIC and HOAt/HOBt (1:1) and the Mtt group
was deprotected with hexafluoroisopropanol. Attachment of thioamide
linker was achieved in two steps; 4-sulfamoylbutyric acid (3 fold
excess) was first coupled the resin using DIC and HOAt/HOBt (1:1).
Then, 16-(1H-tetrazol-5-yl)hexadecanoic acid (3 fold excess) mixed
with carbonyldiimidazol in NMP was added to the resin followed by
addition of DBU.
[0991] HPLC method B6:
[0992] RT=29.8 min
[0993] LCMS: m/z=1161.2 (M+4H).sup.4+
[0994] Calculated MW=4640.2
Example 52
[Aib8,Glu22,Arg26,Glu30,Pro37]GLP-1-((7-37)Lys
(2-(2-(3-(2-(2-(2-(2-(2-(2-(2-(2-(2-(2-(2-(2-[4-(S)-carboxy-4-(4-(S)-carb-
oxy-4-(4-{4-[16-(Tetrazol-5-yl)hexadecanoylsulfamoyl]butanoylamino}butanoy-
lamino)
butyrylamino)butyrylamino]ethoxy)ethoxy)ethoxy)ethoxy)ethoxy)ethox-
y)ethoxy)ethoxy)ethoxy)ethoxy)ethoxy)ethoxy)propionylamino)ethoxy)ethoxy)
peptide
##STR00091##
[0996] Preparation method: The peptide was prepared on an Apex396
from Advanced Chemtech and attachment of thioamide linker was
achieved in two steps. 4-sulfamoylbutyric acid was first coupled
the resin using DIC and HOAt/HOBt (1:1). Then,
16-(1H-tetrazol-5-yl)hexadecanoic acid mixed with
carbonyldiimidazol in NMP was added to the resin followed by
addition of DBU. Otherwise is the same protocol described in the
beginning of the example section.
[0997] HPLC (method B6):
[0998] RT=30 min
[0999] LCMS: m/z=XX (M+4H).sup.4+: 1274
[1000] Calculated (M+H).sup.+=5096
Example 53
N-alpha37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonadec-
anoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)ace-
tylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Glu22,Arg26,Arg34,epsilon-Lys37]GLP-1-(7-37)
##STR00092##
[1002] Preparation method: B, in similar fashion as described for
example 7.
[1003] HPLC method 2_B6.sub.--1:
[1004] RT=37.05 min
[1005] LCMS: m/z=1106.3 (M+4H).sup.4+
[1006] Calculated (M)=4423.1
Example 54
N-alpha8-[2-(4-imidazolyl)acetyl]N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carb-
oxy-4-({trans-4-[(19-carboxynonadecanoylamino)methyl]cyclohexanecarbonyl}a-
mino)butyrylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl]
[Glu22,Arg26,Arg34,Lys37]GLP-1-(8-37)
##STR00093##
[1008] Preparation method: B
[1009] The peptide was eluted at 68% acetonitrile.
[1010] Structure confirmed by MALDI-MS
[1011] Calculated MW=4409.1
Example 55
[DesaminoHis7,Glu22,Arg26,34]-GLP-1(7-37)-Lys-(2-{2-[2-((S)-4-carboxy-4-{[-
1-(19-carboxynonadecanoyl)piperidine-4-carbonyl]amino}butyrylamino)ethoxy]-
ethoxy}acetyl) peptide
##STR00094##
[1013] Preparation method: B, in similar fashion as described for
example 7.
[1014] HPLC method 03_B6.sub.--1:
[1015] RT=35.58 min
[1016] LCMS: m/z=1077.8 (M+4H).sup.4+
[1017] Calculated (M)=4306.9
Example 56
[DesaminoHis7,Glu22,Arg26,34]-GLP-1(7-37)-Lys-[2-(2-{2-[2-(2-{2-[4-Carboxy-
-4-({4-[(19-carboxynonadecanoylamino)methyl]cyclohexanecarbonyl}amino)buty-
rylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl]
peptide
##STR00095##
[1019] Preparation method: B, in similar fashion as described for
example 7.
[1020] HPLC method 02_B6.sub.--1:
[1021] RT=34.40 min
[1022] LCMS: m/z=1120.8 (M+4H).sup.4+
[1023] Calculated (M)=4480.1
Example 57
[DesaminoHis7,Glu22,Arg26,34]-GLP-1(7-37)-Lys((S)-4-carboxy-4-(2-{2-[2-((S-
)-4-carboxy-4-{[1-(19-carboxynonadecanoyl)piperidine-4-carbonyl]amino}buty-
rylamino)ethoxy]ethoxy}acetylamino)butyryl) peptide
##STR00096##
[1025] Preparation method: B, in similar fashion as described for
example 7.
[1026] HPLC method 03_B6.sub.--1:
[1027] RT=35.14 min
[1028] LCMS: m/z=(M+4H).sup.4+
[1029] Calculated (M)=4436.0
Example 58
[DesaminoHis7,Glu22,Arg26,34]-GLP-1(7-37)-Lys-(2-(2-{2-[(S)-4-carboxy-4-(2-
-{2-[2-((S)-4-carboxy-4-{[1-(19-carboxynonadecanoyl)piperidine-4-carbonyl]-
amino}butyrylamino)ethoxy]ethoxy}acetylamino)butyrylamino]ethoxy}ethoxy)ac-
etyl) peptide
##STR00097##
[1031] Preparation method: B, in similar fashion as described for
example 7.
[1032] HPLC method 03_B6.sub.--1:
[1033] RT=34.92 min
[1034] LCMS: m/z=1146.3 (M+4H).sup.4+
[1035] Calculated (M)=4581.2
Example 59
[DesaminoHis7,Arg26,34]-GLP-1(7-37)-Lys(2-{2-[2-(2-{2-[2-((S)-4-Carboxy-4--
{[1-(19-carboxynonadecanoyl)piperidine-4-carbonyl]amino}butyrylamino)ethox-
y]ethoxy}acetylamino)ethoxy]ethoxy}acetyl) peptide
##STR00098##
[1037] Preparation method: B, in similar fashion as described for
example 7.
[1038] HPLC method 03_B6.sub.--1:
[1039] RT=35.39 min
[1040] LCMS: m/z=1095.8 (M+4H).sup.4+
[1041] Calculated (M)=4380.0
Example 60
N-epsilon37-(2-{2-[2-(2-{2-[2-((S)-4-Carboxy-4-{[1-(19-carboxynonadecanoyl-
)piperidine-4-carbonyl]amino}butyrylamino)ethoxy]ethoxy}acetylamino)ethoxy-
]ethoxy}acetyl) [DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37)
##STR00099##
[1043] Preparation method: B, in similar fashion as described for
example 7.
[1044] HPLC method 03_A1.sub.--1:
[1045] RT=35.73 min
[1046] LCMS: m/z=1081.3 (M+4H).sup.4+
[1047] Calculated (M)=4323.0
Example 61
N-epsilon37-((S)-4-Carboxy-4-{[1-(19-carboxy-nonadecanoyl)-piperidine-4-ca-
rbonyl]-amino}butyryl)
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37)
##STR00100##
[1049] Preparation method: B, in similar fashion as described for
example 7.
[1050] HPLC method 03_B6.sub.--1:
[1051] RT=36.28 min
[1052] LCMS: m/z=1009.5 (M+4H).sup.4+
[1053] Calculated (M)=4032.6
Example 62
[DesaminoHis7,Glu22,Arg26,34]-GLP-1(7-37)-Lys-((S)-4-Carboxy-4-{[1-(19-car-
boxynonadecanoyl)-piperidine-4-carbonyl]-amino}-butyryl)
peptide
##STR00101##
[1055] Preparation method: B, in similar fashion as described for
example 7.
[1056] HPLC method 03_B6.sub.--1:
[1057] RT=36.06 min
[1058] LCMS: m/z=1041.0 (M+4H).sup.4+
[1059] Calculated (M)=4161.8
Example 63
N-epsilon26-[2-(2-{2-[(R)-4-Carboxy-4-((R)-4-carboxy-4-{12-[4-(16-1H-tetra-
zol-5-yl-hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino)b-
utyrylamino]ethoxy}ethoxy)acetyl]-[Aib8,Arg34]GLP-1(7
##STR00102##
[1061] Preparation method B
[1062] The peptide was eluted at 70% acetonitrile
[1063] Structure confirmed by MALDI-MS
[1064] Calculated MW=4454.1
Example 64
N-epsilon37-{2-[2-(2-{(S)-4-[(S)-4-(12-{4-[16-(2-tert-Butyl-2H-tetrazol-5--
yl)-hexadecanoylsulfamoyl]butyrylamino}dodecanoylamino)-4-carboxybutyrylam-
ino)-4-carboxybutyrylamino}ethoxy)ethoxy]acetyl}
[DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1(7-37)
##STR00103##
[1066] Preparation method B
[1067] The peptide was eluted at 74% acetonitrile
[1068] Structure confirmed by MALDI-MS
[1069] Calculated MW=4652.4
Example 65
N-epsilon37-[2-(2-{2-[(S)-4-Carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1H-tetr-
azol-5-yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino)-
butyrylamino]ethoxy}ethoxy)acetyl]
[DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37)
##STR00104##
[1071] Preparation method B
[1072] The peptide was eluted at 65% acetonitrile
[1073] Structure confirmed by MALDI-MS
[1074] Calculated MW=4524.2
Example 66
N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonad-
ecanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)a-
cetylamino]ethoxy}ethoxy)acetyl]
[Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)
##STR00105##
[1076] Preparation analogous to SPPS Method B.
[1077] HPLC method 02_B6.sub.--1:
[1078] RT=33.58 min
[1079] LCMS: m/z=1114 (M+4H).sup.4+
[1080] Calculated (M)=4451.1
Example 67
[ImPr.sup.7,Arg.sup.26,34,Glu.sup.22]GLP-1-(7-37)Lys[2-(2-[2-((S)-4-((S)-4-
-(12-[4-(16-1H-tetrazol-5-ylhexadecanoylsulfamoyl)butyrylamino]dodecanoyla-
mino)-4-carboxybutyrylamino)-4-carboxybutyrylamino)ethoxy]ethoxy)acetyl]-a-
mid
##STR00106##
[1082] Preparation method A
[1083] The peptide was eluted at 61% acetonitrile
[1084] Structure confirmed by LC-MS
[1085] Calculated MW: (M/3)+1=1550.8 and (M/4)+1=1163.1; (Sciex100
API)
[1086] Found MW: (M/3)+1=1551.9 and (M/4)+1=1164.3; (Sciex100
API)
Example 68
N-epsilon36-[2-(2-[2-(2-[2-(2-((R)-3-[trans-4-((9-Carboxynonadecanoylamino-
]methyl)cyclohexylcarbonylamino]3-carboxypropionylamino)ethoxy)ethoxy]acet-
ylamino)ethoxy]ethoxy)acetyl] [Aib8,Glu22,Gln34]GLP-1-(7-37)
##STR00107##
[1088] Preparation method: A
[1089] HPLC (method B6):
[1090] RT=36.8 min
[1091] MS-TOF: m/z=4468
[1092] Calculated (M+H).sup.+=4469
Example 69
N-epsilon26-[2-(2-[2-(2-[2-(2-((R)-3-[trans-4-((9-Carboxynonadecanoylamino-
]methyl)cyclohexylcarbonylamino]3-carboxypropionylamino)ethoxy)ethoxy]acet-
ylamino)ethoxy]ethoxy)acetyl] [Aib8,Glu22,Gln34]GLP-1-(7-37)
##STR00108##
[1094] Preparation method: A
[1095] HPLC (method B4):
[1096] RT=11.4 min
[1097] LCMS: m/z=1433 (M+3H).sup.3+
[1098] Calculated (M+H).sup.+=4296.9
Example 70
N-epsilon18-[2-(2-[2-(2-[2-(2-((R)-3-[trans-4-((9-Carboxynonadecanoylamino-
]methyl)cyclohexylcarbonylamino]3-carboxypropionylamino)ethoxy)ethoxy]acet-
ylamino)ethoxy]ethoxy)acetyl]
[Aib8,22,35,Lys18,Arg26,34]GLP-1-(7-37)
##STR00109##
[1100] Preparation method: A
[1101] HPLC (method B4):
[1102] RT=11.0 min
[1103] LCMS: m/z=1459 (M+3H).sup.3+
[1104] Calculated (M+H).sup.+=4378.1
Example 71
N-epsilon18-[2-(2-[2-(2-[2-(2-((R)-3-[trans-4-((9-Carboxynonadecanoylamino-
]methyl)cyclohexylcarbonylamino]3-carboxypropionylamino)ethoxy)ethoxy]acet-
ylamino)ethoxy]ethoxy)acetyl][Aib8,Lys18,Glu22,Gln34]GLP-1-(7-37)
##STR00110##
[1106] Preparation method: A
[1107] HPLC (method B4):
[1108] RT=11.4 min
[1109] MS-TOF: m/z=4338
[1110] Calculated (M+H).sup.+=4338
[1111] Microwave-based Liberty peptide synthesizer (CEM Corp.,
North Carolina 0.125 mMol synthesis of A-B-C-D- derivatized Lys
GLP-1 analogues
Example 72
Synthesis of Peptide Amides
[1112] General notice. The starting resin used for the synthesis of
the peptide amides was Rink-Amide resin and either Wang or
chlorotrityl resin was used for peptides with a carboxy
C-terminal
Synthesis of the
N-epsilon26-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl] Derivatization in Example 19
Step 1
[1113] After the peptide sequence was completed, and the mtt
protecting was removed from the epsilon amino group of the Lys, a
0.3M solution of FMOC 8-amino-3,6-dioxaoctanic acid/HOAT in NMP
(2.5 ml) was added to the resin, followed by addition of a 0.75M
solution of DIC in NMP (1 ml). The reaction was heated to 70-75
degrees for 5 min followed by a wash with NMP (4.times.7 ml).
Step 2
[1114] The resin obtained in step 1 was FMOC deprotected using 5%
piperidine in NMP (7 ml) heated for 30 sec drained washed with NMP
(7 ml) followed by additional 5% piperidine in NMP (7 ml) heated
for 3 min at 70-75 degrees followed by washing with NMP (4.times.7
ml).
[1115] A 0.3M solution of FMOC 8-amino-3,6-dioxaoctanic acid/HOAT
in NMP (2.5 ml) was added to the resin followed by addition of a
0.75M solution of DIC in NMP (1 ml). The reaction was heated to
70-75 degrees for 5 min followed by a wash with NMP (4.times.7
ml).
Step 3
[1116] The resin obtained in step 2 was FMOC deprotected using 5%
piperidine in NMP (7 ml) heated for 30 sec drained washed with NMP
(7 ml) followed by additional 5% piperidine in NMP (7 ml) heated
for 3 min at 70-75 degrees followed by washing with NMP (4.times.7
ml).
[1117] A 0.3M solution of FMOC-Glu-OTBU/HOAT in NMP (2.5 ml) was
added to the resin followed by addition of a 0.75M solution of DIC
in NMP (1 ml). The reaction was heated to 70-75 degrees for 5 min
followed by a wash with NMP (4.times.7 ml).
Step 4
[1118] The resin obtained in step 3 was FMOC deprotected using 5%
piperidine in NMP (7 ml) heated for 30 sec drained washed with NMP
(7 ml) followed by additional 5% piperidine in NMP (7 ml) heated
for 3 min at 70-75 degrees followed by washing with NMP (4.times.7
ml).
[1119] A 0.3M solution of FMOC-Tranexamic acid/HOAT in NMP (2.5 ml)
was added to the resin followed by addition of a 0.75M solution of
DIC in NMP (1 ml). The reaction was heated to 70-75 degrees for 5
min followed by a wash with NMP (4.times.7 ml).
Step 5
[1120] The resin obtained in step 4 as FMOC deprotected using 5%
piperidine in NMP (7 ml) heated for 30 sec drained washed with NMP
(7 ml) followed by additional 5% piperidine in NMP (7 ml) heated
for 3 min at 70-75 degrees followed by washing with NMP (4.times.7
ml).
[1121] A 0.3M solution of eicosanedioic acid mono tert.-butyl ester
and HOAT in NMP (2.5 ml) was added to the resin followed by
addition of a 0.75M solution of DIC in NMP (1 ml). The reaction was
heated to 70-75 degrees for 5 min followed by a wash with NMP
(4.times.7 ml).
Step 6
[1122] Removal of Tert Butyl Ester Protection and Cleavage from
Resin
[1123] The resin obtained in step 5 was washed with DCM (4.times.7
ml) and dried. The dry resin was removed from the Liberty and
treated for 2 h with TFA/TIS/water (92.5/5/2.5) cleaving the
peptide from the resin and removing the tert. butyl ester
protection groups. The resin was filtered off and the peptide was
precipitated with diethyl ether, and isolated by centrifugation.
The peptide was redissolved in 30% acetic acid or an alternative
solvent mixture and purified using one of the described
methods.
Synthesis of the
[2-(2-[2-(2-[2-(2-((S)-4-[1-[19-Carboxynonadecanoyl]piperidine-4-carbonyl-
amino]-4-carboxybutyrylamino)ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acety-
l] Derivatization in Example 14
Step 7
[1124] After the peptide sequence was completed, and the mtt
protecting was removed from the epsilon amino group of the Lys, the
resin was modified as described in steps 1-3. The resin was FMOC
deprotected using 5% piperidine in NMP (7 ml) heated for 30 sec
drained washed with NMP (7 ml) followed by additional 5% piperidine
in NMP (7 ml) heated for 3 min at 70-75 degrees followed by washing
with NMP (4.times.7 ml).
[1125] A 0.3M solution of FMOC-isonipecotic acid/HOAT in NMP (2.5
ml) was added to the resin followed by addition of a 0.75M solution
of DIC in NMP (1 ml). The reaction was heated to 70-75 degrees for
5 min followed by a wash with NMP (4.times.7 ml).
Step 8
[1126] The resin obtained in step 7 as FMOC was deprotected using
5% piperidine in NMP (7 ml) heated for 30 sec drained washed with
NMP (7 ml) followed by additional 5% piperidine in NMP (7 ml)
heated for 3 min at 70-75 degrees followed by washing with NMP
(4.times.7 ml).
[1127] A 0.3M solution of eicosanedioic acid mono tert-butyl
ester/HOAT in NMP (2.5 ml) was added to the resin followed by
addition of a 0.75M solution of DIC in NMP (1 ml). The reaction was
heated to 70-75 degrees for 5 min followed by a wash with NMP
(4.times.7 ml) followed by the cleavage procedure described in step
6.
Synthesis of the
N-epsilon31-(2-{2-[2-(2-{2-[2-((S)-3-Carboxy-3-{[1-(19-carboxy-nonadecano-
yl)piperidine-4-carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)et-
hoxy]ethoxy}acetyl) Derivatization in Example 15
Step 9
[1128] The resin obtained in step 2 was FMOC deprotected using 5%
piperidine in NMP (7 ml) heated for 30 sec drained washed with NMP
(7 ml) followed by additional 5% piperidine in NMP (7 ml) heated
for 3 min at 70-75 degrees followed by washing with NMP (4.times.7
ml).
[1129] A 0.3M solution of FMOC-Asp-OTBU/HOAT in NMP (2.5 ml) was
added to the resin followed by addition of a 0.75M solution of DIC
in NMP (1 ml). The reaction was heated to 70-75 degrees for 5 min
followed by a wash with NMP (4.times.7 ml).
Step 10
[1130] The resin obtained in step 9 is followed by Step 7 attaching
the FMOC isonipecotic acid followed by step 8 attaching the
eicosanedioic acid mono tert.-butyl ester finalising the synthesis
by deprotection as described in Step 6
Synthesis of the
N-epsilon26-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynona-
decanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}ethoxy)-
acetylamino]ethoxy}ethoxy)acetyl] Derivatization in Example 18
Step 11
[1131]
N-epsilon26-[2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-({trans-4-[(19-carbo-
xynonadecanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy}e-
thoxy)acetylamino]ethoxy}ethoxy)acetyl] derivatization is obtained
following Step 1-3-4-5 and 6
Synthesis of the
N-epsilon26-[(S)-4-Carboxy-4-({trans-4-[(19-carboxynonadecanoylamino)meth-
yl]cyclohexanecarbonyl}amino)butyryl] Derivatization in Example
16
Step 12
[1132] A 0.3M solution of FMOC-Glu-OTBU/HOAT in NMP (2.5 ml) was
added to the resin after Mtt deprotection followed by addition of a
0.75M solution of DIC in NMP (1 ml). The reaction was heated to
70-75 degrees for 5 min followed by a wash with NMP (4.times.7 ml),
followed by step 4-5 and 6
Step 13
[1133] For attachment of described A part of the albumin binder the
procedure in step 8 can be used replacing eicosanedioic acid mono
tert.-butyl ester with the appropriate A as an acid.
Step 14
[1134] For attachment of described B part of the albumin binder the
procedure in step 7 can be used replacing the FMOC-Isonipecotic
acid with the appropriate B as acid
Step 15
[1135] For attachment of described C part of the albumin binder the
procedure in step 9 can be used replacing the FMOC-Asp-OTBU acid
with the appropriate C as an acid.
Step 16
[1136] For attachment of described D part of the albumin binder the
procedure in step 1 can be used replacing the FMOC
8-amino-3,6-dioxaoctanic acid with the appropriate D as an
acid.
Biological Findings
[1137] Protraction of GLP-1 Derivatives after i.v. or s.c.
Administration
[1138] The protraction of a number GLP-1 derivatives of the
invention may be determined by monitoring the concentration thereof
in plasma after sc administration to healthy pigs, using the
methods described below. For comparison also the concentration in
plasma of GLP-1(7-37) after sc. administration may be followed. The
protraction of other GLP-1 derivatives of the invention can be
determined in the same way.
Example 73
Pharmacokinetic Testing in Minipigs
[1139] A number of GLP-1 derivatives of the invention (the
compounds of Examples 1, 2, 5, 7, 9, 10, 14, 16, 17, 18, 19, 20,
23, 24, 25, 26, 27, 28, 31, 33, 34, 35, 49, 50, 52, 59, and 63)
were subjected to pharmacokinetic testing in minipigs. Liraglutide
was included in the test for comparative purposes.
[1140] Generally, the test substances are to be dissolved in a
vehicle suitable for subcutaneous or intravenous administration. In
the present study the test substances were administered
subcutaneously. Each animal received a dose of 2 nmol/kg body
weight and the concentration was adjusted so the dosing volume was
approximately 1 ml, using the following vehicle: 50 mM phosphate
buffer with 0.05% w/v Tween 80 (pH approximately 8).
[1141] The study was performed in male Gottingen minipigs from
Ellegaard Gottingen Minipigs ApS. An acclimatisation period of
approximately 6-10 days was allowed before the animals entered the
study. At start of the acclimatisation period the minipigs were
about 5 months old and in the weight range of 7-10 kg.
[1142] The study was conducted in a suitable animal room with a
room temperature set at 21-23.degree. C. and the relative humidity
to .gtoreq.50%. The room was illuminated to give a cycle of 12
hours light and 12 hours darkness. Light was from 06.00 to 18.00
h.
[1143] The animals were housed in pens with straw as bedding, six
together in each pen.
[1144] The animals had free access to domestic quality drinking
water during the study, but were fasted from approximately 4 pm the
day before dosing until approximately 12 hours after dosing.
[1145] The animals were weighed on arrival and on the days of
dosing.
[1146] The animals received a single subcutaneous injection. The
subcutaneous injection was given on the right side of the neck,
approximately 5-7 cm from the ear and 7-9 cm from the middle of the
neck. The injections were given with a stopper on the needle,
allowing 0.5 cm of the needle to be introduced.
[1147] Each test substance was given to typically three but in some
cases two or more animals. A full plasma concentration-time
profile, employing 12-16 sampling points, was obtained from each
animal. Blood samples were collected according to the following
schedule:
After Intravenous Administration (not Applicable in the Present
Study):
[1148] Predose (0), 0.17 (10 minutes), 0.5, 1, 2, 4, 6, 8, 12, 24,
48, 72, 96, and 120 hours after injection. In some cases also 168
hours and 240 hours post injection,
After Subcutaneous Administration:
[1149] Predose (0), 0.5, 1, 2, 4, 6, 8, 12, 24, 48, 72, 96, and 120
hours after injection.
[1150] At each sampling time, 1-2 ml of blood was drawn from each
animal. The blood samples were taken from a jugular vein. In some
cases also 168 hours and 240 hours post injection.
[1151] The blood samples were collected into test tubes containing
a buffer for stabilisation in order to prevent enzymatic
degradation of the GLP-1 derivatives. An example of a suitable
buffer is: EDTA (di-natrium) 0.18 M; Aprotinin 15000 KIE/ml,
Val-Pyr 0.30 mM and with pH adjusted to 7.4)--or directly into EDTA
testtubes (ie Sarstedt Micro tube 1.3 mL K3E). Blood samples were
preferably kept on ice for max 20 min. before centrifugation.
[1152] Plasma was separated using centrifugation (e.g. at 4 dgC, 10
min., 1500 G) and was immediately transferred to Micronic-tubes.
Approximately 200 .mu.l plasma was transferred to each
Micronic-tube. The plasma was stored at -20.degree. C. until
assayed. The plasma samples were assayed for the content of GLP-1
derivatives using a suitable assay, e.g. an immunoassay, such as
ELISA, RIA, RRA, or LCMS assay, as described below.
[1153] For the LCMS assay, plasma samples were analysed by LC-MS on
an LTQ-Orbitrap mass spectrometer (ThermoFisher Scientific, Bremen)
to which Accela HPLC pumps and an autosampler were connected (both
from ThermoFisher). The mass spectrometer was equipped with an
electrospray interface, which was operated in positive ionisation
mode. Analysis was conducted in selected ion monitoring mode with a
window of 5 Da and at a resolution of 30000. For quantification
purposes, the five most intense isotope peaks were extracted with
an accuracy of 5 ppm. Gradient elution was performed on a Jupiter
Proteo column (4.mu.) 90A (50.times.2.0 mm ID). Mobile phases
consisted of A. 0.1% formic acid and B. 0.1% formic acid in
acetonitrile and the flow rate was 0.3 ml/min. Plasma samples were
precipitated with organic solvent. For construction of plasma
standards, compound was spiked to plasma and the plasma standards
were treated as the samples. Quality controls were prepared as the
standards, with accept criteria at 20%.
[1154] The plasma concentration-time profiles were analysed, e.g.
by pharmacokinetic analysis. An example of a suitable analysis tool
is (NCA) using WinNonlin Professional 5.0 (Pharsight Inc., Mountain
View, Calif., USA). NCA was performed using the individual plasma
concentration-time profiles from each animal and terminal half-life
(T1/2) was calculated.
[1155] Except for two compounds, all tested GLP-1 derivatives of
the invention had a half-life after subcutaneous administration in
minipigs in the range of 19-101 hours. And except for three
compounds, all tested GLP-1 derivatives of the invention had a
half-life after subcutaneous administration in minipigs in the
range of 29-101 hours. The half-life of the comparative compound
liraglutide was 18 hours.
[1156] Selected derivatives of the invention may be tested in
Danish Landrace pigs:
Pharmacokinetic Testing of GLP-1 Derivatives in Pigs
[1157] Pigs (50% Duroc, 25% Yorkshire, 25% Danish Landrace, app 40
kg) are fasted from the beginning of the experiment. To each pig
0.5 nmol of test derivative per kg body weight is administered in a
50 .mu.M isotonic solution (5 mM phosphate, pH 7.4, 0.02%
Tween.RTM.-20 (Merck), 45 mg/ml mannitol (pyrogen free, Novo
Nordisk). Blood samples are drawn from a catheter in vena
jugularis. 5 ml of the blood samples are poured into chilled
glasses containing 175 .mu.l of the following solution: 0.18 M
EDTA, 15000 KIE/ml aprotinin (Novo Nordisk) and 0.30 mM
Valine-Pyrrolidide (Novo Nordisk), pH 7.4. Within 30 min, the
samples are centrifuged for 10 min at 5-6000*g. Temperature is kept
at 4.degree. C. The supernatant is pipetted into different glasses
and kept at minus 20.degree. C. until use.
[1158] The plasma concentrations of the peptides are determined in
a sandwich ELISA or by RIA using different mono- or polyclonal
antibodies. Choice of antibodies depends of the GLP-1 derivatives.
The time at which the peak concentration in plasma is achieved
varies within wide limits, depending on the particular GLP-1
derivative selected.
General Assay Protocol for Sandwich ELISA in 96-Wells
Microtiterplate
[1159] Coating buffer (PBS): Phosphate buffered saline, pH7.2
[1160] Wash-buffer (PBS-wash): Phosphate buffered saline, 0.05% v/v
Tween 20, pH 7.2 [1161] Assay-buffer (BSA-buffer): Phosphate
buffered saline, 10 g/l Bovin Serum Albumin [1162] (Fluka 05477),
0.05% v/v Tween 20, pH 7.2 [1163] Streptavidin-buffer Phosphate
buffered saline, 0.5 M NaCl, 0.05% v/v Tween 20, pH 7.2 [1164]
Standard: Individual derivatives in a plasma-matrix [1165] A-TNP:
Nonsens antibody [1166] AMDEX: Streptavin-horseradish-peroxodase
(Amersham RPN4401V) [1167] TMB-substrate: 3,3',5,5'
tetramethylbenzidine (<0.02%), hydrogen peroxide
[1168] The assay was carried out as follows (volumen/well): [1169]
1.) coat with 100 .mu.l catching antibody 5 .mu.g/ml in PBS-buffer
[1170] incubate o/n, 4.degree. C. [1171] 5.times.PBS-wash [1172]
blocked with last wash in minimum 30 minute [1173] then empty the
plate [1174] 2.) 20 .mu.l sample+100 .mu.l biotinylated detecting
antibody 1 .mu.g/ml in BSA-buffer with 10 .mu.g/ml A-TNP [1175]
incubate 2 h, room temperature, on a shaker
.quadrature.5.times.PBS-wash, then empty the plate [1176] 3.) 100
.mu.l AMDEX 1:8000 in Streptavidin-buffer [1177] incubate 45-60
minute, room temperature, on a shaker [1178] 5.times.PBS-wash, then
empty the plate [1179] 4.) 100 .mu.l TMB-substrate [1180] incubate
x minute at room temperature on a shaker [1181] stop the reaction
with 100 .mu.l 4 M H.sub.3PO.sub.4
[1182] Read the absorbance at 450 nm with 620 nm as reference
[1183] The concentration in the samples was calculated from
standard curves.
General Assay Protocol for RIA
[1184] DB-buffer: 80 mM phosphate buffer, 0.1% Human serum albumin,
10 mM EDTA, 0.6 mM thiomersal, pH 7.5 [1185] FAM-buffer: 40 mM
phosphate buffer, 0.1% Human Serum Albumin, 0.6 mM thiomersal, pH
7.5 [1186] Charcoal: 40 mM phosphate buffer, 0.6 mM thiomersal,
16.7% bovine plasma, 15 g/l activated carbon, pH 7.5 (mix the
suspension minimum 1 h before use at 4.degree. C.) [1187] Standard:
Individual derivatives in a plasma-matrix
[1188] The assay was carried out in minisorp tubes 12.times.75 mm
(volumen/tube) as follows:
TABLE-US-00013 Db-buffer SAMPLE Antibody FAM-buf. Tracer Charcoal
H.sub.2O Day 1 Total 100 .mu.L NSB 330 .mu.L 100 .mu.L Sample 300
.mu.L 30 .mu.L 100 .mu.L 100 .mu.L Mix, incubate o/n at 4.degree.
C. Day 2 Total 1.5 mL NSB 1.5 mL Sample 1.5 mL
[1189] Mix--incubate 30 min at 4.degree. C.--centrifuge at 3000
rpm, 30 min--immediately after transfer supernatants to new tubes,
close with stopper and count on gamma-counter for 1 minute.
[1190] The concentration in the samples was calculated from
individual standard curves.
GLP-1 Radio Receptor ASSAY (RRA):
[1191] The method is a radiometric-ligand binding assay using
LEADseeker imaging particles. The assay is composed of membrane
fragments containing the GLP-1 receptor, unlabeled GLP-1 analogues,
human GLP-1 labelled with .sup.125I and PS LEADseeker particles
coated with wheat germ agglutinin (WGA). Cold and
.sup.125I-labelled GLP-1 will compete for the binding to the
receptor. When the LEADseeker particles are added they will bind to
carbohydrates residues on the membrane fragments via the
WGA-residues. The proximity between the .sup.125I-molecules and the
LEADseeker particles causes light emission from the particles. The
LEADseeker will image the emitted light and it will be reversibly
correlated to the amount of GLP-1 analogue present in the
sample.
Reagents & Materials:
[1192] Pre treatment of animal plasma: Animal plasma was heat
treated for 4 hrs at 56.degree. C. and centrifuged at 10.000 rpm
for 10 minutes. Afterwards, Val-Pyr (10 .mu.M) and aprotinin (500
KIE/mL) was added and stored at <-18.degree. C. until use.
[1193] GLP-1 analogues calibrators: GLP-1 analogues were spiked
into heat-treated plasma to produce dilution lines ranging from
approximately 1 .mu.M to 1 pM.
[1194] GLP-1 RRA assay buffer: 25 mM Na-HEPES (pH=7.5), 2.5 mM
CaCl.sub.2, 1 mM MgCl.sub.2, 50 mM NaCl, 0.1% ovalbumin, 0.003%
tween 20, 0.005% bacitracin, 0.05% NaN.sub.3.
[1195] GLP-1 receptor suspension: GLP-1 receptor membrane fragments
were purified from baby hamster kidney (BHK) cells stably
expressing the human pancreatic GLP-1 receptor. Stored
<-80.degree. C. until use.
[1196] WGA-coupled polystyrene LEADseeker imaging beads (RPNQ0260,
Amersham): The beads were reconstituted with GLP-1 RRA assay buffer
to a concentration of 13.3 mg/mL. The GLP-1 receptor membrane
suspension was then added and incubated cold (2-8.degree. C.) at
end-over-end for at least 1 hr prior to use.
[1197] [.sup.125I]-GLP-1(7-36)amide (Novo Nordisk A/S). Stored
<-18.degree. C. until use.
[1198] Ethanol 99.9% vol (De Dansk Spritfabrikker A/S): Stored
<-18.degree. C. until use.
[1199] MultiScreen.RTM. Solvinert 0.45 .mu.m hydrophobic PTFE
plates (MSRPN0450, Millipore Corp.)
[1200] Poly propylene plates (cat. no. 650201, Greiner Bio-One)
[1201] White polystyrene 384-well plates (cat. no. 781075, Greiner
Bio-One)
Apparatus:
[1202] Horizontal plate mixer
[1203] Centrifuge with a standard swinging-bucket microtitre plate
rotor assembly
[1204] UltraVap--Drydown Sample Concentrator (Porvair)
[1205] LEADseeker.TM. Multimodality Imaging System (Amersham)
Assay Procedure:
Sample Preparation:
[1206] Mount the MultiScreen.RTM. Solvinert filter plate on a
chemical-comparable receiver plate (i.e. poly propylene plates) to
collect the filtrate.
[1207] Add 150 .mu.L ice-cold ethanol 99.9% into the empty wells of
the MultiScreen.RTM. Solvinert filter plate followed by 50 .mu.L
calibrator or plasma sample. Place the storage lid on the filter
plate.
[1208] Incubate 15 minutes at 18-22.degree. C. on a horizontal
plate mixer.
[1209] Place the assembled filter and receiver plate, with the lid,
into a standard swinging-bucket microtitre plate rotor assembly.
The filtrate is then collected in the empty wells of the receiver
plate at 1500 rpm for 2 minutes.
[1210] Dry down the filtrate by using the UltraVap with heated
(40.degree. C.) N.sub.2 for duration of 15 minutes. Reconstitute
the dry material by adding 100 .mu.L GLP-1 RRA assay buffer into
each well. Incubate for 5 minutes on a horizontal mixer.
GLP-1 Radio Receptor Assay:
[1211] Use the following pipetting scheme and white polystyrene
384-well plates: [1212] 35 .mu.L GLP-1 RRA assay buffer [1213] 5
.mu.L reconstituted filtrate. [1214] 10 .mu.L
[.sup.125I]GLP-1(7-36)amide. The stock solution was diluted in
GLP-1 RRA assay buffer to 20.000 cpm/well prior to use. [1215] 15
.mu.L GLP-1 receptor membrane fragments (.apprxeq.0.5 .mu.g/well)
pre-coated to WGA-polystyrene LEADseeker imaging beads (0.2
mg/well)
[1216] Seal the plates and incubate over night at 18-22.degree.
C.
[1217] The light emission from each wells are detected by using the
LEADseeker.TM. Multimodality Imaging System for duration of 10
minutes.
Example 74
Stimulation of cAMP Formation in a Cell Line Expressing the Cloned
Human GLP-1 Receptor
[1218] The potencies of a number of GLP-1 derivatives of the
invention (the compounds of Examples 1-28, 31-37, and 39-71) were
determined as described below, i.e. as the stimulation of the
formation of cyclic AMP (cAMP) in a medium containing the human
GLP-1 receptor. For comparison, the potency of liraglutide was also
determined.
[1219] Purified plasma membranes from a stable transfected cell
line, BHK467-12A (tk-ts13), expressing the human GLP-1 receptor was
stimulated with the GLP-1 derivative in question, and the potency
of cAMP production was measured using the AlphaScreen.TM. cAMP
Assay Kit from Perkin Elmer Life Sciences.
[1220] A stable transfected cell line has been prepared at NN A/S,
Denmark, and a high expressing clone was selected for screening.
The cells were grown at 5% CO.sub.2 in DMEM, 5% FCS, 1% Pen/Strep
(Penicillin/Streptomycin) and 0.5 mg/ml of the selection marker
G418.
[1221] Cells at approximate 80% confluence were washed 2.times.
with PBS (Phosphate Buffered Saline) and harvested with Versene
(aqueous solution of the tetrasodium salt of
ethylenediaminetetraacetic acid), centrifuged 5 min at 1000 rpm and
the supernatant removed. The additional steps were all made on ice.
The cell pellet was homogenized by the Ultrathurax for 20-30 sec.
in 10 ml of Buffer 1 (20 mM Na-HEPES, 10 mM EDTA, pH=7.4),
centrifuged 15 min at 20.000 rpm and the pellet resuspended in 10
ml of Buffer 2 (20 mM Na-HEPES, 0.1 mM EDTA, pH=7.4). The
suspension was homogenized for 20-30 sec and centrifuged 15 min at
20.000 rpm. Suspension in Buffer 2, homogenization and
centrifugation was repeated once and the membranes were resuspended
in Buffer 2 and ready for further analysis or stored at -80.degree.
C.
[1222] The functional receptor assay was carried out by measuring
the peptide induced cAMP production by The AlphaScreen Technology.
The basic principle of The AlphaScreen Technology is a competition
between endogenous cAMP and exogenously added biotin-cAMP. The
capture of cAMP is achieved by using a specific antibody conjugated
to acceptor beads. Formed cAMP was counted and measured at a
AlphaFusion Microplate Analyzer. The EC.sub.50 values were
calculated using the Graph-Pad Prism software (version 5).
[1223] Except for six compounds, all tested GLP-1 derivatives of
the invention were found to have potencies (EC.sub.50) below
4.00.
Example 75
Affinity to the GLP-1 Receptor at High Vs. Low Albumin
[1224] The binding affinity of GLP-1 peptides to the human GLP-1
receptor was measured by way of its displacement of .sup.125I-GLP-1
from the receptor.
[1225] In order to test the binding of the peptides to albumin, the
assay was performed with a low concentration of albumin
(0.005%--corresponding to the residual amount thereof in the
tracer), as well as with a high concentration of albumin (2.0%
added).
[1226] A shift in the binding affinity, IC.sub.50, is an indication
that the peptide in question binds to albumin, and thereby a
prediction of a potential protracted pharmacokinetic profile of the
peptide in question in animal models.
Conditions
[1227] Species (in vitro): Hamster
[1228] Biological End Point: Receptor Binding
[1229] Assay Method: SPA
[1230] Receptor: GLP-1 receptor
[1231] Cell Line: BHK tk-ts13
Membrane Purification:
[1232] The cells (approx. 80% confluence) were washed twice in PBS
and harvested (PBS+EDTA or Versene), following which they were
separated by centrifugation at 1000 rpm for 5 min. The cells/cell
pellet must be kept on ice to the extent possible in the subsequent
steps. The cell pellet was homogenised with Ultrathurrax for 20-30
seconds in a suitable amount of Buffer 1 (depending on the amount
of cells, but e.g. 10 ml). The homogenate as centrifuged at 20000
rpm for 15 minutes. The pellet was resuspended (homogenised) in 10
ml Buffer 2 and re-centrifuged. This step was repeated once more.
The resulting pellet was resuspended in Buffer 2, and the protein
concentration was determined. The membranes were stored at
-80.degree. C.
Buffer 1: 20 mM Na-HEPES+10 mM EDTA, pH 7.4
Buffer 2: 20 mM Na-HEPES+0.1 mM EDTA, pH 7.4
Binding Assay:
SPA:
[1233] Test compounds/peptides, membranes, SPA-particles and
[.sup.125I] are diluted in assay buffer. 25 ul (micro liter) of
test compounds/peptides are added to Optiplate. HSA ("high albumin"
experiment), or buffer ("low albumin" experiment), is added (50
ul). Add 5-10 ug protein/sample (50 ul) corresponding to 0.1-0.2 mg
protein/ml (to be preferably optimised for each membrane
preparation). Add SPA-particles (Wheatgerm agglutinin SPA beads)
RPNQ 0001) 0.5 mg/well (50 ul). Start the incubation with
[I.sup.125]-GLP-1 (final concentration 0.05 nM corresponding to
49.880 DPM, 25 ul). The plates are sealed with PlateSealer.
Incubate for 120 minutes at 30.degree. C. while shaking. The plates
are centrifuged (1500 rpm, 10 min) and counted in TopCounter.
Assay buffer: 50 mM HEPES
5 mM EGTA
5 mM MgCl2
0.005% Tween 20
[1234] pH 7.4
HSA was SIGMA A1653.
[1235] The IC.sub.50 value is read from the curve as the
concentration which displaces 50% of .sup.125I-GLP-1 from the
receptor, and the ratio of [(IC.sub.50/nM) high
HSA]/[(IC.sub.50/nM) ultralow HSA] was determined. Twenty-one of
the tested GLP-1 derivatives had a ratio below 10, twelve in the
range of 10-30, twelve in the range of 30-50, and fourteen in the
range of 50-100.
Example 76
Albumin Binding Affinity
[1236] The affinities of a number of GLP-1 derivatives of the
invention (the compounds of Examples 1-2, 4-16, 22-28, 31, and
33-71) for human serum albumin (HSA) were measured by a competition
scintillation proximity assay (SPA) as described in the
following.
[1237] Streptavidin-SPA beads (GE Healthcare RPNQ0009) were
incubated with biotinylated HSA for 5 hours. The beads were washed
with buffer to remove unbound HSA. The beads were mixed with a
.sup.125I-labeled acylated GLP-1 analogue
(N-epsilon37-[2-(2-[2-((S)-4-((S)-4-(12-[4-(16-(1H-tetrazol-5-yl-
)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino)-4-carboxybutyrylamino-
)-4-carboxybutyrylamino)ethoxy]ethoxy)acetyl]
[Aib8,.sup.125I-Tyr19,Glu22,Arg26,Arg34,Lys37]GLP-1(7-37)-NH.sub.2)
in a buffer containing 100 mM Hepes, 100 mM NaCl, 10 mM MgSO.sub.4,
0.025% Tween-20, pH 7.4. The mixture was pipetted into the wells of
a Perkin Elmer Optiplate-96 6005290 (100 .mu.l per well) and 100
.mu.l of a dilution series of the GLP-1 derivative to be measured
was added in the same buffer. After 20 hours of gentle rocking at
room temperature the plates were centrifuged and counted on a
TopCounter. Bound cpm was plotted as a function of GLP-1 derivative
concentration and the EC.sub.50 value of the competition curve was
used as a measure of the affinity of the derivative for HSA.
[1238] The albumin binding affinities (EC.sub.50, in nM) of various
GLP-1 derivatives of the invention are shown in Table 1 below.
TABLE-US-00014 TABLE 1 Albumin binding affinity Albumin binding
affinity Compound of Example No. (EC.sub.50 /nM) 63, 44, 50, 47,
53, 67, 37, 46, 43, 42, 65, 1-100 68, 64, 34, 66, 38, 39 33, 49,
69, 57, 35, 45, 36, 10, 58 100-150 51, 55, 41, 40, 56, 15, 22, 54,
9, 13 150-300 62, 12, 7, 60, 4, 52, 2, 5, 8, 31, 16, 14, 1 300-800
70, 26, 71, 48, 61, 11, 23, 24, 27, 6 800-2000 59, 28, 25 above
2000
[1239] As it is apparent from Table 1, several of the GLP-1
derivatives of the invention have a high albumin binding affinity
corresponding to an EC.sub.50 of below 2000 nM (the lower the
EC.sub.50, the higher the albumin binding affinity).
Example 77
Dose-Response Study in db/db Mice
[1240] A number of GLP-1 derivatives of the invention (the
compounds of Examples 1, 7, 14, 16, 22, 23, 24, 26, 27, 28, 31, 33,
46, 47, 48, 49, 50, 53, and 59) were tested in a dose-response
study in an obese, diabetic mouse model (db/db mice) as described
in the following.
[1241] Fifty db/db mice (Taconic, Denmark), 10-12 weeks of age,
were housed according to standard animal welfare rules of Novo
Nordisk and were given free access to standard chow (e.g. Altromin
1324, Brogaarden, Gentofte, Denmark) and tap water and kept at
24.degree. C. After 1 week of acclimatisation, the basal blood
glucose was assessed twice. Based on the mean blood glucose values,
42 mice were selected for further experimentation and allocated to
7 groups (n=6) with matching blood glucose levels. The mice were
used in experiments of 3-6 days' duration for up to 4 times,
following which they were euthanized.
[1242] The seven groups received treatment as follows:
1: Vehicle, s.c.
[1243] 2: GLP-1 derivative, 0.3 nmol/kg, s.c. 3: GLP-1 derivative,
1 nmol/kg, s.c. 4: GLP-1 derivative, 3 nmol/kg, s.c. 5: GLP-1
derivative, 10 nmol/kg, s.c. 6: GLP-1 derivative, 30 nmol/kg, s.c.
7: GLP-1 derivative, 100 nmol/kg, s.c.
[1244] Vehicle: 50 mM phosphate, 0.05% tween 80, pH 8. The GLP-1
derivative was dissolved in the vehicle, e.g. to concentrations of
0.05, 0.17, 0.5, 1.7, 5 and 17 nmol/ml and 300 microliter were
administered s.c. per mouse weighing 50 g (6 ml/kg).
[1245] On the day of dosing, the compound in question was dosed at
approximately 9 am (time 0). At time--1/2 h (8.30 am) blood glucose
was assessed, following which the mice were weighed. Blood glucose
was assessed several times on the day of dosing, usually at time 1,
3 and 6 h (10 am, 12 am and 3 pm).
[1246] On the following days, the blood glucose was assessed at
time 24, 48, 72, and 96 h after dosing (i.e. at 9 am on day 2, 3,
4, 5), followed by weighing. In some studies, blood glucose and
body weight was furthermore assessed 120 h (day 6) after
dosing.
[1247] The mice were weighed individually on a digital weight.
[1248] Samples for the measurement of blood glucose were obtained
from the tail tip capillary of conscious mice. Blood, 10 .mu.l, was
collected into heparinised capillaries and transferred to 500 .mu.l
glucose buffer (EBIO buffer solution, Eppendorf, Germany). The
glucose concentration was measured using the glucose oxidase method
(glucose analyser Biosen 5040, EKF Diagnostic, GmbH, Barleben,
Germany). The samples were kept at room temperature for up to 1 h
until analysis. If analysis had to be postponed, samples were kept
at 4.degree. C. for a maximum of 24 h.
[1249] The half-lives (T1/2) were calculated according to the
following mathematical model: Assuming that
(1) the disappearance of the compounds from plasma is
monoexponential; (2) the effect on blood glucose (deltaBG) can be
described by a standard sigmoidal dose-response curve; (3) the
first 6 hours of absorption and distribution are ignored and only
the return of the glucose from the bottom to the baseline (minimum
to 0) is fitted; then the glucose response (Y) (for example
deltaBG) can be described by the following equation:
Y=Bottom+(Top-Bottom)/(1+Dose*exp(-ln 2*t/T1/2)/ED50),
where the variables ED50 and T1/2 are defined as follows: ED50 is
the dose giving rise to half maximal effect on BG (in nmol/kg) T1/2
is the half-life (in hours); and the following are global
Constants: Top (the response after return to baseline glucose), and
Bottom (the response at maximal glucose fall); and the following is
a constant for each data set (each dose): Dose (the administered
dose (in nmol/kg)). All data sets are fitted simultaneously.
[1250] All compounds tested had a half-life (T1/2) in the range of
12-35 hours.
Sequence CWU 1
1
7131PRTHomo sapiensPEPTIDE(1)..(31) 1His Ala Glu Gly Thr Phe Thr
Ser Asp Val Ser Ser Tyr Leu Glu Gly1 5 10 15Gln Ala Ala Lys Glu Phe
Ile Ala Trp Leu Val Lys Gly Arg Gly 20 25 30239PRTArtificial
SequenceSynthetic 2His Ala Glu Gly Thr Phe Thr Ser Asp Val Ser Ser
Tyr Leu Glu Gly1 5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val
Lys Gly Arg Gly Lys 20 25 30Lys Gly Ala Pro Pro Pro Ser
35332PRTArtificial SequenceSynthetic 3His Ala Glu Gly Thr Phe Thr
Ser Asp Val Ser Ser Tyr Leu Glu Gly1 5 10 15Gln Ala Ala Lys Glu Phe
Ile Ala Trp Leu Val Lys Gly Arg Gly Lys 20 25 30439PRTHeloderma
suspectumPEPTIDE(1)..(39) 4His Gly Glu Gly Thr Phe Thr Ser Asp Leu
Ser Lys Gln Met Glu Glu1 5 10 15Glu Ala Val Arg Leu Phe Ile Glu Trp
Leu Lys Asn Gly Gly Pro Ser 20 25 30Ser Gly Ala Pro Pro Pro Ser
35544PRTArtificial SequenceSynthetic 5His Gly Glu Gly Thr Phe Thr
Ser Asp Leu Ser Lys Gln Met Glu Glu1 5 10 15Glu Ala Val Arg Leu Phe
Ile Glu Trp Leu Lys Asn Gly Gly Pro Ser 20 25 30Ser Gly Ala Pro Pro
Ser Lys Lys Lys Lys Lys Lys 35 40632PRTArtificial SequenceSynthetic
6His Ala Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1 5
10 15Gln Ala Ala Arg Glu Phe Ile Ala Trp Leu Val Lys Gly Arg Gly
Lys 20 25 30731PRTArtificial SequenceSynthetic 7His Ala Glu Gly Thr
Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1 5 10 15Gln Ala Ala Arg
Glu Phe Ile Ala Trp Leu Val Lys Gly Gly Lys 20 25 30
* * * * *