U.S. patent application number 12/586207 was filed with the patent office on 2010-06-24 for lefty, lefty derivatives and uses thereof.
This patent application is currently assigned to Acceleron Pharma Inc.. Invention is credited to John Knopf, Ravindra Kumar, Jasbir Seehra.
Application Number | 20100160225 12/586207 |
Document ID | / |
Family ID | 37605233 |
Filed Date | 2010-06-24 |
United States Patent
Application |
20100160225 |
Kind Code |
A1 |
Knopf; John ; et
al. |
June 24, 2010 |
Lefty, lefty derivatives and uses thereof
Abstract
The disclosure relates to Lefty derivatives and the uses of
Lefty polypeptides as antagonists of the function of certain
ligands such as Nodal, GDF-8 (Myostatin), and GDF-11. These
derivatives may be fused to other functional heterologous proteins
such as IgG, especially the Fc portion of IgG. According to the
disclosure, Lefty polypeptides are useful in the treatment of a
variety of disorders, including, for example, neuronal diseases,
muscle and bone conditions, and metabolic disorders.
Inventors: |
Knopf; John; (Carlisle,
MA) ; Seehra; Jasbir; (Lexington, MA) ; Kumar;
Ravindra; (Shrewsbury, MA) |
Correspondence
Address: |
ROPES & GRAY LLP
PATENT DOCKETING 39/41, ONE INTERNATIONAL PLACE
BOSTON
MA
02110-2624
US
|
Assignee: |
Acceleron Pharma Inc.
Cambridge
MA
|
Family ID: |
37605233 |
Appl. No.: |
12/586207 |
Filed: |
September 18, 2009 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
11479181 |
Jun 30, 2006 |
7612040 |
|
|
12586207 |
|
|
|
|
60696226 |
Jul 1, 2005 |
|
|
|
Current U.S.
Class: |
514/1.1 ;
435/325; 435/366; 435/375; 435/69.1; 530/324; 530/350; 530/387.3;
536/23.5 |
Current CPC
Class: |
C07K 14/495 20130101;
A61P 11/00 20180101; C07K 14/47 20130101; A61P 19/02 20180101; A61P
25/16 20180101; A61K 38/00 20130101; A61P 3/04 20180101; A61P 25/00
20180101; A61P 1/16 20180101; A61P 9/00 20180101; A61P 35/00
20180101; A61P 25/14 20180101; A61P 21/04 20180101; A61P 25/28
20180101; A61P 21/00 20180101; A61P 9/12 20180101; A61P 29/00
20180101; A61P 43/00 20180101; A61P 3/10 20180101; A61P 1/04
20180101 |
Class at
Publication: |
514/12 ; 530/350;
530/324; 530/387.3; 536/23.5; 435/325; 435/366; 435/69.1;
435/375 |
International
Class: |
A61K 38/16 20060101
A61K038/16; C07K 14/435 20060101 C07K014/435; C07K 16/00 20060101
C07K016/00; C12N 15/12 20060101 C12N015/12; C12N 5/16 20060101
C12N005/16; C12N 5/22 20060101 C12N005/22; C12P 21/00 20060101
C12P021/00; A61P 21/00 20060101 A61P021/00; A61P 3/04 20060101
A61P003/04; A61P 25/00 20060101 A61P025/00; A61P 29/00 20060101
A61P029/00; A61P 9/00 20060101 A61P009/00; A61P 9/12 20060101
A61P009/12; A61P 11/00 20060101 A61P011/00 |
Claims
1. A recombinant Lefty derivative polypeptide comprising an amino
acid sequence as set forth in the formula: -A-X-B-, wherein A
consists essentially of an amino acid sequence at least 85%
identical to the sequence of Region 2 of SEQ ID NO:1; wherein B
consists essentially of an amino acid sequence at least 85%
identical to the sequence of Region 4 of SEQ ID NO:1; wherein X
consists of zero, one or more than one amino acid; and wherein the
recombinant, Lefty derivative polypeptide binds to one or more of
Nodal, myostatin and GDF-11.
2. The recombinant Lefty derivative polypeptide of claim 1, wherein
the recombinant Lefty derivative polypeptide comprises an amino
acid sequence that is at least 85% identical to the cystine knot
portion of a human Lefty polypeptide.
3. The recombinant Lefty derivative polypeptide of claim 1, wherein
the recombinant Lefty derivative polypeptide comprises an amino
acid sequence that is at least 85% identical to a human Lefty
polypeptide sequence selected from the group consisting of: amino
acids 22-353 of SEQ ID NO:1 and amino acids 22-353 of SEQ ID NO:2,
wherein one or both RXXR cleavage sequences are altered so as to
prevent cleavage at the altered sequence.
4. The recombinant Lefty derivative polypeptide of claim 1, wherein
A consists of an amino acid sequence at least 95% identical to the
sequence of Region 2 of SEQ ID NO:1 and wherein B consists of an
amino acid sequence at least 95% identical to the sequence of
Region 4 of SEQ ID NO:1.
5. The recombinant Lefty derivative polypeptide of claim 1, wherein
A is selected from the group consisting of:
CRQEMYIDLQGMKWAKNWVLEPPG FLAYECVGT (SEQ ID NO: 5) and
CRQEMYIDLQGMKWAENWVLEPPGFLAYECVGT (SEQ ID NO: 7), and wherein B is
selected from the group consisting of: TABLE-US-00009 (SEQ ID NO:
6) CIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKC and (SEQ ID NO: 8)
CIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKC.
6. The recombinant Lefty derivative polypeptide of claim 1, wherein
X comprises an amino acid sequence that has low immunogenicity.
7. The recombinant Lefty derivative polypeptide of claim 1, wherein
X comprises a glycosylation site.
8. The recombinant Lefty derivative polypeptide of claim 1, wherein
the length of X is between 0-50 amino acids.
9. The recombinant Lefty derivative polypeptide of claim 1, wherein
X comprises a dimerization domain.
10. The recombinant Lefty derivative polypeptide of claim 1,
wherein the polypeptide is fused to an additional domain.
11. The recombinant Lefty derivative polypeptide of claim 10,
wherein the additional domain is a dimerization domain.
12. The recombinant Lefty derivative polypeptide of claim 10,
wherein the additional domain is fused to the carboxyl or amino
terminus of the Lefty polypeptide.
13. The recombinant Lefty derivative polypeptide of claim 11,
wherein the dimerization domain comprises a Lefty propeptide
sequence.
14. The recombinant Lefty derivative polypeptide of claim 11,
wherein the dimerization domain comprises an immunoglobulin Fab
constant domain.
15. The recombinant Lefty derivative polypeptide of claim 14,
wherein said immunoglobulin Fab constant domain is selected from an
immunoglobulin heavy chain constant region and an immunoglobulin
light chain constant region.
16. The recombinant Lefty derivative polypeptide of claim 11,
wherein the dimerization domain is a leucine zipper domain.
17. The recombinant Lefty derivative polypeptide of claim 16,
wherein said leucine zipper domain comprises at least four leucine
heptads.
18. The recombinant Lefty derivative polypeptide of claim 17,
wherein said leucine zipper domain is selected from the group
consisting of a Fos and a Jun leucine zipper domain.
19. The recombinant Lefty derivative polypeptide of claim 11,
further comprising a linker sequence interposed between and
covalently joining the Lefty polypeptide and the dimerization
domain.
20. The recombinant Lefty derivative polypeptide of claim 1,
wherein X comprises a domain that binds Nodal, myostatin and/or
GDF-11.
21. The recombinant Lefty derivative polypeptide of claim 1,
wherein the additional domain is a domain that binds Nodal,
myostatin and/or GDF-11.
22. The recombinant Lefty derivative polypeptide of claim 21,
wherein the domain that binds Nodal, myostatin and/or GDF-11
inhibits the binding of Nodal, myostatin and/or GDF-11 to a Type I
receptor.
23. The recombinant Lefty derivative polypeptide of claim 22
wherein the domain that binds Nodal, myostatin and/or GDF-11
competitively inhibits the binding of Nodal, myostatin and/or
GDF-11 to a Type I receptor selected from the group consisting of
ALK4 and ALK7.
24. The recombinant Lefty derivative polypeptide of claim 22,
wherein the domain that binds Nodal, myostatin and/or GDF-11 is
selected from the group consisting of: (a) an extracellular portion
of ALK4; (b) an extracellular portion of ALK7; (c) an
antigen-binding portion of an antibody that binds Nodal, myostatin
and/or GDF-11; and (d) a randomized polypeptide that has been
selected for binding to Nodal, myostatin and/or GDF-11.
25. The recombinant Lefty derivative polypeptide of claim 1,
wherein said modified Lefty polypeptide inhibits signaling mediated
by a protein selected from an ActRII receptor, myostatin, Nodal,
and GDF-11 in a cell.
26. The recombinant Lefty derivative polypeptide of claim 1,
wherein said modified Lefty polypeptide comprises a heterogenous
sequence that mediates secretion of the recombinant Lefty
derivative polypeptide.
27. The recombinant Lefty derivative polypeptide of claim 26,
wherein said heterogenous sequence that mediates secretion of the
recombinant Lefty derivative polypeptide is a honey bee melatin
leader sequence.
28. A recombinant polynucleotide comprising a nucleotide sequence
encoding a Lefty derivative polypeptide of claim 1.
29. The recombinant polynucleotide of claim 28, further comprising
a promoter sequence operably linked to the nucleotide sequence
encoding the Lefty derivative polypeptide.
30. A cell transformed with a recombinant polynucleotide of claim
29.
31. The cell of claim 30, wherein the cell is a mammalian cell.
32. The cell of claim 31, wherein the cell is a human cell.
33. A method of making a recombinant Lefty derivative polypeptide,
comprising: a) culturing a cell of claim 30 under conditions
suitable for expression of the recombinant Lefty derivative
polypeptide; and b) recovering the recombinant Lefty derivative
polypeptide so expressed.
34. An isolated Lefty polypeptide complex comprising: a) a first
Lefty polypeptide; and b) a second Lefty polypeptide, wherein the
first and second Lefty polypeptides are associated to form a
complex, and wherein the complex binds to a TGF-.beta. family
member selected from the group consisting of: myostatin, Nodal and
GDF-11.
35. The Lefty polypeptide complex of claim 34, wherein the
polypeptide complex is a homodimer.
36. A pharmaceutical preparation comprising a modified Lefty
polypeptide of claim 1.
37. A method for inhibiting the activity of GDF-11 and/or myostatin
in vivo, the method comprising administering to the subject an
effective amount of a Lefty polypeptide.
38. A method for treating a subject having a disorder associated
with muscle loss or insufficient muscle growth, comprising
administering to the subject an effective amount of a composition
comprising a Lefty polypeptide.
39. The method of claim 38, wherein the subject has a condition
selected from muscle atrophy, ALS, and a muscle wasting
disorder.
40. The method of claim 39, wherein the muscle wasting disorder is
selected from the group consisting of cachexia, anorexia, DMD
syndrome, BMD syndrome, AIDS wasting syndrome, muscular
dystrophies, neuromuscular diseases, motor neuron diseases,
diseases of the neuromuscular junction, and inflammatory
myopathies.
41. A method for treating a subject having a disorder associated
with neurodegeneration, comprising administering to the subject an
effective amount of a composition comprising a Lefty
polypeptide.
42. The method of claim 41, wherein the disorder is selected from
the group consisting of Alzheimer's Disease (AD), Parkinson's
Disease (PD), Amyotrophic Lateral Sclerosis (ALS), Huntington's
disease (HD).
43. A method for inhibiting the activity of GDF-11 and/or myostatin
in vitro, the method comprising administering to the cells an
effective amount of a Lefty polypeptide.
44. A method for decreasing the body fat content or reducing the
rate of increase in body fat content in a subject, comprising
administering to a subject in need thereof an effective amount of a
Lefty polypeptide.
45. A method for treating a disorder associated with undesirable
body weight gain in a subject, comprising administering to a
subject in need thereof an effective amount of a Lefty
polypeptide.
46. The method of claim 45, wherein said disorder is selected from
the group consisting of obesity, non-insulin dependent diabetes
mellitus (NIDDM), cardiovascular disease, cancer, hypertension,
osteoarthritis, stroke, respiratory problems, and gall bladder
disease.
47. The method of claim 37 wherein the Lefty polypeptide is
selected from a wildtype Lefty polypeptide or fragments thereof, a
recombinant Lefty derivative polypeptide, and a dimerized Lefty
polypeptide.
Description
RELATED APPLICATION
[0001] This application is a continuation of U.S. application Ser.
No. 11/479,181 filed Jun. 30, 2006, which claims the benefit of
Provisional Application No. 60/696,226, filed Jul. 1, 2005, which
applications are hereby incorporated by reference in their
entireties.
BACKGROUND OF THE INVENTION
[0002] Myostatin, or growth/differentiation factor 8 (GDF-8),
belongs to the transforming growth factor-.beta. (TGF-.beta.)
superfamily (McPherron et al., Nature 387:83-90 (1997)). The human
myostatin gene has been cloned (Nestor et al. Proc. Natl. Acad.
Sci. 95:14938-43 (1998)). Myostatin is present in human skeletal
muscle in both type 1 and type 2 fibers. Myostatin negatively
regulates the growth and development of skeletal muscle (Nestor et
al., supra).
[0003] Myostatin knock-out mice are significantly larger than
wild-type mice and have a large and widespread increase in skeletal
muscle mass (McPherron et al., Nature 387:83-90 (1997). Two breeds
of cattle, characterized by increased muscle mass, have mutations
in the myostatin coding sequence (McPherron et al., Proc. Natl.
Acad. Sci. 94:12457-61 (1997)). The serum and intramuscular
concentrations of immunoreactive myostatin are increased in
HIV-infected men with muscle wasting compared with healthy men, and
correlate inversely with the fat-free mass index (Nestor et al.,
supra). Recently, a human child with an apparent loss-of-function
mutation in myostatin was identified (Schuelke et al., N Engl J.
Med. 2004 Jun. 24; 350(26):2682-8). The infant had a marked
increase in skeletal muscle mass. Taken together, these data
provide genetic and physiological evidence that myostatin is a
negative regulator of skeletal muscle growth in humans and
contributes to muscle wasting in HIV-infected men.
[0004] In view of the above findings, a need exists for a manner of
regulating myostatin activity, particularly in individuals who
experience muscle wasting as a result of a condition or disease
state such as, for example, aging, Autoimmune Deficiency Syndrome
(AIDS), Multiple Sclerosis, and cancer. Additionally, GDF-11 is a
protein that is closely related to myostatin and participates in
neurological functions. Thus, regulators of myostatin are likely to
find use in the regulation of GDF-11 and neurological processes as
well.
[0005] The present invention provides methods and compositions
which may be utilized to help individuals with a variety of
conditions associated with signaling mediated by TGF-.beta. family
members, including myostatin and GDF-11.
SUMMARY OF THE INVENTION
[0006] The disclosure provides new uses for Lefty polypeptides and
provides a variety of Lefty derivative polypeptides. In part, the
disclosure provides methods for using Lefty polypeptides as
antagonists of myostatin and/or GDF-11. Accordingly, the disclosure
provides methods for using Lefty polypeptides to treat a host of
disorders related muscle or neurological function. In part, the
disclosure provides regions of Lefty polypeptides that are
functionally significant for the inhibition of Nodal, myostatin
and/or GDF-11, and regions that may be readily modified without
substantially affecting the inhibition of Nodal, myostatin and/or
GDF-11. Therefore, the disclosure provides Lefty derivative
polypeptides that retain Nodal, myostatin and/or GDF-11 antagonist
function. Lefty derivative polypeptides may also exhibit desirable
features such as improved solublitity or improved
pharmacokinetics.
[0007] In certain aspects, the disclosure provides recombinant
Lefty derivative polypeptides. Lefty derivative polypeptides are
polypeptides that bear structural and functional relationship to
naturally occurring Lefty polypeptides but have an amino acid
sequence that is not identical to that of the mouse Lefty-1 and
Lefty-2 polypeptides or the human Lefty-A or Lefty-B polypeptides.
Lefty derivative polypeptides retain the ability to bind to one or
more of Nodal, myostatin and/or GDF-11. In particular, the
disclosure provides that Lefty proteins may be viewed as containing
five regions, Regions 1-5. See FIGS. 1-5. The general cystine knot
structure (maintained primarily by a series of cross-linked
cysteine residues) and Regions 2 and 4 are expected to be primarily
responsible for the binding of Lefty to Nodal, myostatin and
GDF-11. Regions 1, 3 and 5, and particularly the C-terminal portion
of Region 1 and Region 3 as a whole, are not expected to
participate significantly in binding, and accordingly, these
regions are attractive targets for modifying the amino acid
sequences of Lefty proteins. Preferably, recombinant Lefty
derivative polypeptides are selected to inhibit signaling mediated
by a protein such as an ActRII receptor, myostatin, Nodal, and/or
GDF-11 in a biochemical binding assay or a cell-based assay.
[0008] In certain embodiments, a recombinant Lefty derivative
polypeptide comprises an amino acid sequence as set forth in the
formula: -A-X-B-, wherein A consists of an amino acid sequence at
least 85%, 90%, 95%, 98% or 100% identical to the sequence of
Region 2 of human Lefty A (SEQ ID NO:5) or Lefty B (SEQ ID NO:7);
and wherein B consists of an amino acid sequence at least 85%, 90%,
95%, 98% or 100% identical to the sequence of Region 4 of human
Lefty A or B, SEQ ID Nos: 6 and 8, respectively. Region 2 of Lefty
A has the sequence CRQEMYIDLQGMKWAKNWVLEPPG FLAYECVGT (SEQ ID NO:
5). Region 2 of Lefty B has the sequence
CRQEMYIDLQGMKWAENWVLEPPGFLAYECVGT (SEQ ID NO: 7). Region 4 of Lefty
A has the sequence CIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKC (SEQ ID NO:
6) and Region 4 of Lefty B has the sequence
CIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKC (SEQ ID NO: 8).
[0009] A recombinant Lefty derivative polypeptide will preferably
bind to one or more of Nodal, myostatin and GDF-11, preferably with
a K.sub.D of less than 10.sup.-6, 10.sup.-7, 10.sup.-8 or
10.sup.-9. X may consist of zero, one or more than one one amino
acid, except that X should be selected so as to maintain the
functional activity of the Lefty derivative polypeptide. X may
comprise an amino acid sequence that has low immunogenicity. X may
include a site for post-translational modification, preferably
glycosylation. X may be less than 500, 400, 300, 200, 100, 50 or
less than 25 amino acids. X may include an additional domain, such
as a dimerization domain, a domain that binds to Nodal, myostatin
and/or GDF-11 or a domain that otherwise confers a desirable
property such as improved solubility or improved
pharmacokinetics.
[0010] A recombinant Lefty derivative polypeptide may or may not
include amino acids that are N-terminal to the A portion of the
-A-X-B- formula, and also may or may not include amino acids that
are C-terminal to the B portion of the -A-X-B- formula.
Accordingly, a Lefty derivative polypeptide comprising a sequence
of formula -A-X-B- should be understood to include, as optional
embodiments, sequence that is N-terminal to A and/or sequence that
is C-terminal to B. If specific reference to these portions is
needed, such regions may be referred to as "W" and "Y". Thus, a
derivative Lefty polypeptide may consist essentially of a sequence
represented as W-A-X-B, A-X-B-Y or W-A-X-B-Y. The sequence of W and
Y, if such sequence is included at all, is relatively unconstrained
and will be selected so as to retain any of the desirable
functional activities of the Lefty derivative polypeptide. W and Y
may comprise an amino acid sequence that has low immunogenicity. W
and Y may include a site for post-translational modification,
preferably glycosylation. W and Y may be less than 500, 400, 300,
200, 100, 50 or less than 25 amino acids. W and Y may include an
additional domain, such as a dimerization domain, a domain that
binds to Nodal, myostatin and/or GDF-11 or a domain that otherwise
confers a desirable property such as improved solubility or
improved pharmacokinetics. In one embodiment, W includes a "long"
Region 1 sequence corresponding to the sequence resulting after
cleavage of the most N-terminal RXXR propeptide cleavage site of a
Lefty protein. In one embodiment, W includes a "short" sequence
corresponding to the sequence resulting after cleavage of the
second RXXR propeptide cleavage site. In further embodiments, W may
include some or all of the propeptide sequence, in which case W
will generally be altered such that the first and/or second RXXR
cleavage site is altered to reduce or eliminate cleavage. A
preferred method for altering the RXXR cleavage site is to include
a site for glycosylation which site either alters the sequence of
the RXXR site or results in a glycosylation that occludes the
cleavage site or otherwise inhibits cleavage. Any of portions W, X
or Y may be at least 85% identical to a naturally occurring region
1, 3 or 5, respectively, of a naturally occurring Lefty
polypeptide, particularly human Lefty A or B, and may also be at
least 90%, 95%, 98%, 99% or 100% identical to such sequence.
[0011] The recombinant Lefty derivative polypeptide may comprise an
amino acid sequence that is at least 85% identical to the cystine
knot portion of a human Lefty polypeptide. The recombinant Lefty
derivative polypeptide may comprise an amino acid sequence that is
at least 85% identical to a human Lefty polypeptide sequence
selected from the group consisting of: amino acids 22-353 of SEQ ID
NO:1 and amino acids 22-353 of SEQ ID NO:2, wherein one or both
RXXR cleavage sequences are altered so as to prevent cleavage at
the altered sequence.
[0012] As demonstrated herein, mature Lefty A polypeptides
initiating at the first or second RXXR cleavage site, and N- or
C-terminal Fc fusions thereof, have myostatin binding activity.
Accordingly, a recombinant Lefty polypeptide may be a "long" form
(e.g., 34 kDa form) or a "short" form (e.g., 28 kDa form) depending
on the size of the sequence, corresponding to Region 1, between the
propeptide cleavage site and the beginning of the cystine knot
domain. A long form may be a Lefty derivative polypeptide in which
the second RXXR cleavage site is altered to eliminate cleavage and
permit consistent production of the longer form. A long form may
also be produced by expression of a sequence that retains the
second RXXR cleavage site in a cell line or culture conditions that
are deficient for cleavage activity.
[0013] A Lefty derivative polypeptide may include one or more
sequence alterations that introduce one or more sites for
post-translational modification. Glycosylation is a preferred
post-translational modification, and such modification will
preferably be positioned in portions W, X or Y of the Lefty
derivative polypeptide.
[0014] As noted above, a Lefty derivative polypeptide may include
one or more additional domains, fused to the amino- or the
carboxy-terminus or within any of Regions W, X or Y. As described
herein, Lefty may be a potent antagonist in a dimeric or multimeric
form, and therefore, the additional domain may be a dimerization or
multimerization domain. It is expected that the propeptide
functions naturally to mediate Lefty dimerization, and therefore,
the dimerization domain may comprise a Lefty propeptide sequence of
either a short or long form. A dimerization domain may be an Fc
domain. A dimerization domain may comprise an immunoglobulin Fab
constant domain, and the Fab constant domain may be selected, for
example, from an immunoglobulin heavy chain constant region and an
immunoglobulin light chain constant region. Other dimerization or
multimerization domains may be chosen, such as a leucine zipper
domain. A leucine zipper domain may comprise at least four leucine
heptads, and may be, for example, a Fos or a Jun leucine zipper
domain. Amino acid linkers may be interposed between any Lefty
amino acid sequence and any additional domain(s). An additional
domain may be a domain that binds to and, preferably, inhibits
Nodal, myostatin and/or GDF-11. For example, Lefty is expected to
block the Type II receptor binding site of BMP proteins, and
therefore a second domain that block the Type I receptor (e.g.,
ALK4 or ALK7) binding site would be useful to improve the
antagonistic properties of the Lefty molecule. A domain that
competitively inhibits the binding of Nodal, myostatin and/or
GDF-11 to ALK4 or ALK7 may be, for example, (a) an extracellular
portion of ALK4; (b) an extracellular portion of ALK7; (c) an
antigen-binding portion of an antibody that binds Nodal, myostatin
and/or GDF-11; and (d) a randomized polypeptide that has been
selected for binding to Nodal, myostatin and/or GDF-11.
[0015] In certain aspects, a recombinant Lefty derivative
polypeptide comprises a heterogenous sequence that mediates
secretion of the recombinant Lefty derivative polypeptide, such as
a honey bee melatin leader sequence.
[0016] The disclosure further provides recombinant polynucleotides
comprising a nucleotide sequence encoding a Lefty derivative
polypeptide disclosed herein. The recombinant polynucleotide may
include a promoter sequence operably linked to the nucleotide
sequence encoding the Lefty derivative polypeptide. Such nucleic
acids may be introduced into cells, such as mammalian cells (e.g.,
human or CHO cells). Such cells may be used in a method of making a
recombinant Lefty derivative polypeptide, comprising: a) culturing
a cell encoding the recombinant Lefty derivative polypeptide under
conditions suitable for expression of the recombinant Lefty
derivative polypeptide; and b) recovering the recombinant Lefty
derivative polypeptide so expressed.
[0017] As noted above, it is now expected that Lefty will act as a
potent antagonist in a dimeric or multimeric form. Therefore, one
may prepare an isolated Lefty polypeptide complex comprising: a
first Lefty polypeptide and a second Lefty polypeptide, wherein the
first and second Lefty polypeptides are associated to form a
complex, and wherein the complex binds to a TGF-.beta. family
member selected from the group consisting of: myostatin, Nodal and
GDF-11. The Lefty polypeptide complex may be a heterodimer (or
multimer) or a homodimer (or multimers).
[0018] In certain aspects, the disclosure provides pharmaceutical
preparations comprising any of the various Lefty derivatives or
dimeric Lefty polypeptides.
[0019] In certain aspects, the disclosure provides new uses for
Lefty polypeptides, including Lefty derivative polypeptides
disclosed herein. In one embodiment, the disclosure provides
methods for treating a subject having a disorder associated with
muscle loss or insufficient muscle growth, comprising administering
to the subject an effective amount of a composition comprising a
Lefty polypeptide. In another embodiment, the disclosure provides
methods for treating a disorder associated with neurodegeneration,
comprising administering to the subject an effective amount of a
composition comprising a Lefty polypeptide. In a further
embodiment, a Lefty polypeptide may be used to promote weight loss
and to treat disorders relating to body fat content or body weight,
such as obesity and Type II diabetes. In certain embodiments, Lefty
polypeptides may be used to bind to and/or inhibit the activity of
Nodal, myostatin and/or GDF-11 in vitro or in vivo. The Lefty
polypeptide may be a wildtype Lefty polypeptide or fragments
thereof, a recombinant Lefty derivative polypeptide, as well as a
dimerized Lefty polypeptide.
[0020] The disclosure further provides for the use of a Lefty
polypeptide for making a medicament for the treatment of a disorder
associated with abnormal amount, development or metabolic activity
of muscle tissue or a disorder associated with neurodegeneration or
a disorder relating to body fat content or body weight.
BRIEF DESCRIPTION OF THE DRAWINGS
[0021] FIG. 1 shows a schematic of the conserved cystine knot
structure of members of the TGF-.beta. superfamily, based on the
structure of BMP-7. Cysteines that form the core of the structure
are indicated as C1-C6. In the traditional receptor ligand members
of the family, Loops A and B mediate binding to Type II receptors,
while the region between C3 and C4 contains an alpha helix and
other amino acids that mediate dimerization and binding to Type I
receptors. The region between C3 and C4 also contains a cysteine
that is critical for the formation of a disulfide linkage between
monomers. In the Dan family of ligand binding "traps", Loops A and
B participate in binding to the target BMP ligand while the region
between C3 and C4 is generally smaller than in the receptor
ligands. As described herein, Lefty proteins may be mapped onto
this structure and divided into five functional regions. Region 1
is the portion of the mature polypeptide that is N-terminal to C1
(the first cysteine of the cystine knot domain). Regions 2 and 4
correspond to Loops A and B and participate in ligand binding
(ligands such as Nodal, myostatin and GDF-11). Region 3 of Lefty
proteins lacks the alpha helix and the cysteine that participates
in intermolecular crosslinking. Region 5 is the portion that is
C-terminal to the final cysteine of the cystine knot domain.
[0022] FIG. 2 shows an alignment of the cystine knot domains of
several members of the TGF-.beta. family. PDRC, Gremlin, Cerberus
and Noggin are members of the ligand "trap" grouping--proteins that
bind to and inhibit the activity of various receptor ligand members
of the TGF-.beta. family. BMP-2, GDF-8 and TGF-.beta. are
traditional receptor ligands that form disulfide-crosslinked dimers
and bind and activate Type I and Type II receptor-mediated
signaling. Lefty, shown at center, is a Lefty polypeptide. The
regions corresponding to the Loops A and B, which mediate Type II
receptor binding in BMP receptor ligands, are underlined at bottom.
The region corresponding to the "Dimerization Loop" is overlined at
top, and a box shows the Type I receptor binding helix of BMP-2.
The cysteine that participates in monomer-monomer disulfide bond
formation is shown in red. Notably, the Dimerization Loop is longer
in BMP-2, GDF-8 and TGF-.beta. than in Lefty or the trap family
members. Conserved cysteines are shown in green. The SEQ ID Nos.
for each of these sequences is as follows: PDRC (SEQ ID NO:17);
Gremlin (SEQ ID NO:18); Cerberus (SEQ ID NO:19); Dan (SEQ ID
NO:20); Noggin (SEQ ID NO:21); Human Lefty A (SEQ ID NO:22); BMP-2
(SEQ ID NO:23); GDF-8 (SEQ ID NO:24); TGF-.beta. (SEQ ID
NO:25).
[0023] FIG. 3 shows an alignment of the Lefty proteins, human
Lefty-A and -B and murine lefty-1 and lefty-2. Regions
corresponding to the signal peptide, the RXXR cleavage sites (which
mark the C-terminus of the propeptide), the conserved cysteines
("C") of the cystine knot and the locations of sequence variations
that are associated with human disorders (R314K, S342K) are shown.
SEQ ID Nos. 1-4.
[0024] FIG. 4 shows the human Lefty A and Lefty B amino acid
sequences (NCBI RefSeq ID NP.sub.--003231 and NP.sub.--066277,
respectively; SEQ ID Nos. 1 and 2, respectively.) The signal
sequence is underlined with a dotted line. RXXR cleavage sites are
underlined. The cystine knot domain is double underlined.
[0025] FIG. 5 shows the amino acid sequences of the 34 kDa mature
forms of human Lefty A and Lefty B which result from cleavage at
the first RXXR cleavage site (SEQ ID Nos. 9 and 10 respectively).
Regions 1 through 5, as described in FIG. 1, are indicated. Regions
1 and 5 have a broken underline. Regions 2 and 4 have a single
underline. Region 3 has a double underline. Shaded regions
correspond to regions that may be modified or deleted to generate
Lefty variants that retain Nodal, myostatin and/or GDF-11
inhibiting activity.
[0026] FIG. 6 is a schematic diagram showing various human Lefty A
constructs that were prepared and tested for myostatin binding. The
larger forms (34 kDa, or "Lefty 34") included an alteration to
inactivate the second RXXR cleavage site. The natural signal
sequence was replaced (along with two alanine residues C-terminal
thereto) with a honey bee melatin leader sequence. The shorter
forms (28 kDa, or "Lefty 28") contained the melatin leader sequence
followed by an amino-terminally truncated Lefty sequence beginning
with the Leucine that immediately follows the second RXXR cleavage
sequence. N- and C-terminal Fc fusions were prepared as shown.
[0027] FIG. 7 shows data from a Biacore.TM. binding assay. GDF-11
was immobilized on a Biacore chip and conditioned medium from cells
expressing the various Lefty constructs was passaged through the
chip. The rising curve indicates protein binding, which decreases
during the subsequent wash phase. Control samples show little or no
binding. These data demonstrate that Lefty 34 and Lefty 28 bind
directly to myostatin.
DETAILED DESCRIPTION OF THE INVENTION
1. Overview
[0028] The disclosure relates to the discovery that Lefty proteins
bind to GDF-11, in addition to Nodal. Given the sequence
conservation between myostatin and GDF-11, Lefty proteins are
expected to bind and inhibit both myostatin and GDF-11. The
disclosure also relates to the surprising insight that Lefty
proteins will be potent as binders when dimerized or multimerized.
Accordingly, the disclosure provides Lefty polypeptides and fusion
proteins that form dimers or multimers. Furthermore, the disclosure
provides regions of various Lefty polypeptides that may be modified
to obtain Lefty derivatives that may retain the ability to inhibit
Nodal, myostatin and/or GDF-11. Such derivatives may exhibit one or
more desirable features, including, for example, improved protein
expression, improved solubility, decreased tendency to adsorb
non-specifically to surfaces (improved "handling"), improved serum
half-life, improved tissue distribution and decreased
immunogenicity.
[0029] Murine Lefty-1 and Lefty-2 genes are expressed
asymmetrically prior to the appearance of anatomic left-right (LR)
differences (Meno C, et al., 1996, Nature 381:151-155; Meno C, et
al., 1997, Genes Cells 2:513-524; Meno C, et al., 1998, Cell,
94:287-297). Both are expressed on the left side of the embryo in
the floor-plate and in the lateral-plate mesoderm; Lefty-2 is
expressed more strongly in lateral-plate mesoderm than in
floor-plate, whereas the reverse is true for Lefty-1. Two human
Lefty proteins, Lefty-A and Lefty-B, were identified as homologous
to the murine proteins (Kosaki et al., 1999, Am J Hum Genet,
64:712-721). In humans, two mutations in Lefty-A are associated
with left-right axis malformations. Lefty-A is also referred to as
Ebaf (endometrum bleeding-associated factor) (Kothapalli et al.,
1997, J Clin Invest, 99:2342-2350). Human Lefty-A and Lefty-B are
96% identical in amino acid sequence. Mouse lefty-1 and lefty-2 are
90% identical in amino acid sequence. Human Lefty-A is 81%
identical to to each of the mouse lefty proteins, and human Lefty-B
is 82% identical to each of the mouse lefty proteins.
[0030] TGF-.beta. family members are generally encoded as
prepro-proteins that undergo secretion and cleavage to remove a
signal sequence and further cleavage at a dibasic or RXXR site,
which breaks the peptide bond between the mature carboxy-terminal
portion and the amino-terminal propeptide region. Lefty proteins
have two, rather than one, putative cleavage sites that release
carboxy-terminal mature protein, and multiple cleavage forms of
Lefty can be found in cell cultures. As shown herein, both long (34
kDa) and short (28 kDa) forms of mature Lefty retain certain key
activities. Among members of the TGF-.beta. family, propeptides
have different functional attributes. In some instances, the
propeptide portion is released upon cleavage and plays no further
functional role. In other instances, the propeptide portion
associates with the mature protein, generally either increasing
bioavailability of the mature portion or inhibiting the activity of
the mature portion, or both. No role for the Lefty propeptide has
been proposed. However, in view of the present disclosure it is
expected that, in physiological conditions, the propeptide region
of Lefty polypeptides may associate with the mature portion and
mediate the formation of dimers.
[0031] The mature portions of TGF-.beta. family members generally
contain a conserved cystine-knot structure. This structure is
illustrated in FIG. 1, as deduced from the solved structure of
BMP-7. The cystine knot include two loops, designated Loop 1 and
Loop 2, that participate in type II receptor binding. A third
region contains amino acids that participate in Type I receptor
binding and an .alpha.-helix and a conserved cysteine that are
usually essential for formation of homo- or hetero-dimers and the
covalent stabilization of such dimers (Thisse C, et al., 1999,
Development, 126:229-240; Meno C, et al., 1996, Nature 381:151-155;
Meno C, et al., 1997, Genes Cells 2:513-524). The binding of
TGF-.beta. ligand to the Type I and Type II receptors normally
activates the canonical TGF-.beta. signaling pathway, typically
marked by activation of one or more SMAD proteins. Lefty proteins
are atypical members of the TGF-.beta. family. Unlike most other
TGF-.beta. family members, Lefty proteins lack the .alpha.-helix
and a conserved cysteine that mediate dimerization. For these
reasons, most published reports indicate that Lefty proteins are
monomeric (see, e.g., Sakuma et al., 2002). Thus, it is a
surprising insight of the present disclosure that Lefty proteins
bind to target molecules in a dimeric form and may naturally
perform their physiological roles in a dimeric conformation.
[0032] Numerous members of the TGF-.beta. family act as antagonists
of the canonical TGF-.beta. receptor-ligand signaling pathway. The
Dan family of antagonists have a conserved cystine knot domain.
These proteins dimerize and bind to a target ligand of the
TGF-.beta. family, inhibiting the signaling mediated by that
ligand. Another antagonist, Noggin, functions similarly. These
antagonists are referred to herein as "traps".
[0033] Lefty also acts as an antagonist. Genetic evidence suggests
that Lefty functions as an antagonist of Nodal. In embryonic
patterning, Lefty is thought to restrict the range and duration of
Nodal activity (e.g., Meno C, et al., 1999, Mol Cell, 4:287-298).
Lefty-induced inhibition of Nodal signaling was rescued by excess
ActRIIA or ActRIIB, suggesting that Lefty antagonizes Nodal
signaling through competive binding to the common receptor ActRIIA
or ActRIIB (Sakuma et al., 2002, Genes Cells 7:401-412). This mode
of antagonism is consistent with the presumed monomeric nature of
Lefty, and presents a model for antagonism that is distinct from
the mechanism proposed for the "trap" proteins. In one report,
Lefty was reported to bind directly to Nodal (Chen and Shen, 2004,
Curr. Biol. 14: 618-624).
[0034] The present disclosure reports the discovery that Lefty may
directly bind to and antagonize numerous ligands of the TGF-.beta.
family, and may do so as a dimer. Accordingly, the disclosure
provides Lefty polypeptides for inhibiting Nodal, myostatin (GDF-8)
and/or GDF-11 function. The present disclosure further provides
Lefty polypeptide derivatives, meaning variants and fragments of
naturally occurring Lefty polypeptides that retain the ability to
inhibit Nodal, myostatin and/or GDF-11. Examples of such
derivatives include N-terminally truncated versions of Lefty, Lefty
polypeptide containing alterations in any or all of Regions 1, 3
and 5 (see FIGS. 1-4), glycosylated (or other post-translationally
modified) forms of Lefty and fusion proteins comprising any of the
various Lefty polypeptides disclosed herein. These so-called "Lefty
derivatives" can be used to reduce the severity of a pathologic
condition, which is characterized, at least in part, by an
undesirable level of Nodal, myostatin and/or GDF-11 activity. For
instance, the pharmaceutical preparations of the present disclosure
can be administered in an amount effective to prevent, ameliorate
or reduce the severity of a variety of disorders related to
neurological or muscular function.
[0035] The terms used in this specification generally have their
ordinary meanings in the art, within the context of this disclosure
and in the specific context where each term is used. Certain terms
are discussed below or elsewhere in the specification, to provide
additional guidance to the practitioner in describing the
compositions and methods of the disclosure and how to make and use
them. The scope an meaning of any use of a term will be apparent
from the specific context in which the term is used.
[0036] "About" and "approximately" shall generally mean an
acceptable degree of error for the quantity measured given the
nature or precision of the measurements. Typically, exemplary
degrees of error are within 20 percent (%), preferably within 10%,
and more preferably within 5% of a given value or range of
values.
[0037] Alternatively, and particularly in biological systems, the
terms "about" and "approximately" may mean values that are within
an order of magnitude, preferably within 5-fold and more preferably
within 2-fold of a given value. Numerical quantities given herein
are approximate unless stated otherwise, meaning that the term
"about" or "approximately" can be inferred when not expressly
stated.
[0038] The methods of the disclosure may include steps of comparing
sequences to each other, including wild-type sequence to one or
more mutants/sequence variants Such comparisons typically comprise
alignments of polymer sequences, e.g., using sequence alignment
programs and/or algorithms that are well known in the art (for
example, BLAST, FASTA and MEGALIGN, to name a few). The skilled
artisan can readily appreciate that, in such alignments, where a
mutation contains a residue insertion or deletion, the sequence
alignment will introduce a "gap" (typically represented by a dash,
or "A") in the polymer sequence not containing the inserted or
deleted residue.
[0039] "Homologous" refers to the relationship between two proteins
or nucleic acids that possess a common evolutionary origin,
including proteins from superfamilies in the same species of
organism, as well as homologous proteins from different species of
organism. Such proteins (and their encoding nucleic acids) have
sequence homology, as reflected by their sequence similarity,
whether in terms of percent identity or by the presence of specific
residues or motifs and conserved positions.
[0040] The term "sequence similarity" refers to the degree of
identity or correspondence between nucleic acid or amino acid
sequences that may or may not share a common evolutionary
origin.
[0041] A nucleic acid molecule is "hybridizable" to another nucleic
acid molecule, such as a cDNA, genomic DNA, or RNA, when a single
stranded form of the nucleic acid molecule can anneal to the other
micleic acid molecule under the appropriate conditions of
temperature and solution ionic strength (see Sambrook et al.
Molecular Cloning: A Laboratory Manual, Second Edition (1989) Cold
Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.). The
conditions of temperature and ionic strength determine the
"stringency" of the hybridization. For preliminary screening for
homologous nucleic acids, low stringency hybridization conditions,
corresponding to a T.sub.m (melting temperature) of 55.degree. C.,
can be used, e.g., 5.times.SSC, 0.1% SDS, 0.25% milk, and no
formamide; or 30% formamide, 5.times.SSC, 0.5% SDS).
[0042] Moderate stringency hybridization conditions correspond to a
higher L.sub.i, e.g., 40% formamide, with 5.times. or 6.times.SSC.
High stringency hybridization conditions correspond to the highest
T.sub.m, e.g., 50% formamide, 5.times. or 6.times.SSC. SSC is 0.15
M NaCl, 0.015 M Na-citrate.
[0043] "High stringency conditions" are understood to encompass
conditions of hybridization which allow hybridization of
structurally related, but not structurally dissimilar, nucleic
acids. The term "stringent" is a term of art which is understood by
the skilled artisan to describe any of a number of alternative
hybridization and wash conditions which allow annealing of only
highly complementary nucleic acids.
[0044] Exemplary high stringent hybridization conditions is
equivalent to about 20-27.degree. C. below the melting temperature
(T.sub.m) of the DNA duplex formed in about 1 M salt. Many
equivalent procedures exist and several popular molecular cloning
manuals describe suitable conditions for stringent hybridization
and, furthermore, provide formulas for calculating the length of
hybrids expected to be stable under these conditions (see e.g.
Current Protocols in Molecular Biology, John Wiley & Sons, N.Y.
(1989), 6.3.1-6 or 13.3.6; or pages 9.47-9.57 of Sambrook, et al.
(1989) Molecular Cloning, 2.sup.nd ed., Cold Spring Harbor
Press).
[0045] Hybridization requires that the two nucleic acids contain
complementary sequences, although depending on the stringency of
the hybridization, mismatches between bases are possible. The
appropriate stringency for hybridizing nucleic acids depends on the
length of the nucleic acids and the degree of complementation,
variables well known in the art. The greater the degree of
similarity or homology between two nucleotide sequences, the
greater the value of T.sub.m, for hybrids of nucleic acids having
those sequences. The relative stability (corresponding to higher
T.sub.m) of micleic acid hybridizations decreases in the following
order: RNA:RNA, DNA:RNA, DNA:DNA. For hybrids of greater than 100
nucleotides in length, equations for calculating T.sub.n, have been
derived (see Sambrook et al., supra, 9.51). For hybridization with
shorter nucleic acids, i.e., oligonucleotides, the position of
mismatches becomes more important, and the length of the
oligonucleotide determines its specificity (see Sambrook et al.,
supra, 11.8). A minimum length for a hybridizable nucleic acid is
at least about 10 nucleotides; preferably at least about 15
nucleotides; and more preferably the length is at least about 20
nucleotides.
[0046] Unless specified, the term "standard hybridization
conditions" refers to a T.sub.m of about 55.degree. C., and
utilizes conditions as set forth above. In a preferred embodiment,
the T.sub.m is 60.degree. C.; in a more preferred embodiment, the
T.sub.m, is 65.degree. C. In a specific embodiment, "high
stringency" refers to hybridization and/or washing conditions at
68.degree. C. in 0.2.times.SSC, at 42.degree. C. in 50% formamide,
4.times.SSC, or under conditions that afford levels of
hybridization equivalent to those observed under either of these
two conditions.
[0047] Suitable hybridization conditions for oligonucleotides
(e.g., for oligonucleotide probes or primers) are typically
somewhat different than for full-length nucleic acids (e.g.,
full-length cDNA), because of the oligonucleotides' lower melting
temperature. Because the melting temperature of oligonucleotides
will depend on the length of the oligonucleotide sequences
involved, suitable hybridization temperatures will vary depending
upon the oligonucleotide molecules used. Exemplary temperatures may
be 37.degree. C. (for 14-base oligonucleotides), 48.degree. C. (for
17-base oligonucleotides), 55.degree. C. (for 20-base
oligonucleotides) and 60.degree. C. (for 23-base oligonucleotides).
Exemplary suitable hybridization conditions for oligonucleotides
include washing in 6.times.SSC, 0.05% sodium pyrophosphate, or
other conditions that afford equivalent levels of
hybridization.
[0048] A protein or polypeptide, including an enzyme, may be a
"native" or "wild-type," meaning that it occurs in nature; or it
may be a "mutant," "variant," or "modified," meaning that it has
been made, altered, derived, or is in some way different or changed
from a native protein or from another mutant.
[0049] "Lefty protein" or "Lefty polypeptide" refers to mammalian
Lefty proteins, such as the murine Lefty proteins or human Lefty
proteins, and other proteins which share sequence homology and
functional attributes of the mammalian Lefty proteins, including
any Lefty derivatives. Exemplary amino acid sequences for Lefty
proteins include:
TABLE-US-00001 Murine Lefty-1 protein (NCBI RefSeq ID NP_034224)
(SEQ ID NO: 3): 1 mpflwlcwal walslvslre altgeqilgs llqqlqldqp
pvldkadveg mvipshvrtq 61 yvallqhsha srsrgkrfsq nlrevagrfl
vsetsthllv fgmeqrlppn selvqavlrl 121 fqepvprtal rrqkrlsphs
ararvtiewl rfrddgsnrt alidsrlvsi hesgwkafdv 181 teavnfwqql
srprqplllq vsvqrehlgp gtwsshklvr faaqgtpdgk gqgepqlelh 241
tldlkdygaq gncdpeapvt egtrccrqem yldlqgmkwa enwileppgf ltyecvgscl
301 qlpesltsrw pflgprqcva semtslpmiv svkeggrtrp qvvslpnmrv
qtcscasdga 361 liprrlqp Murine Lefty-2 protein (NCBI RefSeq ID
NP_796073) (SEQ ID NO: 4): 1 mkslwlcwal wvlplagpga amteeqvlss
llqqlqlsqa ptldsadvee maipthvrsq 61 yvallqgsha drsrgkrfsq
nfrevagrfl msetsthllv fgmeqrlppn selvqavlrl 121 fqepvprtal
rrferlsphs ararvtiewl rvredgsnrt alidsrlvsi hesgwkafdv 181
teavnfwqql srprqplllq vsvqrehlgp gtwsahklvr faaqgtpdgk gqgepqlelh
241 tldlkdygaq gncdpevpvt egtrccrqem yldlqgmkwa enwileppgf
ltyecvgscl 301 qlpesltigw pflgprqcva semtslpmiv svkeggrtrp
qvvslpnmrv qtcscasdga 361 liprgidl Human Lefty-A protein (NCBI
RefSeq ID NP_003231) (SEQ ID NO: 1): 1 mwplwlcwal wvlplagpga
alteeqllgs llrqlqlsev pvldradmek lvipahvraq 61 yvvllrrshg
drsrgkrfsq sfrevagrfl aseasthllv fgmeqrlppn selvqavlrl 121
fqepvpkaal hrhgrlsprs aqarvtvewl rvrddgsnrt slidsrlvsv hesgwkafdv
181 teavnfwqql srprqplllq vsvqrehlgp lasgahklvr fasqgapagl
gepqlelhtl 241 dlrdygaqgd cdpeapmteg trccrgemyi dlqgmkwakn
wvleppgfla yecvgtcqqp 301 pealafnwpf lgprqciase taslpmivsi
keggrtrpqv vslpnmrvqk cscasdgalv 361 prrlqp
[0050] RXXR cleavage sites are underlined. The cysteine, knot
domain is double underlined.
TABLE-US-00002 Human Lefty-B protein (NCBI RefSeq ID NP_066277)
(SEQ ID NO: 2): 1 mqplwlcwal wvlplaspga altgeqllgs llrqlqlkev
ptldradmee lvipthvraq 61 yvallqrshg drsrgkrfsq sfrevagrfl
aleasthllv fgmeqrlppn selvqavlrl 121 fqepvpkaal hrhgrlsprs
ararvtvewl rvrddgsnrt slidsrlvsv hesgwkafdv 181 teavnfwqql
srprqplllq vsvqrehlgp lasgahklvr fasqgapagl gepqlelhtl 241
dlgdygaqgd cdpeapmteg trccrgemyi dlqgmkwaen wvleppgfla yecvqtcrqp
301 pealafkwpf lgprqciase tdslpmivsi keqgrtrpqv vslpnmrvqk
cscasdgalv 361 prrlqp
[0051] RXXR cleavage sites are underlined. The cysteine knot domain
is double underlined.
TABLE-US-00003 Murine Lefty-1 cDNA (NCBI RefSeq ID NM_010094) (SEQ
ID NO: 13): 1 aggacacctc agggacacac acatccaagg ctcctcttcc
cggacagcac catgccattc 61 ctgtggctct gctgggcact ctgggcactg
tcgctggtta gcctcaggga agccctgacc 121 ggagagcaga tcctgggcag
cctgctgcaa cagctgcagc tcgatcaacc gccagtcctg 181 gacaaggctg
atgtggaagg gatggtcatc ccctcgcacg tgaggactca gtatgtggcc 241
ctgctacaac acagccatgc cagccgctcc cgaggcaaga ggttcagcca gaaccttcga
301 gaggtggcag gcaggttcct ggtgtcagag acctccactc acctgctagt
gttcggaatg 361 gagcagcggc tgccgcctaa cagcgagctg gtgcaggctg
tgctgcggct gttccaggag 421 cctgtgccca gaacagctct ccggaggcaa
aagaggctgt ccccacacag tgcccgggct 481 cgggtcacca ttgaatggct
gcgcttccgc gacgacggct ccaaccgcac tgcccttatc 541 gattctaggc
tcgtgtccat ccacgagagc ggctggaagg ccttcgacgt gaccgaggcc 601
gtgaacttct ggcagcagct gagccggccg aggcagccgc tgctgctcca ggtgtcggtg
661 cagagggagc atctggggcc gggaacctgg agctcacaca agttggttcg
tttcgcggcg 721 caggggacgc cggatggcaa ggggcagggc gagccacagc
tggagctgca cacgctggac 781 ctcaaggact atggagctca aggcaattgt
gaccccgagg caccagtgac tgaaggcacc 841 cgatgctgtc gccaggagat
gtacctggac ctgcagggga tgaagtgggc cgagaactgg 901 atcctagaac
cgccagggtt cctgacatat gaatgtgtgg gcagctgcct gcagctaccg 961
gagtccctga ccagcaggtg gccatttctg gggcctcggc agtgtgtcgc ctcagagatg
1021 acctccctgc ccatgattgt cagcgtgaag gagggaggca ggaccaggcc
tcaagtggtc 1081 agcctgccca acatgagggt gcagacctgt agctgcgcct
cagatggggc gctcataccc 1141 aggaggctgc agccataggc gcggggtgtg
gcttccccaa ggatgtgcct ttcatgcaaa 1201 tctgaagtgc tcattatact
gggagagctg gggattctaa ctccctaatg ggcaatccct 1261 gtgtgtgctc
tttgcttcct ctgaagtagc ctcatcccta aatttttacc ttcgaggaat 1321
gtgactcgct ggcccctgga ggcgctctga cccagtggtc tctgtccttc atattgttca
1381 ctgcactgta tgcgaagcac ttacatgtat agatactgca aaccaaggac
agaatcccca 1441 attgccattg ttcccttaat ttgtcgctga atctgggctg
agtcccagtc ttgactctgg 1501 acctaagcca caagttgggc aaacatgtcc
aacctaggca atactggctt tgctagatgt 1561 gaataaaata tgctttgttt tgt
Murine Lefty-2 cDNA (NCBI RefSeq ID NM_177099) (SEQ ID NO: 14): 1
gtcccaagaa cttttcaggg cacttttagg gacgcatata tccacgattc ctcctgggca
61 gcgccatgaa gtccctgtgg ctttgctggg cactctgggt actgcccctg
gctggccctg 121 gggcagcgat gaccgaggaa caggtcctga gcagtctact
gcagcagctg cagctcagcc 181 aggcccccac cctggacagc gcggatgtgg
aggagatggc catccctacc cacgtgaggt 241 cccagtatgt ggccctgctg
cagggaagtc acgctgaccg ctcccgaggc aagaggttca 301 gccagaattt
tcgagaggtg gcaggcaggt tcctgatgtc agagacctcc actcacctgc 361
tagtgttcgg aatggagcag cggctgccgc ctaacagcga gctggtgcag gctgtgctgc
421 ggctgttcca ggagcctgtg cccagaacag ctctccggag gtttgagagg
ctgtccccac 481 acagtgcccg ggctcgggtc accattgaat ggctgagagt
ccgtgaggat ggctccaatc 541 gcactgccct catcgactct aggctcgtgt
ccatccacga gagcggctgg aaggccttcg 601 acgtgaccga ggccgtgaac
ttctggcagc agctgagccg gccgaggcag ccgctgctgc 661 tccaggtgtc
ggtgcagagg gagcatctgg ggccggggac ctggagcgca cacaagttgg 721
tccgtttcgc ggcgcagggg acgccggacg gcaaggggca gggcgagcca cagctggagc
781 tgcacacgct ggacctcaag gactacggag ctcaaggcaa ttgtgacccc
gaggtaccag 841 tgactgaagg cacccgatgc tgtcgccagg agatgtacct
ggacctgcag gggatgaagt 901 gggccgagaa ctggatccta gaaccgccag
ggttcctgac gtatgaatgt gtgggcagct 961 gcctgcagct accagagtcc
ctgaccatcg ggtggccatt tctggggcct cggcagtgtg 1021 ttgcctcaga
gatgacctcc ttgcccatga ttgtcagtgt gaaggaggga ggcaggacca 1081
ggcctcaagt ggtcagcctg cccaacatga gggtgcagac ctgtagctgc gcctcagatg
1141 gggcgctcat acccaggggg atagatctgt agtctccctg tccacagatg
tattctcagt 1201 gagcttgtcc taacttagtg ctctcgtcag acctttgctc
tacagtcttg gttttcttgt 1261 ccatcaccca gtttaagcac ttacatgggt
aaatcatgtc actccagtag gacacactga 1321 ccccacttag ccaaggacat
ggctatgcag tgaacaggtt cgcatctgag tctgttttct 1381 ggccagaact
cagcttaatg tacaacaaaa ccctacggtg agaacagggg aatcaaaagc 1441
tcgtttactc ttacaccgtg attactggca tcaacgtacc atgtcaggga ctgcccacag
1501 caggctggga gggagacatc tcagaagcct gcggcagctc cttgtgaaaa
accgttgttc 1561 ccatttctcc taaccttagc cctagacaag agctgtatag
atttcatgtg tgtgactgct 1621 tttcagttgg ccttggtgtt catagttatt
ctatattatt tgactttcct actcctttct 1681 ccttctgccc tggtgaattc
tatgaaacta gatgttcctt gatgtaatga ttcttaaaca 1741 attaaaaagt
tgaggcatgg gacacagcac agcacagtcc tgatggccca ggtgcatgct 1801
gtagatgtat tctgtgtgct cttatcttgg aaacaatgca ataactttgc aatgttagtt
1861 cagattaatg tttgacttgc aaagaaagtt tgaagaaatt attagaaagt
gaaatagagc 1921 caacactggg atcccgaaaa gaaaaaagct attgaagtta
tgaaataagt tttgcacaaa 1981 atttgagagt gtttcctgga taagcaagta
tagaatacat aaaatcttat attagtaaaa 2041 ctaagccaaa acaccgggac
tcttaggagg gtcactgcgt gcaatgtgca gaagcagaaa 2101 gctggcagaa
ctgccgagtt aagggtgtac ctgagtcttt ctggccattg cctggcagct 2161
ttgcccatgt catttattgt cagagcttca cgggaaaatg caagtagccg acttcggagc
2221 tctgagctct ggagtataat aagtcaaaag gtaaagttta aataatgata
agtttgcaat 2281 aattattatt ttggccagag gcctgggaat aggggaagct
tgaaactctg ggggaacaat 2341 tataattctt gattctttgt gtgatgtggg
tattgttttg aatttgattt ggcaacgatt 2401 atacaatgtc tttttttcct
atctgcattt ggagtatcaa taaaagactg gggcaagaga 2461 aaaaaaaaaa
aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa 2521
aaaaaaaaaa aaaa Human Lefty-A cDNA (NCBI RefSeq ID NM_003240) (SEQ
ID NO: 15): 1 acacccagct gcctgagacc ctccttcaac ctccctagag
gacagcccca ctctgcctcc 61 tgctccccca gggcagcacc atgtggcccc
tgtggctctg ctgggcactc tgggtgctgc 121 ccctggctgg ccccggggcg
gccctgaccg aggagcagct cctgggcagc ctgctgcggc 181 agctgcagct
cagcgaggtg cccgtactgg acagggccga catggagaag ctggtcatcc 241
ccgcccacgt gagggcccag tatgtagtcc tgctgcggcg cagccacggg gaccgctccc
301 gcggaaagag gttcagccag agcttccgag aggtggccgg caggttcctg
gcgtcggagg 361 ccagcacaca cctgctggtg ttcggcatgg agcagcggct
gccgcccaac agcgagctgg 421 tgcaggccgt gctgcggctc ttccaggagc
cggtccccaa ggccgcgctg cacaggcacg 481 ggcggctgtc cccgcgcagc
gcccaggccc gggtgaccgt cgagtggctg cgcgtccgcg 541 acgacggctc
caaccgcacc tccctcatcg actccaggct ggtgtccgtc cacgagagcg 601
gctggaaggc cttcgacgtg accgaggccg tgaacttctg gcagcagctg agccggcccc
661 ggcagccgct gctgctacag gtgtcggtgc agagggagca tctgggcccg
ctggcgtccg 721 gcgcccacaa gctggtccgc tttgcctcgc agggggcgcc
agccgggctt ggggagcccc 781 agctggagct gcacaccctg gacctcaggg
actatggagc tcagggcgac tgtgaccctg 841 aagcaccaat gaccgagggc
acccgctgct gccgccagga gatgtacatt gacctgcagg 901 ggatgaagtg
ggccaagaac tgggtgctgg agcccccggg cttcctggct tacgagtgtg 961
tgggcacctg ccagcagccc ccggaggccc tggccttcaa ttggccattt ctggggccgc
1021 gacagtgtat cgcctcggag actgcctcgc tgcccatgat cgtcagcatc
aaggagggag 1081 gcaggaccag gccccaggtg gtcagcctgc ccaacatgag
ggtgcagaag tgcagctgtg 1141 cctcggatgg ggcgctcgtg ccaaggaggc
tccagccata ggcgcctggt gtatccattg 1201 agccctctaa ctgaacgtgt
gcatagaggt ggtcttaatg taggtcttaa ctttatactt 1261 agcaagttac
tccatcccaa tttagtgctc ctgtgtgacc ttcgccctgt gtccttccat 1321
ttcctgtctt tcccgtccat cacccatcct aagcacttac gtgagtaaat aatgcagctc
1381 agatgctgag ctctagtagg aaatgctggc atgctgatta caagatacag
ctgagcaatg 1441 cacacatttt cagctgggag tttctgttct ctggcaaatt
cttcactgag tctggaacaa 1501 taatacccta tgattagaac tggggaaaca
gaactgaatt gctgtgttat atgaggaatt 1561 aaaaccttca aatctctatt
tcccccaaat actgacccat tctggacttt tgtaaacata 1621 cctaggcccc
tgttcccctg agagggtgct aagaggaagg atgaagggct tcaggctggg 1681
ggcagtggac agggaattgg gatacctgga ttctggttct gacagggcca caagctagga
1741 tctctaacaa acgcagaagg ctttggctcg tcatttcctc ttaaaaagga
ggagctgggc 1801 ttcagctcta agaacttcat tgccctgggg atcagacagc
ccctacctac ccctgcccac 1861 tcctctggag actgagcctt gcccgtgcat
atttaggtca tttcccacac tgtcttagag 1921 aacttgtcac cagaaaccac
atgtatttgc atgttttttg ttaatttagc taaagcaatt 1981 gaatgtagat
actcagaaga aataaaaaat gatgtttcaa aaaaaaaaaa aaaaaaaaaa 2041
aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
2101 aa Human Lefty-B cDNA (NCBI RefSeq ID NM_020997) (SEQ ID NO:
16): 1 gcctgagacc ctcctgcagc cttctcaagg gacagcccca ctctgcctct
tgctcctcca 61 gggcagcacc atgcagcccc tgtggctctg ctgggcactc
tgggtgttgc ccctggccag 121 ccccggggcc gccctgaccg gggagcagct
cctgggcagc ctgctgcggc agctgcagct 181 caaagaggtg cccaccctgg
acagggccga catggaggag ctggtcatcc ccacccacgt 241 gagggcccag
tacgtggccc tgctgcagcg cagccacggg gaccgctccc gcggaaagag 301
gttcagccag agcttccgag aggtggccgg caggttcctg gcgttggagg ccagcacaca
361 cctgctggtg ttcggcatgg agcagcggct gccgcccaac agcgagctgg
tgcaggccgt 421 gctgcggctc ttccaggagc cggtccccaa ggccgcgctg
cacaggcacg ggcggctgtc 481 cccgcgcagc gcccgggccc gggtgaccgt
cgagtggctg cgcgtccgcg acgacggctc 541 caaccgcacc tccctcatcg
actccaggct ggtgtccgtc cacgagagcg gctggaaggc 601 cttcgacgtg
accgaggccg tgaacttctg gcagcagctg agccggcccc ggcagccgct 661
gctgctacag gtgtcggtgc agagggagca tctgggcccg ctggcgtccg gcgcccacaa
721 gctggtccgc tttgcctcgc agggggcgcc agccgggctt ggggagcccc
agctggagct 781 gcacaccctg gaccttgggg actatggagc tcagggcgac
tgtgaccctg aagcaccaat 841 gaccgagggc acccgctgct gccgccagga
gatgtacatt gacctgcagg ggatgaagtg 901 ggccgagaac tgggtgctgg
agcccccggg cttcctggct tatgagtgtg tgggcacctg 961 ccggcagccc
ccggaggccc tggccttcaa gtggccgttt ctggggcctc gacagtgcat
1021 cgcctcggag actgactcgc tgcccatgat cgtcagcatc aaggagggag
gcaggaccag 1081 gccccaggtg gtcagcctgc ccaacatgag ggtgcagaag
tgcagctgtg cctcggatgg 1141 tgcgctcgtg ccaaggaggc tccagccata
ggcgcctagt gtagccatcg agggacttga 1201 cttgtgtgtg tttctgaagt
gttcgagggt accaggagag ctggcgatga ctgaactgct 1261 gatggacaaa
tgctctgtgc tctctagtga gccctgaatt tgcttcctct gacaagttac 1321
ctcacctaat ttttgcttct caggaatgag aatctttggc cactggagag cccttgctca
1381 gttttctcta ttcttattat tcactgcact atattctaag cacttacatg
tggagatact 1441 gtaacctgag ggcagaaagc ccaatgtgtc attgtttact
tgtcctgtca ctggatctgg 1501 gctaaagtcc tccaccacca ctctggacct
aagacctggg gttaagtgtg ggttgtgcat 1561 ccccaatcca gataataaag
actttgtaaa acatgaataa aacacatttt attctaaaaa 1621 aaaaaaaaaa
aaaaaaaaaa aaaaaaa
[0052] It is expected that Lefty proteins also exist in other
species, including all mammals.
[0053] Unless specifically stated otherwise, "Lefty polypeptide"
includes both wild-type is (including naturally occurring alleles)
and altered ("derivative") Lefty forms, including various truncated
and variant versions of Lefty that retain the ability to inhibit
the activity of a TGF-.beta. family member such as Nodal, myostatin
or GDF-11.
[0054] As used herein, the term "Lefty activity" refers to one or
more of the activities which are exhibited by the Lefty proteins of
the present disclosure. In particular, "Lefty activity" includes
the ability to bind to one or more of Nodal, myostatin and
GDF-11.
[0055] "Specifically binds" includes reference to the preferential
association of a ligand, in whole or part, with a particular target
molecule (i.e., "binding partner" or "binding moiety") relative to
compositions lacking that target molecule. It is, of course,
recognized that a certain degree of non-specific interaction may
occur between the subject Lefty polypeptides and other non-target
proteins. Typically specific binding results in a much stronger
association between the Lefty polypeptide and the target protein
(e.g., Nodal, myostatin and/or GDF-11) than between the Lefty
polypeptide and other proteins.
2. Lefty Derivatives
[0056] The disclosure provides novel derivatives of Lefty proteins.
The term "Lefty derivatives" includes altered forms of known Lefty
proteins, such as variants induced by mutagenesis, insertions or
deletions, and fragments of Lefty proteins, which variants retain
Nodal, myostatin and/or GDF-11 binding activity. Lefty derivatives
also include proteins sharing structural and/or functional
similarity to known Lefty proteins, including those proteins which
are described further herein. Such proteins may have amino acid
sequences sharing significant sequence identity (e.g., at least
about 50%, 60%, 70%, 80%, 90%, 95%, 99% or more) with the human or
mouse Lefty proteins, over the full-length, the mature portion, or
at least within the Regions 2 and 4 of the human or mouse Lefty.
Lefty derivatives also include proteins that have amino acid
sequences that are encoded by nucleic acid sequences that hybridize
under stringent conditions with the coding sequences for human or
mouse Lefty, particularly that portion of the coding sequence for
the mature portion, especially Regions 2 and 4. The term "Lefty
derivative" excludes any of SEQ ID Nos. 1-4.
[0057] As described in FIGS. 1-5, Lefty proteins may be divided
into portions, including a signal sequence, a propeptide, and a
mature portion. The mature portion can be viewed as having five
regions. Region 1 is the portion of the mature polypeptide that is
N-terminal to C1 (the first cysteine of the cystine knot domain).
Regions 2 and 4 correspond to Loops A and B and participate in
ligand binding (ligands such as Nodal, myostatin and GDF-11).
Region 3 of Lefty proteins lacks the alpha helix and the cysteine
that participates in intermolecular crosslinking. Region 5 is the
portion that is C-terminal to the final cysteine of the cystine
knot domain. The propeptide will be long or short, depending on
whether the upstream (N-terminal) or downstream RXXR cleavage site
is used. Conversely, the mature portion, if expressed with a
propeptide, will be short or long, depending on which RXXR cleavage
site is used.
[0058] It is expected that Regions 2 and 4 mediate binding to
Nodal, myostatin and GDF-11, and accordingly, any of Regions 1, 3
and 5 may be altered, in so far as ligand binding is retained. It
is expected that the basic cystine knot structure will generally be
conserved in Lefty derivatives that retain ligand binding
activity.
[0059] Lefty proteins from other species, especially those of
mammals, can be readily obtained by standard molecular biology
protocols, such as PCR, low stringency hybridization, or
antibody-mediated screening of expression libraries using
antibodies cross-reacting with identified Lefty homologs in target
species.
[0060] In certain embodiments, isolated fragments of the Lefty
polypeptides can be obtained by screening polypeptides
recombinantly produced from the corresponding fragment of the
nucleic acid encoding a Lefty polypeptide (e.g., SEQ ID Nos:
13-16). In addition, fragments can be chemically synthesized using
techniques known in the art such as conventional Merrifield solid
phase f-Moc or t-Boc chemistry. The fragments can be produced
(recombinantly or by chemical synthesis) and tested to identify
those peptidyl fragments that can function to bind to Nodal,
myostatin and/or GDF-11, or for a cell-based activity, such as
stimulation of muscle growth.
[0061] In certain embodiments, a Lefty derivative has an amino acid
sequence that is at least 75% identical to an amino acid sequence
as set forth in any of SEQ ID Nos. 1-4, 9, 10, 11, 12 or 22. In
certain cases, the Lefty derivative has an amino acid sequence at
least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to an
amino acid sequence as set forth in any of SEQ ID Nos. 1-4, 9, 10,
11, 12 or 22. Preferably such variants retain the ability to bind
to to Nodal, myostatin and/or GDF-11.
[0062] In certain embodiments, the present invention contemplates
making functional Lefty derivatives by modifying the structure of a
Lefty polypeptide. Such modifications may be made, for example, for
such purposes as enhancing therapeutic efficacy, or stability
(e.g., ex vivo shelf life and resistance to proteolytic degradation
in vivo). Lefty derivatives can also be produced, for instance, by
amino acid substitution, deletion, or addition. For instance, it is
reasonable to expect that an isolated replacement of a leucine with
an isoleucine or valine, an aspartate with a glutamate, a threonine
with a serine, or a similar replacement of an amino acid with a
structurally related amino acid (e.g., conservative mutations) will
not have a major effect on the biological activity of the resulting
molecule. Conservative replacements are those that take place
within a family of amino acids that are related in their side
chains. Whether a change in the amino acid sequence of a Lefty
derivative results in a functional homolog can be readily
determined by assessing the ability of the variant propeptide to
produce a response in cells, or to bind to ligand, in a fashion
similar to the wild-type Lefty.
[0063] In certain embodiments, the present invention contemplates
making mutations in a proteolytic cleavage site of a Lefty sequence
to make the site less susceptible to proteolytic cleavage. Computer
analysis (using a commercially available software, e.g., MacVector,
Omega, PCGene, Molecular Simulation, Inc.) can be used to identify
proteolytic cleavage sites. As will be recognized by one of skill
in the art, most of the described mutations, variants or
modifications may be made at the nucleic acid level or, in some
cases, by post translational modification or chemical synthesis.
Such techniques are well known in the art.
[0064] In certain embodiments, the present invention contemplates
specific mutations of the Lefty sequences so as to alter the
glycosylation of the polypeptide. Such mutations may be selected so
as to introduce or eliminate one or more glycosylation sites, such
as O-linked or N-linked glycosylation sites. Asparagine-linked
glycosylation recognition sites generally comprise a tripeptide
sequence, asparagine-X-threonine (where "X" is any amino acid)
which are specifically recognized by appropriate cellular
glycosylation enzymes. The alteration may also be made by the
addition of, or substitution by, one or more serine or threonine
residues to the sequence of the wild-type Lefty (for O-linked
glycosylation sites). A variety of amino acid substitutions or
deletions at one or both of the first or third amino acid positions
of a glycosylation recognition site (and/or amino acid deletion at
the second position) results in non-glycosylation at the modified
tripeptide sequence. Another means of increasing the number of
carbohydrate moieties on a Lefty polypeptide is by chemical or
enzymatic coupling of glycosides to the Lefty polypeptide.
Depending on the coupling mode used, the sugar(s) may be attached
to (a) arginine and histidine; (b) free carboxyl groups; (c) free
sulfhydryl groups such as those of cysteine; (d) free hydroxyl
groups such as those of serine, threonine, or hydroxyproline; (e)
aromatic residues such as those of phenylalanine, tyrosine, or
tryptophan; or (f) the amide group of glutamine. Removal of one or
more carbohydrate moieties present on a Lefty polypeptide may be
accomplished chemically and/or enzymatically. Chemical
deglycosylation may involve, for example, exposure of the Lefty
polypeptide to the compound trifluoromethanesulfonic acid, or an
equivalent compound. This treatment results in the cleavage of most
or all sugars except the linking sugar (N-acetylglucosamine or
N-acetylgalactosamine), while leaving the amino acid sequence
intact. Chemical deglycosylation is further described by Hakimuddin
et al. (1987) Arch. Biochem. Biophys. 259:52 and by Edge et al.
(1981) Anal. Biochem. 118:131. Enzymatic cleavage of carbohydrate
moieties on Lefty polypeptide can be achieved by the use of a
variety of endo- and exo-glycosidases as described by Thotakura et
al. (1987) Meth. Enzymol. 138:350. The nucleic acid and/or amino
acid sequence of a propeptide may be adjusted, as appropriate,
depending on the type of expression system used, as mammalian,
yeast, insect and plant cells may all introduce differing
glycosylation patterns that can be affected by the amino acid
sequence of the peptide.
[0065] Examples of sequence modifications that can be made in
Lefty-A are set forth below:
TABLE-US-00004 LTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLLRRSHGD
RSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLF
QEPVPKAAL(N)HR(T/G)HGR(N)LSPRSAQARVTVEWLRVRDDGSNRT
SLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGP
LASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAP(N)M
TE(N)GTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEA
(N)LA(T)FNW(S)P(T)FLGPRQCIASETASLPMIVSIKEGGRTRPQVV
SLPNMRVQKCSCASDGALVPRRLQP
[0066] The first and second cleavage sites are underlined. Possible
alterations, which may be used together, individually, or in
combinations, are shown in brackets following the amino acid that
would be altered. In this version, the polypeptide will be cleaved
at the first site to give rise to a 34 kDa Lefty-A polypeptide
beginning with the bold font pheylalanine (F). The second RXXR
cleavage site may be altered to eliminate cleavage (e.g., R->G
change) or to eliminate cleavage and introduce a glycosylation site
(other changes shown). Other mutations are shown to introduce
glycosylation sites at the C-terminal end of Region 1 and in Region
3. Similar mutations may be made in any of SEQ ID Nos. 2-4.
[0067] This disclosure contemplates methods of generating mutants,
including sets of combinatorial mutants of Lefty polypeptides, as
well as truncation mutants; pools of combinatorial mutants are
especially useful for identifying functional variant sequences. The
purpose of screening such combinatorial libraries may be to
generate, for example, Lefty derivatives which can act as
antagonists of Nodal, myostatin and/or GDF-11. For example, a Lefty
polypeptide variant may be screened for ability to bind to a Nodal,
myostatin and/or GDF-11 polypeptide, or for the ability to prevent
binding of a Nodal, myostatin and/or GDF-11 to a cell expressing a
receptor, such as an ActRIIA or B. The activity of a Lefty
polypeptide variant may also be tested in a cell-based or in vivo
assay. For example, the effect of a Lefty polypeptide variant on
the expression of genes involved in muscle cell growth or
myostatin-sensitive promoter may be assessed. Likewise, a Lefty
polypeptide may be administered to a mouse or other animal, and one
or more bone properties, such as density or volume may be assessed.
The healing rate for bone fractures may also be evaluated. The
effect of a Lefty polypeptide on gene expression changes caused by
any of myostatin, Nodal or GDF-11 may be assessed. For example, an
A-204 reporter gene assay may be used to evaluate the effects of
Lefty polypeptides on signaling by GDF-11 and myostatin or other
TGF-beta family members. A cell line, (e.g., human rhabdomyosarcoma
cell line) may be transfected with a reporter vector that places a
reporter gene (e.g., luciferase) under direction of a TGF-beta
signaling-sensitive regulatory element (e.g., pGL3(CAGA)12
described in Dennler et al, 1998, EMBO 17: 3091-3100.) The CAGA22
motif is present in TGF-Beta responsive genes (PAI-1 gene), and
this type of vector is of general use for factors signaling through
Smad2 and 3. Lefty polypeptides may be tested for effects on the
reporter gene activity.
[0068] Combinatorially-derived variants can be generated which have
a selective potency relative to a naturally occurring Lefty
polypeptide. Likewise, mutagenesis can give rise to variants which
have intracellular half-lives dramatically different than the
corresponding wild-type propeptide. For example, the altered
protein can be rendered either more stable or less stable to
proteolytic degradation.
[0069] A combinatorial library may be produced by way of a
degenerate library of genes encoding a library of polypeptides
which each include at least a portion of potential Lefty
polypeptide sequences. For instance, a mixture of synthetic
oligonucleotides can be enzymatically ligated into gene sequences
such that the degenerate set of potential Lefty polypeptide
nucleotide sequences are expressible as individual polypeptides, or
alternatively, as a set of larger fusion proteins (e.g., for phage
display).
[0070] There are many ways by which the library of potential
homologs can be generated from a degenerate oligonucleotide
sequence. Chemical synthesis of a degenerate gene sequence can be
carried out in an automatic DNA synthesizer, and the synthetic
genes then be ligated into an appropriate vector for expression.
The synthesis of degenerate oligonucleotides is well known in the
art (see for example, Narang, S A (1983) Tetrahedron 39:3; Itakura
et al., (1981) Recombinant DNA, Proc. 3rd Cleveland Sympos.
Macromolecules, ed. AG Walton, Amsterdam: Elsevier pp 273-289;
Itakura et al., (1984) Annu. Rev. Biochem. 53:323; Itakura et al.,
(1984) Science 198:1056; Ike et al., (1983) Nucleic Acid Res.
11:477). Such techniques have been employed in the directed
evolution of other proteins (see, for example, Scott et al., (1990)
Science 249:386-390; Roberts et al., (1992) PNAS USA 89:2429-2433;
Devlin et al., (1990) Science 249: 404-406; Cwirla et al., (1990)
PNAS USA 87: 6378-6382; as well as U.S. Pat. Nos. 5,223,409,
5,198,346, and 5,096,815).
[0071] Alternatively, other forms of mutagenesis can be utilized to
generate a combinatorial library. For example, Lefty polypeptide
variants can be generated and isolated from a library by screening
using, for example, alanine scanning mutagenesis and the like (Ruf
et al., (1994) Biochemistry 33:1565-1572; Wang et al., (1994) J.
Biol. Chem. 269:3095-3099; Balint et al., (1993) Gene 137:109-118;
Grodberg et al., (1993) Eur. J. Biochem. 218:597-601; Nagashima et
al., (1993) J. Biol. Chem. 268:2888-2892; Lowman et al., (1991)
Biochemistry 30:10832-10838; and Cunningham et al., (1989) Science
244:1081-1085), by linker scanning mutagenesis (Gustin et al.,
(1993) Virology 193:653-660; Brown et al., (1992) Mol. Cell. Biol.
12:2644-2652; McKnight et al., (1982) Science 232:316); by
saturation mutagenesis (Meyers et al., (1986) Science 232:613); by
PCR mutagenesis (Leung et al., (1989) Method Cell Mol Biol
1:11-19); or by random mutagenesis, including chemical mutagenesis,
etc. (Miller et al., (1992) A Short Course in Bacterial Genetics,
CSHL Press, Cold Spring Harbor, N.Y.; and Greener et al., (1994)
Strategies in Mol Biol 7:32-34). Linker scanning mutagenesis,
particularly in a combinatorial setting, is an attractive method
for identifying truncated (bioactive) forms of Lefty
polypeptides.
[0072] A wide range of techniques are known in the art for
screening gene products of combinatorial libraries made by point
mutations and truncations, and, for that matter, for screening cDNA
libraries for gene products having a certain property. Such
techniques will be generally adaptable for rapid screening of the
gene libraries generated by the combinatorial mutagenesis of Lefty
polypeptides. The most widely used technique for screening large
gene libraries typically comprises cloning the gene library into
replicable expression vectors, transforming appropriate cells with
the resulting library of vectors, and expressing the combinatorial
genes under conditions in which detection of a desired activity
facilitates relatively easy isolation of the vector encoding the
gene whose product was detected. Each of the illustrative assays
described below are amenable to high through-put analysis as
necessary to screen large numbers of degenerate sequences created
by combinatorial mutagenesis techniques.
[0073] In certain embodiments, the Lefty polypeptides of the
present invention include peptidomimetics. As used herein, the term
"peptidomimetic" includes chemically modified peptides and
peptide-like molecules that contain non-naturally occurring amino
acids, peptoids, and the like. Peptidomimetics provide various
advantages over a peptide, including enhanced stability when
administered to a subject. Methods for identifying a peptidomimetic
are well known in the art and include the screening of databases
that contain libraries of potential peptidomimetics. For example,
the Cambridge Structural Database contains a collection of greater
than 300,000 compounds that have known crystal structures (Allen et
al., Acta Crystallogr. Section B, 35:2331 (1979)). Where no crystal
structure of a target molecule is available, a structure can be
generated using, for example, the program CONCORD (Rusinko et al.,
J. Chem. Inf. Comput. Sci. 29:251 (1989)). Another database, the
Available Chemicals Directory (Molecular Design Limited,
Informations Systems; San Leandro Calif.), contains about 100,000
compounds that are commercially available and also can be searched
to identify potential peptidomimetics of the Lefty polypeptides.
For instance, non-hydrolyzable peptide analogs of such residues can
be generated using benzodiazepine (e.g., see Freidinger et al., in
Peptides: Chemistry and Biology, G. R. Marshall ed., ESCOM
Publisher: Leiden, Netherlands, 1988), azepine (e.g., see Huffman
et al., in Peptides: Chemistry and Biology, G. R. Marshall ed.,
ESCOM Publisher: Leiden, Netherlands, 1988), substituted gamma
lactam rings (Garvey et al., in Peptides: Chemistry and Biology, G.
R. Marshall ed., ESCOM Publisher: Leiden, Netherlands, 1988),
keto-methylene pseudopeptides (Ewenson et al., (1986) J. Med. Chem.
29:295; and Ewenson et al., in Peptides: Structure and Function
(Proceedings of the 9th American Peptide Symposium) Pierce Chemical
Co. Rockland, Ill., 1985), b-turn dipeptide cores (Nagai et al.,
(1985) Tetrahedron Lett 26:647; and Sato et al., (1986) J Chem Soc
Perkin Trans 1:1231), and b-aminoalcohols (Gordon et al., (1985)
Biochem Biophys Res Commun 126:419; and Dann et al., (1986) Biochem
Biophys Res Commun 134:71).
[0074] In certain embodiments, the Lefty polypeptides of the
invention may further comprise post-translational modifications in
addition to any that are naturally present in the propeptide. Such
modifications include, but are not limited to, acetylation,
carboxylation, glycosylation, phosphorylation, lipidation, and
acylation. As a result, the modified Lefty polypeptides may contain
non-amino acid elements, such as polyoxyalkylene glycols (e.g.,
polyethylene glycols, polypropylene glycols), lipids, poly- or
mono-saccharide, and phosphates. Effects of such non-amino acid
elements on the functionality of a Lefty polypeptide may be tested
as described herein. When a Lefty polypeptide is produced in cells
by cleaving a nascent form of the Lefty polypeptide,
post-translational processing may also be important for correct
folding and/or function of the protein. Different cells (such as
CHO, HeLa, MDCK, 293, W138, NIH-3T3 or HEK293) have specific
cellular machinery and characteristic mechanisms for such
post-translational activities and may be chosen to ensure the
correct modification and processing of the Lefty polypeptide.
[0075] The various Lefty polypeptides may be prepared as fusion
proteins. A fusion protein may include one or more additional
polypeptide portion that enhance one or more of in vivo stability,
in vivo half life, uptake/administration, tissue localization or
distribution, formation of protein complexes, and/or purification.
For example, a fusion protein may include an immunoglobulin Fc
domain and/or a purification subsequence selected from: an epitope
tag, a FLAG tag, a polyhistidine sequence, and a GST fusion. A
Lefty polypeptide may include one or more modified amino acid
residues selected from: a glycosylated amino acid, a PEGylated
amino acid, a farnesylated amino acid, an acetylated amino acid, a
biotinylated amino acid, an amino acid conjugated to a lipid
moiety, and an amino acid conjugated to an organic derivatizing
agent.
[0076] A fusion protein or coupled protein system (e.g. non-fusion
covalent linkage by crosslinking) may also include a second
antagonist domain, which is a polypeptide affinity reagent that
selectively binds to Nodal, myostatin and/or GDF-11 and competes
with the binding of an ALK7 or ALK4 receptor. The affinity reagent
may be an antibody agent. An antibody agent may be, for example, a
recombinant antibody; a monoclonal antibody; a VH domain; a VL
domain; an scFv; an Fab fragment; an Fab' fragment; an F(ab).sub.2;
an Fv; or a disulfide linked Fv, a fully human antibody or a
humanized chimeric antibody, or an antigen binding fragment
thereof. An affinity reagent is a peptide or scaffolded peptide
that selectively binds to Nodal, myostatin and/or Lefty and
competes with the binding of an ALK7 or ALK4 receptor. An affinity
reagent may include a Nodal, myostatin and/or GDF-11 binding domain
of ALK7 or ALK4. For example, an extracellular domain of ALK7 or
ALK4 (preferably human ALK7 or ALK4) may be used. The affinity
reagent may be a small organic molecule that selectively binds to
Nodal, myostatin and/or GDF-11 and competes with the binding of an
ALK7 or ALK4 receptor.
[0077] An example of a human ALK7 ligand binding domain is shown
below:
TABLE-US-00005 (SEQ ID NO: 26)
LKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFC
HSSNNVTKTECCFTDFCNNITLHLP
[0078] An example of a human ALK4 myostatin binding domain is shown
below:
TABLE-US-00006 (SEQ ID NO: 27)
ALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGK
PFYCLSSEDLRNTHCCYTDY
[0079] It is understood that different elements of the fusion
proteins may be arranged in any manner that is consistent with the
desired functionality. For example, a Lefty polypeptide may be
placed C-terminal to a heterologous domain, or, alternatively, a
heterologous domain may be placed C-terminal to a Lefty
polypeptide. The propeptide domain and the heterologous domain need
not be adjacent in a fusion protein, and additional domains or
amino acid sequences may be included C- or N-terminal to either
domain or between the domains.
[0080] In certain embodiments, the Lefty polypeptides of the
present invention contain one or more modifications that are
capable of stabilizing the Lefty polypeptides. For example, such
modifications may enhance the in vitro half life of the
propeptides, enhance circulatory half life of the propeptides or
reducing proteolytic degradation of the propeptides. Such
stabilizing modifications include, but are not limited to, fusion
proteins (including, for example, fusion proteins comprising a
Lefty polypeptide and a stabilizer domain), modifications of a
glycosylation site (including, for example, addition of a
glycosylation site to a Lefty polypeptide), and modifications of
carbohydrate moiety (including, for example, removal of
carbohydrate moieties from a Lefty polypeptide). In the case of
fusion proteins, a Lefty polypeptide is fused to a stabilizer
domain such as an IgG molecule (e.g., an Fc domain). As used
herein, the term "stabilizer domain" not only refers to a fusion
domain (e.g., Fc) as in the case of fusion proteins, but also
includes nonproteinaceous modifications such as a carbohydrate
moiety, or nonproteinaceous polymer, such as polyethylene glycol
(PEG). PEG may be affixed to Lefty polypeptides in a variety of
sizes, ranging from 1000 D to 50,000 D or more molecular weight
polymers. PEG polymers may be affixed to propeptides in a
selective, residue specific manner, particularly when directed
against the N-terminal amine or an engineered cysteine. PEG
polymers may also be affixed in a relatively uncontrolled reaction,
in which primary amines and/or sulfhydryl groups may be reacted.
The stoichiometry may range from 1:1 (PEG:peptide) to 2:1 and
higher.
[0081] In certain embodiments, the Lefty polypeptide is fused with
an immunoglobulin Fc domain. In a preferred embodiment, the Fc
domain is an IgG1 Fc fragment. An IgG1 Fc fragment may include
various alterations, including, for example, mutations that reduce
binding to Fc.gamma. Receptor and mutations that decreased binding
to MHC class I-related Fc-receptor (FcRN). Examples of mutations
include mutations in the an Fc portion at positions 265 (Asp to
Ala), 322 (Lys to Ala), and 434 (Asn to Ala).
[0082] In certain embodiments, the present invention makes
available isolated and/or purified forms of the Lefty polypeptides,
which are isolated from, or otherwise substantially free of, other
proteins.
[0083] In certain embodiments, Lefty polypeptides (unmodified or
modified) of the invention can be produced by a variety of
art-recognized techniques. For example, such Lefty polypeptides can
be synthesized using standard protein chemistry techniques such as
those described in Bodansky, M. Principles of Peptide Synthesis,
Springer Verlag, Berlin (1993) and Grant G. A. (ed.), Synthetic
Peptides: A User's Guide, W. H. Freeman and Company, New York
(1992). In addition, automated peptide synthesizers are
commercially available (e.g., Advanced ChemTech Model 396;
Milligen/Biosearch 9600). Alternatively, the Lefty polypeptides,
fragments or variants thereof may be recombinantly produced using
various expression systems (e.g., E. coli, Chinese Hamster Ovary
cells, COS cells, baculovirus) as is well known in the art (also
see below). In a further embodiment, the modified or unmodified
Lefty polypeptides may be produced by digestion of naturally
occurring or recombinantly produced Lefty polypeptide by using, for
example, a protease, e.g., trypsin, thermolysin, chymotrypsin,
pepsin, or paired basic amino acid converting enzyme (PACE).
Computer analysis (using a commercially available software, e.g.,
MacVector, Omega, PCGene, Molecular Simulation, Inc.) can be used
to identify proteolytic cleavage sites.
3. Nucleic Acids Encoding Lefty Polypeptides
[0084] In certain aspects, the invention provides isolated and/or
recombinant nucleic acids encoding any of the Lefty polypeptides,
including derivatives, disclosed herein. The subject nucleic acids
may be single-stranded or double stranded. Such nucleic acids may
be DNA or RNA molecules. These nucleic acids are may be used, for
example, in methods for making Lefty polypeptides or as direct
therapeutic agents (e.g., in a gene therapy approach).
[0085] In other embodiments, nucleic acids of the invention also
include nucleotide sequences that hybridize under highly stringent
conditions to the nucleotide sequence designated in SEQ ID Nos:
13-16, complement sequence of SEQ ID Nos: 13-16, or fragments
thereof. As discussed above, one of ordinary skill in the art will
understand readily that appropriate stringency conditions which
promote DNA hybridization can be varied. One of ordinary skill in
the art will understand readily that appropriate stringency
conditions which promote DNA hybridization can be varied. For
example, one could perform the hybridization at 6.0.times. sodium
chloride/sodium citrate (SSC) at about 45.degree. C., followed by a
wash of 2.0.times.SSC at 50.degree. C. For example, the salt
concentration in the wash step can be selected from a low
stringency of about 2.0.times.SSC at 50.degree. C. to a high
stringency of about 0.2.times.SSC at 50.degree. C. In addition, the
temperature in the wash step can be increased from low stringency
conditions at room temperature, about 22.degree. C., to high
stringency conditions at about 65.degree. C. Both temperature and
salt may be varied, or temperature or salt concentration may be
held constant while the other variable is changed. In one
embodiment, the invention provides nucleic acids which hybridize
under low stringency conditions of 6.times.SSC at room temperature
followed by a wash at 2.times.SSC at room temperature.
[0086] Isolated nucleic acids which differ from the nucleic acids
as set forth in SEQ ID Nos: 13-16 due to degeneracy in the genetic
code are also within the scope of the invention. For example, a
number of amino acids are designated by more than one triplet.
Codons that specify the same amino acid, or synonyms (for example,
CAU and CAC are synonyms for histidine) may result in "silent"
mutations which do not affect the amino acid sequence of the
protein. However, it is expected that DNA sequence polymorphisms
that do lead to changes in the amino acid sequences of the subject
proteins will exist among mammalian cells. One skilled in the art
will appreciate that these variations in one or more nucleotides
(up to about 3-5% of the nucleotides) of the nucleic acids encoding
a particular protein may exist among individuals of a given species
due to natural allelic variation. Any and all such nucleotide
variations and resulting amino acid polymorphisms are within the
scope of this invention.
[0087] In certain embodiments, the recombinant nucleic acids of the
invention may be operably linked to one or more regulatory
nucleotide sequences in an expression construct. Regulatory
nucleotide sequences will generally be appropriate to the host cell
used for expression. Numerous types of appropriate expression
vectors and suitable regulatory sequences are known in the art for
a variety of host cells. Typically, said one or more regulatory
nucleotide sequences may include, but are not limited to, promoter
sequences, leader or signal sequences, ribosomal binding sites,
transcriptional start and termination sequences, translational
start and termination sequences, and enhancer or activator
sequences. Constitutive or inducible promoters as known in the art
are contemplated by the invention. The promoters may be either
naturally occurring promoters, or hybrid promoters that combine
elements of more than one promoter. An expression construct may be
present in a cell on an episome, such as a plasmid, or the
expression construct may be inserted in a chromosome. In a
preferred embodiment, the expression vector contains a selectable
marker gene to allow the selection of transformed host cells.
Selectable marker genes are well known in the art and will vary
with the host cell used.
[0088] In certain aspects of the invention, the subject nucleic
acid is provided in an expression vector comprising a nucleotide
sequence encoding a Lefty polypeptide and operably linked to at
least one regulatory sequence. Regulatory sequences are
art-recognized and are selected to direct expression of the Lefty
polypeptide. Accordingly, the term regulatory sequence includes
promoters, enhancers, and other expression control elements.
Exemplary regulatory sequences are described in Goeddel; Gene
Expression Technology: Methods in Enzymology, Academic Press, San
Diego, Calif. (1990). For instance, any of a wide variety of
expression control sequences that control the expression of a DNA
sequence when operatively linked to it may be used in these vectors
to express DNA sequences encoding a Lefty polypeptide. Such useful
expression control sequences, include, for example, the CMV
promoter, the early and late promoters of SV40, tet promoter,
adenovirus or cytomegalovirus immediate early promoter, RSV
promoters, the lac system, the trp system, the TAC or TRC system,
T7 promoter whose expression is directed by T7 RNA polymerase, the
major operator and promoter regions of phage lambda, the control
regions for fd coat protein, the promoter for 3-phosphoglycerate
kinase or other glycolytic enzymes, the promoters of acid
phosphatase, e.g., Pho5, the promoters of the yeast .alpha.-mating
factors, the polyhedron promoter of the baculovirus system and
other sequences known to control the expression of genes of
prokaryotic or eukaryotic cells or their viruses, and various
combinations thereof. It should be understood that the design of
the expression vector may depend on such factors as the choice of
the host cell to be transformed and/or the type of protein desired
to be expressed. Moreover, the vector's copy number, the ability to
control that copy number and the expression of any other protein
encoded by the vector, such as antibiotic markers, should also be
considered.
[0089] A recombinant nucleic acid of the invention can be produced
by ligating the cloned gene, or a portion thereof, into a vector
suitable for expression in either prokaryotic cells, eukaryotic
cells (yeast, avian, insect or mammalian), or both. Expression
vehicles for production of a recombinant Lefty polypeptides include
plasmids and other vectors. For instance, suitable vectors include
plasmids of the types: pBR322-derived plasmids, pEMBL-derived
plasmids, pEX-derived plasmids, pBTac-derived plasmids and
pUC-derived plasmids for expression in prokaryotic cells, such as
E. coli.
[0090] Some mammalian expression vectors contain both prokaryotic
sequences to facilitate the propagation of the vector in bacteria,
and one or more eukaryotic transcription units that are expressed
in eukaryotic cells. The pcDNAI/amp, pcDNAI/neo, pRc/CMV, pSV2gpt,
pSV2neo, pSV2-dhfr, pTk2, pRSVneo, pMSG, pSVT7, pko-neo and pHyg
derived vectors are examples of mammalian expression vectors
suitable for transfection of eukaryotic cells. Some of these
vectors are modified with sequences from bacterial plasmids, such
as pBR322, to facilitate replication and drug resistance selection
in both prokaryotic and eukaryotic cells. Alternatively,
derivatives of viruses such as the bovine papilloma virus (BPV-1),
or Epstein-Barr virus (pHEBo, pREP-derived and p205) can be used
for transient expression of proteins in eukaryotic cells. Examples
of other viral (including retroviral) expression systems can be
found below in the description of gene therapy delivery systems.
The various methods employed in the preparation of the plasmids and
transformation of host organisms are well known in the art. For
other suitable expression systems for both prokaryotic and
eukaryotic cells, as well as general recombinant procedures, see
Molecular Cloning A Laboratory Manual, 2nd Ed., ed. by Sambrook,
Fritsch and Maniatis (Cold Spring Harbor Laboratory Press, 1989)
Chapters 16 and 17. In some instances, it may be desirable to
express the recombinant SLC5A8 polypeptide by the use of a
baculovirus expression system. Examples of such baculovirus
expression systems include pVL-derived vectors (such as pVL1392,
pVL1393 and pVL941), pAcUW-derived vectors (such as pAcUW1), and
pBlueBac-derived vectors (such as the .beta.-gal containing
pBlueBac III).
[0091] In a particular embodiment, a vector will be designed for
production of a subject Lefty polypeptide in CHO cells, such as a
Pcmv-Script vector (Stratagene, La Jolla, Calif.), pcDNA4 vectors
(Invitrogen, Carlsbad, Calif.) and pCI-neo vectors (Promega,
Madison, Wis.). As will be apparent, the subject gene constructs
can be used to cause expression of the subject Lefty polypeptides
in cells propagated in culture, e.g., to produce proteins,
including fusion proteins or variant proteins, for
purification.
[0092] This invention also pertains to a host cell transfected with
a recombinant gene including a coding sequence for one or more of
the subject Lefty polypeptides. The host cell may be any
prokaryotic or eukaryotic cell. For example, a Lefty polypeptide of
the invention may be expressed in bacterial cells such as E. coli,
insect cells (e.g., using a baculovirus expression system), yeast,
or mammalian cells. Other suitable host cells are known to those
skilled in the art.
[0093] Accordingly, the present invention further pertains to
methods of producing the subject Lefty polypeptides. For example, a
host cell transfected with an expression vector encoding a Lefty
polypeptide can be cultured under appropriate conditions to allow
expression of the Lefty polypeptide to occur. The Lefty polypeptide
may be secreted and isolated from a mixture of cells and medium
containing the propeptide. Alternatively, the polypeptide may be
retained cytoplasmically or in a membrane fraction and the cells
harvested, lysed and the protein isolated. A cell culture includes
host cells, media and other byproducts. Suitable media for cell
culture are well known in the art. The polypeptide can be isolated
from cell culture medium, host cells, or both using techniques
known in the art for purifying proteins, including ion-exchange
chromatography, gel filtration chromatography, ultrafiltration,
electrophoresis, and immunoaffinity purification with antibodies
specific for particular epitopes of the Lefty polypeptide. In a
preferred embodiment, the Lefty polypeptide is a fusion protein
containing a domain which facilitates its purification
(purification domain). For example, a fusion gene coding for a
purification leader sequence or C-terminal tail, such as a
poly-(His)/enterokinase cleavage site sequence at the N-terminus of
the desired portion of the recombinant Lefty polypeptide, can allow
purification of the expressed fusion protein by affinity
chromatography using a Ni.sup.2+ metal resin. The purification
sequence can then be subsequently removed by treatment with
enterokinase to provide the purified Lefty polypeptide (e.g., see
Hochuli et al., (1987) J. Chromatography 411:177; and Janknecht et
al., PNAS USA 88:8972).
[0094] Techniques for making fusion genes are well known.
Essentially, the joining of various DNA fragments coding for
different polypeptide sequences is performed in accordance with
conventional techniques, employing blunt-ended or stagger-ended
termini for ligation, restriction enzyme digestion to provide for
appropriate termini, filling-in of cohesive ends as appropriate,
alkaline phosphatase treatment to avoid undesirable joining, and
enzymatic ligation. In another embodiment, the fusion gene can be
synthesized by conventional techniques including automated DNA
synthesizers. Alternatively, PCR amplification of gene fragments
can be carried out using anchor primers which give rise to
complementary overhangs between two consecutive gene fragments
which can subsequently be annealed to generate a chimeric gene
sequence (see, for example, Current Protocols in Molecular Biology,
eds. Ausubel et al., John Wiley & Sons: 1992).
4. Examplary Therapeutic Uses
[0095] The subject Lefty polypeptides, such as the full-length and
the N-terminally truncated Lefty derivatives, can be used in a
number of therapeutic settings to treat a number of diseases
resulting from or exacerbated by the presence of myostatin, Nodal
or GDF-11.
[0096] In certain embodiments, the subject Lefty polypeptides are
used as part of a treatment for a muscular dystrophy. The term
"muscular dystrophy" refers to a group of degenerative muscle
diseases characterized by gradual weakening and deterioration of
skeletal muscles and sometimes the heart and respiratory muscles.
Muscular dystrophies are genetic disorders characterized by
progressive muscle wasting and weakness that begin with microscopic
changes in the muscle. As muscles degenerate over time, the
person's muscle strength declines. Exemplary muscular dystrophies
that can be treated with a regimen including the subject myostatin
include: Duchenne Muscular Dystrophy (DMD), Becker Muscular
Dystrophy (BMD), Emery-Dreifuss Muscular Dystrophy (EDMD),
Limb-Girdle Muscular Dystrophy (LGMD), Facioscapulohumeral Muscular
Dystrophy (FSH or FSHD) (Also known as Landouzy-Dejerine), Myotonic
Dystrophy (MMD) (Also known as Steinert's Disease), Oculopharyngeal
Muscular Dystrophy (OPMD), Distal Muscular Dystrophy (DD),
Congenital Muscular Dystrophy (CMD).
[0097] Duchenne Muscular Dystrophy (DMD) was first described by the
French neurologist Guillaume Benjamin Amand Duchenne in the 1860s.
Becker Muscular Dystrophy (BMD) is named after the German doctor
Peter Emil Becker, who first described this variant of DMD in the
1950s. DMD is one of the most frequent inherited diseases in males,
affecting one in 3,500 boys. DMD occurs when the dystrophin gene,
located on the short arm of the X chromosome, is broken. Since
males only carry one copy of the X chromosome, they only have one
copy of the dystrophin gene. Without the dystrophin protein, muscle
is easily damaged during cycles of contraction and relaxation.
While early in the disease muscle compensates by regeneration,
later on muscle progenitor cells cannot keep up with the ongoing
damage and healthy muscle is replaced by non-functional fibro-fatty
tissue.
[0098] In DMD, boys begin to show signs of muscle weakness as early
as age 3. The disease gradually weakens the skeletal or voluntary
muscles, those in the arms, legs and trunk. By the early teens or
even earlier, the boy's heart and respiratory muscles may also be
affected. BMD is a much milder version of DMD. Its onset is usually
in the teens or early adulthood, and the course is slower and far
less predictable than that of DMD. (Though DMD and BMD affect boys
almost exclusively, in rare cases they can affect girls.
[0099] Until the 1980s, little was known about the cause of any
kind of muscular dystrophy. In 1986, the dystrophin gene deficiency
was identified as the cause of DMD. BMD results from different
mutations in the same gene. BMD patients have some dystrophin, but
it's either insufficient in quantity or poor in quality. Having
some dystrophin protects the muscles of those with BMD from
degenerating as badly or as quickly as those of people with
DMD.
[0100] Recent results demonstrate that blocking or eliminating
Myostatin function in vivo can effectively treat at least certain
symptoms in DMD and BMD patients (Bogdanovich et al., supra; Wagner
et al., supra). Thus, the subject Lefty derivatives, especially the
N-terminally truncated versions thereof, constitute an alternative
means of blocking the function of myostatin in vivo in DMD and BMD
patients.
[0101] Similarly, the subject Lefty derivatives, especially the
N-terminally truncated versions thereof, provide an effective means
to increase muscle mass in other disease conditions that are in
need of muscle growth. For example, Gonzalez-Cadavid et al. (supra)
reported that that myostatin expression correlates inversely with
fat-free mass in humans and that increased expression of the
myostatin gene is associated with weight loss in men with AIDS
wasting syndrome. By inhibiting the function of myostatin in AIDS
patients, at least certain symptoms of AIDS may be alleviated, if
not completely eliminated, thus significantly improving quality of
life in AIDS patients.
[0102] Since loss of myostatin function is also associated with fat
loss without diminution of nutrient intake (Zimmers et al., supra;
McPherron and Lee, supra), the subject Lefty derivatives,
especially the N-terminally truncated versions thereof, may further
be used as a therapeutic agent for slowing or preventing the
development of obesity and type II diabetes. It should also be
noted that Lefty derivatives may affect obesity for reasons
unrelated to myostatin.
[0103] The cancer anorexia-cachexia syndrome is among the most
debilitating and life-threatening aspects of cancer. Progressive
weight loss in cancer anorexia-cachexia syndrome is a common
feature of many types of cancer and is responsible not only for a
poor quality of life and poor response to chemotherapy, but also a
shorter survival time than is found in patients with comparable
tumors without weight loss. Associated with anorexia, fat and
muscle tissue wasting, psychological distress, and a lower quality
of life, cachexia arises from a complex interaction between the
cancer and the host. It is one of the most common causes of death
among cancer patients and is present in 80% at death. It is a
complex example of metabolic chaos effecting protein, carbohydrate,
and fat metabolism. Tumors produce both direct and indirect
abnormalities, resulting in anorexia and weight loss. Currently,
there is no treatment to control or reverse the process.
[0104] Cancer anorexia-cachexia syndrome affects cytokine
production, release of lipid-mobilizing and proteolysis-inducing
factors, and alterations in intermediary metabolism. Although
anorexia is common, a decreased food intake alone is unable to
account for the changes in body composition seen in cancer
patients, and increasing nutrient intake is unable to reverse the
wasting syndrome. Cachexia should be suspected in patients with
cancer if an involuntary weight loss of greater than five percent
of premorbid weight occurs within a six-month period.
[0105] Since systemic overexpression of myostatin in adult mice was
found to induce profound muscle and fat loss analogous to that seen
in human cachexia syndromes (Zimmers et al., supra), the subject
Lefty derivatives, especially the N-terminally truncated versions
thereof as a pharmaceutical composition can be beneficially used as
a Myostatin antagonist/blocker to prevent, treat, or alleviate the
symptoms of the cachexia syndrome, where muscle growth is
desired.
[0106] In certain embodiments, the subject Lefty polypeptides can
be used to form pharmaceutical compositions that can be
beneficially used to prevent, treat, or alleviate symptoms of a
host of diseases involving neurodegeneration. The subject Lefty
polypeptide as a pharmaceutical composition can be beneficially
used to prevent, treat, or alleviate symptoms of diseases with
neurodegeneration, including Alzheimer's Disease (AD), Parkinson's
Disease (PD), Amyotrophic Lateral Sclerosis (ALS), Huntington's
disease, etc.
[0107] Alzheimer's disease (AD) is a chronic, incurable, and
unstoppable central nervous system (CNS) disorder that occurs
gradually, resulting in memory loss, unusual behavior, personality
changes, and a decline in thinking abilities. These losses are
related to the death of specific types of brain cells and the
breakdown of connections between them.
[0108] AD has been described as childhood development in reverse.
In most people with AD, symptoms appear after the age 60. The
earliest symptoms include loss of recent memory, faulty judgment,
and changes in personality. Later in the disease, those with AD may
forget how to do simple tasks like washing their hands. Eventually
people with AD lose all reasoning abilities and become dependent on
other people for their everyday care. Finally, the disease becomes
so debilitating that patients are bedridden and typically develop
coexisting illnesses. AD patients most commonly die from pneumonia,
8 to 20 years from disease onset.
[0109] Parkinson's disease (PD) is a chronic, incurable, and
unstoppable CNS disorder that occurs gradually and results in
uncontrolled body movements, rigidity, tremor, and gait
difficulties. These motor system problems are related to the death
of brain cells in an area of the brain that produces dopamine--a
chemical that helps control muscle activity.
[0110] In most people with PD, symptoms appear after age 50. The
initial symptoms of PD are a pronounced tremor affecting the
extremities, notably in the hands or lips. Subsequent
characteristic symptoms of PD are stiffness or slowness of
movement, a shuffling walk, stooped posture, and impaired balance.
There are wide ranging secondary symptoms such as memory loss,
dementia, depression, emotional changes, swallowing difficulties,
abnormal speech, sexual dysfunction, and bladder and bowel
problems. These symptoms will begin to interfere with routine
activities, such as holding a fork or reading a newspaper. Finally,
people with PD become so profoundly disabled that they are
bedridden. People with PD usually die from pneumonia.
[0111] Amyotrophic lateral sclerosis (ALS; Lou Gehrig's disease;
motor neuron disease) is a chronic, incurable, and unstoppable CNS
disorder that attacks the motor neurons, components of the CNS that
connect the brain to the skeletal muscles. In ALS, the motor
neurons deteriorate and eventually die, and though a person's brain
normally remains fully functioning and alert, the command to move
never reaches the muscles.
[0112] Most people who have ALS are between 40 and 70 years old.
The first motor neurons that weaken are those leading to the arms
or legs. Those with ALS may have trouble walking, they may drop
things, fall, slur their speech, and laugh or cry uncontrollably.
Eventually the zo muscles in the limbs begin to atrophy from
disuse. This muscle weakness will become debilitating and a person
will need a wheel chair or become unable to function out of bed.
Most ALS patients die from respiratory failure or from
complications of ventilator assistance like pneumonia, 3-5 years
from disease onset. Because ALS symptomology relates to a loss of
muscle function, treatments that enhance muscle fiber growth or
retention, such as anti-myostatin treatments, may be effective.
[0113] The causes of these neurological diseases has remained
largely unknown. They are conventionally defined as distinct
diseases, yet clearly show extraordinary similarities in basic
processes and commonly demonstrate overlapping symptoms far greater
than would be expected by chance alone. Current disease definitions
fail to properly deal with the issue of overlap and a new
classification of the neurodegenerative disorders has been called
for.
[0114] Huntington's disease (HD) is another neurodegenerative
disease resulting from genetically programmed degeneration of
neurons in certain areas of the brain. This degeneration causes
uncontrolled movements, loss of intellectual faculties, and
emotional disturbance. HD is a familial disease, passed from parent
to child through a dominant mutation in the wild-type gene. Some
early symptoms of HD are mood swings, depression, irritability or
trouble driving, learning new things, remembering a fact, or making
a decision. As the disease progresses, concentration on
intellectual tasks becomes increasingly difficult and the patient
may have difficulty feeding himself or herself and swallowing. The
rate of disease progression and the age of onset vary from person
to person.
[0115] Tay-Sachs disease and Sandhoff disease are glycolipid
storage diseases caused by the lack of lysosomal
.beta.-hexosaminidase (Gravel et al., in The Metabolic Basis of
Inherited Disease, eds. Scriver et al., McGraw-Hill, New York, pp.
2839-2879, 1995). In both disorders, G.sub.M2 ganglioside and
related glycolipidssubstrates for .beta.-hexosaminidaseaccumulate
in the nervous system and trigger acute neurodegeneration. In the
most severe forms, the onset of symptoms begins in early infancy. A
precipitous neurodegenerative course then ensues, with affected
infants exhibiting motor dysfunction, seizure, visual loss, and
deafness. Death usually occurs by 2-5 years of age. Neuronal loss
through an apoptotic mechanism has been demonstrated (Huang et al.,
Hum. Mol. Genet. 6: 1879-1885, 1997).
[0116] It is well-known that apoptosis plays a role in AIDS
pathogenesis in the immune system. However, HIV-1 also induces
neurological disease. Shi et al. (J. Clin. Invest. 98: 1979-1990,
1996) examined apoptosis induced by HIV-1 infection of the central
nervous system (CNS) in an in vitro model and in brain tissue from
AIDS patients, and found that HIV-1 infection of primary brain
cultures induced apoptosis in neurons and astrocytes in vitro.
Apoptosis of neurons and astrocytes was also detected in brain
tissue from 10/11 AIDS patients, including 5/5 patients with HIV-1
dementia and 4/5 nondemented patients.
[0117] Neuronal loss is a also a salient feature of prion diseases,
such as Creutzfeldt-Jakob disease in human, BSE in cattle (mad cow
disease), Scrapie Disease in sheep and goats, and feline spongiform
encephalopathy (FSE) in cats.
[0118] The subject Lefty polypeptides are also useful to prevent,
treat, and alleviate symptoms of various PNS disorders, such as the
ones described below. The PNS is composed of the nerves that lead
to or branch off from the CNS. The peripheral nerves handle a
diverse array of functions in the body, including sensory, motor,
and autonomic functions. When an individual has a peripheral
neuropathy, nerves of the PNS have been damaged. Nerve damage can
arise from a number of causes, such as disease, physical injury,
poisoning, or malnutrition. These agents may affect either afferent
or efferent nerves. Depending on the cause of damage, the nerve
cell axon, its protective myelin sheath, or both may be injured or
destroyed.
[0119] The term peripheral neuropathy encompasses a wide range of
disorders in which the nerves outside of the brain and spinal
cord--peripheral nerves--have been damaged. Peripheral neuropathy
may also be referred to as peripheral neuritis, or if many nerves
are involved, the terms polyneuropathy or polyneuritis may be
used.
[0120] Peripheral neuropathy is a widespread disorder, and there
are many underlying causes. Some of these causes are common, such
as diabetes, and others are extremely rare, such as acrylamide
poisoning and certain inherited disorders. The most common
worldwide cause of peripheral neuropathy is leprosy. Leprosy is
caused by the bacterium Mycobacterium leprae, which attacks the
peripheral nerves of affected people. According to statistics
gathered by the World Health Organization, an estimated 1.15
million people have leprosy worldwide.
[0121] Leprosy is extremely rare in the United States, where
diabetes is the most commonly known cause of peripheral neuropathy.
It has been estimated that more than 17 million people in the
United States and Europe have diabetes-related polyneuropathy. Many
neuropathies are idiopathic--no known cause can be found. The most
common of the inherited peripheral neuropathies in the United
States is Charcot-Marie-Tooth disease, which affects approximately
125,000 persons.
[0122] Another of the better known peripheral neuropathies is
Guillain-Barr syndrome, which arises from complications associated
with viral illnesses, such as cytomegalovirus, Epstein-Barr virus,
and human immunodeficiency virus (HIV), or bacterial infection,
including Campylobacter jejuni and Lyme disease. The worldwide
incidence rate is approximately 1.7 cases per 100,000 people
annually. Other well-known causes of peripheral neuropathies
include chronic alcoholism, infection of the varicella-zoster
virus, botulism, and poliomyelitis. Peripheral neuropathy may
develop as a primary symptom, or it may be due to another disease.
For example, peripheral neuropathy is only one symptom of diseases
such as amyloid neuropathy, certain cancers, or inherited
neurologic disorders. Such diseases may affect the peripheral
nervous system (PNS) and the central nervous system (CNS), as well
as other body tissues.
[0123] Other PNS diseases treatable with the subject Lefty
derivatives, especially the N-terminally truncated Lefty
derivatives include: Brachial Plexus Neuropathies (Diseases of the
cervical and first thoracic roots, nerve trunks, cords, and
peripheral nerve components of the brachial plexus. Clinical
manifestations include regional pain, paresthesia; muscle weakness,
and decreased sensation in the upper extremity. These disorders may
be associated with trauma, including birth injuries; thoracic
outlet syndrome; neoplasms, neuritis, radiotherapy; and other
conditions. See Adams et al., Principles of Neurology, 6.sup.th ed,
pp 1351-2); Diabetic Neuropathies (Peripheral, autonomic, and
cranial nerve disorders that are associated with disbetes mellitus.
These conditions usually result from diabetic microvascular injury
involving small blood vessels that supply nerves (vasa nervorum).
Relatively common conditions which may be associated with diabetic
neuropathy include third nerve palsy; mononeuropathy;
mononeuropathy multiplex; diabetic amyotrophy; a painful
polyneuropathy; autonomic neuropathy; and thoracoabdominal
neuropathy. See Adams et al., Principles of Neurology, 6.sup.th ed,
p1325); Mononeuropathies (Disease or trauma involving a single
peripheral nerve in isolation, or out of proportion to evidence of
diffuse peripheral nerve dysfunction. Mononeuropathy multiplex
refers to a condition characterized by multiple isolated nerve
injuries. Mononeuropathies may result from a wide variety of
causes, including ischemia; traumatic injury; compression;
connective tissue diseases; cumulative trauma disorders; and other
conditions); Neuralgia (Intense or aching pain that occurs along
the course or distribution of a peripheral or cranial nerve);
Peripheral Nervous System Neoplasms (Neoplasms which arise from
peripheral nerve tissue. This includes neurofibromas; Schwannomas;
granular cell tumors; and malignant peripheral nerve sheath tumors.
See DeVita Jr et al., Cancer: Principles and Practice of Oncology,
5.sup.th ed, pp 1750-1); Nerve Compression Syndromes (Mechanical
compression of nerves or nerve roots from internal or external
causes. These may result in a conduction block to nerve impulses,
due to, for example, myelin sheath dysfunction, or axonal loss. The
nerve and nerve sheath injuries may be caused by ischemia;
inflammation; or a direct mechanical effect); Neuritis (A general
term indicating inflammation of a peripheral or cranial nerve.
Clinical manifestation may include pain; paresthesias; paresis; or
hyperthesia); Polyneuropathies (Diseases of multiple peripheral
nerves. The various forms are categorized by the type of nerve
affected (e.g., sensory, motor, or autonomic), by the distribution
of nerve injury (e.g., distal vs. proximal), by nerve component
primarily affected (e.g., demyelinating vs. axonal), by etiology,
or by pattern of inheritance).
[0124] Myostatin inhibitors may also promote bone growth and a
combination of bone and muscle strengthening, making the Lefty
polypeptides disclosed herein useful for treating disorders such as
osteoporosis, frailty, low bone density and tumor induced bone
loss.
[0125] While the above description provides likely mechanisms of
action by which Lefty polypeptides, including Lefty derivatives,
may achieve desirable therapeutic effects, such effects may also
result from alternative mechanisms or several different mechanisms.
It is quite likely that Lefty polypeptides will inhibit additional
members of the TGF-beta family, and accordingly, such activity may
contribute to a therapeutic effect.
5. Exemplary Formulations
[0126] The subject compositions may be used alone, or as part of a
conjoint therapy with other compounds/pharmaceutical compositions.
In certain embodiments, a pharmaceutical preparation comprising a
Lefty polypeptide will be in compliance with guidelines established
by the relevant regulatory agency (e.g., the Food and Drug
Administration in the U.S.). Such a preparation will typically be
substantially pyrogen-free.
[0127] The Lefty polypeptides for use in the subject methods may be
conveniently formulated for administration with a biologically
acceptable medium, such as water, buffered saline, polyol (for
example, glycerol, propylene glycol, liquid polyethylene glycol and
the like) or suitable mixtures thereof. The optimum concentration
of the active ingredient(s) in the chosen medium can be determined
empirically, according to procedures well known to medicinal
chemists. As used herein, "biologically acceptable medium" includes
any and all solvents, dispersion media, and the like which may be
appropriate for the desired route of administration of the
pharmaceutical preparation. The use of such media for
pharmaceutically active substances is known in the art. Except
insofar as any conventional media or agent is incompatible with the
activity of the phosphopeptide therapeutics, its use in the
pharmaceutical preparation of the disclosure is contemplated.
Suitable vehicles and their formulation inclusive of other proteins
are described, for example, in the book Remington's Pharmaceutical
Sciences (Remington's Pharmaceutical Sciences. Mack Publishing Co.,
Easton, Pa., USA 1985). These vehicles include injectable "deposit
formulations."
[0128] Pharmaceutical formulations of the present disclosure can
also include veterinary compositions, e.g., pharmaceutical
preparations of the Lefty therapeutics suitable for veterinary
uses, e.g., for the treatment of live stock (cow, sheep, goat, pig,
and horse, etc.) or domestic animals, e.g., cats and dogs.
[0129] Methods of disclosure may also be provided by rechargeable
or biodegradable devices. Various slow release polymeric devices
have been developed and tested in vivo in recent years for the
controlled delivery of drugs, including proteinacious
biopharmaceuticals. A variety of biocompatible polymers (including
hydrogels), including both biodegradable and non-degradable
polymers, can be used to form an implant for the sustained release
of a therapeutic at a particular target site.
[0130] The pharmaceutical compositions according to the present
disclosure may be administered as either a single dose or in
multiple doses. The pharmaceutical compositions of the present
disclosure may be administered either as individual therapeutic
agents or in combination with other therapeutic agents. The
treatments of the present disclosure may be combined with
conventional therapies, which may be administered sequentially or
simultaneously. The pharmaceutical compositions of the present
disclosure may be administered by any means that enables the Lefty
polypeptides to reach the targeted cells/tissues/organs. In some
embodiments, routes of administration include those selected from
the group consisting of oral, intravesically, intravenous,
intraarterial, intraperitoneal, local administration into the blood
supply of the organ in which the targeted cells reside or directly
into the cells. Intravenous administration is the preferred mode of
administration. It may be accomplished with the aid of an infusion
pump.
[0131] The phrases "parenteral administration" and "administered
parenterally" as used herein means modes of administration other
than enteral and topical administration, usually by injection, and
includes, without limitation, intravenous, intramuscular,
intraarterial, intrathecal, intracapsular, intraorbital,
intracardiac, intradermal, intraperitoneal, transtracheal,
subcutaneous, subcuticular, intraarticulare, subcapsular,
subarachnoid, intraspinal and intrastermal injection and
infusion.
[0132] The phrases "systemic administration," "administered
systemically," "peripheral administration" and "administered
peripherally" as used herein mean the administration of a compound,
drug or other material other than directly into the central nervous
system, such that it enters the patient's system and, thus, is
subject to metabolism and other like processes, for example,
subcutaneous administration.
[0133] These compounds may be administered to humans and other
animals for therapy by any suitable route of administration,
including orally, intravesically, nasally, as by, for example, a
spray, rectally, intravaginally, parenterally, intracisternally and
topically, as by powders, ointments or drops, including buccally
and sublingually.
[0134] Regardless of the route of administration selected, the
compounds of the present disclosure, which may be used in a
suitable hydrated form, and/or the pharmaceutical compositions of
the present disclosure, are formulated into pharmaceutically
acceptable dosage forms such as described below or by other
conventional methods known to those of skill in the art.
[0135] Actual dosage levels of the active ingredients in the
pharmaceutical compositions of this disclosure may be varied so as
to obtain an amount of the active ingredient which is effective to
achieve the desired therapeutic response for a particular patient,
composition, and mode of administration, without being toxic to the
patient.
[0136] The selected dosage level will depend upon a variety of
factors including the activity of the particular compound of the
present disclosure employed, or the ester, salt or amide thereof,
the route of administration, the time of administration, the rate
of excretion of the particular compound being employed, the
duration of the treatment, other drugs, compounds and/or materials
used in combination with the particular phosphopeptide therapeutic
employed, the age, sex, weight, condition, general health and prior
medical history of the patient being treated, and like factors well
known in the medical arts.
[0137] A physician or veterinarian having ordinary skill in the art
can readily determine and prescribe the effective amount of the
pharmaceutical composition required. For example, the physician or
veterinarian could start doses of the compounds of the disclosure
employed in the pharmaceutical composition at levels lower than
that required in order to achieve the desired therapeutic effect
and gradually increase the dosage until the desired effect is
achieved.
[0138] In general, a suitable daily dose of a compound of the
disclosure will be that amount of the compound which is the lowest
dose effective to produce a therapeutic effect. Such an effective
dose will generally depend upon the factors described above.
Generally, intravenous, intracerebrovenitricular and subcutaneous
doses of the compounds of this disclosure for a patient will range
from about 0.0001 to about 100 mg per kilogram of body weight per
day.
[0139] If desired, the effective daily dose of the active compound
may be administered as two, three, four, five, six or more
sub-doses administered separately at appropriate intervals
throughout the day, optionally, in unit dosage forms.
[0140] The term "treatment" is intended to encompass also
prophylaxis, therapy and cure.
[0141] The patient receiving this treatment is any animal in need,
including primates, in particular humans, and other non-human
mammals such as equines, cattle, swine and sheep; and poultry and
pets in general.
[0142] The compound of the disclosure can be administered as such
or in admixtures with pharmaceutically acceptable carriers and can
also be administered in conjunction with other antimicrobial agents
such as penicillins, cephalosporins, aminoglycosides and
glycopeptides. Conjunctive therapy, thus includes sequential,
simultaneous and separate administration of the active compound in
a way that the therapeutical effects of the first administered one
is not entirely eliminated when the subsequent is administered.
[0143] Generally, the nomenclature used herein and the laboratory
procedures utilized in the present disclosure include molecular,
biochemical, microbiological and recombinant DNA techniques. Such
techniques are thoroughly explained in the literature. See, for
example, "Molecular Cloning: A laboratory Manual" Sambrook et al.,
(1989); "Current Protocols in Molecular Biology" Volumes I-III
Ausubel, R. M., ed. (1994); Ausubel et al., "Current Protocols in
Molecular Biology", John Wiley and Sons, Baltimore, Md. (1989);
Perbal, "A Practical Guide to Molecular Cloning", John Wiley &
Sons, New York (1988); Watson et al., "Recombinant DNA", Scientific
American Books, New York; Birren et al. (eds) "Genome Analysis: A
Laboratory Manual Series", Vols. 1-4, Cold Spring Harbor Laboratory
Press, New York (1998); methodologies as set forth in U.S. Pat.
Nos. 4,666,828; 4,683,202; 4,801,531; 5,192,659 and 5,272,057;
"Cell Biology: A Laboratory Handbook", Volumes Cellis, J. E., ed.
(1994); "Current Protocols in Immunology" Volumes I-III Coligan J.
E., ed. (1994); Stites et al. (eds), "Basic and Clinical
Immunology" (8.sup.th Edition), Appleton & Lange, Norwalk,
Conn. (1994); Mishell and Shiigi (eds), "Selected Methods in
Cellular Immunology", W. H. Freeman and Co., New York (1980);
available immunoassays are extensively described in the patent and
scientific literature, see, for example, U.S. Pat. Nos. 3,791,932;
3,839,153; 3,850,752; 3,850,578; 3,853,987; 3,867,517; 3,879,262;
3,901,654; 3,935,074; 3,984,533; 3,996,345; 4,034,074; 4,098,876;
4,879,219; 5,011,771 and 5,281,521; "Oligonucleotide Synthesis"
Gait, M. J., ed. (1984); "Nucleic Acid Hybridization" Hames, B. D.,
and Higgins S. J., eds. (1985); "Transcription and Translation"
Hames, B. D., and Higgins S. J., eds. (1984); "Animal Cell Culture"
Freshney, R. I., ed. (1986); "Immobilized Cells and Enzymes" IRL
Press, (1986); "A Practical Guide to Molecular Cloning" Perbal, B.,
(1984) and "Methods in Enzymology" Vol. 1-317, Academic Press; "PCR
Protocols: A Guide To Methods And Applications", Academic Press,
San Diego, Calif. (1990); Marshak et al., "Strategies for Protein
Purification and Characterization--Laboratory Course Manual" CSHL
Press (1996); all of which are incorporated by reference as if
fully set forth herein. Other general references are provided
throughout this document. The procedures therein are believed to be
well known in the art and are provided for the convenience of the
reader. All the information contained therein is incorporated
herein by reference.
EXEMPLIFICATION
[0144] The invention now being generally described, it will be more
readily understood by reference to the following examples, which
are included merely for purposes of illustration of certain
embodiments and embodiments of the present invention, and are not
intended to limit the invention.
Example 1
Construction, Expression, and Purification of Lefty
Polypeptides
[0145] The various Lefty-A constructs described in FIG. 6 were
subcloned into pAID4 vector and plasmid cDNAs were transfected (10
ug DNA) transiently into Cos cells by lipofectamine method. After
six hours, growth media was added. Twenty four hours later, media
was changed to serum free media and harvested after 48 hours. After
centrifugation, supernatant was collected and kept at -20C.
[0146] The constructs produced and tested replace the endogenous
Lefty-A signal sequence with a honey melatin sequence. The
following Lefty-A sequence was fused to the melatin for expression
of the 34 kDa (long) form:
TABLE-US-00007 LTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLLRRSHGD
RSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLF
QEPVPKAALHGHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVH
ESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRF
ASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYID
LQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASET
ASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
[0147] The bold "F" indicates the expected first amino acid of the
mature 34 kDa form. The underlined "G" shows the site of an R->G
alteration to eliminate the second RXXR cleavage site.
[0148] The following sequence was fused to the melatin leader for
expression of the 28 kDa (short) form of Lefty-A:
TABLE-US-00008 LSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVN
FWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQL
ELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEP
PGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGR
TRPQVVSLPNMRVQKCSCASDGALVPRRLQP
[0149] The various Fc fusions described in FIG. 6 were generated
based on the above "Lefty 34" and "Lefty 28" constructs.
Example 2
Lefty-A Polypeptides Bind to Myostatin
[0150] BiaCore chip analysis was carried out with each of the Lefty
constructs. GDF-11 is a close homolog of myostatin that regulates
neurological processes. GDF-11 was immobilized on a BiaCore CM5
chip using standard amine coupling procedure. As shown in FIG. 7,
each of the Lefty constructs binds to myostatin.
[0151] All publications and patents mentioned herein are hereby
incorporated by reference in their entirety as if each individual
publication or patent was specifically and individually indicated
to be incorporated by reference.
[0152] While specific embodiments of the subject matter have been
discussed, the above specification is illustrative and not
restrictive. Many variations will become apparent to those skilled
in the art upon review of this specification and the claims below.
The full scope of the invention should be determined by reference
to the claims, along with their full scope of equivalents, and the
specification, along with such variations.
Sequence CWU 1
1
281366PRTHomo sapiens 1Met Trp Pro Leu Trp Leu Cys Trp Ala Leu Trp
Val Leu Pro Leu Ala 1 5 10 15Gly Pro Gly Ala Ala Leu Thr Glu Glu
Gln Leu Leu Gly Ser Leu Leu 20 25 30Arg Gln Leu Gln Leu Ser Glu Val
Pro Val Leu Asp Arg Ala Asp Met 35 40 45Glu Lys Leu Val Ile Pro Ala
His Val Arg Ala Gln Tyr Val Val Leu 50 55 60Leu Arg Arg Ser His Gly
Asp Arg Ser Arg Gly Lys Arg Phe Ser Gln65 70 75 80Ser Phe Arg Glu
Val Ala Gly Arg Phe Leu Ala Ser Glu Ala Ser Thr 85 90 95His Leu Leu
Val Phe Gly Met Glu Gln Arg Leu Pro Pro Asn Ser Glu 100 105 110Leu
Val Gln Ala Val Leu Arg Leu Phe Gln Glu Pro Val Pro Lys Ala 115 120
125Ala Leu His Arg His Gly Arg Leu Ser Pro Arg Ser Ala Gln Ala Arg
130 135 140Val Thr Val Glu Trp Leu Arg Val Arg Asp Asp Gly Ser Asn
Arg Thr145 150 155 160Ser Leu Ile Asp Ser Arg Leu Val Ser Val His
Glu Ser Gly Trp Lys 165 170 175Ala Phe Asp Val Thr Glu Ala Val Asn
Phe Trp Gln Gln Leu Ser Arg 180 185 190Pro Arg Gln Pro Leu Leu Leu
Gln Val Ser Val Gln Arg Glu His Leu 195 200 205Gly Pro Leu Ala Ser
Gly Ala His Lys Leu Val Arg Phe Ala Ser Gln 210 215 220Gly Ala Pro
Ala Gly Leu Gly Glu Pro Gln Leu Glu Leu His Thr Leu225 230 235
240Asp Leu Arg Asp Tyr Gly Ala Gln Gly Asp Cys Asp Pro Glu Ala Pro
245 250 255Met Thr Glu Gly Thr Arg Cys Cys Arg Gln Glu Met Tyr Ile
Asp Leu 260 265 270Gln Gly Met Lys Trp Ala Lys Asn Trp Val Leu Glu
Pro Pro Gly Phe 275 280 285Leu Ala Tyr Glu Cys Val Gly Thr Cys Gln
Gln Pro Pro Glu Ala Leu 290 295 300Ala Phe Asn Trp Pro Phe Leu Gly
Pro Arg Gln Cys Ile Ala Ser Glu305 310 315 320Thr Ala Ser Leu Pro
Met Ile Val Ser Ile Lys Glu Gly Gly Arg Thr 325 330 335Arg Pro Gln
Val Val Ser Leu Pro Asn Met Arg Val Gln Lys Cys Ser 340 345 350Cys
Ala Ser Asp Gly Ala Leu Val Pro Arg Arg Leu Gln Pro 355 360
3652366PRTHomo sapiens 2Met Gln Pro Leu Trp Leu Cys Trp Ala Leu Trp
Val Leu Pro Leu Ala 1 5 10 15Ser Pro Gly Ala Ala Leu Thr Gly Glu
Gln Leu Leu Gly Ser Leu Leu 20 25 30Arg Gln Leu Gln Leu Lys Glu Val
Pro Thr Leu Asp Arg Ala Asp Met 35 40 45Glu Glu Leu Val Ile Pro Thr
His Val Arg Ala Gln Tyr Val Ala Leu 50 55 60Leu Gln Arg Ser His Gly
Asp Arg Ser Arg Gly Lys Arg Phe Ser Gln65 70 75 80Ser Phe Arg Glu
Val Ala Gly Arg Phe Leu Ala Leu Glu Ala Ser Thr 85 90 95His Leu Leu
Val Phe Gly Met Glu Gln Arg Leu Pro Pro Asn Ser Glu 100 105 110Leu
Val Gln Ala Val Leu Arg Leu Phe Gln Glu Pro Val Pro Lys Ala 115 120
125Ala Leu His Arg His Gly Arg Leu Ser Pro Arg Ser Ala Arg Ala Arg
130 135 140Val Thr Val Glu Trp Leu Arg Val Arg Asp Asp Gly Ser Asn
Arg Thr145 150 155 160Ser Leu Ile Asp Ser Arg Leu Val Ser Val His
Glu Ser Gly Trp Lys 165 170 175Ala Phe Asp Val Thr Glu Ala Val Asn
Phe Trp Gln Gln Leu Ser Arg 180 185 190Pro Arg Gln Pro Leu Leu Leu
Gln Val Ser Val Gln Arg Glu His Leu 195 200 205Gly Pro Leu Ala Ser
Gly Ala His Lys Leu Val Arg Phe Ala Ser Gln 210 215 220Gly Ala Pro
Ala Gly Leu Gly Glu Pro Gln Leu Glu Leu His Thr Leu225 230 235
240Asp Leu Gly Asp Tyr Gly Ala Gln Gly Asp Cys Asp Pro Glu Ala Pro
245 250 255Met Thr Glu Gly Thr Arg Cys Cys Arg Gln Glu Met Tyr Ile
Asp Leu 260 265 270Gln Gly Met Lys Trp Ala Glu Asn Trp Val Leu Glu
Pro Pro Gly Phe 275 280 285Leu Ala Tyr Glu Cys Val Gly Thr Cys Arg
Gln Pro Pro Glu Ala Leu 290 295 300Ala Phe Lys Trp Pro Phe Leu Gly
Pro Arg Gln Cys Ile Ala Ser Glu305 310 315 320Thr Asp Ser Leu Pro
Met Ile Val Ser Ile Lys Glu Gly Gly Arg Thr 325 330 335Arg Pro Gln
Val Val Ser Leu Pro Asn Met Arg Val Gln Lys Cys Ser 340 345 350Cys
Ala Ser Asp Gly Ala Leu Val Pro Arg Arg Leu Gln Pro 355 360
3653368PRTMus musculus 3Met Pro Phe Leu Trp Leu Cys Trp Ala Leu Trp
Ala Leu Ser Leu Val 1 5 10 15Ser Leu Arg Glu Ala Leu Thr Gly Glu
Gln Ile Leu Gly Ser Leu Leu 20 25 30Gln Gln Leu Gln Leu Asp Gln Pro
Pro Val Leu Asp Lys Ala Asp Val 35 40 45Glu Gly Met Val Ile Pro Ser
His Val Arg Thr Gln Tyr Val Ala Leu 50 55 60Leu Gln His Ser His Ala
Ser Arg Ser Arg Gly Lys Arg Phe Ser Gln65 70 75 80Asn Leu Arg Glu
Val Ala Gly Arg Phe Leu Val Ser Glu Thr Ser Thr 85 90 95His Leu Leu
Val Phe Gly Met Glu Gln Arg Leu Pro Pro Asn Ser Glu 100 105 110Leu
Val Gln Ala Val Leu Arg Leu Phe Gln Glu Pro Val Pro Arg Thr 115 120
125Ala Leu Arg Arg Gln Lys Arg Leu Ser Pro His Ser Ala Arg Ala Arg
130 135 140Val Thr Ile Glu Trp Leu Arg Phe Arg Asp Asp Gly Ser Asn
Arg Thr145 150 155 160Ala Leu Ile Asp Ser Arg Leu Val Ser Ile His
Glu Ser Gly Trp Lys 165 170 175Ala Phe Asp Val Thr Glu Ala Val Asn
Phe Trp Gln Gln Leu Ser Arg 180 185 190Pro Arg Gln Pro Leu Leu Leu
Gln Val Ser Val Gln Arg Glu His Leu 195 200 205Gly Pro Gly Thr Trp
Ser Ser His Lys Leu Val Arg Phe Ala Ala Gln 210 215 220Gly Thr Pro
Asp Gly Lys Gly Gln Gly Glu Pro Gln Leu Glu Leu His225 230 235
240Thr Leu Asp Leu Lys Asp Tyr Gly Ala Gln Gly Asn Cys Asp Pro Glu
245 250 255Ala Pro Val Thr Glu Gly Thr Arg Cys Cys Arg Gln Glu Met
Tyr Leu 260 265 270Asp Leu Gln Gly Met Lys Trp Ala Glu Asn Trp Ile
Leu Glu Pro Pro 275 280 285Gly Phe Leu Thr Tyr Glu Cys Val Gly Ser
Cys Leu Gln Leu Pro Glu 290 295 300Ser Leu Thr Ser Arg Trp Pro Phe
Leu Gly Pro Arg Gln Cys Val Ala305 310 315 320Ser Glu Met Thr Ser
Leu Pro Met Ile Val Ser Val Lys Glu Gly Gly 325 330 335Arg Thr Arg
Pro Gln Val Val Ser Leu Pro Asn Met Arg Val Gln Thr 340 345 350Cys
Ser Cys Ala Ser Asp Gly Ala Leu Ile Pro Arg Arg Leu Gln Pro 355 360
3654368PRTMus musculus 4Met Lys Ser Leu Trp Leu Cys Trp Ala Leu Trp
Val Leu Pro Leu Ala 1 5 10 15Gly Pro Gly Ala Ala Met Thr Glu Glu
Gln Val Leu Ser Ser Leu Leu 20 25 30Gln Gln Leu Gln Leu Ser Gln Ala
Pro Thr Leu Asp Ser Ala Asp Val 35 40 45Glu Glu Met Ala Ile Pro Thr
His Val Arg Ser Gln Tyr Val Ala Leu 50 55 60Leu Gln Gly Ser His Ala
Asp Arg Ser Arg Gly Lys Arg Phe Ser Gln65 70 75 80Asn Phe Arg Glu
Val Ala Gly Arg Phe Leu Met Ser Glu Thr Ser Thr 85 90 95His Leu Leu
Val Phe Gly Met Glu Gln Arg Leu Pro Pro Asn Ser Glu 100 105 110Leu
Val Gln Ala Val Leu Arg Leu Phe Gln Glu Pro Val Pro Arg Thr 115 120
125Ala Leu Arg Arg Phe Glu Arg Leu Ser Pro His Ser Ala Arg Ala Arg
130 135 140Val Thr Ile Glu Trp Leu Arg Val Arg Glu Asp Gly Ser Asn
Arg Thr145 150 155 160Ala Leu Ile Asp Ser Arg Leu Val Ser Ile His
Glu Ser Gly Trp Lys 165 170 175Ala Phe Asp Val Thr Glu Ala Val Asn
Phe Trp Gln Gln Leu Ser Arg 180 185 190Pro Arg Gln Pro Leu Leu Leu
Gln Val Ser Val Gln Arg Glu His Leu 195 200 205Gly Pro Gly Thr Trp
Ser Ala His Lys Leu Val Arg Phe Ala Ala Gln 210 215 220Gly Thr Pro
Asp Gly Lys Gly Gln Gly Glu Pro Gln Leu Glu Leu His225 230 235
240Thr Leu Asp Leu Lys Asp Tyr Gly Ala Gln Gly Asn Cys Asp Pro Glu
245 250 255Val Pro Val Thr Glu Gly Thr Arg Cys Cys Arg Gln Glu Met
Tyr Leu 260 265 270Asp Leu Gln Gly Met Lys Trp Ala Glu Asn Trp Ile
Leu Glu Pro Pro 275 280 285Gly Phe Leu Thr Tyr Glu Cys Val Gly Ser
Cys Leu Gln Leu Pro Glu 290 295 300Ser Leu Thr Ile Gly Trp Pro Phe
Leu Gly Pro Arg Gln Cys Val Ala305 310 315 320Ser Glu Met Thr Ser
Leu Pro Met Ile Val Ser Val Lys Glu Gly Gly 325 330 335Arg Thr Arg
Pro Gln Val Val Ser Leu Pro Asn Met Arg Val Gln Thr 340 345 350Cys
Ser Cys Ala Ser Asp Gly Ala Leu Ile Pro Arg Gly Ile Asp Leu 355 360
365533PRTHomo sapiens 5Cys Arg Gln Glu Met Tyr Ile Asp Leu Gln Gly
Met Lys Trp Ala Lys 1 5 10 15Asn Trp Val Leu Glu Pro Pro Gly Phe
Leu Ala Tyr Glu Cys Val Gly 20 25 30Thr636PRTHomo sapiens 6Cys Ile
Ala Ser Glu Thr Ala Ser Leu Pro Met Ile Val Ser Ile Lys 1 5 10
15Glu Gly Gly Arg Thr Arg Pro Gln Val Val Ser Leu Pro Asn Met Arg
20 25 30Val Gln Lys Cys 35733PRTHomo sapiens 7Cys Arg Gln Glu Met
Tyr Ile Asp Leu Gln Gly Met Lys Trp Ala Glu 1 5 10 15Asn Trp Val
Leu Glu Pro Pro Gly Phe Leu Ala Tyr Glu Cys Val Gly 20 25
30Thr836PRTHomo sapiens 8Cys Ile Ala Ser Glu Thr Asp Ser Leu Pro
Met Ile Val Ser Ile Lys 1 5 10 15Glu Gly Gly Arg Thr Arg Pro Gln
Val Val Ser Leu Pro Asn Met Arg 20 25 30Val Gln Lys Cys
359289PRTHomo sapiens 9Phe Ser Gln Ser Phe Arg Glu Val Ala Gly Arg
Phe Leu Ala Ser Glu 1 5 10 15Ala Ser Thr His Leu Leu Val Phe Gly
Met Glu Gln Arg Leu Pro Pro 20 25 30Asn Ser Glu Leu Val Gln Ala Val
Leu Arg Leu Phe Gln Glu Pro Val 35 40 45Pro Lys Ala Ala Leu His Arg
His Gly Arg Leu Ser Pro Arg Ser Ala 50 55 60Gln Ala Arg Val Thr Val
Glu Trp Leu Arg Val Arg Asp Asp Gly Ser65 70 75 80Asn Arg Thr Ser
Leu Ile Asp Ser Arg Leu Val Ser Val His Glu Ser 85 90 95Gly Trp Lys
Ala Phe Asp Val Thr Glu Ala Val Asn Phe Trp Gln Gln 100 105 110Leu
Ser Arg Pro Arg Gln Pro Leu Leu Leu Gln Val Ser Val Gln Arg 115 120
125Glu His Leu Gly Pro Leu Ala Ser Gly Ala His Lys Leu Val Arg Phe
130 135 140Ala Ser Gln Gly Ala Pro Ala Gly Leu Gly Glu Pro Gln Leu
Glu Leu145 150 155 160His Thr Leu Asp Leu Arg Asp Tyr Gly Ala Gln
Gly Asp Cys Asp Pro 165 170 175Glu Ala Pro Met Thr Glu Gly Thr Arg
Cys Cys Arg Gln Glu Met Tyr 180 185 190Ile Asp Leu Gln Gly Met Lys
Trp Ala Lys Asn Trp Val Leu Glu Pro 195 200 205Pro Gly Phe Leu Ala
Tyr Glu Cys Val Gly Thr Cys Gln Gln Pro Pro 210 215 220Glu Ala Leu
Ala Phe Asn Trp Pro Phe Leu Gly Pro Arg Gln Cys Ile225 230 235
240Ala Ser Glu Thr Ala Ser Leu Pro Met Ile Val Ser Ile Lys Glu Gly
245 250 255Gly Arg Thr Arg Pro Gln Val Val Ser Leu Pro Asn Met Arg
Val Gln 260 265 270Lys Cys Ser Cys Ala Ser Asp Gly Ala Leu Val Pro
Arg Arg Leu Gln 275 280 285Pro10289PRTHomo sapiens 10Phe Ser Gln
Ser Phe Arg Glu Val Ala Gly Arg Phe Leu Ala Leu Glu 1 5 10 15Ala
Ser Thr His Leu Leu Val Phe Gly Met Glu Gln Arg Leu Pro Pro 20 25
30Asn Ser Glu Leu Val Gln Ala Val Leu Arg Leu Phe Gln Glu Pro Val
35 40 45Pro Lys Ala Ala Leu His Arg His Gly Arg Leu Ser Pro Arg Ser
Ala 50 55 60Arg Ala Arg Val Thr Val Glu Trp Leu Arg Val Arg Asp Asp
Gly Ser65 70 75 80Asn Arg Thr Ser Leu Ile Asp Ser Arg Leu Val Ser
Val His Glu Ser 85 90 95Gly Trp Lys Ala Phe Asp Val Thr Glu Ala Val
Asn Phe Trp Gln Gln 100 105 110Leu Ser Arg Pro Arg Gln Pro Leu Leu
Leu Gln Val Ser Val Gln Arg 115 120 125Glu His Leu Gly Pro Leu Ala
Ser Gly Ala His Lys Leu Val Arg Phe 130 135 140Ala Ser Gln Gly Ala
Pro Ala Gly Leu Gly Glu Pro Gln Leu Glu Leu145 150 155 160His Thr
Leu Asp Leu Gly Asp Tyr Gly Ala Gln Gly Asp Cys Asp Pro 165 170
175Glu Ala Pro Met Thr Glu Gly Thr Arg Cys Cys Arg Gln Glu Met Tyr
180 185 190Ile Asp Leu Gln Gly Met Lys Trp Ala Glu Asn Trp Val Leu
Glu Pro 195 200 205Pro Gly Phe Leu Ala Tyr Glu Cys Val Gly Thr Cys
Arg Gln Pro Pro 210 215 220Glu Ala Leu Ala Phe Lys Trp Pro Phe Leu
Gly Pro Arg Gln Cys Ile225 230 235 240Ala Ser Glu Thr Asp Ser Leu
Pro Met Ile Val Ser Ile Lys Glu Gly 245 250 255Gly Arg Thr Arg Pro
Gln Val Val Ser Leu Pro Asn Met Arg Val Gln 260 265 270Lys Cys Ser
Cys Ala Ser Asp Gly Ala Leu Val Pro Arg Arg Leu Gln 275 280
285Pro11345PRTHomo sapiens 11Leu Thr Glu Glu Gln Leu Leu Gly Ser
Leu Leu Arg Gln Leu Gln Leu 1 5 10 15Ser Glu Val Pro Val Leu Asp
Arg Ala Asp Met Glu Lys Leu Val Ile 20 25 30Pro Ala His Val Arg Ala
Gln Tyr Val Val Leu Leu Arg Arg Ser His 35 40 45Gly Asp Arg Ser Arg
Gly Lys Arg Phe Ser Gln Ser Phe Arg Glu Val 50 55 60Ala Gly Arg Phe
Leu Ala Ser Glu Ala Ser Thr His Leu Leu Val Phe65 70 75 80Gly Met
Glu Gln Arg Leu Pro Pro Asn Ser Glu Leu Val Gln Ala Val 85 90 95Leu
Arg Leu Phe Gln Glu Pro Val Pro Lys Ala Ala Leu His Gly His 100 105
110Gly Arg Leu Ser Pro Arg Ser Ala Gln Ala Arg Val Thr Val Glu Trp
115 120 125Leu Arg Val Arg Asp Asp Gly Ser Asn Arg Thr Ser Leu Ile
Asp Ser 130 135 140Arg Leu Val Ser Val His Glu Ser Gly Trp Lys Ala
Phe Asp Val Thr145 150 155 160Glu Ala Val Asn Phe Trp Gln Gln Leu
Ser Arg Pro Arg Gln Pro Leu 165 170 175Leu Leu Gln Val Ser Val Gln
Arg Glu His Leu Gly Pro Leu Ala Ser 180 185 190Gly Ala His Lys Leu
Val Arg Phe Ala Ser Gln Gly Ala Pro Ala Gly 195 200 205Leu Gly Glu
Pro Gln Leu Glu Leu His Thr Leu Asp Leu Arg Asp Tyr 210 215 220Gly
Ala Gln Gly Asp Cys Asp Pro Glu Ala Pro Met Thr Glu Gly Thr225 230
235 240Arg Cys Cys Arg Gln Glu Met Tyr Ile Asp Leu Gln Gly Met Lys
Trp 245 250 255Ala Lys Asn Trp Val Leu Glu Pro Pro Gly Phe Leu
Ala Tyr Glu Cys 260 265 270Val Gly Thr Cys Gln Gln Pro Pro Glu Ala
Leu Ala Phe Asn Trp Pro 275 280 285Phe Leu Gly Pro Arg Gln Cys Ile
Ala Ser Glu Thr Ala Ser Leu Pro 290 295 300Met Ile Val Ser Ile Lys
Glu Gly Gly Arg Thr Arg Pro Gln Val Val305 310 315 320Ser Leu Pro
Asn Met Arg Val Gln Lys Cys Ser Cys Ala Ser Asp Gly 325 330 335Ala
Leu Val Pro Arg Arg Leu Gln Pro 340 34512231PRTHomo sapiens 12Leu
Ser Pro Arg Ser Ala Gln Ala Arg Val Thr Val Glu Trp Leu Arg 1 5 10
15Val Arg Asp Asp Gly Ser Asn Arg Thr Ser Leu Ile Asp Ser Arg Leu
20 25 30Val Ser Val His Glu Ser Gly Trp Lys Ala Phe Asp Val Thr Glu
Ala 35 40 45Val Asn Phe Trp Gln Gln Leu Ser Arg Pro Arg Gln Pro Leu
Leu Leu 50 55 60Gln Val Ser Val Gln Arg Glu His Leu Gly Pro Leu Ala
Ser Gly Ala65 70 75 80His Lys Leu Val Arg Phe Ala Ser Gln Gly Ala
Pro Ala Gly Leu Gly 85 90 95Glu Pro Gln Leu Glu Leu His Thr Leu Asp
Leu Arg Asp Tyr Gly Ala 100 105 110Gln Gly Asp Cys Asp Pro Glu Ala
Pro Met Thr Glu Gly Thr Arg Cys 115 120 125Cys Arg Gln Glu Met Tyr
Ile Asp Leu Gln Gly Met Lys Trp Ala Lys 130 135 140Asn Trp Val Leu
Glu Pro Pro Gly Phe Leu Ala Tyr Glu Cys Val Gly145 150 155 160Thr
Cys Gln Gln Pro Pro Glu Ala Leu Ala Phe Asn Trp Pro Phe Leu 165 170
175Gly Pro Arg Gln Cys Ile Ala Ser Glu Thr Ala Ser Leu Pro Met Ile
180 185 190Val Ser Ile Lys Glu Gly Gly Arg Thr Arg Pro Gln Val Val
Ser Leu 195 200 205Pro Asn Met Arg Val Gln Lys Cys Ser Cys Ala Ser
Asp Gly Ala Leu 210 215 220Val Pro Arg Arg Leu Gln Pro225
230131583DNAMus musculus 13aggacacctc agggacacac acatccaagg
ctcctcttcc cggacagcac catgccattc 60ctgtggctct gctgggcact ctgggcactg
tcgctggtta gcctcaggga agccctgacc 120ggagagcaga tcctgggcag
cctgctgcaa cagctgcagc tcgatcaacc gccagtcctg 180gacaaggctg
atgtggaagg gatggtcatc ccctcgcacg tgaggactca gtatgtggcc
240ctgctacaac acagccatgc cagccgctcc cgaggcaaga ggttcagcca
gaaccttcga 300gaggtggcag gcaggttcct ggtgtcagag acctccactc
acctgctagt gttcggaatg 360gagcagcggc tgccgcctaa cagcgagctg
gtgcaggctg tgctgcggct gttccaggag 420cctgtgccca gaacagctct
ccggaggcaa aagaggctgt ccccacacag tgcccgggct 480cgggtcacca
ttgaatggct gcgcttccgc gacgacggct ccaaccgcac tgcccttatc
540gattctaggc tcgtgtccat ccacgagagc ggctggaagg ccttcgacgt
gaccgaggcc 600gtgaacttct ggcagcagct gagccggccg aggcagccgc
tgctgctcca ggtgtcggtg 660cagagggagc atctggggcc gggaacctgg
agctcacaca agttggttcg tttcgcggcg 720caggggacgc cggatggcaa
ggggcagggc gagccacagc tggagctgca cacgctggac 780ctcaaggact
atggagctca aggcaattgt gaccccgagg caccagtgac tgaaggcacc
840cgatgctgtc gccaggagat gtacctggac ctgcagggga tgaagtgggc
cgagaactgg 900atcctagaac cgccagggtt cctgacatat gaatgtgtgg
gcagctgcct gcagctaccg 960gagtccctga ccagcaggtg gccatttctg
gggcctcggc agtgtgtcgc ctcagagatg 1020acctccctgc ccatgattgt
cagcgtgaag gagggaggca ggaccaggcc tcaagtggtc 1080agcctgccca
acatgagggt gcagacctgt agctgcgcct cagatggggc gctcataccc
1140aggaggctgc agccataggc gcggggtgtg gcttccccaa ggatgtgcct
ttcatgcaaa 1200tctgaagtgc tcattatact gggagagctg gggattctaa
ctccctaatg ggcaatccct 1260gtgtgtgctc tttgcttcct ctgaagtagc
ctcatcccta aatttttacc ttcgaggaat 1320gtgactcgct ggcccctgga
ggcgctctga cccagtggtc tctgtccttc atattgttca 1380ctgcactgta
tgcgaagcac ttacatgtat agatactgca aaccaaggac agaatcccca
1440attgccattg ttcccttaat ttgtcgctga atctgggctg agtcccagtc
ttgactctgg 1500acctaagcca caagttgggc aaacatgtcc aacctaggca
atactggctt tgctagatgt 1560gaataaaata tgctttgttt tgt
1583142534DNAMus musculus 14gtcccaagaa cttttcaggg cacttttagg
gacgcatata tccacgattc ctcctgggca 60gcgccatgaa gtccctgtgg ctttgctggg
cactctgggt actgcccctg gctggccctg 120gggcagcgat gaccgaggaa
caggtcctga gcagtctact gcagcagctg cagctcagcc 180aggcccccac
cctggacagc gcggatgtgg aggagatggc catccctacc cacgtgaggt
240cccagtatgt ggccctgctg cagggaagtc acgctgaccg ctcccgaggc
aagaggttca 300gccagaattt tcgagaggtg gcaggcaggt tcctgatgtc
agagacctcc actcacctgc 360tagtgttcgg aatggagcag cggctgccgc
ctaacagcga gctggtgcag gctgtgctgc 420ggctgttcca ggagcctgtg
cccagaacag ctctccggag gtttgagagg ctgtccccac 480acagtgcccg
ggctcgggtc accattgaat ggctgagagt ccgtgaggat ggctccaatc
540gcactgccct catcgactct aggctcgtgt ccatccacga gagcggctgg
aaggccttcg 600acgtgaccga ggccgtgaac ttctggcagc agctgagccg
gccgaggcag ccgctgctgc 660tccaggtgtc ggtgcagagg gagcatctgg
ggccggggac ctggagcgca cacaagttgg 720tccgtttcgc ggcgcagggg
acgccggacg gcaaggggca gggcgagcca cagctggagc 780tgcacacgct
ggacctcaag gactacggag ctcaaggcaa ttgtgacccc gaggtaccag
840tgactgaagg cacccgatgc tgtcgccagg agatgtacct ggacctgcag
gggatgaagt 900gggccgagaa ctggatccta gaaccgccag ggttcctgac
gtatgaatgt gtgggcagct 960gcctgcagct accagagtcc ctgaccatcg
ggtggccatt tctggggcct cggcagtgtg 1020ttgcctcaga gatgacctcc
ttgcccatga ttgtcagtgt gaaggaggga ggcaggacca 1080ggcctcaagt
ggtcagcctg cccaacatga gggtgcagac ctgtagctgc gcctcagatg
1140gggcgctcat acccaggggg atagatctgt agtctccctg tccacagatg
tattctcagt 1200gagcttgtcc taacttagtg ctctcgtcag acctttgctc
tacagtcttg gttttcttgt 1260ccatcaccca gtttaagcac ttacatgggt
aaatcatgtc actccagtag gacacactga 1320ccccacttag ccaaggacat
ggctatgcag tgaacaggtt cgcatctgag tctgttttct 1380ggccagaact
cagcttaatg tacaacaaaa ccctacggtg agaacagggg aatcaaaagc
1440tcgtttactc ttacaccgtg attactggca tcaacgtacc atgtcaggga
ctgcccacag 1500caggctggga gggagacatc tcagaagcct gcggcagctc
cttgtgaaaa accgttgttc 1560ccatttctcc taaccttagc cctagacaag
agctgtatag atttcatgtg tgtgactgct 1620tttcagttgg ccttggtgtt
catagttatt ctatattatt tgactttcct actcctttct 1680ccttctgccc
tggtgaattc tatgaaacta gatgttcctt gatgtaatga ttcttaaaca
1740attaaaaagt tgaggcatgg gacacagcac agcacagtcc tgatggccca
ggtgcatgct 1800gtagatgtat tctgtgtgct cttatcttgg aaacaatgca
ataactttgc aatgttagtt 1860cagattaatg tttgacttgc aaagaaagtt
tgaagaaatt attagaaagt gaaatagagc 1920caacactggg atcccgaaaa
gaaaaaagct attgaagtta tgaaataagt tttgcacaaa 1980atttgagagt
gtttcctgga taagcaagta tagaatacat aaaatcttat attagtaaaa
2040ctaagccaaa acaccgggac tcttaggagg gtcactgcgt gcaatgtgca
gaagcagaaa 2100gctggcagaa ctgccgagtt aagggtgtac ctgagtcttt
ctggccattg cctggcagct 2160ttgcccatgt catttattgt cagagcttca
cgggaaaatg caagtagccg acttcggagc 2220tctgagctct ggagtataat
aagtcaaaag gtaaagttta aataatgata agtttgcaat 2280aattattatt
ttggccagag gcctgggaat aggggaagct tgaaactctg ggggaacaat
2340tataattctt gattctttgt gtgatgtggg tattgttttg aatttgattt
ggcaacgatt 2400atacaatgtc tttttttcct atctgcattt ggagtatcaa
taaaagactg gggcaagaga 2460aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa 2520aaaaaaaaaa aaaa
2534152102DNAHomo sapiens 15acacccagct gcctgagacc ctccttcaac
ctccctagag gacagcccca ctctgcctcc 60tgctccccca gggcagcacc atgtggcccc
tgtggctctg ctgggcactc tgggtgctgc 120ccctggctgg ccccggggcg
gccctgaccg aggagcagct cctgggcagc ctgctgcggc 180agctgcagct
cagcgaggtg cccgtactgg acagggccga catggagaag ctggtcatcc
240ccgcccacgt gagggcccag tatgtagtcc tgctgcggcg cagccacggg
gaccgctccc 300gcggaaagag gttcagccag agcttccgag aggtggccgg
caggttcctg gcgtcggagg 360ccagcacaca cctgctggtg ttcggcatgg
agcagcggct gccgcccaac agcgagctgg 420tgcaggccgt gctgcggctc
ttccaggagc cggtccccaa ggccgcgctg cacaggcacg 480ggcggctgtc
cccgcgcagc gcccaggccc gggtgaccgt cgagtggctg cgcgtccgcg
540acgacggctc caaccgcacc tccctcatcg actccaggct ggtgtccgtc
cacgagagcg 600gctggaaggc cttcgacgtg accgaggccg tgaacttctg
gcagcagctg agccggcccc 660ggcagccgct gctgctacag gtgtcggtgc
agagggagca tctgggcccg ctggcgtccg 720gcgcccacaa gctggtccgc
tttgcctcgc agggggcgcc agccgggctt ggggagcccc 780agctggagct
gcacaccctg gacctcaggg actatggagc tcagggcgac tgtgaccctg
840aagcaccaat gaccgagggc acccgctgct gccgccagga gatgtacatt
gacctgcagg 900ggatgaagtg ggccaagaac tgggtgctgg agcccccggg
cttcctggct tacgagtgtg 960tgggcacctg ccagcagccc ccggaggccc
tggccttcaa ttggccattt ctggggccgc 1020gacagtgtat cgcctcggag
actgcctcgc tgcccatgat cgtcagcatc aaggagggag 1080gcaggaccag
gccccaggtg gtcagcctgc ccaacatgag ggtgcagaag tgcagctgtg
1140cctcggatgg ggcgctcgtg ccaaggaggc tccagccata ggcgcctggt
gtatccattg 1200agccctctaa ctgaacgtgt gcatagaggt ggtcttaatg
taggtcttaa ctttatactt 1260agcaagttac tccatcccaa tttagtgctc
ctgtgtgacc ttcgccctgt gtccttccat 1320ttcctgtctt tcccgtccat
cacccatcct aagcacttac gtgagtaaat aatgcagctc 1380agatgctgag
ctctagtagg aaatgctggc atgctgatta caagatacag ctgagcaatg
1440cacacatttt cagctgggag tttctgttct ctggcaaatt cttcactgag
tctggaacaa 1500taatacccta tgattagaac tggggaaaca gaactgaatt
gctgtgttat atgaggaatt 1560aaaaccttca aatctctatt tcccccaaat
actgacccat tctggacttt tgtaaacata 1620cctaggcccc tgttcccctg
agagggtgct aagaggaagg atgaagggct tcaggctggg 1680ggcagtggac
agggaattgg gatacctgga ttctggttct gacagggcca caagctagga
1740tctctaacaa acgcagaagg ctttggctcg tcatttcctc ttaaaaagga
ggagctgggc 1800ttcagctcta agaacttcat tgccctgggg atcagacagc
ccctacctac ccctgcccac 1860tcctctggag actgagcctt gcccgtgcat
atttaggtca tttcccacac tgtcttagag 1920aacttgtcac cagaaaccac
atgtatttgc atgttttttg ttaatttagc taaagcaatt 1980gaatgtagat
actcagaaga aataaaaaat gatgtttcaa aaaaaaaaaa aaaaaaaaaa
2040aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
aaaaaaaaaa 2100aa 2102161647DNAHomo sapiens 16gcctgagacc ctcctgcagc
cttctcaagg gacagcccca ctctgcctct tgctcctcca 60gggcagcacc atgcagcccc
tgtggctctg ctgggcactc tgggtgttgc ccctggccag 120ccccggggcc
gccctgaccg gggagcagct cctgggcagc ctgctgcggc agctgcagct
180caaagaggtg cccaccctgg acagggccga catggaggag ctggtcatcc
ccacccacgt 240gagggcccag tacgtggccc tgctgcagcg cagccacggg
gaccgctccc gcggaaagag 300gttcagccag agcttccgag aggtggccgg
caggttcctg gcgttggagg ccagcacaca 360cctgctggtg ttcggcatgg
agcagcggct gccgcccaac agcgagctgg tgcaggccgt 420gctgcggctc
ttccaggagc cggtccccaa ggccgcgctg cacaggcacg ggcggctgtc
480cccgcgcagc gcccgggccc gggtgaccgt cgagtggctg cgcgtccgcg
acgacggctc 540caaccgcacc tccctcatcg actccaggct ggtgtccgtc
cacgagagcg gctggaaggc 600cttcgacgtg accgaggccg tgaacttctg
gcagcagctg agccggcccc ggcagccgct 660gctgctacag gtgtcggtgc
agagggagca tctgggcccg ctggcgtccg gcgcccacaa 720gctggtccgc
tttgcctcgc agggggcgcc agccgggctt ggggagcccc agctggagct
780gcacaccctg gaccttgggg actatggagc tcagggcgac tgtgaccctg
aagcaccaat 840gaccgagggc acccgctgct gccgccagga gatgtacatt
gacctgcagg ggatgaagtg 900ggccgagaac tgggtgctgg agcccccggg
cttcctggct tatgagtgtg tgggcacctg 960ccggcagccc ccggaggccc
tggccttcaa gtggccgttt ctggggcctc gacagtgcat 1020cgcctcggag
actgactcgc tgcccatgat cgtcagcatc aaggagggag gcaggaccag
1080gccccaggtg gtcagcctgc ccaacatgag ggtgcagaag tgcagctgtg
cctcggatgg 1140tgcgctcgtg ccaaggaggc tccagccata ggcgcctagt
gtagccatcg agggacttga 1200cttgtgtgtg tttctgaagt gttcgagggt
accaggagag ctggcgatga ctgaactgct 1260gatggacaaa tgctctgtgc
tctctagtga gccctgaatt tgcttcctct gacaagttac 1320ctcacctaat
ttttgcttct caggaatgag aatctttggc cactggagag cccttgctca
1380gttttctcta ttcttattat tcactgcact atattctaag cacttacatg
tggagatact 1440gtaacctgag ggcagaaagc ccaatgtgtc attgtttact
tgtcctgtca ctggatctgg 1500gctaaagtcc tccaccacca ctctggacct
aagacctggg gttaagtgtg ggttgtgcat 1560ccccaatcca gataataaag
actttgtaaa acatgaataa aacacatttt attctaaaaa 1620aaaaaaaaaa
aaaaaaaaaa aaaaaaa 16471785PRTHomo sapiens 17Cys Lys Thr Gln Pro
Leu Arg Gln Thr Val Ser Glu Glu Gly Cys Arg 1 5 10 15Ser Arg Thr
Ile Leu Asn Arg Phe Cys Tyr Gly Gln Cys Asn Ser Phe 20 25 30Tyr Ile
Pro Arg His Val Lys Lys Glu Glu Glu Ser Phe Gln Ser Cys 35 40 45Ala
Phe Cys Lys Pro Gln Arg Val Thr Ser Val Leu Val Glu Leu Glu 50 55
60Cys Pro Gly Leu Asp Pro Pro Phe Arg Leu Lys Lys Ile Gln Lys Val65
70 75 80Lys Gln Cys Arg Cys 851885PRTHomo sapiens 18Cys Lys Thr Gln
Pro Leu Lys Gln Thr Ile His Glu Glu Gly Cys Asn 1 5 10 15Ser Arg
Thr Ile Ile Asn Arg Phe Cys Tyr Gly Gln Cys Asn Ser Phe 20 25 30Tyr
Ile Pro Arg His Ile Arg Lys Glu Glu Gly Ser Phe Gln Ser Cys 35 40
45Ser Phe Cys Lys Pro Lys Lys Phe Thr Thr Met Met Val Thr Leu Asn
50 55 60Cys Pro Glu Leu Gln Pro Pro Thr Lys Lys Lys Arg Val Thr Arg
Val65 70 75 80Lys Gln Cys Arg Cys 851980PRTHomo sapiens 19Cys Arg
Thr Val Pro Phe Ser Gln Thr Ile Thr His Glu Gly Cys Glu 1 5 10
15Lys Val Val Val Gln Asn Asn Leu Cys Phe Gly Lys Cys Gly Ser Val
20 25 30His Phe Pro Gly Ala Ala Gln His Ser His Thr Ser Cys Ser His
Cys 35 40 45Leu Pro Ala Lys Phe Thr Thr Met His Leu Pro Leu Asn Cys
Thr Glu 50 55 60Leu Ser Ser Val Ile Lys Val Val Met Leu Val Glu Glu
Cys Gln Cys65 70 75 802089PRTHomo sapiens 20Cys Glu Ala Lys Asn Ile
Thr Gln Ile Val Gly His Ser Gly Cys Glu 1 5 10 15Ala Lys Ser Ile
Gln Asn Arg Ala Cys Leu Gly Gln Cys Phe Ser Tyr 20 25 30Ser Val Pro
Asn Thr Phe Pro Gln Ser Thr Glu Ser Leu Val His Cys 35 40 45Asp Ser
Cys Met Pro Ala Gln Ser Met Trp Glu Ile Val Thr Leu Glu 50 55 60Cys
Pro Gly His Glu Glu Val Pro Arg Val Asp Lys Leu Val Glu Lys65 70 75
80Ile Leu His Cys Ser Cys Gln Ala Cys 852172PRTHomo sapiens 21Cys
Pro Val Leu Tyr Ala Trp Asn Asp Leu Gly Ser Arg Phe Trp Pro 1 5 10
15Arg Tyr Val Lys Val Gly Ser Cys Cys Ser Val Pro Glu Gly Met Val
20 25 30Cys Lys Pro Ser Lys Ser Val His Leu Thr Val Leu Arg Trp Arg
Cys 35 40 45Gln Arg Arg Gly Gly Gln Arg Cys Gly Trp Pro Ile Gln Tyr
Pro Ile 50 55 60Ile Ser Glu Cys Lys Cys Ser Cys65 7022104PRTHomo
sapiens 22Cys Asp Pro Glu Ala Pro Met Thr Glu Gly Thr Arg Cys Cys
Arg Gln 1 5 10 15Glu Met Tyr Ile Asp Leu Gln Gly Met Lys Trp Ala
Lys Asn Trp Val 20 25 30Leu Glu Pro Pro Gly Phe Leu Ala Tyr Glu Cys
Val Gly Thr Cys Gln 35 40 45Gln Pro Pro Glu Ala Leu Ala Phe Asn Trp
Pro Phe Leu Gly Pro Arg 50 55 60Gln Cys Ile Ala Ser Glu Thr Ala Ser
Leu Pro Met Ile Val Ser Ile65 70 75 80Lys Glu Gly Gly Arg Thr Arg
Pro Gln Val Val Ser Leu Pro Asn Met 85 90 95Arg Val Gln Lys Cys Ser
Cys Ala 1002382PRTHomo sapiens 23Cys Lys Arg His Pro Leu Tyr Asp
Phe Ser Asp Val Gly Trp Asn Asp 1 5 10 15Trp Ile Val Ala Pro Pro
Gly Tyr His Ala Phe Tyr Cys His Gly Glu 20 25 30Cys Pro Phe Pro Leu
Ala Asp His Ser Lys Ile Pro Lys Ala Cys Cys 35 40 45Val Pro Thr Glu
Leu Ser Ala Ile Ser Met Leu Tyr Leu Asp Glu Asn 50 55 60Glu Lys Val
Val Leu Lys Asn Tyr Gln Asp Met Val Val Glu Gly Cys65 70 75 80Gly
Cys2495PRTHomo sapiens 24Cys Asp Glu His Ser Thr Glu Ser Arg Cys
Cys Arg Tyr Pro Leu Thr 1 5 10 15Asp Phe Glu Glu Ala Pro Gly Trp
Asp Trp Ile Ile Ala Pro Lys Arg 20 25 30Tyr Lys Ala Asn Tyr Cys Ser
Gly Glu Cys Glu Phe Val Phe Leu Gln 35 40 45Lys Tyr Pro His Pro Arg
Gly Ser Ala Gly Pro Cys Cys Thr Pro Thr 50 55 60Lys Met Ser Pro Ile
Asn Met Leu Tyr Phe Asn Gly Lys Glu Gln Ile65 70 75 80Ile Tyr Gly
Lys Ile Pro Ala Met Val Val Asp Arg Cys Gly Cys 85 90 952595PRTHomo
sapiens 25Cys Phe Ser Ser Thr Glu Lys Asn Cys Cys Val Arg Gln Leu
Tyr Ile 1 5 10 15Asp Phe Arg Lys Asp Leu Gly Trp Lys Trp Ile His
Glu Pro Lys Gly 20 25 30Tyr His Ala Asn Phe Cys Leu Gly Pro Cys Pro
Tyr Ile Trp Ser Leu 35 40 45Asp Thr Gln Tyr Pro Gly Ala Ser Ala Ala
Pro Cys Cys Val Pro Gln 50 55 60Ala Leu Glu Pro Leu Pro Ile Val Tyr
Tyr Val Gly Arg Lys Pro Lys65 70 75 80Val Glu Gln Leu Ser Asn Met
Ile Val Arg Ser Cys Lys Cys Ser 85 90 952675PRTHomo sapiens 26Leu
Lys Cys Val Cys Leu Leu Cys Asp Ser Ser Asn Phe Thr Cys Gln 1 5 10
15Thr Glu Gly Ala Cys Trp Ala
Ser Val Met Leu Thr Asn Gly Lys Glu 20 25 30Gln Val Ile Lys Ser Cys
Val Ser Leu Pro Glu Leu Asn Ala Gln Val 35 40 45Phe Cys His Ser Ser
Asn Asn Val Thr Lys Thr Glu Cys Cys Phe Thr 50 55 60Asp Phe Cys Asn
Asn Ile Thr Leu His Leu Pro65 70 752770PRTHomo sapiens 27Ala Leu
Leu Cys Ala Cys Thr Ser Cys Leu Gln Ala Asn Tyr Thr Cys 1 5 10
15Glu Thr Asp Gly Ala Cys Met Val Ser Ile Phe Asn Leu Asp Gly Met
20 25 30Glu His His Val Arg Thr Cys Ile Pro Lys Val Glu Leu Val Pro
Ala 35 40 45Gly Lys Pro Phe Tyr Cys Leu Ser Ser Glu Asp Leu Arg Asn
Thr His 50 55 60Cys Cys Tyr Thr Asp Tyr65 7028354PRTHomo
sapiensVARIANT113Xaa = Thr or Gly 28Leu Thr Glu Glu Gln Leu Leu Gly
Ser Leu Leu Arg Gln Leu Gln Leu 1 5 10 15Ser Glu Val Pro Val Leu
Asp Arg Ala Asp Met Glu Lys Leu Val Ile 20 25 30Pro Ala His Val Arg
Ala Gln Tyr Val Val Leu Leu Arg Arg Ser His 35 40 45Gly Asp Arg Ser
Arg Gly Lys Arg Phe Ser Gln Ser Phe Arg Glu Val 50 55 60Ala Gly Arg
Phe Leu Ala Ser Glu Ala Ser Thr His Leu Leu Val Phe65 70 75 80Gly
Met Glu Gln Arg Leu Pro Pro Asn Ser Glu Leu Val Gln Ala Val 85 90
95Leu Arg Leu Phe Gln Glu Pro Val Pro Lys Ala Ala Leu Asn His Arg
100 105 110Xaa His Gly Arg Asn Leu Ser Pro Arg Ser Ala Gln Ala Arg
Val Thr 115 120 125Val Glu Trp Leu Arg Val Arg Asp Asp Gly Ser Asn
Arg Thr Ser Leu 130 135 140Ile Asp Ser Arg Leu Val Ser Val His Glu
Ser Gly Trp Lys Ala Phe145 150 155 160Asp Val Thr Glu Ala Val Asn
Phe Trp Gln Gln Leu Ser Arg Pro Arg 165 170 175Gln Pro Leu Leu Leu
Gln Val Ser Val Gln Arg Glu His Leu Gly Pro 180 185 190Leu Ala Ser
Gly Ala His Lys Leu Val Arg Phe Ala Ser Gln Gly Ala 195 200 205Pro
Ala Gly Leu Gly Glu Pro Gln Leu Glu Leu His Thr Leu Asp Leu 210 215
220Arg Asp Tyr Gly Ala Gln Gly Asp Cys Asp Pro Glu Ala Pro Asn
Met225 230 235 240Thr Glu Asn Gly Thr Arg Cys Cys Arg Gln Glu Met
Tyr Ile Asp Leu 245 250 255Gln Gly Met Lys Trp Ala Lys Asn Trp Val
Leu Glu Pro Pro Gly Phe 260 265 270Leu Ala Tyr Glu Cys Val Gly Thr
Cys Gln Gln Pro Pro Glu Ala Asn 275 280 285Leu Ala Thr Phe Asn Trp
Ser Pro Thr Phe Leu Gly Pro Arg Gln Cys 290 295 300Ile Ala Ser Glu
Thr Ala Ser Leu Pro Met Ile Val Ser Ile Lys Glu305 310 315 320Gly
Gly Arg Thr Arg Pro Gln Val Val Ser Leu Pro Asn Met Arg Val 325 330
335Gln Lys Cys Ser Cys Ala Ser Asp Gly Ala Leu Val Pro Arg Arg Leu
340 345 350Gln Pro
* * * * *