U.S. patent application number 12/760891 was filed with the patent office on 2010-10-07 for human monoclonal antibodies against human il-4.
This patent application is currently assigned to NOVARTIS AG. Invention is credited to JOSE M. CARBALLIDO HERRERA, JAN E. DE VRIES, CHRISTOPH SCHWAERZLER.
Application Number | 20100254993 12/760891 |
Document ID | / |
Family ID | 35457817 |
Filed Date | 2010-10-07 |
United States Patent
Application |
20100254993 |
Kind Code |
A1 |
CARBALLIDO HERRERA; JOSE M. ;
et al. |
October 7, 2010 |
HUMAN MONOCLONAL ANTIBODIES AGAINST HUMAN IL-4
Abstract
Antibodies which are specific for human interleukin-4 and their
use in the treatment of IL-4 and/or IgE mediated diseases.
Inventors: |
CARBALLIDO HERRERA; JOSE M.;
(PERCHTOLDSDORF, AT) ; DE VRIES; JAN E.; (WIEN,
AT) ; SCHWAERZLER; CHRISTOPH; (WIEN, AT) |
Correspondence
Address: |
NOVARTIS INSTITUTES FOR BIOMEDICAL RESEARCH, INC.
220 MASSACHUSETTS AVENUE
CAMBRIDGE
MA
02139
US
|
Assignee: |
NOVARTIS AG
|
Family ID: |
35457817 |
Appl. No.: |
12/760891 |
Filed: |
April 15, 2010 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
11632939 |
May 15, 2007 |
7740843 |
|
|
PCT/EP2005/008361 |
Aug 2, 2005 |
|
|
|
12760891 |
|
|
|
|
Current U.S.
Class: |
424/142.1 ;
424/130.1; 435/320.1; 435/325; 530/387.1; 530/388.15;
536/23.53 |
Current CPC
Class: |
A61P 17/04 20180101;
A61P 37/06 20180101; A61P 31/04 20180101; A61P 21/04 20180101; C07K
2317/21 20130101; A61P 1/00 20180101; A61P 43/00 20180101; A61P
7/06 20180101; A61P 37/08 20180101; C07K 2317/92 20130101; A61P
11/06 20180101; A61P 1/04 20180101; A61P 37/00 20180101; C07K
2317/56 20130101; C07K 2317/565 20130101; C07K 16/247 20130101;
A61P 17/00 20180101; A61P 19/02 20180101; A61P 27/14 20180101; A61P
11/02 20180101 |
Class at
Publication: |
424/142.1 ;
530/387.1; 530/388.15; 536/23.53; 435/320.1; 435/325;
424/130.1 |
International
Class: |
A61K 39/395 20060101
A61K039/395; C07K 16/18 20060101 C07K016/18; C07H 21/04 20060101
C07H021/04; C12N 15/74 20060101 C12N015/74; C12N 5/10 20060101
C12N005/10; A61P 11/06 20060101 A61P011/06; A61P 37/08 20060101
A61P037/08 |
Foreign Application Data
Date |
Code |
Application Number |
Aug 3, 2004 |
GB |
0417301.9 |
Aug 3, 2004 |
GB |
0417302.7 |
Aug 3, 2004 |
GB |
0417303.5 |
Aug 3, 2004 |
GB |
0417304.3 |
Aug 3, 2004 |
GB |
0417305.0 |
Aug 3, 2004 |
GB |
0417306.8 |
Claims
1. An isolated human IL-4 specific antibody, or fragment thereof,
which binds to human IL-4 with a dissociation constant K.sub.d of
equal or less than 800 pM.
2. An antibody of claim 1 comprising a) a polypeptide of SEQ ID
NO:1 and a polypeptide of SEQ ID NO:2, or b) a polypeptide of SEQ
ID NO:9 and a polypeptide of SEQ ID NO:10, or c) a polypeptide of
SEQ ID NO:17 and a polypeptide of SEQ ID NO:18, or d) a polypeptide
of SEQ ID NO:25 and a polypeptide of SEQ ID NO:26, or e) a
polypeptide of SEQ ID NO:33 and a polypeptide of SEQ ID NO:34, or
f) a polypeptide of SEQ ID NO:41 and a polypeptide of SEQ ID
NO:42.
3. An antibody of claim 1 comprising a) a polypeptide of SEQ ID
NO:3 and a polypeptide of SEQ ID NO:4, or b) a polypeptide of SEQ
ID NO:11 and a polypeptide of SEQ ID NO:12, or c) a polypeptide of
SEQ ID NO:19 and a polypeptide of SEQ ID NO:20, or d) a polypeptide
of SEQ ID NO:27 and a polypeptide of SEQ ID NO:28, or e) a
polypeptide of SEQ ID NO:35 and a polypeptide of SEQ ID NO:36, or
f) a polypeptide of SEQ ID NO:43 and a polypeptide of SEQ ID
NO:44.
4. The antibody of claim 1 that is monoclonal.
5. Isolated polynucleotides comprising polynucleotides encoding an
antibody of claim 1.
6. Polynucleotides of claim 6 encoding the amino acid sequence of
an antibody of claim 2.
7. Polynucleotides of claim 6 comprising a) a polynucleotide of SEQ
ID NO:5 and a polynucleotide of SEQ ID NO:6, or b) a polynucleotide
of SEQ ID NO:13 and a polynucleotide of SEQ ID NO:14, or c) a
polynucleotide of SEQ ID NO:21 and a polynucleotide of SEQ ID
NO:22, or d) a polynucleotide of SEQ ID NO:29 and a polynucleotide
of SEQ ID NO:30, or e) a polynucleotide of SEQ ID NO:37 and a
polynucleotide of SEQ ID NO:38, or f) a polynucleotide of SEQ ID
NO:45 and a polynucleotide of SEQ ID NO:46.
8. Polynucleotides of claim 6 encoding a) a polypeptide of SEQ ID
NO:7 and SEQ ID NO:8, or b) a polypeptide of SEQ ID NO:15 and SEQ
ID NO:16, or c) a polypeptide of SEQ ID NO:23 and SEQ ID NO:24, or
d) a polypeptide of SEQ ID NO:31 and SEQ ID NO:32, or e) a
polypeptide of SEQ ID NO:39 and SEQ ID NO:40, or f) a polypeptide
of SEQ ID NO:47 and SEQ ID NO:48.
9. An expression vector comprising polynucleotides of claim 6.
10. An expression system comprising a polynucleotide of claims 6
wherein said expression system or part thereof is capable of
producing an antibody of claim 1 when said expression system or
part thereof is present in a compatible host cell.
11. An isolated host cell comprising an expression system of claim
11.
12. Use of an antibody of any one of claims 1 to 5 as a
pharmaceutical.
13. Use of an antibody of any one of claims 1 to 5 for the
manufacture of a medicament for the treatment of diseases mediated
by IL-4 and/or IgE.
14. Use of claim 14 wherein the disease is selected from the group
consisting of atopic dermatitis, allergic asthma and allergic
rhinitis.
15. Use of any one of claims 13 to 15 wherein the antibody is
selected from the group consisting of an human IL-4 monoclonal
antibody, a fragment thereof and an analog thereof.
16. A pharmaceutical composition comprising an antibody of claim 1
in association with at least one pharmaceutically acceptable
excipient.
17. A method of treatment of diseases mediated by IL-4 and/or IgE
which treatment comprises administering to a subject in need of
such treatment an effective amount of an antibody of claim 1.
18. A method of treatment, where in the disease is selected from
the group consisting of atopic dermatitis, allergic asthma and
allergic rhinitis.
Description
[0001] The present invention relates to antibodies which are
specific for human interleukin-4 (hIL-4).
[0002] Allergic diseases such as atopic dermatitis, allergic
rhinitis, asthma and food allergies are characteristically
associated with exacerbated Th2 cell responses to innocuous
environmental antigens (allergens). Allergens are captured by
antigen presenting cells, processed and presented in the context of
MHC Class II molecules to allergen-specific T helper (Th) cells.
Allergen specific Th cells belong to the Th2 phenotype and develop
from precursor T cells under the influence of interleukin-4 (IL-4).
Once Th2 cells are activated, they secrete IL-4 and interleukin-13
(IL-13), which together with surface bound signals induce B cells
to switch to IgE producing plasma cells. IgE molecules bind to high
affinity Fc.epsilon.IR on mast cells and, after subsequent
encounter with allergen, induce mast cell activation and the
release of mediators of allergic reactions. Th2 cytokines also
promote the survival of eosinophils and the growth of mast cells
which, after degranulation, also release additional Th2 cytokines
capable of augmenting IgE production, Th2 cell differentiation and
eosinophil survival. Thus, Th2 cells play a pivotal role in the
induction and development of allergic responses and therefore,
antagonizing their development and/or their effector functions
would be an efficient way to intervene in allergic responses.
[0003] IL-4 and IL-13 share many biological activities due to the
fact that both cytokines use the IL-4 receptor (IL-4R)-alpha chain
as a component of their respective receptor complexes. IL-13
signals through an heterodimeric complex consisting of an IL-13
binding chain (1 L-13R.alpha.1) and the IL-4R.alpha. chain. IL-4
utilizes this IL-4R.alpha./IL-13R.alpha.1 complex, called type II
IL-4R, as an alternative to the type I IL-4R, consisting of
IL-4R.alpha. chain and the common .gamma. chain (c.gamma.) shared
by receptors for IL-2, IL-4, IL-7, IL-9, IL-15 and thymic stromal
lymphopoietin (TSLP). Because T cells do not express 1
L-13R.alpha.1, IL-13 in contrast to IL-4 does not support T cell
proliferation and cannot induce the differentiation of naive human
Th cells towards the Th2 phenotype (see e.g. J. E. de Vries et al.,
Encyclopedia of Hormones and related cell regulators, Academic
Press, 2002). IL-4 plays a pivotal role in T cell proliferation and
thus in the development and maintenance of allergic diseases. IL-4
gene deficient mice or mice lacking IL-4 (see e.g. Kuhn R. et al.,
Science, 1991 (5032) 707:10) or the downstream signaling factor
STATS (see e.g. Kaplan M. H. et al., Immunity, 1996 (3) 313-9) do
not develop significant numbers of Th2 cells and have reduced IgE
responses.
[0004] We have now found antibodies with a high affinity for human
IL-4 and a strong inhibitory potential of IL-4 mediated IgE
synthesis by naive human B cells.
[0005] In one aspect the present invention provides an human IL-4
specific antibody which binds to human IL-4 with a dissociation
constant K.sub.d of equal or less than 800 pM, such as e.g. equal
or less than 200 pM.
[0006] In another aspect the present invention provides an antibody
having a first domain comprising in sequence the hypervariable
regions CDR1, CDR2 and CDR3 and a second domain comprising in
sequence the hypervariable regions CDR1', CDR2' and CDR3' selected
from the group consisting of an antibody wherein [0007] a) said
CDR1 has the amino acid sequence
Gly-Phe-Thr-Phe-Ser-Ser-Tyr-Ala-Met-His (GFTFSSYAMH) (SEQ ID NO:
49), [0008] said CDR2 has the amino acid sequence
Phe-Ile-Trp-Asp-Asp-Gly-Ser-Phe-Lys-Tyr-Tyr-Ala-Glu-Ser-Val-Lys-Gly
(FIWDDGSFKYYAESVKG) (SEQ ID NO: 50), [0009] said CDR3 has the amino
acid sequence Glu-Gly-Ser-Trp-Ser-Pro-Asp-Ile-Phe (EGSWSPDIF) (SEQ
ID NO: 51), [0010] said CDR1' has the amino acid sequence
Ser-Gln-Gly-Ile-Ser-Arg-Ala (SQGISRA) (SEQ ID NO: 52), [0011] said
CDR2' has the amino acid sequence Asp-Ala-Ser (DAS) (SEQ ID NO:
53), [0012] said CDR3' has the amino acid sequence
Phe-Asn-Ser-Tyr-Pro-Ile (FNSYPI) (SEQ ID NO: 54), [0013] b) said
CDR1 has the amino acid sequence
Gly-Phe-Thr-Leu-Ser-Ser-Phe-Gly-Met-His (GFTLSSFGMH) (SEQ ID NO:
55), [0014] said CDR2 has the amino acid sequence
Val-Ile-Trp-Tyr-Asp-Gly-Ser-Asn-Glu-Tyr-Tyr-Ala-Asp-Ser-Val-Lys-Gly
(VIWYDGSNEYYADSVKG) (SEQ ID NO: 56), [0015] said CDR3 has the amino
acid sequence Glu-Gly-Ser-Trp-Ser-Pro-Asp-Ile-Phe (EGSWSPDIF) (SEQ
ID NO: 57), [0016] said CDR1' has the amino acid sequence
Ser-Gln-Gly-Ile-Arg-Ser-Ala (SQGIRSA) (SEQ ID NO: 58), [0017] said
CDR2' has the amino acid sequence Asp-Ala-Ser (DAS) (SEQ ID NO:
53), [0018] said CDR3' has the amino acid sequence
Phe-Asn-Ser-Tyr-Pro-Val (FNSYPV) (SEQ ID NO: 59), [0019] c) said
CDR1 has the amino acid sequence
Gly-Phe-Thr-Leu-Ser-Ser-Tyr-Gly-Met-His (GFTLSSYGMH) (SEQ ID NO:
60), [0020] said CDR2 has the amino acid sequence
Val-Ile-Trp-Tyr-Asp-Gly-Asn-Asn-Gln-Tyr-Tyr-Ala-Asp-Ser-Val-Lys-Gly
(VIWYDGNNQYYADSVKG) (SEQ ID NO: 61), [0021] said CDR3 has the amino
acid sequence Glu-Gly-Ser-Trp-Ser-Pro-Asp-Ile-Phe (EGSWSPDIF) (SEQ
ID NO: 62), [0022] said CDR1' has the amino acid sequence
Ser-Gln-Gly-Ile-Ser-Ser-Tyr (SQGISSY) (SEQ ID NO: 63), said CDR2'
has the amino acid sequence Asp-Ala-Ser (DAS) (SEQ ID NO: 53),
[0023] said CDR3' has the amino acid sequence Phe-Asn-Ser-Tyr-Pro
(FNSYP) (SEQ ID NO: 64), [0024] d) said CDR1 has the amino acid
sequence Gly-Asp-Thr-Phe-Ser-Ser-Tyr-Ala-Ile-Ser (GDTFSSYAIS) (SEQ
ID NO: 65), [0025] said CDR2 has the amino acid sequence
Gly-Ile-Ile-Pro-Val-Ile-Gly-Thr-Val-Asn-Tyr-Glu-Glu-Arg-Phe-Gln--
Asp (GIIPVIGTVNYEERFQD) (SEQ ID NO: 66), [0026] said CDR3 has the
amino acid sequence Glu-Glu-Gly-Phe-Leu (EEGFL) (SEQ ID NO: 67),
[0027] said CDR1' has the amino acid sequence
Ser-Gln-Gly-Ile-Ser-Ser-Ala (SQGISSA) (SEQ ID NO: 68), [0028] said
CDR2' has the amino acid sequence Asp-Ala-Ser (DAS) (SEQ ID NO:
53), [0029] said CDR3' has the amino acid sequence
Phe-Asn-Ser-Tyr-Pro-Leu (FNSYPL) (SEQ ID NO: 69), [0030] e) said
CDR1 has the amino acid sequence
Gly-Phe-Thr-Phe-Ser-Cys-Cys-Gly-Met-His (GFTFSCCGMH) (SEQ ID NO:
70), [0031] said CDR2 has the amino acid sequence
Val-Ile-Trp-Tyr-Asp-Gly-Ser-Asn-Lys-Tyr-Tyr-Ala-Asp-Ser-Val-Lys-Gly
(VIWYDGSNKYYADSVKG) (SEQ ID NO: 71), [0032] said CDR3 has the amino
acid sequence Asp-Ser-Ser-Gly-Ser-Phe-Tyr-Glu-Tyr-Phe (DSSGSFYEYF)
(SEQ ID NO: 72), [0033] said CDR1' has the amino acid sequence
Ser-Gln-Gly-Ile-Asn-Ser-Ala (SQGINSA) (SEQ ID NO: 73, [0034] said
CDR2' has the amino acid sequence Asp-Ala-Ser (DAS) (SEQ ID NO:
53), [0035] said CDR3' has the amino acid sequence
Phe-Asn-Ser-Tyr-Pro-Tyr (FNSYPY) (SEQ ID NO: 74), and [0036] f)
said CDR1 has the amino acid sequence
Gly-Phe-Thr-Phe-Ser-Gly-Tyr-Gly-Met-His (GFTFSGYGMH) (SEQ ID NO:
75), [0037] said CDR2 has the amino acid sequence
Val-Val-Trp-Tyr-Asp-Gly-Gly-Tyr-Lys-Phe-Tyr-Ala-Asp-Ser-Val-Lys-Gly
(VVWYDGGYKFYADSVKG) (SEQ ID NO: 76), [0038] said CDR3 has the amino
acid sequence Asp-Ser-Ser-Gly-Ser-Phe-Tyr-Glu-Tyr-Leu (DSSGSFYEYL)
(SEQ ID NO: 77), [0039] said CDR1' has the amino acid sequence
Ser-Gln-Gly-Ile-Ser-Ser-Ala (SQGISSA) (SEQ ID NO: 78), [0040] said
CDR2' has the amino acid sequence Asp-Ala-Ser (DAS) (SEQ ID NO:
53), [0041] said CDR3' has the amino acid sequence
Phe-Asn-Ser-Tyr-Pro-His (FNSYPH) (SEQ ID NO: 79).
[0042] CDR1, CDR2 and CDR3 are part of the amino acid sequence of
the heavy chain of such antibody and CDRI', CDR2' and CDR3' are
part of the amino acid sequence of the light chain of such
antibody.
[0043] We also have found an antibody comprising: [0044] the amino
acid sequence of the heavy chain of a mature polypeptide of SEQ ID
NO:1 and the amino acid sequence of the light chain of a mature
polypeptide of SEQ ID NO:2, or [0045] the amino acid sequence of
the heavy chain of a mature polypeptide of SEQ ID NO:9 and the
amino acid sequence of the light chain of a mature polypeptide of
SEQ ID NO:10, or [0046] the amino acid sequence of the heavy chain
of a mature polypeptide of SEQ ID NO:17 and the amino acid sequence
of the light chain of a mature polypeptide of SEQ ID NO:18, or
[0047] the amino acid sequence of the heavy chain of a mature
polypeptide of SEQ ID NO:25 and the amino acid sequence of the
light chain of a mature polypeptide of SEQ ID NO:26, or [0048] the
amino acid sequence of the heavy chain of a mature polypeptide of
SEQ ID NO:33 and the amino acid sequence of the light chain of a
mature polypeptide of SEQ ID NO:34, or [0049] the amino acid
sequence of the heavy chain of a mature polypeptide of SEQ ID NO:41
and the amino acid sequence of the light chain of a mature
polypeptide of SEQ ID NO:42.
[0050] In a further aspect the present invention provides an
antibody comprising
a) a polypeptide of SEQ ID NO:1 and a polypeptide of SEQ ID NO:2,
or b) a polypeptide of SEQ ID NO:9 and a polypeptide of SEQ ID
NO:10, or c) a polypeptide of SEQ ID NO: 17 and a polypeptide of
SEQ ID NO: 18, or d) a polypeptide of SEQ ID NO:25 and a
polypeptide of SEQ ID NO:26, or e) a polypeptide of SEQ ID NO:33
and a polypeptide of SEQ ID NO:34, or f) a polypeptide of SEQ ID
NO:41 and a polypeptide of SEQ ID NO:42.
[0051] We further have found an antibody comprising: [0052] the
amino acid sequence of the heavy chain of a polypeptide of SEQ ID
NO:1 further containing a leader sequence (=SEQ ID NO:3) and the
amino acid sequence of the light chain of a polypeptide of SEQ ID
NO:2 further containing a leader sequence (=SEQ ID NO:4), or [0053]
the amino acid sequence of the heavy chain of a polypeptide of SEQ
ID NO:9 further containing a leader sequence (=SEQ ID NO:11) and
the amino acid sequence of the light chain of a polypeptide of SEQ
ID NO:10 further containing a leader sequence (=SEQ ID NO:12), or
[0054] the amino acid sequence of the heavy chain of a polypeptide
of SEQ ID NO:17 further containing a leader sequence (=SEQ ID
NO:19) and the amino acid sequence of the light chain of a
polypeptide of SEQ ID NO:18 further containing a leader sequence
(=SEQ ID NO:20), or [0055] the amino acid sequence of the heavy
chain of a polypeptide of SEQ ID NO:25 further containing a leader
sequence (=SEQ ID NO:27) and the amino acid sequence of the light
chain of a polypeptide of SEQ ID NO:26 further containing a leader
sequence (=SEQ ID NO:28), or [0056] the amino acid sequence of the
heavy chain of a polypeptide of SEQ ID NO:33 further containing a
leader sequence (=SEQ ID NO:35) and the amino acid sequence of the
light chain of a polypeptide of SEQ ID NO:34 further containing a
leader sequence (=SEQ ID NO:36), or [0057] the amino acid sequence
of the heavy chain of a polypeptide of SEQ ID NO:41 further
containing a leader sequence (=SEQ ID NO:43) and the amino acid
sequence of the light chain of a polypeptide of SEQ ID NO:42
further containing a leader sequence (=SEQ ID NO:44).
[0058] In a further aspect the present invention provides an
antibody comprising
a) a polypeptide of SEQ ID NO:3 and a polypeptide of SEQ ID NO:4,
or b) a polypeptide of SEQ ID NO:11 and a polypeptide of SEQ ID
NO:12, or c) a polypeptide of SEQ ID NO:19 and a polypeptide of SEQ
ID NO:20, or d) a polypeptide of SEQ ID NO:27 and a polypeptide of
SEQ ID NO:28, or e) a polypeptide of SEQ ID NO:35 and a polypeptide
of SEQ ID NO:36, or f) a polypeptide of SEQ ID NO:43 and a
polypeptide of SEQ ID NO:44.
[0059] Antibodies provided by the present invention are hereinafter
also designated as "compound(s) of (according to) the present
invention".
[0060] In another aspect the present invention provides a compound
of the present invention which is selected from the group
consisting of an human IL-4 specific monoclonal antibody (hIL-4
mAb), a fragment thereof and an analog thereof.
[0061] An hIL-4 mAb is an antibody which specifically recognizes
human IL-4, i.e. includes antigen binding sites specific for human
IL-4, and which has specifically its CDRs but also other parts of
the heavy and light chain derived from human immunoglobulins. The
antibody may be of any isotype including IgG1, IgG2, IgG3 and IgG4,
preferably of isotype IgG1.
[0062] "A fragment thereof" means a part of the heavy and light
chain variable sequence of a hIL-4 mAb, which retains the same
antigen binding specificity and/or neutralizing ability as the
molecule from which the fragments are derived, e.g. a Fab fragment
or a F(ab').sub.2 fragment derived from hIL-4 mAb. A Fab fragment
contains the entire light chain and amino terminal portions of the
heavy chain; a F(ab').sub.2 fragment is the fragment formed by 2
Fab fragments bound by disulfide bonds. Such fragments can be
obtained by conventional means, e.g. cleavage of the monoclonal
antibodies with the appropriate proteolytic enzymes, papain and/or
pepsin, or by recombinant methods, and the fragments themselves are
useful as therapeutic and/or prophylactic agents.
[0063] "An analog thereof" means a hIL-4 mAb with an amino acid
sequence which is modified by at least one amino acid outside of
the CDR regions, e.g. outside of CDR1, CDR2 and CDR3 of the heavy
chain or outside of CDR1', CDR2' and CDR3' of the light chain. Said
modification includes a chemical modification, a substitution or a
rearrangement of one or a few amino acids, i.e. no more than 10
amino acids, which modification permits the amino acid sequence to
retain the biological characteristics, e.g. antigen specificity and
affinity, of the unmodified sequence. For example silent mutations
can be constructed via substitution to create endonuclease
restriction sites within or surrounding the CDR regions.
[0064] An analog may also arise as allelic variation. An "allelic
variation or modification" is an alteration in the nucleic acid
sequence encoding an antibody of the present invention outside of
the CDR regions. Such alterations or modifications may be due to
the degeneracies of the genetic code or may be liberately
engineered to provide desired characteristics. Such variations or
modifications may or may not result in alterations in any encoded
amino acid sequence, but retain the biological activities, e.g.
antigen specificity and affinity.
[0065] We have also found polynucleotides encoding compounds of the
present invention.
[0066] In another aspect the present invention provides isolated
polynucleotides comprising polynucleotides encoding a compound of
the present invention.
[0067] In another aspect the present invention provides
polynucleotides encoding the amino acid sequence of CDR1, CDR2 and
CDR3 of a compound of the present invention and polynucleotides
encoding the amino acid sequence of CDR1', CDR2' and CDR3' of a
compound of the present invention.
[0068] In another aspect the present invention provides
polynucleotides comprising
a) a polynucleotide of SEQ ID NO:5 and a polynucleotide of SEQ ID
NO:6, or b) a polynucleotide of SEQ ID NO:13 and a polynucleotide
of SEQ ID NO:14, or c) a polynucleotide of SEQ ID NO:21 and a
polynucleotide of SEQ ID NO:22, or d) a polynucleotide of SEQ ID
NO:29 and a polynucleotide of SEQ ID NO:30, or e) a polynucleotide
of SEQ ID NO:37 and a polynucleotide of SEQ ID NO:38, or f) a
polynucleotide of SEQ ID NO:45 and a polynucleotide of SEQ ID
NO:46.
[0069] In another aspect the present invention provides
polynucleotides encoding
a) a polypeptide of SEQ ID NO:7 and SEQ ID NO:8, or b) a
polypeptide of SEQ ID NO:15 and SEQ ID NO:16, or c) a polypeptide
of SEQ ID NO:23 and SEQ ID NO:24, or d) a polypeptide of SEQ ID
NO:31 and SEQ ID NO:32, or e) a polypeptide of SEQ ID NO:39 and SEQ
ID NO:40, or f) a polypeptide of SEQ ID NO:47 and SEQ ID NO:48. SEQ
ID NO:5 is a polynucleotide encoding an amino acid sequence of SEQ
ID NO:1. SEQ ID NO:6 is a polynucleotide encoding an amino acid
sequence of SEQ ID NO:2. SEQ ID NO:7 is a polynucleotide encoding
an amino acid sequence of SEQ ID NO:3. SEQ ID NO:8 is a
polynucleotide encoding an amino acid sequence of SEQ ID NO:4. SEQ
ID NO:13 is a polynucleotide encoding an amino acid sequence of SEQ
ID NO:9. SEQ ID NO:14 is a polynucleotide encoding an amino acid
sequence of SEQ ID NO:10. SEQ ID NO:15 is a polynucleotide encoding
an amino acid sequence of SEQ ID NO:11. SEQ ID NO:16 is a
polynucleotide encoding an amino acid sequence of SEQ ID NO:12. SEQ
ID NO:21 is a polynucleotide encoding an amino acid sequence of SEQ
ID NO:17: SEQ ID NO:22 is a polynucleotide encoding an amino acid
sequence of SEQ ID NO:18. SEQ ID NO:23 is a polynucleotide encoding
an amino acid sequence of SEQ ID NO:19. SEQ ID NO:24 is a
polynucleotide encoding an amino acid sequence of SEQ ID NO:20. SEQ
ID NO:29 is a polynucleotide encoding an amino acid sequence of SEQ
ID NO:25. SEQ ID NO:30 is a polynucleotide encoding an amino acid
sequence of SEQ ID NO:26. SEQ ID NO:31 is a polynucleotide encoding
an amino acid sequence of SEQ ID NO:27. SEQ ID NO:32 is a
polynucleotide encoding an amino acid sequence of SEQ ID NO:28. SEQ
ID NO:37 is a polynucleotide encoding an amino acid sequence of SEQ
ID NO:33. SEQ ID NO:38 is a polynucleotide encoding an amino acid
sequence of SEQ ID NO:34. SEQ ID NO:39 is a polynucleotide encoding
an amino acid sequence of SEQ ID NO:35. SEQ ID NO:40 is a
polynucleotide encoding an amino acid sequence of SEQ ID NO:36. SEQ
ID NO:45 is a polynucleotide encoding an amino acid sequence of SEQ
ID NO:41. SEQ ID NO:46 is a polynucleotide encoding an amino acid
sequence of SEQ ID NO:42. SEQ ID NO:47 is a polynucleotide encoding
an amino acid sequence of SEQ ID NO:43. SEQ ID NO:48 is a
polynucleotide encoding an amino acid sequence of SEQ ID NO:44.
[0070] A compound of the present invention may be produced by
recombinant DNA techniques. Thus, one or more DNA molecules
encoding the antibody, a fragment thereof or an analog thereof may
be constructed, placed under appropriate control sequences in an
appropriate vector and transferred into a suitable host (organism)
for expression. The compound of the present invention may be
obtained according, e.g. analogously, to a method as conventional
together with the information provided herein, e.g. with the
knowledge of the amino acid sequence of the hypervariable and/or
variable regions and the polynucleotides encoding these regions. A
method for constructing a variable domain gene is e.g. described in
EP 239 400 and may be briefly summarized as follows:
A replicable expression vector including a suitable promoter
operably linked to a polynucleotide sequence of interest, e.g.
encoding at least a variable domain of an immunoglobulin heavy or
light chain comprising CDRs, is prepared, a suitable cell line is
transformed with said expression vector, the transformed cell line
is cultured and the corresponding immunoglobulin is obtained.
[0071] In another aspect the present invention provides an
expression vector comprising a polynucleotide encoding a compound
of the present invention, e.g. at least one polynucleotide of SEQ
ID NO:5, SEQ ID NO: 6, SEQ ID NO:7, SEQ ID No:8, SEQ ID NO:13, SEQ
ID NO:14, SEQ ID NO:15, SEQ ID No:16, SEQ ID NO:21, SEQ ID NO:22,
SEQ ID NO:23, SEQ ID No:24, SEQ ID NO:37, SEQ ID NO:38, SEQ ID
NO:39, SEQ ID No:40, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47 or
SEQ ID No:48.
[0072] Naturally an expression vector can comprise more than one
polynucleotide.
[0073] In another aspect the present invention provides [0074] An
expression system comprising a polynucleotide encoding a compound
of the present invention wherein said expression system or part
thereof is capable of producing a compound of the present
invention, e.g. a hIL-4 mAb, when said expression system or part
thereof is present in a compatible host cell; and [0075] An
isolated host cell comprising an expression system as defined
above.
[0076] Expression vectors, e.g. comprising suitable promoter(s) and
genes encoding heavy and light chain constant parts are known, e.g.
and are commercially available and include e.g. heavy chain vector
IgG1 and light chain vector human kappa. A conventional expression
vector or recombinant plasmid may be produced by placing the
respective polynucleotide in operative association with
conventional regulatory control sequences capable of controlling
the replication and expression in, and/or secretion from, a host
cell. Regulatory sequences include promoter sequences, e.g. CMV
promoter, LCK promoter, and appropriate signal sequences.
[0077] A selected host cell may be transfected by conventional
techniques with the vector of interest to create a transfected host
cell, which then may be cultured by conventional techniques to
produce the compounds of the present invention. Appropriate cell
lines may be found according, e.g. analogously, to a method as
conventional. Appropriate hosts are known or may be found
according, e.g. analogously, to a method as conventional and
include cell cultures or transgenic animals. Suitable host cells or
cell lines for the expression of the compounds of the present
invention are preferably eukaryotic cells such as e.g. CHO, COS, a
fibroblast cell (e.g. 3T3) and myeloid cells among others,
preferably a mammalian cell, such as a CHO cell or SP2/0.
[0078] The compounds of the present invention exhibit
pharmacological activity and are therefore useful as
pharmaceuticals. E.g., the compounds of the present invention
interfere strongly with the binding of IL-4 to an IL-4 receptor and
are herein also referred to as IL-4 blocking or neutralizing
compounds of the present invention, including hIL-4 mAb(s).
Compounds of the present invention show activity and their affinity
can be determined in the TEST: AFFINITY MEASUREMENT as described in
Example 1.
[0079] A compound of the present invention thus shows therapeutic
activity against IL-4 and/or IgE mediated diseases, such as [0080]
various allergic diseases, e.g. including urticaria, allergic
reactions to medication, rhinitis, e.g. allergic rhinitis,
conjunctivitis, e.g. rhinoconjunctivitis, dermatitis, e.g. atopic
dermatitis, asthma, e.g. atopic asthma and allergic asthma,
anaphylactic shock; preferably atopic dermatitis, allergic asthma,
allergic rhinitis, allergic rhinoconjunctivitis, such as allergic
asthma or atopic dermatitis; [0081] autoimmune diseases, including
e.g. Kawasaki disease, Grave's disease, Sjorgen's syndrome,
autoimmune lymphoproliferative syndrome, autoimmune haemolytic
anemia, autoimmune uveitis, myasthenia gravis, Lupus Erythematosis
and Bullous pemphigoid; [0082] disorders of the digestive system in
which IL-4 and/or IgE play a role, including e.g. ulcers, gastric
inflammation, mucosal inflammation, ulcerative colitis, Crohn's
disease, inflammatory bowel disease and other disorders of the
digestive system in which IL-4 and/or IgE play a role; [0083]
diseases wherein IL-4 and/or IgE are overproduced and considered to
contribute to pathology, including e.g. systemic sclerosis
(scleroderma), septic arthritis and reactive arthritis.
[0084] In another aspect the present invention provides a compound
of the present invention, e.g. a hIL-4 mAb, for use as a
pharmaceutical, e.g. against IL-4 and/or IgE mediated diseases,
e.g. allergic diseases, e.g. atopic dermatitis, allergic asthma,
allergic rhinitis, preferably atopic dermatitis.
[0085] In another aspect the present invention provides the use of
the present invention of a compound of the present invention which
is selected from the group consisting of a hIL-4 mAb, a fragment
thereof and an analog thereof.
[0086] For pharmaceutical use a compound of the present invention
includes one or more, preferably one, compounds of the present
invention, e.g. a combination of two or more compounds of the
present invention.
[0087] In another aspect the present invention provides the use of
a compound of the present invention for the manufacture of a
medicament, e.g. a pharmaceutical composition, for the treatment of
diseases mediated by IL-4 and/or IgE, e.g. allergic diseases, e.g.
allergic rhinoconjunctivitis, atopic dermatitis, allergic asthma,
allergic rhinitis, preferably allergic asthma or atopic dermatitis,
such as atopic dermatitis.
[0088] In a further aspect the present invention provides the use
of a compound of the present invention for the manufacture of a
medicament, e.g. a pharmaceutical composition, for the treatment of
a disease as described above, e.g. selected from the group
consisting of atopic dermatitis, allergic asthma and allergic
rhinitis.
[0089] In a further aspect the present invention provides a
compound of the present invention for the uses as mentioned above,
wherein the compound of the present invention is selected from the
group consisting of a hIL-4 mAb, a fragment thereof and an analog
thereof.
[0090] It has, for example been determined that the affinity
constant of a compound of the present invention, e.g. a hIL-4 mAb,
a fragment thereof or an analog thereof, for human IL-4 is equal or
less than 800 pM, e.g. is equal or less than 200 pM, such as of
about 30 pM to about 200 pM, preferably of about 45 pM to about 170
pM, such as about 100 pM, more preferred about 50 pM, such as about
45 pM.
[0091] It has, for example also been determined that the affinity
constant of a compound of the present invention, e.g. a hIL-4 mAb,
a fragment thereof or an analog thereof, for human IL-4 is of 30 pM
to 200 pM, preferably of 45 pM to 170 pM, such as 100 pM, more
preferred 50 pM, such as 45 pM. It is therefore, indicated that for
the treatment of diseases mediated by IL-4, the compounds of the
present invention may be administered to larger mammals, for
example humans, by similar modes of administration at similar
dosages than conventionally used with monoclonal antibodies.
[0092] In another aspect the present invention provides an antibody
which binds to human IL-4 with a dissociation constant of equal or
less than 200 pM, e.g. 30 to 200 pM.
[0093] In a further aspect of the present invention the antibody
for the uses as mentioned above is a hIL-4 mAb, a fragment thereof
or an analog thereof which binds to human IL-4 with a dissociation
constant K.sub.d of equal or less than 200 pM, e.g. 30 to 200
pM.
[0094] In a further aspect the present invention provides a method
of treatment of diseases which are mediated by IL-4 and/or IgE,
e.g. allergic diseases, e.g. atopic dermatitis, allergic asthma,
allergic rhinitis, preferably atopic dermatitis, which treatment
comprises administering to a subject in need of such treatment an
effective amount of a compound of the present invention; e.g. in
the form of a pharmaceutical composition.
[0095] In a further aspect of the present invention a compound of
the present invention is administered in combination with another
pharmaceutically active agent either simultaneously or in
sequence.
[0096] Treatment includes treatment and prophylaxis.
[0097] For such treatment, the appropriate dosage will, of course,
vary depending upon, for example, the chemical nature and the
pharmacokinetic data of an antibody of the present invention
employed, the individual host, the mode of administration and the
nature and severity of the conditions being treated. However, in
general, for satisfactory results in larger mammals, for example
humans, an indicated daily dosage is in the range from, e.g. about,
0.1 ng/kg to, e.g. about, 10 mg/kg, such as from, e.g. about, 100
ng/kg to, e.g. about, 2 mg/kg of a compound of the present
invention; conveniently administered, for example, in divided doses
up to four times a day. A compound of the present invention may be
administered by any conventional route, for example parenterally,
e.g. including intravenous, intradermal, intramuscular,
subcutaneous, intranasal administration, injectable solutions or
suspensions or inhaler powder.
[0098] In another aspect the present invention provides a
pharmaceutical composition comprising a compound of the present
invention in association with at least one pharmaceutical
excipient, e.g. appropriate carrier and/or diluent, e.g. including
fillers, binders, disintegrators, flow conditioners, lubricants,
sugars and sweeteners, fragrances, preservatives, stabilizers,
wetting agents and/or emulsifiers, solubilizers, salts for
regulating osmotic pressure and/or buffers.
[0099] In another aspect the present invention provides a
pharmaceutical composition according to the present invention
further comprising another pharmaceutically active agent.
[0100] Such compositions may be manufactured according, e.g.
analogously to a method as conventional, e.g. by mixing,
granulating, coating, dissolving or lyophilizing processes. Unit
dosage forms may contain, for example, from, e.g. about, 0.5 mg to,
e.g. about, 1000 mg, such as 1 mg to about 500 mg.
[0101] A compound of the present invention may be used for
pharmaceutical treatment according to the present invention alone
or in combination with one or more other pharmaceutically active
agents. Such other pharmaceutically active agents include e.g.
other antibodies, e.g. such as antibodies neutralizing IgE,
cytokines or cytokine receptors, which are chosen according to the
particular condition to be treated.
[0102] Combinations include fixed combinations, in which two or
more pharmaceutically active agents are in the same formulation;
kits, in which two or more pharmaceutically active agents in
separate formulations are sold in the same package, e.g. with
instruction for co-administration; and free combinations in which
the pharmaceutically active agents are packaged separately, but
instruction for simultaneous or sequential administration are
given.
[0103] In another aspect the present invention also provides a
method for diagnosing allergies and other conditions associated
with excess IgE production in a human which comprises
a) contacting a sample of a biological fluid with an antibody of
the present invention, and b) assaying for the occurrence of
binding between said antibody and human IL-4.
[0104] In the following Examples all temperatures are in degrees
Celsius (.degree. C.) and are uncorrected.
[0105] The following abbreviations are used:
FACS Buffer PBS, 2% FCS and 0.2% NaN.sub.3
[0106] FCS fetal calf serum FITC fluoroescein isothiocyanat
IC.sub.50 inhibitory concentration KLH keyhole limpet hemocyanin
mAb monoclonal antibody MTX methotrexate PBS phosphate buffered
saline slgD surface Immunoglobulin D rmIL-3 recombinant murine
interleukin-3 rhIL-4 recombinant human interleukin-4 rhIL-13
recombinant human interleukin-13 rpm revolutions per minute RPMI
Roswell Park Memorial Institute medium RT room temperature
TF-buffer 272 mM sucrose, 1 mM MgCl.sub.2, 7 mM phosphate buffer pH
7.4
EXAMPLES
Example 1
a) Antibody Production
[0107] Plasmids encoding the variable regions of the sequence SEQ
ID NO: 5 or 7 (=heavy chain) and the sequence SEQ ID NO: 6 or 8
(=light chain) of the antibody are cloned into expression cassettes
for human kappa light chains and human IgG1 heavy chains.
[0108] The specificity determining regions are combined with the
necessary elements to generate complete monoclonal antibodies, i.e.
promoter, leader sequence and splice donor sites for splicing to
the antibody constant region exons that are required for the
expression of functional immunoglobulin proteins. The variable
region cassettes for the heavy and light chain antibodies, encoding
for leader sequences, variable region and 3'-prime splice donor
sites for splicing the constant region exons CH1-CH4 and kappa, are
transferred into mammalian expression vectors HC (heavy chain
vector, human IgG1) and LC (light chain vector, human kappa).
[0109] The light chain containing plasmid and the heavy chain
containing plasmid are introduced into Sp2/0 cells in a
co-transfection approach. E.g. for transfection, cells in
exponential growth phase with a viability of about 95% are used.
Cells are washed twice with cold TF-buffer and cell concentration
is adjusted to 2.times.10.sup.7 cells/ml in TF-buffer. 0.8 ml cell
suspension obtained are mixed with 15 .mu.g each of the heavy chain
and light chain plasmid and placed on ice for 10 minutes.
Transfection is done by electroporation using the Biorad Gene
Pulser (280 V and 25 .mu.F). After electroporation, cells are
placed on ice for 15 minutes, transferred into 50 ml cold culture
medium and incubated for 1 day at 37.degree. and 5% CO.sub.2. For
clonal amplification, the G418 resistant cells obtained are
cultivated in the presence of 200 nM MTX. An aliquot of the
heterogeneous cell pool is seeded into 96-well plates at clonal
density of 1 viable cell/well in culture medium containing 200 nM
MTX allowing selection of clonal populations of amplified cells.
Limiting dilution cloning is applied to generate clonal cell lines
after amplification and adaptation to serum-free culture
conditions. Cells are seeded into two 96-well plates at a
concentration of 0.5 cell/well. Wells are screened microscopically
for clonality one day after seeding. Only monoclonal antibodies are
used for further testing.
[0110] The antibody obtained comprises an amino acid sequence of
SEQ ID NO:1 and SEQ ID NO:2.
b) Affinity Measurements
[0111] Affinity measurements of human mAbs of the present invention
are carried on a BIAcore.TM. 2000 instrument. Anti-human IgG is
coated onto a BIAcore sensorchip CM-5 (BIAcore), so that
application of defined amounts of human mAbs results in capturing
on this prepared surface and hence in a change of refractory
properties that are measured. A subsequent application of rhIL-4
results in a further change of the refractory properties, which
allows determination of the association rate (K.sub.on, on rate) as
well as the dissociation rate (K.sub.off, off rate) and the product
of these two, the affinity (K.sub.d, dissociation constant, given
in pM), according to the BIAevaluation 3.0 software. Using several
concentrations of rhIL-4 in BIAbuffer, an affinity of 43 pM of an
mAb as defined by CDRs as described in claim 2a) is determined.
c) Determination of Inhibitory Potential on IL-4 Mediated IgE
[0112] c1) Cell Sources
[0113] Human B cells are isolated from peripheral blood,
respectively, buffy coats by Ficoll-paque density centrifugation,
followed by magnetic separation with MACS beads (Miltenyi Biotech)
specific for human CD19 or human CD22 on an AutoMACS device.
[0114] Naive human B cells are similarly isolated using anti-human
slgD FITC labeled goat F(ab').sub.2 antibodies followed by
anti-FITC MACS beads.
c2) Cell Culture/Maintenance
[0115] Transfectants (BaF/3 transfectants carrying the IL-4R.alpha.
and the IL-13R.alpha.1) are cultured in RPMI 1640 medium
supplemented with Glutamax (Invitrogen), 10% FCS, 1%
penicillin/streptomycin and 10 ng/ml rhIL-4 (Novartis). Cells are
split 1:1 twice weekly, washed with fresh medium without rhIL-4 and
kept in such medium overnight (=starved cells).
[0116] Human ex vivo (naive) B cell cultures are incubated in
X-Vivo medium (Cambrex, XV15) supplemented with Glutamax, 10% FCS,
1% penicillin/streptomycin in 96-well plates (Costar).
c3) BAF Cell Proliferation Assay
[0117] Starved cells as described in b) are collected, washed with
fresh medium, counted and adjusted to 2.times.10.sup.5 cells/ml of
which 100 .mu.l per well are distributed to 96-well plates
(Costar). For titration series the cytokines rhIL-4, rhIL-13 and
rmIL-3 are prepared in 4 times the desired final concentration in
the same medium.
[0118] For titration series antibodies are either used as cell
culture supernatants with ELISA determined concentrations or from
purified material at 4 times the desired concentrations in the same
medium. The pre-dilutions of cytokines and antibodies are mixed at
equal volumes and 100 .mu.l of the pre-mix are transferred to the
well prepared with cells. Controls are set up for background
proliferation (medium without cytokine and without antibody=100%
inhibition) and maximum proliferation (medium with cytokine only=0%
inhibition).
[0119] After overnight incubation at 37.degree. in the presence of
5% CO.sub.2, [methyl-.sup.3H]thimidine (Amersham TRK120) 1 .mu.Ci
per well is added in 10 .mu.l of medium and incubated for 8 hours.
Following a freeze/thaw cycle cells are harvested from the plates
on filter mats using a Tomtek harvester. Filter mats are dried in a
microwave oven for 2 minutes at 650 W and transferred to a sample
bag together with a sheet of Meltilex Scintillation Wax (Wallac).
Wax is melted through the filter and filters obtained are placed
inside appropriate cassettes and inserted into a micro-beta reader
(Wallac) for scintillation counting using a program measuring 30
seconds per field and extrapolating to counts per minutes. An
IC.sub.50 of 30 pM is measured in this test system for the
antibody.
c4) IL-4 Induced CD23 Up-Regulation on B Cells
[0120] MACS separated B cells are adjusted to 0.5-1.times.10.sup.6
cells/ml in XV15 and plated out in 100 .mu.l per well of 96 well
round bottom plates. Cytokines (1 ng/ml final) and mAb (2
.mu.g/ml-2 ng/ml final) are pre-diluted and pre-mixed as described
above and added in 100 .mu.l to reach a final volume of 200
.mu.l.
[0121] After culturing overnight at 37.degree. in the presence of
5% CO.sub.2 cells are transferred to 96-well plates (Costar) and
centrifuged at 2200 rpm (.about.1000.times.g) for 1 minute after
flicking off the supernatant washed with FACS buffer.
[0122] Florochrome labeled mAbs [HLA-DR FITC (Caltag #MHLDRO1
1:800), CD19 PE (Caltag #MHCD1904 1:200) and CD23 APC (Caltag
#MHCD2305 1:200)] are prepared in FACS buffer and distributed in 50
.mu.l per well. After 30-60 minutes incubation at RT, wells are
filled up with FACS buffer, centrifuged and the centrifugation
residue obtained is washed with FACS buffer. Cells are re-suspended
in FACS buffer with 2 .mu.g/ml propidium iodide and analyzed on a
dual laser FacsCalibur flow cytometer (BD Biosciences). Cells are
gated according to their forward scatter and side scatter
properties as well as their ability to exclude propidium iodide and
their CD19 expression. Mean fluorescence intensities and percentage
of cells above arbitrary threshold (set on un-induced cells) in
CD23 expression are determined. Baseline expression (100%
inhibition) is determined on cells without cytokine, whereas 0%
inhibition is set on cells incubated with cytokine but without
mAb.
[0123] An IC.sub.50 of 334 pM for this antibody is determined for
IL-4 induced CD23 expression on the cells as described above in the
presence of 70 pM recombinant human IL-4.
c5) IL-4 Induced IgE Production by Naive B Cells
[0124] Magnetically sorted naive B cells are adjusted to
3.times.10.sup.5 cells per ml in XV15 and plated out in 100 .mu.l
per well of 96-well plates in a 6.times.6 array in the center of
the plate, surrounded by PBS filled wells during the 10 days of
culture at 37.degree. in the presence of 5% CO.sub.2. One plate
each is prepared per mAb to be tested, consisting of 3 wells each
un-induced and induced controls and quintuplicate repeats of mAb
titrations starting at 7 .mu.g/ml and running in 3-fold dilution
down to 29 ng/ml final concentrations added in 50 .mu.l four times
concentrated pre-dilution. Inducing conditions are rhIL-4 at 20
ng/ml plus anti-CD40 mAb (Novartis) at 0.5 .mu.g/ml final
concentrations also added in 50 .mu.l of four times concentrated
pre-dilution. IgE concentrations are determined at the end of the
culture period by a standard sandwich ELISA method.
[0125] An 1050 of 2806 pM for this antibody is determined for IL-4
induced IgE on the cells as described above.
Examples 2 to 6
[0126] Antibodies are obtained analogously as described in example
1 and comprise the following amino acid sequences:
Example 2 is an antibody comprising amino acid sequence SEQ ID NO:9
and SEQ ID NO:10. Example 3 is an antibody comprising amino acid
sequence SEQ ID NO:17 and SEQ ID NO:18. Example 4 is an antibody
comprising amino acid sequence SEQ ID NO:25 and SEQ ID NO:26.
Example 5 is an antibody comprising amino acid sequence SEQ ID
NO:33 and SEQ ID NO:34. Example 6 is an antibody comprising amino
acid sequence SEQ ID NO:41 and SEQ ID NO:42.
[0127] Table 1 summarizes the IC.sub.50 values of the antibodies in
the various test systems as described in Example 1b to c.
TABLE-US-00001 TABLE 1 IC50 [pM] measured in the particular assays
BAF cell K.sub.d [pM] proliferation IL-4 induced CD23 IL-4 induced
IgE Ex. 1 43 30 334 2806 Ex. 2 59 50 463 5339 Ex. 3 89 84 873 7813
Ex. 4 66 688 848 7570 Ex. 5 84 218 2835 9944 Ex. 6 170 167 2869
2648
SEQUENCE LISTING
TABLE-US-00002 [0128] SEQ ID NO: 1 (amino acid sequence of the
mature polypeptide of the heavy chain, underlined amino acids
correspond to CDR1, CDR2 and CDR3)
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVTF
IWDDGSFKYYAESVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREG
SWSPDIFDIWGQGTMVTVSS SEQ ID NO: 2 (amino acid sequence of the
mature polypeptide of the light chain, underlined amino acids
correspond to CDR1, CDR2' and CDR3)
AIQLTQSPSSLSASVGDRVTITCRASQGISRALAWYQQKPGKAPKLLIYD
ASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYPITFGQ GTRLEIKRT SEQ ID
NO: 3 (amino acid sequence of the polypeptide of SEQ ID NO: 1 with
leader sequence, amino acids marked in bold correspond to the
leader sequence) MEFGLNWVFLVALFRGVHCQVQLVESGGGVVQPGRSLRLSCAASGFTFSS
YAMHWVRQAPGKGLEWVTFIWDDGSFKYYAESVKGRFTISRDNSKNTLYL
QMNSLRAEDTAVYYCAREGSWSPDIFDIWGQGTMVTVSS SEQ ID NO: 4 (amino acid
sequence of the polypeptide of SEQ ID NO: 2 with leader sequence,
amino acids marked in bold correspond to the leader sequence)
MDMRVPAQLLGLLLLWLPGARCAIQLTQSPSSLSASVGDRVTITCRASQG
ISRALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSL
QPEDFATYYCQQFNSYPITFGQGTRLEIKRT SEQ ID NO: 5 (nucleotides encoding
an amino acid sequence of SEQ ID NO: 9)
CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTC
CCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTAGCTATGCCA
TGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGACATTT
ATATGGGATGATGGAAGTTTTAAATATTATGCAGAGTCCGTGAAGGGCCG
ATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATTTGCAAATGA
ACAGCCTGAGAGCCGAAGACACGGCTGTGTATTACTGTGCGAGAGAGGGC
AGCTGGTCTCCTGATATATTTGATATCTGGGGCCAAGGGACAATGGTCAC CGTCTCTTCA SEQ
ID NO: 6 (nucleotides encoding an amino acid sequence of SEQ ID NO:
2) GCCATCCAGTTGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGA
CAGAGTCACCATCACTTGCCGGGCAAGTCAGGGCATTAGCAGAGCTTTAG
CCTGGTATCAGCAGAAACCAGGGAAAGCTCCTAAGCTCCTGATCTATGAT
GCCTCCAGTTTGGAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATC
TGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGATTTTG
CAACTTATTACTGTCAACAGTTTAATAGTTACCCCATCACCTTCGGCCAA
GGGACACGACTGGAGATTAAACGAACT SEQ ID NO: 7 (nucleotides encoding an
amino acid sequence of SEQ ID NO: 3)
ATGGAGTTTGGGCTGAACTGGGTTTTCCTCGTTGCTCTTTTCAGAGGTGT
CCACTGTCAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTG
GGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTAGC
TATGCCATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGT
GACATTTATATGGGATGATGGAAGTTTTAAATATTATGCAGAGTCCGTGA
AGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATTTG
CAAATGAACAGCCTGAGAGCCGAAGACACGGCTGTGTATTACTGTGCGAG
AGAGGGCAGCTGGTCTCCTGATATATTTGATATCTGGGGCCAAGGGACAA
TGGTCACCGTCTCTTCA SEQ ID NO: 8 (nucleotides encoding an amino acid
sequence of SEQ ID NO: 4)
ATGGACATGAGGGTCCCCGCTCAGCTCCTGGGGCTTCTGCTGCTCTGGCT
CCCAGGTGCCAGATGTGCCATCCAGTTGACCCAGTCTCCATCCTCCCTGT
CTGCATCTGTAGGAGACAGAGTCACCATCACTTGCCGGGCAAGTCAGGGC
ATTAGCAGAGCTTTAGCCTGGTATCAGCAGAAACCAGGGAAAGCTCCTAA
GCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTCCCATCAAGGT
TCAGCGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTG
CAGCCTGAAGATTTTGCAACTTATTACTGTCAACAGTTTAATAGTTACCC
CATCACCTTCGGCCAAGGGACACGACTGGAGATTAAACGAACT SEQ ID NO: 9 (amino
acid sequence of the mature polypeptide of the heavy chain,
underlined amino acids correspond to CDR1, CDR2 and CDR3)
QVQLVESGGGVVQPGRSLRLSCAASGFTLSSFGMHWVRQAPGKGLEWVAV
IWYDGSNEYYADSVKGRFTTSRDNSKNTLYLQMNSLRAEDTAVYYCAREG
SWSPDIFDIWGQGTMVTVSS SEQ ID NO: 10 (amino acid sequence of the
mature polypeptide of the light chain, underlined amino acids
correspond to CDR1, CDR2' and CDR3)
AIQLTQSPSSLSASVGDRVTITCRTSQGIRSALAWYQQNPGKAPKLLIYD
ASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYPVTFGQ GTRLEIKRT SEQ ID
NO: 11 (amino acid sequence of the polypeptide of SEQ ID NO: 9 with
leader sequence, amino acids marked in bold correspond to the
leader sequence) MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCAASGFTLSS
FGMHWVRQAPGKGLEWVAVIWYDGSNEYYADSVKGRFTTSRDNSKNTLYL
QMNSLRAEDTAVYYCAREGSWSPDIFDIWGQGTMVTVSS SEQ ID NO: 12 (amino acid
sequence of the polypeptide of SEQ ID NO: 10 with leader sequence,
amino acids marked in bold correspond to the leader sequence)
MDMRVPAQLLGLLLLWLPGARCAIQLTQSPSSLSASVGDRVTITCRTSQG
IRSALAWYQQNPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSL
QPEDFATYYCQQFNSYPVTFGQGTRLEIKRT SEQ ID NO: 13 (nucleotides encoding
an amino acid sequence of SEQ ID NO: 9)
CAGGTGCAACTGGTGGAGTCGGGGGGAGGCGTGGTCCAGCCTGGGAGGTC
CCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTAAGTAGCTTTGGCA
TGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCAGTT
ATATGGTATGATGGAAGTAATGAATACTATGCAGACTCCGTGAAGGGCCG
ATTCACCACCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGA
ACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAGAGAGGGC
AGCTGGTCTCCTGATATTTTTGATATCTGGGGCCAAGGGACAATGGTCAC CGTCTCTTCA SEQ
ID NO: 14 (nucleotides encoding an amino acid sequence of SEQ ID
NO: 10) GCCATCCAGTTGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGA
CAGAGTCACCATCACTTGCCGGACAAGTCAGGGCATTCGCAGTGCTTTAG
CCTGGTATCAGCAGAACCCCGGGAAAGCTCCTAAGCTCCTGATCTATGAT
GCCTCCAGTTTGGAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATC
TGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGATTTTG
CAACTTATTACTGTCAACAGTTTAATAGTTACCCCGTCACCTTCGGCCAA
GGGACACGACTGGAGATTAAACGAACT SEQ ID NO: 15 (nucleotides encoding an
amino acid sequence of SEQ ID NO: 11)
ATGGAGTTTGGGCTGAGCTGGGTTTTCCTCGTTGCTCTTTTAAGAGGTGT
CCAGTGTCAGGTGCAACTGGTGGAGTCGGGGGGAGGCGTGGTCCAGCCTG
GGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTAAGTAGC
TTTGGCATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGT
GGCAGTTATATGGTATGATGGAAGTAATGAATACTATGCAGACTCCGTGA
AGGGCCGATTCACCACCTCCAGAGACAATTCCAAGAACACGCTGTATCTG
CAAATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAG
AGAGGGCAGCTGGTCTCCTGATATTTTTGATATCTGGGGCCAAGGGACAA
TGGTCACCGTCTCTTCA SEQ ID NO: 16 (nucleotides encoding an amino acid
sequence of SEQ ID NO: 12)
ATGGACATGAGGGTCCCCGCTCAGCTCCTGGGGCTTCTGCTGCTCTGGCT
CCCAGGTGCCAGATGTGCCATCCAGTTGACCCAGTCTCCATCCTCCCTGT
CTGCATCTGTAGGAGACAGAGTCACCATCACTTGCCGGACAAGTCAGGGC
ATTCGCAGTGCTTTAGCCTGGTATCAGCAGAACCCCGGGAAAGCTCCTAA
GCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTCCCATCAAGGT
TCAGCGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTG
CAGCCTGAAGATTTTGCAACTTATTACTGTCAACAGTTTAATAGTTACCC
CGTCACCTTCGGCCAAGGGACACGACTGGAGATTAAACGAACT SEQ ID NO: 17 (amino
acid sequence of the mature polypeptide of the heavy chain,
underlined amino acids correspond to CDR1, CDR2 and CDR3)
QVQLVESGGGMVQPGRSLRLSCAASGFTLSSYGMHWVRQAPGKGLEWVTV
IWYDGNNQYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREG
SWSPDIFDIWGQGTMVTVSS SEQ ID NO: 18 (amino acid sequence of the
mature polypeptide of the light chain, underlined amino acids
correspond to CDR1, CDR2' and CDR3)
AIQLTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYD
ASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYPITFGQ
GTRLEIKRT SEQ ID NO: 19 (amino acid sequence of the polypeptide of
SEQ ID NO: 17 with leader sequence, amino acids marked in bold
correspond to the leader sequence)
MEFGLSWVFLVALLRGVQCQVQLVESGGGMVQPGRSLRLSCAASGFTLSS
YGMHWVRQAPGKGLEWVTVIWYDGNNQYYADSVKGRFTISRDNSKNTLYL
QMNSLRAEDTAVYYCAREGSWSPDIFDIWGQGTMVTVSS SEQ ID NO: 20 (amino acid
sequence of the polypeptide of SEQ ID NO: 18 with leader sequence,
amino acids marked in bold correspond to the leader sequence)
MDMRVPAQLLGLLLLWLPGARCAIQLTQSPSSLSASVGDRVTITCRASQG
ISSYLAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSL
QPEDFATYYCQQFNSYPITFGQGTRLEIKRT SEQ ID NO: 21 (nucleotides encoding
an amino acid sequence of SEQ ID NO: 17)
CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCATGGTCCAGCCTGGGAGGTC
CCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCCTCAGTAGCTATGGCA
TGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGACAGTT
ATATGGTATGATGGAAATAATCAATACTATGCAGACTCCGTGAAGGGCCG
ATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGA
ACAGCCTGAGAGCCGAGGACACGGCTGTATATTACTGTGCGAGAGAGGGC
AGCTGGTCTCCTGATATTTTTGATATCTGGGGCCAAGGGACAATGGTCAC CGTCTCTTCA SEQ
ID NO: 22 (nucleotides encoding an amino acid sequence of SEQ ID
NO: 18) GCCATCCAGTTGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGA
CAGAGTCACCATCACTTGCCGGGCAAGTCAGGGCATTAGCAGTTATTTAG
CCTGGTATCAGCAGAAACCAGGGAAAGCTCCTAAGCTCCTGATCTATGAT
GCCTCCAGTTTGGAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATC
TGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGATTTTG
CAACTTATTACTGTCAACAGTTTAATAGTTACCCCATCACCTTCGGCCAA
GGGACACGACTGGAGATTAAACGAACT SEQ ID NO: 23 (nucleotides encoding an
amino acid sequence of SEQ ID NO: 19)
ATGGAGTTTGGGCTGAGCTGGGTTTTCCTCGTTGCTCTTTTAAGAGGTGT
CCAGTGTCAGGTGCAGCTGGTGGAGTCTGGGGGAGGCATGGTCCAGCCTG
GGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCCTCAGTAGC
TATGGCATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGT
GACAGTTATATGGTATGATGGAAATAATCAATACTATGCAGACTCCGTGA
AGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTG
CAAATGAACAGCCTGAGAGCCGAGGACACGGCTGTATATTACTGTGCGAG
AGAGGGCAGCTGGTCTCCTGATATTTTTGATATCTGGGGCCAAGGGACAA
TGGTCACCGTCTCTTCA SEQ ID NO: 24 (nucleotides encoding an amino acid
sequence of SEQ ID NO: 20)
ATGGACATGAGGGTCCCCGCTCAGCTCCTGGGGCTTCTGCTGCTCTGGCT
CCCAGGTGCCAGATGTGCCATCCAGTTGACCCAGTCTCCATCCTCCCTGT
CTGCATCTGTAGGAGACAGAGTCACCATCACTTGCCGGGCAAGTCAGGGC
ATTAGCAGTTATTTAGCCTGGTATCAGCAGAAACCAGGGAAAGCTCCTAA
GCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTCCCATCAAGGT
TCAGCGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTG
CAGCCTGAAGATTTTGCAACTTATTACTGTCAACAGTTTAATAGTTACCC
CATCACCTTCGGCCAAGGGACACGACTGGAGATTAAACGAACT SEQ ID NO: 25 (amino
acid sequence of the mature polypeptide of the heavy chain,
underlined amino acids correspond to CDR1, CDR2 and CDR3)
QVQLVQSGAEVKKPGSSVKVSCKASGDTFSSYAISWVRQAPGQGFEWMGG
IIPVIGTVNYEERFQDRVTITADNSTSTAYMELTSLRSEDTAVYFCGREE GFLDYWGQGTLVTVSS
SEQ ID NO: 26 (amino acid sequence of the mature polypeptide of the
light chain, underlined amino acids correspond to CDR 1, CDR2' and
CDR3) AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYD
ASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYPLLTFG GGTKVEIKRT SEQ
ID NO: 27 (amino acid sequence of the polypeptide of SEQ ID NO: 25
with leader sequence, amino acids marked in bold correspond to the
leader sequence) MDWTWRFLFVVAAATGVQSQVQLVQSGAEVKKPGSSVKVSCKASGDTFSS
YAISWVRQAPGQGFEWMGGIIPVIGTVNYEERFQDRVTITADNSTSTAYM
ELTSLRSEDTAVYFCGREEGFLDYWGQGTLVTVSS SEQ ID NO: 28 (amino acid
sequence of the polypeptide of SEQ ID NO: 26 with leader sequence,
amino acids marked in bold correspond to the leader sequence)
MDMRVPAQLLGLLLLWLPGARCAIQLTQSPSSLSASVGDRVTITCRASQG
ISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSL
QPEDFATYYCQQFNSYPLLTFGGGTKVEIKRT SEQ ID NO: 29 (nucleotides
encoding an amino acid sequence of SEQ ID NO: 25)
CAGGTCCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTC
GGTGAAGGTCTCCTGCAAGGCTTCTGGAGACACCTTCAGCAGTTATGCTA
TCAGTTGGGTGCGACAGGCCCCTGGACAAGGGTTTGAGTGGATGGGAGGG
ATCATCCCTGTCATTGGTACAGTAAATTATGAAGAGAGATTCCAGGACAG
AGTCACGATTACCGCGGACAATTCCACGAGCACAGCCTACATGGAGTTGA
CTAGTCTGAGATCTGAAGACACGGCCGTGTATTTTTGTGGGAGAGAAGAG
GGCTTCCTTGACTATTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA SEQ ID NO: 30
(nucleotides encoding an amino acid sequence of SEQ ID NO: 26)
ATGGACATGAGGGTCCCCGCTCAGCTCCTGGGGCTTCTGCTGCTCTGGCT
CCCAGGTGCCAGATGTGCCATCCAGTTGACCCAGTCTCCATCCTCCCTGT
CTGCATCTGTAGGAGACAGAGTCACCATCACTTGCCGGGCAAGTCAGGGC
ATTAGCAGTGCTTTAGCCTGGTATCAGCAGAAACCAGGGAAAGCTCCTAA
GCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTCCCATCAAGGT
TCAGCGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTG
CAGCCTGAAGATTTTGCAACTTATTACTGTCAACAGTTTAATAGTTACCC
TCTTCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAACGTACG SEQ ID NO: 31
(nucleotides encoding an amino acid sequence of SEQ ID NO: 27)
ATGGACTGGACCTGGAGGTTCCTCTTTGTGGTGGCAGCAGCTACAGGTGT
CCAGTCCCAGGTCCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTG
GGTCCTCGGTGAAGGTCTCCTGCAAGGCTTCTGGAGACACCTTCAGCAGT
TATGCTATCAGTTGGGTGCGACAGGCCCCTGGACAAGGGTTTGAGTGGAT
GGGAGGGATCATCCCTGTCATTGGTACAGTAAATTATGAAGAGAGATTCC
AGGACAGAGTCACGATTACCGCGGACAATTCCACGAGCACAGCCTACATG
GAGTTGACTAGTCTGAGATCTGAAGACACGGCCGTGTATTTTTGTGGGAG
AGAAGAGGGCTTCCTTGACTATTGGGGCCAGGGAACCCTGGTCACCGTCT CCTCA SEQ ID NO:
32 (nucleotides encoding an amino acid sequence of SEQ ID NO: 28)
ATGGACATGAGGGTCCCCGCTCAGCTCCTGGGGCTTCTGCTGCTCTGGCT
CCCAGGTGCCAGATGTGCCATCCAGTTGACCCAGTCTCCATCCTCCCTGT
CTGCATCTGTAGGAGACAGAGTCACCATCACTTGCCGGGCAAGTCAGGGC
ATTAGCAGTGCTTTAGCCTGGTATCAGCAGAAACCAGGGAAAGCTCCTAA
GCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTCCCATCAAGGT
TCAGCGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTG
CAGCCTGAAGATTTTGCAACTTATTACTGTCAACAGTTTAATAGTTACCC
TCTTCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAACGTACG SEQ ID NO: 33 (amino
acid sequence of the mature polypeptide of the heavy chain,
underlined amino acids correspond to CDR1, CDR2 and CDR3)
QVQLVESGGGVVQPGRSLRLSCAASGFTFSCCGMHWVRQAPGKGLEWVAV
IWYDGSNKYYADSVKGRFTISRDTSKNTLYLQMNSLRAEDTAVYYCATDS
SGSFYEYFQHWGQGTLVTVSS SEQ ID NO: 34 (amino acid sequence of the
mature polypeptide of the light chain, underlined amino acids
correspond to CDR1, CDR2' and CDR3)
AIQLTQSPSSLSASVGDRVTITCRASQGINSALAWYQQKPGKAPKLLIYD
ASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYPYTFGQ GTKLEIKRT SEQ ID
NO: 35 (amino acid sequence of the polypeptide of SEQ ID NO: 33
with leader sequence, amino acids marked in bold correspond to the
leader sequence) MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCAASGFTFSC
CGMHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDTSKNTLYL
QMNSLRAEDTAVYYCATDSSGSFYEYFQHWGQGTLVTVSS SEQ ID NO: 36 (amino acid
sequence of the polypeptide of SEQ ID NO: 34 with leader sequence,
amino acids marked in bold correspond to the leader sequence)
MDMRVPAQLLGLLLLWLPGARCAIQLTQSPSSLSASVGDRVTITCRASQG
INSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSL
QPEDFATYYCQQFNSYPYTFGQGTKLEIKRT SEQ ID NO: 37 (nucleotides encoding
an amino acid sequence of SEQ ID NO: 33)
CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTC
CCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTTGCTGTGGCA
TGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCAGTT
ATATGGTATGATGGAAGTAATAAATACTATGCAGACTCCGTGAAGGGCCG
ATTCACCATCTCCAGAGACACTTCCAAGAACACGCTGTATCTGCAAATGA
ACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGACAGATAGT
TCGGGGAGTTTTTATGAATACTTCCAGCACTGGGGCCAGGGCACCCTGGT CACCGTCTCCTCA
SEQ ID NO: 38 (nucleotides encoding an amino acid sequence of SEQ
ID NO: 34) GCCATCCAGTTGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGA
CAGAGTCACCATCACTTGCCGGGCAAGTCAGGGCATTAACAGTGCTTTAG
CCTGGTATCAGCAGAAACCAGGGAAAGCTCCTAAGCTCCTGATCTATGAT
GCCTCCAGTTTGGAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATC
TGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGATTTTG
CAACTTATTACTGTCAACAGTTTAATAGTTACCCGTACACTTTTGGCCAG
GGGACCAAGCTGGAGATCAAACGAACT SEQ ID NO: 39 (nucleotides encoding an
amino acid sequence of SEQ ID NO: 35)
ATGGAGTTTGGGCTGAGCTGGGTTTTCCTCGTTGCTCTTTTAAGAGGTGT
CCAGTGTCAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTG
GGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTTGC
TGTGGCATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGT
GGCAGTTATATGGTATGATGGAAGTAATAAATACTATGCAGACTCCGTGA
AGGGCCGATTCACCATCTCCAGAGACACTTCCAAGAACACGCTGTATCTG
CAAATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAC
AGATAGTTCGGGGAGTTTTTATGAATACTTCCAGCACTGGGGCCAGGGCA
CCCTGGTCACCGTCTCCTCA SEQ ID NO: 40 (nucleotides encoding an amino
acid sequence of SEQ ID NO: 36)
ATGGACATGAGGGTCCCCGCTCAGCTCCTGGGGCTTCTGCTGCTCTGGCT
CCCAGGTGCCAGATGTGCCATCCAGTTGACCCAGTCTCCATCCTCCCTGT
CTGCATCTGTAGGAGACAGAGTCACCATCACTTGCCGGGCAAGTCAGGGC
ATTAACAGTGCTTTAGCCTGGTATCAGCAGAAACCAGGGAAAGCTCCTAA
GCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTCCCATCAAGGT
TCAGCGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTG
CAGCCTGAAGATTTTGCAACTTATTACTGTCAACAGTTTAATAGTTACCC
GTACACTTTTGGCCAGGGGACCAAGCTGGAGATCAAACGAACT SEQ ID NO: 41 (amino
acid sequence of the mature polypeptide of the heavy chain,
underlined amino acids correspond to CDR1, CDR2 and CDR3)
QVQLVESGGGVVQPGRSLRLSCAASGFTFSGYGMHWVRQAPGRGLDWVAV
VWYDGGYKFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDS
SGSFYEYLQHWGQGTLVTVSS SEQ ID NO: 42 (amino acid sequence of the
mature polypeptide of the light chain, underlined amino acids
correspond to CDR1, CDR2' and CDR3)
AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIY
DASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYPHFW PGDQAGDQTNCG SEQ
ID NO: 43 (amino acid sequence of the polypeptide of SEQ ID NO: 41
with leader sequence, amino acids marked in bold correspond to the
leader sequence) MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCAASGFTFSG
YGMHWVRQAPGRGLDWVAVVWYDGGYKFYADSVKGRFTISRDNSKNTLYL
QMNSLRAEDTAVYYCARDSSGSFYEYLQHWGQGTLVTVSS SEQ ID NO: 44 (amino acid
sequence of the polypeptide of SEQ ID NO: 42 with leader sequence,
amino acids marked in bold correspond to the leader sequence)
MDMRVPAQLLGLLLLWLPGARCAIQLTQSPSSLSASVGDRVTITCRASQG
ISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSL
QPEDFATYYCQQFNSYPHFWPGDQAGDQTNCG SEQ ID NO: 45 (nucleotides
encoding an amino acid sequence of SEQ ID NO: 41)
CAGGTGCAGTTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTC
CCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTGGCTATGGCA
TGCACTGGGTCCGCCAGGCTCCAGGCAGGGGGCTGGACTGGGTGGCAGTT
GTGTGGTATGATGGAGGTTATAAGTTCTATGCAGACTCCGTGAAGGGCCG
ATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGA
ACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAGAGATAGT
TCGGGGAGTTTTTATGAATACTTACAACATTGGGGCCAGGGCACCCTGGT CACCGTCTCCTCA
SEQ ID NO: 46 (nucleotides encoding an amino acid sequence of SEQ
ID NO: 42) GCCATCCAGTTGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGA
CAGAGTCACCATCACTTGCCGGGCAAGTCAGGGCATTAGCAGTGCTTTAG
CCTGGTATCAGCAGAAACCAGGGAAAGCTCCTAAGCTCCTGATCTATGAT
GCCTCCAGTTTGGAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATC
TGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGATTTTG
CAACTTATTACTGTCAACAGTTTAATAGTTACCCTCACTTTTGGCCAGGG
GACCAAGCTGGAGATCAAACGAACT SEQ ID NO: 47 (nucleotides encoding an
amino acid sequence of SEQ ID NO: 43)
ATGGAGTTTGGGCTGAGCTGGGTTTTCCTCGTTGCTCTTTTAAGAGGTGT
CCAGTGTCAGGTGCAGTTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTG
GGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTGGC
TATGGCATGCACTGGGTCCGCCAGGCTCCAGGCAGGGGGCTGGACTGGGT
GGCAGTTGTGTGGTATGATGGAGGTTATAAGTTCTATGCAGACTCCGTGA
AGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTG
CAAATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAG
AGATAGTTCGGGGAGTTTTTATGAATACTTACAACATTGGGGCCAGGGCA
CCCTGGTCACCGTCTCCTCA SEQ ID NO: 48 (nucleotides encoding an amino
acid sequence of SEQ ID NO: 44)
ATGGACATGAGGGTCCCCGCTCAGCTCCTGGGGCTTCTGCTGCTCTGGCT
CCCAGGTGCCAGATGTGCCATCCAGTTGACCCAGTCTCCATCCTCCCTGT
CTGCATCTGTAGGAGACAGAGTCACCATCACTTGCCGGGCAAGTCAGGGC
ATTAGCAGTGCTTTAGCCTGGTATCAGCAGAAACCAGGGAAAGCTCCTAA
GCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTCCCATCAAGGT
TCAGCGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTG
CAGCCTGAAGATTTTGCAACTTATTACTGTCAACAGTTTAATAGTTACCC
TCACTTTTGGCCAGGGGACCAAGCTGGAGATCAAACGAACT
Sequence CWU 1
1
791120PRTHomo Sapiens 1Gln Val Gln Leu Val Glu Ser Gly Gly Gly Val
Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met His Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45Thr Phe Ile Trp Asp Asp Gly Ser
Phe Lys Tyr Tyr Ala Glu Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu Gly
Ser Trp Ser Pro Asp Ile Phe Asp Ile Trp Gly Gln 100 105 110Gly Thr
Met Val Thr Val Ser Ser 115 1202109PRTHomo Sapiens 2Ala Ile Gln Leu
Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val
Thr Ile Thr Cys Arg Ala Ser Gln Gly Ile Ser Arg Ala 20 25 30Leu Ala
Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr
Asp Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55
60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65
70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Phe Asn Ser Tyr Pro
Ile 85 90 95Thr Phe Gly Gln Gly Thr Arg Leu Glu Ile Lys Arg Thr 100
1053139PRTHomo Sapiens 3Met Glu Phe Gly Leu Asn Trp Val Phe Leu Val
Ala Leu Phe Arg Gly1 5 10 15Val His Cys Gln Val Gln Leu Val Glu Ser
Gly Gly Gly Val Val Gln 20 25 30Pro Gly Arg Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Phe Thr Phe 35 40 45Ser Ser Tyr Ala Met His Trp Val
Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Thr Phe Ile Trp
Asp Asp Gly Ser Phe Lys Tyr Tyr Ala65 70 75 80Glu Ser Val Lys Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn 85 90 95Thr Leu Tyr Leu
Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr
Cys Ala Arg Glu Gly Ser Trp Ser Pro Asp Ile Phe Asp Ile 115 120
125Trp Gly Gln Gly Thr Met Val Thr Val Ser Ser 130 1354131PRTHomo
Sapiens 4Met Asp Met Arg Val Pro Ala Gln Leu Leu Gly Leu Leu Leu
Leu Trp1 5 10 15Leu Pro Gly Ala Arg Cys Ala Ile Gln Leu Thr Gln Ser
Pro Ser Ser 20 25 30Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr
Cys Arg Ala Ser 35 40 45Gln Gly Ile Ser Arg Ala Leu Ala Trp Tyr Gln
Gln Lys Pro Gly Lys 50 55 60Ala Pro Lys Leu Leu Ile Tyr Asp Ala Ser
Ser Leu Glu Ser Gly Val65 70 75 80Pro Ser Arg Phe Ser Gly Ser Gly
Ser Gly Thr Asp Phe Thr Leu Thr 85 90 95Ile Ser Ser Leu Gln Pro Glu
Asp Phe Ala Thr Tyr Tyr Cys Gln Gln 100 105 110Phe Asn Ser Tyr Pro
Ile Thr Phe Gly Gln Gly Thr Arg Leu Glu Ile 115 120 125Lys Arg Thr
1305360DNAHomo Sapiens 5caggtgcagc tggtggagtc tgggggaggc gtggtccagc
ctgggaggtc cctgagactc 60tcctgtgcag cgtctggatt caccttcagt agctatgcca
tgcactgggt ccgccaggct 120ccaggcaagg ggctggagtg ggtgacattt
atatgggatg atggaagttt taaatattat 180gcagagtccg tgaagggccg
attcaccatc tccagagaca attccaagaa cacgctgtat 240ttgcaaatga
acagcctgag agccgaagac acggctgtgt attactgtgc gagagagggc
300agctggtctc ctgatatatt tgatatctgg ggccaaggga caatggtcac
cgtctcttca 3606327DNAHomo Sapiens 6gccatccagt tgacccagtc tccatcctcc
ctgtctgcat ctgtaggaga cagagtcacc 60atcacttgcc gggcaagtca gggcattagc
agagctttag cctggtatca gcagaaacca 120gggaaagctc ctaagctcct
gatctatgat gcctccagtt tggaaagtgg ggtcccatca 180aggttcagcg
gcagtggatc tgggacagat ttcactctca ccatcagcag cctgcagcct
240gaagattttg caacttatta ctgtcaacag tttaatagtt accccatcac
cttcggccaa 300gggacacgac tggagattaa acgaact 3277417DNAHomo Sapiens
7atggagtttg ggctgaactg ggttttcctc gttgctcttt tcagaggtgt ccactgtcag
60gtgcagctgg tggagtctgg gggaggcgtg gtccagcctg ggaggtccct gagactctcc
120tgtgcagcgt ctggattcac cttcagtagc tatgccatgc actgggtccg
ccaggctcca 180ggcaaggggc tggagtgggt gacatttata tgggatgatg
gaagttttaa atattatgca 240gagtccgtga agggccgatt caccatctcc
agagacaatt ccaagaacac gctgtatttg 300caaatgaaca gcctgagagc
cgaagacacg gctgtgtatt actgtgcgag agagggcagc 360tggtctcctg
atatatttga tatctggggc caagggacaa tggtcaccgt ctcttca 4178393DNAHomo
Sapiens 8atggacatga gggtccccgc tcagctcctg gggcttctgc tgctctggct
cccaggtgcc 60agatgtgcca tccagttgac ccagtctcca tcctccctgt ctgcatctgt
aggagacaga 120gtcaccatca cttgccgggc aagtcagggc attagcagag
ctttagcctg gtatcagcag 180aaaccaggga aagctcctaa gctcctgatc
tatgatgcct ccagtttgga aagtggggtc 240ccatcaaggt tcagcggcag
tggatctggg acagatttca ctctcaccat cagcagcctg 300cagcctgaag
attttgcaac ttattactgt caacagttta atagttaccc catcaccttc
360ggccaaggga cacgactgga gattaaacga act 3939120PRTHomo Sapiens 9Gln
Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Leu Ser Ser Phe
20 25 30Gly Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp
Val 35 40 45Ala Val Ile Trp Tyr Asp Gly Ser Asn Glu Tyr Tyr Ala Asp
Ser Val 50 55 60Lys Gly Arg Phe Thr Thr Ser Arg Asp Asn Ser Lys Asn
Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu Gly Ser Trp Ser Pro Asp Ile
Phe Asp Ile Trp Gly Gln 100 105 110Gly Thr Met Val Thr Val Ser Ser
115 12010109PRTHomo Sapiens 10Ala Ile Gln Leu Thr Gln Ser Pro Ser
Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg
Thr Ser Gln Gly Ile Arg Ser Ala 20 25 30Leu Ala Trp Tyr Gln Gln Asn
Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Asp Ala Ser Ser Leu
Glu Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr
Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe
Ala Thr Tyr Tyr Cys Gln Gln Phe Asn Ser Tyr Pro Val 85 90 95Thr Phe
Gly Gln Gly Thr Arg Leu Glu Ile Lys Arg Thr 100 10511139PRTHomo
Sapiens 11Met Glu Phe Gly Leu Ser Trp Val Phe Leu Val Ala Leu Leu
Arg Gly1 5 10 15Val Gln Cys Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln 20 25 30Pro Gly Arg Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Leu 35 40 45Ser Ser Phe Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Val Ile Trp Tyr Asp Gly
Ser Asn Glu Tyr Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr
Thr Ser Arg Asp Asn Ser Lys Asn 85 90 95Thr Leu Tyr Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ala Arg
Glu Gly Ser Trp Ser Pro Asp Ile Phe Asp Ile 115 120 125Trp Gly Gln
Gly Thr Met Val Thr Val Ser Ser 130 13512131PRTHomo Sapiens 12Met
Asp Met Arg Val Pro Ala Gln Leu Leu Gly Leu Leu Leu Leu Trp1 5 10
15Leu Pro Gly Ala Arg Cys Ala Ile Gln Leu Thr Gln Ser Pro Ser Ser
20 25 30Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Thr
Ser 35 40 45Gln Gly Ile Arg Ser Ala Leu Ala Trp Tyr Gln Gln Asn Pro
Gly Lys 50 55 60Ala Pro Lys Leu Leu Ile Tyr Asp Ala Ser Ser Leu Glu
Ser Gly Val65 70 75 80Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr
Asp Phe Thr Leu Thr 85 90 95Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala
Thr Tyr Tyr Cys Gln Gln 100 105 110Phe Asn Ser Tyr Pro Val Thr Phe
Gly Gln Gly Thr Arg Leu Glu Ile 115 120 125Lys Arg Thr
13013360DNAHomo Sapiens 13caggtgcaac tggtggagtc ggggggaggc
gtggtccagc ctgggaggtc cctgagactc 60tcctgtgcag cgtctggatt caccttaagt
agctttggca tgcactgggt ccgccaggct 120ccaggcaagg ggctggagtg
ggtggcagtt atatggtatg atggaagtaa tgaatactat 180gcagactccg
tgaagggccg attcaccacc tccagagaca attccaagaa cacgctgtat
240ctgcaaatga acagcctgag agccgaggac acggctgtgt attactgtgc
gagagagggc 300agctggtctc ctgatatttt tgatatctgg ggccaaggga
caatggtcac cgtctcttca 36014327DNAHomo Sapiens 14gccatccagt
tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga cagagtcacc 60atcacttgcc
ggacaagtca gggcattcgc agtgctttag cctggtatca gcagaacccc
120gggaaagctc ctaagctcct gatctatgat gcctccagtt tggaaagtgg
ggtcccatca 180aggttcagcg gcagtggatc tgggacagat ttcactctca
ccatcagcag cctgcagcct 240gaagattttg caacttatta ctgtcaacag
tttaatagtt accccgtcac cttcggccaa 300gggacacgac tggagattaa acgaact
32715417DNAHomo Sapiens 15atggagtttg ggctgagctg ggttttcctc
gttgctcttt taagaggtgt ccagtgtcag 60gtgcaactgg tggagtcggg gggaggcgtg
gtccagcctg ggaggtccct gagactctcc 120tgtgcagcgt ctggattcac
cttaagtagc tttggcatgc actgggtccg ccaggctcca 180ggcaaggggc
tggagtgggt ggcagttata tggtatgatg gaagtaatga atactatgca
240gactccgtga agggccgatt caccacctcc agagacaatt ccaagaacac
gctgtatctg 300caaatgaaca gcctgagagc cgaggacacg gctgtgtatt
actgtgcgag agagggcagc 360tggtctcctg atatttttga tatctggggc
caagggacaa tggtcaccgt ctcttca 41716393DNAHomo Sapiens 16atggacatga
gggtccccgc tcagctcctg gggcttctgc tgctctggct cccaggtgcc 60agatgtgcca
tccagttgac ccagtctcca tcctccctgt ctgcatctgt aggagacaga
120gtcaccatca cttgccggac aagtcagggc attcgcagtg ctttagcctg
gtatcagcag 180aaccccggga aagctcctaa gctcctgatc tatgatgcct
ccagtttgga aagtggggtc 240ccatcaaggt tcagcggcag tggatctggg
acagatttca ctctcaccat cagcagcctg 300cagcctgaag attttgcaac
ttattactgt caacagttta atagttaccc cgtcaccttc 360ggccaaggga
cacgactgga gattaaacga act 39317120PRTHomo Sapiens 17Gln Val Gln Leu
Val Glu Ser Gly Gly Gly Met Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Phe Thr Leu Ser Ser Tyr 20 25 30Gly Met
His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Thr
Val Ile Trp Tyr Asp Gly Asn Asn Gln Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Ala Arg Glu Gly Ser Trp Ser Pro Asp Ile Phe Asp Ile Trp
Gly Gln 100 105 110Gly Thr Met Val Thr Val Ser Ser 115
12018109PRTHomo Sapiens 18Ala Ile Gln Leu Thr Gln Ser Pro Ser Ser
Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala
Ser Gln Gly Ile Ser Ser Tyr 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro
Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Asp Ala Ser Ser Leu Glu
Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp
Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala
Thr Tyr Tyr Cys Gln Gln Phe Asn Ser Tyr Pro Ile 85 90 95Thr Phe Gly
Gln Gly Thr Arg Leu Glu Ile Lys Arg Thr 100 10519139PRTHomo Sapiens
19Met Glu Phe Gly Leu Ser Trp Val Phe Leu Val Ala Leu Leu Arg Gly1
5 10 15Val Gln Cys Gln Val Gln Leu Val Glu Ser Gly Gly Gly Met Val
Gln 20 25 30Pro Gly Arg Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe
Thr Leu 35 40 45Ser Ser Tyr Gly Met His Trp Val Arg Gln Ala Pro Gly
Lys Gly Leu 50 55 60Glu Trp Val Thr Val Ile Trp Tyr Asp Gly Asn Asn
Gln Tyr Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ser Lys Asn 85 90 95Thr Leu Tyr Leu Gln Met Asn Ser Leu
Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ala Arg Glu Gly
Ser Trp Ser Pro Asp Ile Phe Asp Ile 115 120 125Trp Gly Gln Gly Thr
Met Val Thr Val Ser Ser 130 13520131PRTHomo Sapiens 20Met Asp Met
Arg Val Pro Ala Gln Leu Leu Gly Leu Leu Leu Leu Trp1 5 10 15Leu Pro
Gly Ala Arg Cys Ala Ile Gln Leu Thr Gln Ser Pro Ser Ser 20 25 30Leu
Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser 35 40
45Gln Gly Ile Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys
50 55 60Ala Pro Lys Leu Leu Ile Tyr Asp Ala Ser Ser Leu Glu Ser Gly
Val65 70 75 80Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe
Thr Leu Thr 85 90 95Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr
Tyr Cys Gln Gln 100 105 110Phe Asn Ser Tyr Pro Ile Thr Phe Gly Gln
Gly Thr Arg Leu Glu Ile 115 120 125Lys Arg Thr 13021360DNAHomo
Sapiens 21caggtgcagc tggtggagtc tgggggaggc atggtccagc ctgggaggtc
cctgagactc 60tcctgtgcag cgtctggatt caccctcagt agctatggca tgcactgggt
ccgccaggct 120ccaggcaagg ggctggagtg ggtgacagtt atatggtatg
atggaaataa tcaatactat 180gcagactccg tgaagggccg attcaccatc
tccagagaca attccaagaa cacgctgtat 240ctgcaaatga acagcctgag
agccgaggac acggctgtat attactgtgc gagagagggc 300agctggtctc
ctgatatttt tgatatctgg ggccaaggga caatggtcac cgtctcttca
36022327DNAHomo Sapiens 22gccatccagt tgacccagtc tccatcctcc
ctgtctgcat ctgtaggaga cagagtcacc 60atcacttgcc gggcaagtca gggcattagc
agttatttag cctggtatca gcagaaacca 120gggaaagctc ctaagctcct
gatctatgat gcctccagtt tggaaagtgg ggtcccatca 180aggttcagcg
gcagtggatc tgggacagat ttcactctca ccatcagcag cctgcagcct
240gaagattttg caacttatta ctgtcaacag tttaatagtt accccatcac
cttcggccaa 300gggacacgac tggagattaa acgaact 32723417DNAHomo Sapiens
23atggagtttg ggctgagctg ggttttcctc gttgctcttt taagaggtgt ccagtgtcag
60gtgcagctgg tggagtctgg gggaggcatg gtccagcctg ggaggtccct gagactctcc
120tgtgcagcgt ctggattcac cctcagtagc tatggcatgc actgggtccg
ccaggctcca 180ggcaaggggc tggagtgggt gacagttata tggtatgatg
gaaataatca atactatgca 240gactccgtga agggccgatt caccatctcc
agagacaatt ccaagaacac gctgtatctg 300caaatgaaca gcctgagagc
cgaggacacg gctgtatatt actgtgcgag agagggcagc 360tggtctcctg
atatttttga tatctggggc caagggacaa tggtcaccgt ctcttca 41724393DNAHomo
Sapiens 24atggacatga gggtccccgc tcagctcctg gggcttctgc tgctctggct
cccaggtgcc 60agatgtgcca tccagttgac ccagtctcca tcctccctgt ctgcatctgt
aggagacaga 120gtcaccatca cttgccgggc aagtcagggc attagcagtt
atttagcctg gtatcagcag 180aaaccaggga aagctcctaa gctcctgatc
tatgatgcct ccagtttgga aagtggggtc 240ccatcaaggt tcagcggcag
tggatctggg acagatttca ctctcaccat cagcagcctg 300cagcctgaag
attttgcaac ttattactgt caacagttta atagttaccc catcaccttc
360ggccaaggga cacgactgga gattaaacga act 39325116PRTHomo Sapiens
25Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ser1
5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Asp Thr Phe Ser Ser
Tyr 20 25 30Ala Ile Ser Trp Val Arg Gln Ala Pro Gly Gln Gly Phe Glu
Trp Met 35 40 45Gly Gly Ile Ile Pro Val Ile Gly Thr Val Asn Tyr Glu
Glu Arg Phe 50 55 60Gln Asp Arg Val Thr Ile Thr Ala Asp Asn Ser Thr
Ser Thr Ala Tyr65 70 75 80Met Glu Leu Thr Ser Leu Arg Ser Glu Asp
Thr Ala Val Tyr Phe Cys 85 90 95Gly Arg Glu Glu Gly Phe Leu Asp Tyr
Trp Gly Gln Gly Thr Leu Val 100 105 110Thr Val Ser Ser
11526110PRTHomo Sapiens 26Ala Ile Gln Leu Thr Gln Ser Pro Ser Ser
Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala
Ser Gln Gly Ile Ser Ser Ala
20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu
Ile 35 40 45Tyr Asp Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe
Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser
Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Phe
Asn Ser Tyr Pro Leu 85 90 95Leu Thr Phe Gly Gly Gly Thr Lys Val Glu
Ile Lys Arg Thr 100 105 11027135PRTHomo Sapiens 27Met Asp Trp Thr
Trp Arg Phe Leu Phe Val Val Ala Ala Ala Thr Gly1 5 10 15Val Gln Ser
Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys 20 25 30Pro Gly
Ser Ser Val Lys Val Ser Cys Lys Ala Ser Gly Asp Thr Phe 35 40 45Ser
Ser Tyr Ala Ile Ser Trp Val Arg Gln Ala Pro Gly Gln Gly Phe 50 55
60Glu Trp Met Gly Gly Ile Ile Pro Val Ile Gly Thr Val Asn Tyr Glu65
70 75 80Glu Arg Phe Gln Asp Arg Val Thr Ile Thr Ala Asp Asn Ser Thr
Ser 85 90 95Thr Ala Tyr Met Glu Leu Thr Ser Leu Arg Ser Glu Asp Thr
Ala Val 100 105 110Tyr Phe Cys Gly Arg Glu Glu Gly Phe Leu Asp Tyr
Trp Gly Gln Gly 115 120 125Thr Leu Val Thr Val Ser Ser 130
13528132PRTHomo Sapiens 28Met Asp Met Arg Val Pro Ala Gln Leu Leu
Gly Leu Leu Leu Leu Trp1 5 10 15Leu Pro Gly Ala Arg Cys Ala Ile Gln
Leu Thr Gln Ser Pro Ser Ser 20 25 30Leu Ser Ala Ser Val Gly Asp Arg
Val Thr Ile Thr Cys Arg Ala Ser 35 40 45Gln Gly Ile Ser Ser Ala Leu
Ala Trp Tyr Gln Gln Lys Pro Gly Lys 50 55 60Ala Pro Lys Leu Leu Ile
Tyr Asp Ala Ser Ser Leu Glu Ser Gly Val65 70 75 80Pro Ser Arg Phe
Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 85 90 95Ile Ser Ser
Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln 100 105 110Phe
Asn Ser Tyr Pro Leu Leu Thr Phe Gly Gly Gly Thr Lys Val Glu 115 120
125Ile Lys Arg Thr 13029348DNAHomo Sapiens 29caggtccagc tggtgcagtc
tggggctgag gtgaagaagc ctgggtcctc ggtgaaggtc 60tcctgcaagg cttctggaga
caccttcagc agttatgcta tcagttgggt gcgacaggcc 120cctggacaag
ggtttgagtg gatgggaggg atcatccctg tcattggtac agtaaattat
180gaagagagat tccaggacag agtcacgatt accgcggaca attccacgag
cacagcctac 240atggagttga ctagtctgag atctgaagac acggccgtgt
atttttgtgg gagagaagag 300ggcttccttg actattgggg ccagggaacc
ctggtcaccg tctcctca 34830396DNAHomo Sapiens 30atggacatga gggtccccgc
tcagctcctg gggcttctgc tgctctggct cccaggtgcc 60agatgtgcca tccagttgac
ccagtctcca tcctccctgt ctgcatctgt aggagacaga 120gtcaccatca
cttgccgggc aagtcagggc attagcagtg ctttagcctg gtatcagcag
180aaaccaggga aagctcctaa gctcctgatc tatgatgcct ccagtttgga
aagtggggtc 240ccatcaaggt tcagcggcag tggatctggg acagatttca
ctctcaccat cagcagcctg 300cagcctgaag attttgcaac ttattactgt
caacagttta atagttaccc tcttctcact 360ttcggcggag ggaccaaggt
ggagatcaaa cgtacg 39631405DNAHomo Sapiens 31atggactgga cctggaggtt
cctctttgtg gtggcagcag ctacaggtgt ccagtcccag 60gtccagctgg tgcagtctgg
ggctgaggtg aagaagcctg ggtcctcggt gaaggtctcc 120tgcaaggctt
ctggagacac cttcagcagt tatgctatca gttgggtgcg acaggcccct
180ggacaagggt ttgagtggat gggagggatc atccctgtca ttggtacagt
aaattatgaa 240gagagattcc aggacagagt cacgattacc gcggacaatt
ccacgagcac agcctacatg 300gagttgacta gtctgagatc tgaagacacg
gccgtgtatt tttgtgggag agaagagggc 360ttccttgact attggggcca
gggaaccctg gtcaccgtct cctca 40532396DNAHomo Sapiens 32atggacatga
gggtccccgc tcagctcctg gggcttctgc tgctctggct cccaggtgcc 60agatgtgcca
tccagttgac ccagtctcca tcctccctgt ctgcatctgt aggagacaga
120gtcaccatca cttgccgggc aagtcagggc attagcagtg ctttagcctg
gtatcagcag 180aaaccaggga aagctcctaa gctcctgatc tatgatgcct
ccagtttgga aagtggggtc 240ccatcaaggt tcagcggcag tggatctggg
acagatttca ctctcaccat cagcagcctg 300cagcctgaag attttgcaac
ttattactgt caacagttta atagttaccc tcttctcact 360ttcggcggag
ggaccaaggt ggagatcaaa cgtacg 39633121PRTHomo Sapiens 33Gln Val Gln
Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg1 5 10 15Ser Leu
Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Cys Cys 20 25 30Gly
Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40
45Ala Val Ile Trp Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val
50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Thr Ser Lys Asn Thr Leu
Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95Ala Thr Asp Ser Ser Gly Ser Phe Tyr Glu Tyr Phe
Gln His Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115
12034109PRTHomo Sapiens 34Ala Ile Gln Leu Thr Gln Ser Pro Ser Ser
Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala
Ser Gln Gly Ile Asn Ser Ala 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro
Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Asp Ala Ser Ser Leu Glu
Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp
Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala
Thr Tyr Tyr Cys Gln Gln Phe Asn Ser Tyr Pro Tyr 85 90 95Thr Phe Gly
Gln Gly Thr Lys Leu Glu Ile Lys Arg Thr 100 10535140PRTHomo Sapiens
35Met Glu Phe Gly Leu Ser Trp Val Phe Leu Val Ala Leu Leu Arg Gly1
5 10 15Val Gln Cys Gln Val Gln Leu Val Glu Ser Gly Gly Gly Val Val
Gln 20 25 30Pro Gly Arg Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe
Thr Phe 35 40 45Ser Cys Cys Gly Met His Trp Val Arg Gln Ala Pro Gly
Lys Gly Leu 50 55 60Glu Trp Val Ala Val Ile Trp Tyr Asp Gly Ser Asn
Lys Tyr Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser
Arg Asp Thr Ser Lys Asn 85 90 95Thr Leu Tyr Leu Gln Met Asn Ser Leu
Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ala Thr Asp Ser
Ser Gly Ser Phe Tyr Glu Tyr Phe Gln 115 120 125His Trp Gly Gln Gly
Thr Leu Val Thr Val Ser Ser 130 135 14036131PRTHomo Sapiens 36Met
Asp Met Arg Val Pro Ala Gln Leu Leu Gly Leu Leu Leu Leu Trp1 5 10
15Leu Pro Gly Ala Arg Cys Ala Ile Gln Leu Thr Gln Ser Pro Ser Ser
20 25 30Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala
Ser 35 40 45Gln Gly Ile Asn Ser Ala Leu Ala Trp Tyr Gln Gln Lys Pro
Gly Lys 50 55 60Ala Pro Lys Leu Leu Ile Tyr Asp Ala Ser Ser Leu Glu
Ser Gly Val65 70 75 80Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr
Asp Phe Thr Leu Thr 85 90 95Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala
Thr Tyr Tyr Cys Gln Gln 100 105 110Phe Asn Ser Tyr Pro Tyr Thr Phe
Gly Gln Gly Thr Lys Leu Glu Ile 115 120 125Lys Arg Thr
13037363DNAHomo Sapiens 37caggtgcagc tggtggagtc tgggggaggc
gtggtccagc ctgggaggtc cctgagactc 60tcctgtgcag cgtctggatt caccttcagt
tgctgtggca tgcactgggt ccgccaggct 120ccaggcaagg ggctggagtg
ggtggcagtt atatggtatg atggaagtaa taaatactat 180gcagactccg
tgaagggccg attcaccatc tccagagaca cttccaagaa cacgctgtat
240ctgcaaatga acagcctgag agccgaggac acggctgtgt attactgtgc
gacagatagt 300tcggggagtt tttatgaata cttccagcac tggggccagg
gcaccctggt caccgtctcc 360tca 36338327DNAHomo Sapiens 38gccatccagt
tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga cagagtcacc 60atcacttgcc
gggcaagtca gggcattaac agtgctttag cctggtatca gcagaaacca
120gggaaagctc ctaagctcct gatctatgat gcctccagtt tggaaagtgg
ggtcccatca 180aggttcagcg gcagtggatc tgggacagat ttcactctca
ccatcagcag cctgcagcct 240gaagattttg caacttatta ctgtcaacag
tttaatagtt acccgtacac ttttggccag 300gggaccaagc tggagatcaa acgaact
32739420DNAHomo Sapiens 39atggagtttg ggctgagctg ggttttcctc
gttgctcttt taagaggtgt ccagtgtcag 60gtgcagctgg tggagtctgg gggaggcgtg
gtccagcctg ggaggtccct gagactctcc 120tgtgcagcgt ctggattcac
cttcagttgc tgtggcatgc actgggtccg ccaggctcca 180ggcaaggggc
tggagtgggt ggcagttata tggtatgatg gaagtaataa atactatgca
240gactccgtga agggccgatt caccatctcc agagacactt ccaagaacac
gctgtatctg 300caaatgaaca gcctgagagc cgaggacacg gctgtgtatt
actgtgcgac agatagttcg 360gggagttttt atgaatactt ccagcactgg
ggccagggca ccctggtcac cgtctcctca 42040393DNAHomo Sapiens
40atggacatga gggtccccgc tcagctcctg gggcttctgc tgctctggct cccaggtgcc
60agatgtgcca tccagttgac ccagtctcca tcctccctgt ctgcatctgt aggagacaga
120gtcaccatca cttgccgggc aagtcagggc attaacagtg ctttagcctg
gtatcagcag 180aaaccaggga aagctcctaa gctcctgatc tatgatgcct
ccagtttgga aagtggggtc 240ccatcaaggt tcagcggcag tggatctggg
acagatttca ctctcaccat cagcagcctg 300cagcctgaag attttgcaac
ttattactgt caacagttta atagttaccc gtacactttt 360ggccagggga
ccaagctgga gatcaaacga act 39341121PRTHomo Sapiens 41Gln Val Gln Leu
Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Gly Tyr 20 25 30Gly Met
His Trp Val Arg Gln Ala Pro Gly Arg Gly Leu Asp Trp Val 35 40 45Ala
Val Val Trp Tyr Asp Gly Gly Tyr Lys Phe Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Ala Arg Asp Ser Ser Gly Ser Phe Tyr Glu Tyr Leu Gln His
Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115
12042110PRTHomo Sapiens 42Ala Ile Gln Leu Thr Gln Ser Pro Ser Ser
Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala
Ser Gln Gly Ile Ser Ser Ala 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro
Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Asp Ala Ser Ser Leu Glu
Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp
Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala
Thr Tyr Tyr Cys Gln Gln Phe Asn Ser Tyr Pro His 85 90 95Phe Trp Pro
Gly Asp Gln Ala Gly Asp Gln Thr Asn Cys Gly 100 105 11043140PRTHomo
Sapiens 43Met Glu Phe Gly Leu Ser Trp Val Phe Leu Val Ala Leu Leu
Arg Gly1 5 10 15Val Gln Cys Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln 20 25 30Pro Gly Arg Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe 35 40 45Ser Gly Tyr Gly Met His Trp Val Arg Gln Ala
Pro Gly Arg Gly Leu 50 55 60Asp Trp Val Ala Val Val Trp Tyr Asp Gly
Gly Tyr Lys Phe Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr
Ile Ser Arg Asp Asn Ser Lys Asn 85 90 95Thr Leu Tyr Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ala Arg
Asp Ser Ser Gly Ser Phe Tyr Glu Tyr Leu Gln 115 120 125His Trp Gly
Gln Gly Thr Leu Val Thr Val Ser Ser 130 135 14044132PRTHomo Sapiens
44Met Asp Met Arg Val Pro Ala Gln Leu Leu Gly Leu Leu Leu Leu Trp1
5 10 15Leu Pro Gly Ala Arg Cys Ala Ile Gln Leu Thr Gln Ser Pro Ser
Ser 20 25 30Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg
Ala Ser 35 40 45Gln Gly Ile Ser Ser Ala Leu Ala Trp Tyr Gln Gln Lys
Pro Gly Lys 50 55 60Ala Pro Lys Leu Leu Ile Tyr Asp Ala Ser Ser Leu
Glu Ser Gly Val65 70 75 80Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly
Thr Asp Phe Thr Leu Thr 85 90 95Ile Ser Ser Leu Gln Pro Glu Asp Phe
Ala Thr Tyr Tyr Cys Gln Gln 100 105 110Phe Asn Ser Tyr Pro His Phe
Trp Pro Gly Asp Gln Ala Gly Asp Gln 115 120 125Thr Asn Cys Gly
13045363DNAHomo Sapiens 45caggtgcagt tggtggagtc tgggggaggc
gtggtccagc ctgggaggtc cctgagactc 60tcctgtgcag cgtctggatt caccttcagt
ggctatggca tgcactgggt ccgccaggct 120ccaggcaggg ggctggactg
ggtggcagtt gtgtggtatg atggaggtta taagttctat 180gcagactccg
tgaagggccg attcaccatc tccagagaca attccaagaa cacgctgtat
240ctgcaaatga acagcctgag agccgaggac acggctgtgt attactgtgc
gagagatagt 300tcggggagtt tttatgaata cttacaacat tggggccagg
gcaccctggt caccgtctcc 360tca 36346325DNAHomo Sapiens 46gccatccagt
tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga cagagtcacc 60atcacttgcc
gggcaagtca gggcattagc agtgctttag cctggtatca gcagaaacca
120gggaaagctc ctaagctcct gatctatgat gcctccagtt tggaaagtgg
ggtcccatca 180aggttcagcg gcagtggatc tgggacagat ttcactctca
ccatcagcag cctgcagcct 240gaagattttg caacttatta ctgtcaacag
tttaatagtt accctcactt ttggccaggg 300gaccaagctg gagatcaaac gaact
32547420DNAHomo Sapiens 47atggagtttg ggctgagctg ggttttcctc
gttgctcttt taagaggtgt ccagtgtcag 60gtgcagttgg tggagtctgg gggaggcgtg
gtccagcctg ggaggtccct gagactctcc 120tgtgcagcgt ctggattcac
cttcagtggc tatggcatgc actgggtccg ccaggctcca 180ggcagggggc
tggactgggt ggcagttgtg tggtatgatg gaggttataa gttctatgca
240gactccgtga agggccgatt caccatctcc agagacaatt ccaagaacac
gctgtatctg 300caaatgaaca gcctgagagc cgaggacacg gctgtgtatt
actgtgcgag agatagttcg 360gggagttttt atgaatactt acaacattgg
ggccagggca ccctggtcac cgtctcctca 42048391DNAHomo Sapiens
48atggacatga gggtccccgc tcagctcctg gggcttctgc tgctctggct cccaggtgcc
60agatgtgcca tccagttgac ccagtctcca tcctccctgt ctgcatctgt aggagacaga
120gtcaccatca cttgccgggc aagtcagggc attagcagtg ctttagcctg
gtatcagcag 180aaaccaggga aagctcctaa gctcctgatc tatgatgcct
ccagtttgga aagtggggtc 240ccatcaaggt tcagcggcag tggatctggg
acagatttca ctctcaccat cagcagcctg 300cagcctgaag attttgcaac
ttattactgt caacagttta atagttaccc tcacttttgg 360ccaggggacc
aagctggaga tcaaacgaac t 3914910PRTHomo Sapiens 49Gly Phe Thr Phe
Ser Ser Tyr Ala Met His1 5 105017PRTHomo Sapiens 50Phe Ile Trp Asp
Asp Gly Ser Phe Lys Tyr Tyr Ala Glu Ser Val Lys1 5 10
15Gly519PRTHomo Sapiens 51Glu Gly Ser Trp Ser Pro Asp Ile Phe1
5527PRTHomo Sapiens 52Ser Gln Gly Ile Ser Arg Ala1 5533PRTHomo
Sapiens 53Asp Ala Ser1546PRTHomo Sapiens 54Phe Asn Ser Tyr Pro Ile1
55510PRTHomo Sapiens 55Gly Phe Thr Leu Ser Ser Phe Gly Met His1 5
105617PRTHomo Sapiens 56Val Ile Trp Tyr Asp Gly Ser Asn Glu Tyr Tyr
Ala Asp Ser Val Lys1 5 10 15Gly579PRTHomo Sapiens 57Glu Gly Ser Trp
Ser Pro Asp Ile Phe1 5587PRTHomo Sapiens 58Ser Gln Gly Ile Arg Ser
Ala1 5596PRTHomo Sapiens 59Phe Asn Ser Tyr Pro Val1 56010PRTHomo
Sapiens 60Gly Phe Thr Leu Ser Ser Tyr Gly Met His1 5 106117PRTHomo
Sapiens 61Val Ile Trp Tyr Asp Gly Asn Asn Gln Tyr Tyr Ala Asp Ser
Val Lys1 5 10 15Gly629PRTHomo Sapiens 62Glu Gly Ser Trp Ser Pro Asp
Ile Phe1 5637PRTHomo Sapiens 63Ser Gln Gly Ile Ser Ser Tyr1
5645PRTHomo Sapiens 64Phe Asn Ser Tyr Pro1 56510PRTHomo Sapiens
65Gly Asp Thr Phe Ser Ser Tyr Ala Ile Ser1 5 106617PRTHomo Sapiens
66Gly Ile Ile Pro Val Ile Gly Thr Val Asn Tyr Glu Glu Arg Phe Gln1
5 10 15Asp675PRTHomo Sapiens 67Glu Glu Gly Phe Leu1 5687PRTHomo
Sapiens 68Ser Gln Gly Ile Ser Ser Ala1 5696PRTHomo Sapiens 69Phe
Asn Ser Tyr Pro Leu1 57010PRTHomo Sapiens 70Gly Phe Thr Phe Ser Cys
Cys Gly Met His1 5
107117PRTHomo Sapiens 71Val Ile Trp Tyr Asp Gly Ser Asn Lys Tyr Tyr
Ala Asp Ser Val Lys1 5 10 15Gly7210PRTHomo Sapiens 72Asp Ser Ser
Gly Ser Phe Tyr Glu Tyr Phe1 5 10737PRTHomo Sapiens 73Ser Gln Gly
Ile Asn Ser Ala1 5746PRTHomo Sapiens 74Phe Asn Ser Tyr Pro Tyr1
57510PRTHomo Sapiens 75Gly Phe Thr Phe Ser Gly Tyr Gly Met His1 5
107617PRTHomo Sapiens 76Val Val Trp Tyr Asp Gly Gly Tyr Lys Phe Tyr
Ala Asp Ser Val Lys1 5 10 15Gly7710PRTHomo Sapiens 77Asp Ser Ser
Gly Ser Phe Tyr Glu Tyr Leu1 5 10787PRTHomo Sapiens 78Ser Gln Gly
Ile Ser Ser Ala1 5796PRTHomo Sapiens 79Phe Asn Ser Tyr Pro His1
5
* * * * *