U.S. patent application number 12/580216 was filed with the patent office on 2010-04-29 for multipotent/pluripotent cells and methods.
Invention is credited to Tetsuya Ishikawa, Hideki Masaki, Kazuhiro Sakurada, Shunichi Takahashi.
Application Number | 20100105100 12/580216 |
Document ID | / |
Family ID | 39253880 |
Filed Date | 2010-04-29 |
United States Patent
Application |
20100105100 |
Kind Code |
A1 |
Sakurada; Kazuhiro ; et
al. |
April 29, 2010 |
MULTIPOTENT/PLURIPOTENT CELLS AND METHODS
Abstract
Described herein are multipotent stem cells, e.g., human and
other mammalian pluripotent stem cells, and related methods.
Inventors: |
Sakurada; Kazuhiro;
(Yokohama, JP) ; Masaki; Hideki; (Akita, JP)
; Ishikawa; Tetsuya; (Meguro-ku, JP) ; Takahashi;
Shunichi; (Kobe, JP) |
Correspondence
Address: |
WILSON, SONSINI, GOODRICH & ROSATI
650 PAGE MILL ROAD
PALO ALTO
CA
94304-1050
US
|
Family ID: |
39253880 |
Appl. No.: |
12/580216 |
Filed: |
October 15, 2009 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
12157967 |
Jun 13, 2008 |
|
|
|
12580216 |
|
|
|
|
61040646 |
Mar 28, 2008 |
|
|
|
Current U.S.
Class: |
435/29 ;
435/366 |
Current CPC
Class: |
A61P 3/10 20180101; C12N
2501/602 20130101; C12N 2799/027 20130101; C12N 15/85 20130101;
C12N 2501/606 20130101; C12N 5/0696 20130101; A61P 25/28 20180101;
C12N 2501/604 20130101; C12N 2510/00 20130101; C12N 2501/603
20130101 |
Class at
Publication: |
435/29 ;
435/366 |
International
Class: |
C12Q 1/02 20060101
C12Q001/02; C12N 5/0797 20100101 C12N005/0797 |
Foreign Application Data
Date |
Code |
Application Number |
Jun 15, 2007 |
JP |
JPO 2007-159382 |
Nov 20, 2007 |
EP |
PCT/EP2007/010019 |
Claims
1. A human stem cell that is pluripotent, somatic, non-embryonic,
and having the property of long-term self renewal.
2.-132. (canceled)
133. A purified preparation of isolated induced pluripotent somatic
mammalian cells, wherein the cells: (a) express endogenous Oct4 and
Nanog, (b) differentiate into tissues having the characteristics of
endoderm, mesoderm, and ectoderm when injected into SCID mice; (c)
have at least one exogenous gene integrated into the genome; and
(d) do not express an exogenously introduced pluripotency gene.
134. The purified preparation of cells of claim 133, wherein the
cells share the same genome as the donor of said somatic cells and
wherein said donor is a subject in need of cell
transplantation.
135. A method of deriving an induced pluripotent stem cell from a
somatic cell, the method comprising steps of: (a) providing somatic
cells that do not contain a selectable marker, wherein at least
some of which are induced pluripotent stem cells; and (b) selecting
a cell or colony of cells having a morphology characteristic of a
human ES cell colony.
136. The method of claim 135, wherein the provided somatic cells do
not comprise a selectable marker construct.
137. The method of claim 135, wherein the somatic cells contain at
least one exogenously introduced induction factor.
138. The method of claim 137, wherein said exogenously introduced
induction factor is a protein introduced by protein transduction or
transient transfection of a construct encoding said protein.
139. The method of claim 135, wherein the somatic cells of step (a)
contain one or more exogenously introduced pluripotency genes or
proteins encoded by such genes.
140. The method of claim 135, wherein the somatic cells contain or
express at least two exogenous proteins selected from the group
consisting of Oct-4, Sox-2, c-Myc, and KIf4.
141. The method of claim 135, wherein the somatic cells of step (a)
contain one or more exogenously introduced genes selected from the
group consisting of: Oct-4, Sox-2, c-Myc, KIf4, and combinations
thereof.
142. The method of claim 135, wherein the selected cells display
the following characteristics: (i) ability to differentiate into
cells having characteristics of endoderm, mesoderm, and ectoderm
when injected into SCID mice; (ii) expression of endogenous Oct4,
Nanog, or both; and (iii) expression of an ES cell marker.
143. The method of claim 142, wherein the ES cell marker is
selected from the group consisting of: Alkaline Phosphatase (AP),
SSEA-I, SSEA-3, SSEA-4, and TRA-1-60.
144. The method of claim 135, further comprising subjecting the
identified cells to one or more selection steps.
145. The method of claim 144, wherein said one or more selection
steps comprise (e) passaging or subcloning said colony and
identifying cells or a cell colony having an ES-like morphology
from among progeny of the cells of said colony.
146. A method of identifying a somatic cell that is an induced
pluripotent stem cell, the method comprising steps of : (a)
providing a population of cells, at least some of which are induced
pluripotent stem cells, wherein said cell does not comprise an
induction factor promoter reporter construct, and (b) identifying a
cell or colony of cells having a morphology characteristic of an ES
cell or ES cell colony.
147. The method of claim 146, further comprising separating said
cell or at least some cells from said colony of cells from other
cells in the population lacking such morphology.
148. The method of claim 146, wherein the cells of step (a) contain
one or more exogenously introduced genes selected from the group
consisting of: Oct-4, Sox-2, c-Myc, KIf4, and combinations
thereof.
149. A method of identifying a somatic cell that is an induced
pluripotent stem cell, the method comprising steps of: (a)
introducing one or more induction factors to cells, wherein said
induction factors are sufficient to induce the cells to become
pluripotent stem cells; (b) maintaining said cells in culture for a
suitable period of time to allow colonies containing ES- like cells
to develop; and (c) identifying at least one such colony of ES-like
cells without employing selection.
150. The method of claim 149, wherein step (a) comprises
introducing one or more genes selected from the group consisting
of: Oct-4, Sox-2, c-Myc, KIf4, and combinations thereof into the
cells.
151. A purified preparation of isolated induced pluripotent stem
cells from somatic mammalian cells, wherein the cells (a) express
endogenous Oct4 and Nanog; (b) differentiate into tissues having
the characteristics of endoderm, mesoderm, and ectoderm when
injected into SCID mice; and (c) do not contain a DNA encoding a
selectable marker operably linked to an endogenous pluripotency
gene .
152. The purified preparation of cells of claim 151, wherein the
cells comprise the genome of a donor of said somatic cells or a
donor, wherein said donor is an individual in need of cell
transplantation.
153. An induced pluripotent stem cell, wherein the induced
pluripotent stem cell does not comprise a selectable marker.
154. A method of generating a stem cell, comprising the steps of:
(a) providing a differentiated somatic cell that contains at least
one exogenously introduced induction factor that contributes to
inducing said cell to become an induced pluripotent stem cell; (b)
maintaining said cell under conditions appropriate for
proliferation of said cell and for activity of said at least one
exogenously introduced induction factor for a period of time
sufficient to activate at least one endogenous pluripotency gene;
and (c) inactivating said at least one exogenously-introduced
induction factor.
155. The method of claim 154, further comprising identifying cells
that express one or more markers of pluripotency.
156. The method of claim 154, wherein said differentiated somatic
cell is terminally differentiated.
157. The method of claim 154, wherein said differentiated somatic
cell is a blood cell.
158. The method of claim 154, wherein said differentiated somatic
cell is obtained from peripheral blood.
159. The method of claim 154, wherein said at least one induction
factor is a polynucleotide.
160. The method of claim 154, wherein said at least one induction
factor is a polypeptide.
161. The method of claim 154, wherein said at least one induction
factor is selected from the group consisting of Oct4, Sox2, Nanog,
Lin28, c-Myc and combinations thereof.
162. The method of claim 154, wherein said differentiated somatic
cell contains exogenously introduced Oct4, Sox2, and KIf-4.
163. The method of claim 154, wherein said differentiated somatic
cell contains exogenously introduced Oct4, Sox2, KIf-4 and
c-Myc.
164. The method of claim 154, wherein said differentiated somatic
cell further contains exogenously introduced genes Oct4. Sox2 and
KIf-4 and further contains at least one exogenously introduced
induction factor.
165. The method of claim 164, wherein said at least one exogenously
introduced induction factor is a polynucleotide.
166. The method of claim 164, wherein said at least one exogenously
introduced induction factor is a polypeptide.
167. The method of claim 164, wherein said at least one exogenously
introduced induction factor is a polypeptide.
168. The method of claim 154, wherein said at least one exogenously
introduced factor is introduced using a vector.
169. The method of claim 154, wherein said at least one exogenously
introduced factor is introduced using an inducible vector.
170. The method of claim 154, wherein said at least one exogenously
introduced factor is introduced using a vector which is not subject
to methylation-mediated silencing.
171. The method of claim 154, wherein said at least one exogenously
introduced factor is introduced using a viral vector.
172. The method of claim 154, wherein said at least one exogenously
introduced factor is introduced using a retroviral vector.
173. The method of claim 154, wherein said at least one exogenously
introduced factor is introduced using a lentiviral vector.
174. The method of claim 154, wherein said differentiated somatic
cell is maintained in the presence of a growth factor.
175. The method of claim 154, wherein said endogenous pluripotency
gene is selected from the group consisting of Nanog, Oct4, Sox2 and
combinations thereof.
176. An isolated pluripotent cell produced by a method comprising:
(a) providing a differentiated somatic cell that contains at least
one exogenously introduced induction factor that contributes to
inducing said cell to a pluripotent state; (b) maintaining said
cell under conditions appropriate for proliferation of said cell
and for activity of said at least one exogenously introduced factor
for a period of time sufficient to activate at least one endogenous
pluripotency gene; (c) functionally inactivating said at least one
exogenously introduced factor; and (d) differentiating cells which
display one or more markers of pluripotency from cells which do
not.
177. A purified population of somatic cells produced by a method
comprising: (a) providing a differentiated somatic cell that
contains at least one exogenously introduced induction factor; (b)
maintaining said cell under conditions appropriate for
proliferation of said cell and for activity of said at least one
exogenously introduced factor for a period of time sufficient to
activate at least one endogenous pluripotency gene; (c)
functionally inactivating said at least one exogenously introduced
induction factor; and (d) differentiating cells which display one
or more markers of pluripotency from cells which do not.
178. A purified preparation of isolated pluripotent reprogrammed
somatic mammalian cells, wherein the cells (a) express endogenous
Oct4 and Nanog, (b) differentiate into tissues having the
characteristics of endoderm, mesoderm, and ectoderm when injected
into SCID mice; (c) have at least one genetic modification; and (d)
do not express an exogenously introduced pluripotency gene or
selectable marker operably linked to an endogenous pluripotency
gene.
179. The purified preparation of cells of claim 178, wherein the
cells are genetically matched to a donor of said somatic cells or a
donor of a precursor cell of said somatic cells, wherein said donor
is an individual in need of cell therapy.
180. A method of deriving a somatic cell that has an increased
likelihood of having been reprogrammed to an ES-like state, the
method comprising steps of: (a) providing somatic cells that do not
contain a genetic modification usable for chemical selection of
said cells, wherein at least some of the cells have been at least
in part reprogrammed to an ES- like state; and (b) selecting a cell
or colony of cells having a morphology characteristic of an ES cell
or ES cell colony.
181. A method of selecting induced pluripotent stem cells, the
method comprising: a) re-programming a differentiated primary cell
to a pluripotent phenotype, wherein the differentiated primary cell
does not express Nanog mRNA when measured by RT-PCR; b) culturing
the cell re-programmed in step (a) in the absence of a selection
agent after re-programming; c) microscopically observing the
culture of step (b), and isolating a clone of cells in the culture
which have become smooth and rounded in appearance; and d) testing
cells of the clone for the expression of a stem cell marker;
wherein the detection of stem cell marker expression is indicative
that the cells are induced pluripotent stem cells.
182. The method of claim 181 wherein said re-programming comprises
one of: introducing nucleic acid sequences encoding the
transcription factors Oct4, Sox2, c-Myc and KIf4 to said
differentiated somatic cell, the sequences operably linked to
regulatory elements for the expression of the factors; introducing
one or more protein factors that re-program the cell's
differentiation state; and contacting said cell with a small
molecule that induces a re-programming of the cell's differentiated
state.
183. The method of claim 181 further comprising the step of
introducing cells of a said clone that express a stem cell marker
into nude mice and performing histology on a tumor arising from the
cells, wherein the growth of a tumor comprising cells from all
three germ layers further indicates that the cells are pluripotent
stem cells.
184. The method of claim 181 wherein the step of culturing further
comprises passaging said cells.
185. The method of claim 181 wherein said differentiated somatic
cell has a morphology distinctly different from that of an ES
cell.
186. The method of claim 181 wherein the differentiated primary
cell is a fibroblast, and wherein said fibroblast is flattened and
irregularly shaped prior to said re-programming.
187. The method of claim 181 wherein the stem cell marker is
selected from the group consisting of SSEA1, CD9, Nanog, Fbx15,
Ecat1, Esg1, Eras, GdO, Fgf4, Cripto, Dax1, Zpf296, Slc2a3, Rex1,
Utf1, and Oct4.
188. The method of claim 182 wherein said nucleic acid sequences
are comprised in a viral vector or a plasmid.
189. The method of claim 188 wherein said viral vector is a
retroviral vector, a lentiviral vector or an adenoviral vector.
190. The method of claim 181 further comprising the step of testing
cells of said clone for the expression of exogenous Oct4, Sox2,
c-Myc and/or Klf4.
191. The method of claim 181, wherein said cell comprises a human
cell.
192. A method of selecting induced pluripotent stem cells, the
method comprising: a) inducing a differentiated primary cell to a
pluripotent phenotype, wherein the differentiated primary cell does
not express Nanog mRNA when measured by RT-PCR; b) culturing the
cell induced in step (a) in the absence of a selection agent after
inducing pluripotency; c) microscopically observing the culture of
step (b), and isolating a clone of cells in the culture which have
become smooth and rounded in appearance; and d) testing cells of
the clone for the expression of a stem cell marker; wherein the
detection of stem cell marker expression is indicative that the
cells are induced pluripotent stem cells.
193. The method of claim 192 wherein said inducing comprises one
of: introducing nucleic acid sequences encoding the transcription
factors Oct4, Sox2, c-Myc and Klf4 to said differentiated somatic
cell, the sequences operably linked to regulatory elements for the
expression of the factors; introducing one or more protein factors
that induce pluripotency of said differentiated somatic cell; and
contacting said differentiated somatic cell with a small molecule
that induces the cell to become pluripotent.
194. The method of claim 192 further comprising the step of
introducing cells of said clone that express a stem cell marker
into nude mice and performing histology on a teratoma arising from
the cells, wherein the growth of a teratoma comprising cells from
all three germ layers further indicates that the cells are
pluripotent stem cells.
195. The method of claim 192 wherein the step of culturing further
comprises passaging said cells.
196. The method of claim 192 wherein said differentiated somatic
cell has a morphology distinctly different from that of an ES
cell.
197. The method of claim 192 wherein the differentiated primary
cell is a fibroblast, and wherein said fibroblast is flattened and
irregularly shaped prior to said inducing.
198. The method of claim 192 wherein the stem cell marker is
selected from the group consisting of SSEA1, CD9, Nanog, Fbx15,
Ecat1, Esg1, Eras, GdO, Fgf4, Cripto, Dax1, Zpf296, Slc2a3, Rex1,
Utf1, and Oct4.
199. The method of claim 193 wherein said nucleic acid sequences
are comprised in a viral vector or a plasmid.
200. The method of claim 199 wherein said viral vector is a
retroviral vector, a lentiviral vector or an adenoviral vector.
201. The method of claim 192 further comprising the step of testing
cells of said clone for the expression of exogenous Oct4, Sox2,
c-Myc or Klf4.
202. The method of claim 192, wherein said cell comprises a human
cell.
Description
CROSS-REFERENCE
[0001] This application claims the benefit of Japanese Patent
Application No. JPO 2007-159382, filed Jun. 15, 2007,
PCT/EP2007/010019, filed Nov. 20, 2007, and U.S. Provisional
Application 61/040,646, filed Mar. 28, 2008, the contents of all
three of which are incorporated by reference herein in their
entirety.
BACKGROUND OF THE INVENTION
[0002] The field of regenerative medicine encompasses therapies
designed to aid the repair, replacement, or regeneration of damaged
cells, tissues, or organs. One branch of regenerative medicine
includes cell therapies that rely on embryonic stem cells (ES),
which have the potential to give rise to a diverse range of cell
types. ES-based cell therapies have the promise of treating a
variety of health conditions including Alzheimer's Disease,
Parkinson's Disease, stroke, spinal injuries, heart attack, renal
failure, osteoporosis, type I diabetes, multiple sclerosis,
rheumatoid arthritis, burns, and wounds. However, the progress of
such therapies has been hindered by a range of factors including
the possibility of immune rejection of ES cells derived from a
donor who is immunologically incompatible with the recipient.
SUMMARY OF THE INVENTION
[0003] This disclosure encompasses human stem cells that in some
cases are pluripotent and in some cases are multipotent. The
disclosure further encompasses methods for generating such human
stem cells, methods for using such stem cells, and related
compositions.
[0004] Accordingly, in one aspect provided herein are human stem
cells that are pluripotent, somatic, non-embryonic, and have the
property of long-term self renewal. In some embodiments, such human
stem cells comprise exogenous genes including a first exogenous
gene encoding an Oct3/4 polypeptide, a second exogenous gene
encoding a Sox2 polypeptide, and a third exogenous gene encoding a
Klf4 polypeptide. In one embodiment, the human stem cells
comprising exogenous genes comprise three and only three exogenous
genes, where a first exogenous gene encodes an Oct3/4 polypeptide,
a second exogenous gene encodes a Sox2 polypeptide, and a third
exogenous gene encodes a Klf4 polypeptide. In a further embodiment,
the exogenous genes consist essentially of the just-mentioned
first, second, and third exogenous genes. In another embodiment,
the exogenous genes comprise a first exogenous gene encoding an
Oct3/4 polypeptide, a second exogenous gene encoding a Sox2
polypeptide, a third exogenous gene encoding a Klf4 polypeptide,
and a fourth exogenous gene encoding the amino acid sequence of the
mouse-derived cationic amino acid transporter (mCAT) (e.g. mCAT1).
In another embodiment, the human stem cells comprising exogenous
genes comprise four and only four exogenous genes, where a first
exogenous gene encodes an Oct3/4 polypeptide, a second exogenous
gene encodes a Sox2 polypeptide, a third exogenous gene encodes a
Klf4 polypeptide, and a fourth exogenous gene encodes a c-Myc
polypeptide. In a further embodiment, the exogenous genes consist
essentially of the just-mentioned first, second, third, and fourth
exogenous genes. In some embodiments, the exogenous genes do not
include a gene encoding a c-Myc polypeptide. In further
embodiments, the human stem cell comprising the exogenous genes,
does not comprise an exogenous c-Myc polypeptide. In other
embodiments, the exogenous genes include a gene encoding a c-Myc
polypeptide. In one embodiment, where the exogenous genes include a
gene encoding the c-Myc polypeptide, the exogenous genes include a
fifth exogenous gene encoding the amino acid sequence of the
mouse-derived cationic amino acid transporter (mCAT). In some
embodiments, the exogenous genes do not include a gene encoding a
TERT polypeptide. In some embodiments, the exogenous genes do not
include a gene encoding an HPV16 E6 polypeptide or an HPV16E7
polypeptide. In further embodiments, the exogenous genes do not
include a gene encoding any of a TERT polypeptide, an SV40 Large T
antigen polypeptide, an HPV16 E6 polypeptide, or a Bmi 1
polypeptide. In yet other embodiments, the human stem cells
comprising the exogenous genes do not comprise an exogenous gene
capable of inducing cancer. In yet other embodiments, the human
stem cells comprise exogenous genes encoding three or more of the
following: an Oct3/4 polypeptide, a Sox2 polypeptide, a Klf4
polypeptide, and a c-Myc polypeptide.
[0005] In another aspect provided herein are stem cells that are
somatic, non-embryonic, positive for alkaline phosphatase, and
express two or more of the genes TDGF 1, Dnmt3b, FoxD3, GDF3,
Cyp26a1, TERT, zfp42, Sox2, Oct3/4, and Nanog. In some embodiments,
such stem cells are pluripotent.
[0006] In a related aspect provided herein are human stem cells
that, compared to human embryonic stem cells have a higher level of
gene expression in 1 to 1000 genes (e.g., in 1 to 700 genes, 1 to
500 genes, 1 to 300 genes, 1 to 200 genes, 1 to 100 genes, 1 to 50
genes, 3 to 20 genes, 5 to 20 genes, 5 to 50 genes, 10 to 50 genes,
20 to 50 genes, 30 to 100 genes, or 50 to 100 genes). In some
embodiments, such human stems cells are alkaline phosphatase
positive, and express two or more (e.g., 3, 4, 5, 6, 7, 8, 9, or
10) genes selected from TDGF1, Dnmt3b, FoxD3, GDF3, Cyp26a1, Tert,
zfp42, Sox2, Oct3/4, and Nanog.
[0007] In another aspect provided herein are human stem cells that
compared to human embryonic stem cells have a higher level of gene
expression in two or more (e.g., 3 or more, 4 or more, 5 or more,
10 or more, 15 or more, 25 or more, 50 or more, 75 or more, 100 or
more, or 200 or more) of the genes listed in Tables 13, 15, or 16
provided herein. In some embodiments, such human stems cells are
alkaline phosphatase positive, and express two or more (e.g., 3, 4,
5, 6, 7, 8, 9, or 10) genes selected from TDGF1, Dnmt3b, FoxD3,
GDF3, Cyp26a1, Tert, zfp42, Sox2, Oct3/4, and Nanog.
[0008] In a further aspect provided herein are human stem cells
that compared to human embryonic stem cells have a lower level of
gene expression in two or more (e.g., 3 or more, 4 or more, 5 or
more, 10 or more, 15 or more, 25 or more, 50 or more, 75 or more,
100 or more, or 200 or more) of the genes listed in Table 14
provided herein. In some embodiments, such human stems cells are
alkaline phosphatase positive, and express two or more genes (e.g.,
3, 4, 5, 6, 7, 8, 9, or 10) selected from TDGF1, Dnmt3b, FoxD3,
GDF3, Cyp26a1, Tert, zfp42, Sox2, Oct3/4, and Nanog.
[0009] In another aspect provided herein are human stem cells that
compared to human embryonic stem cells have a lower level of gene
expression in 1 to 1000 genes (e.g., in 1 to 300 genes, or 1 to 50
genes). In some embodiments, such human stems cells are alkaline
phosphatase positive, and express two or more genes (e.g., 3, 4, 5,
6, 7, 8, 9, or 10) selected from TDGF1, Dnmt3b, FoxD3, GDF3,
Cyp26a1, Tert, zfp42, Sox2, Oct3/4, and Nanog.
[0010] In a further aspect provided herein are human stem cells in
which the expression levels of 1 to 100 genes is closer to the
expression levels in human fibroblasts than in human embryonic stem
cells. In some embodiments, such human stems cells are alkaline
phosphatase positive, and express two or more genes (e.g., 3, 4, 5,
6, 7, 8, 9, or 10) selected from TDGF1, Dnmt3b, FoxD3, GDF3,
Cyp26a1, Tert, zfp42, Sox2, Oct3/4, and Nanog.
[0011] In yet another aspect provided herein is a method for
generating an autologous stem cell by forcing expression of an
Oct3/4 polypeptide, a Sox2 polypeptide, and a Klf4 polypeptide in a
cultured population of non-embryonic postnatal cells from the human
subject. In some embodiments, the autologous stem cells generated
by this method are capable of forming a teratoma. In one
embodiment, the autologous stem cells so generated are
pluripotent.
[0012] In a further aspect provided herein are human stem cells
generated by a method comprising forcing the expression of an
Oct3/4 polypeptide, a Sox2 polypeptide, and a Klf4 polypeptide in
human postnatal cells to obtain one or more colonies of cells that
have a high nucleus to cytoplasm ratio and are smaller in size than
cells surrounding the one or more colonies, and isolating at least
one of the one or more colonies. In some embodiments, the human
stem cells generated by the just-mentioned method are pluripotent
human stem cells. In some embodiments, forced expression of the
Oct3/4, Sox2, and Klf4 polypeptides is achieved by introducing into
the human postnatal cells one or more expression vectors, e.g.,
retroviral expression vectors, lentiviral expression vectors,
adeno-associated viral expression vectors, adenoviral expression
vectors, recombinant retroviruses, or nucleic acid expression
vectors such as plasmid expression vectors. In one embodiment, the
above-mentioned method does not include forcing expression of a
c-Myc polypeptide in the human postnatal cells. In another
embodiment, the method does not include forcing expression of an
exogenous gene encoding a c-Myc polypeptide in the human postnatal
cells. In a further embodiment, the method further includes forcing
expression of a c-Myc polypeptide in the human postnatal cells. In
some embodiments, where the method further includes forcing
expression of the c-Myc polypeptide, the method comprises forcing
expression of four and only four exogenous genes encoding induction
factors, where the exogenous genes encode an Oct3/4 polypeptide, a
Sox2 polypeptide, a Klf4 polypeptide, and a c-Myc polypeptide. In
one embodiment, the method comprises forcing expression of four
exogenous genes encoding induction factors, where the four
exogenous genes encode an Oct3/4 polypeptide, a Sox2 polypeptide, a
Klf4 polypeptide, and a c-Myc polypeptide. In yet another
embodiment, the method includes forcing the expression of a set of
polypeptides consisting essentially of an Oct3/4 polypeptide, a
Sox2 polypeptide, a Klf4 polypeptide, and a c-Myc polypeptide. In
another embodiment, the method includes forcing the expression of
three and only three exogenous genes encoding induction factors,
where the exogenous genes encode an Oct3/4 polypeptide, a Sox2
polypeptide, and a Klf4 polypeptide. In another embodiment, the
method includes forcing the expression of a set of polypeptides
consisting essentially of an Oct3/4 polypeptide, a Sox2
polypeptide, and a Klf4 polypeptide. In yet another embodiment, the
above-mentioned method for generating the human stem cells also
includes contacting the human postnatal cells with a histone
deacetylase inhibitor. In other embodiments, the above-mentioned
method comprises forcing expression of the Oct3/4, Sox2, and Klf4
polypeptides by introducing into the human postnatal cells: (i) a
first purified polypeptide comprising the amino acid sequence of
the Oct3/4 polypeptide; (ii) a second purified polypeptide
comprising the amino acid sequence of the Sox2 polypeptide; and
(iii) a third purified polypeptide comprising the amino acid
sequence of the Klf4 polypeptide. In some embodiments, at least one
of the first, second, and third purified polypeptides, further
comprises a protein transduction domain.
[0013] In some embodiments, the human stem cells disclosed herein
have one or more of the following properties: pluripotency;
multipotency; capability to form a teratoma; a normal diploid
karyotype; progeny that can be passaged at least about 30 times to
at least about 100 times; shorter telomeres than human embryonic
stem cells; ability to proliferate with an undifferentiated
phenotype under atmospheric oxygen conditions (e.g. greater than 5%
oxygen to about 21% oxygen); proliferation in colonies; induction
from human somatic or postnatal that had been passaged four or
fewer times after preparation from a biological sample; induction
from fetal human somatic cells; induction from adult human somatic
cells; induction from a population of cells comprising any of:
adult human skin fibroblasts, adult peripheral blood mononuclear
cells, adult human bone marrow-derived mononuclear cells, neonatal
human skin fibroblasts, human umbilical vein endothelial cells,
human umbilical artery smooth muscle cells, human postnatal
skeletal muscle cells, human postnatal adipose cells, human
postnatal peripheral blood mononuclear cells, or human cord blood
mononuclear cells; induction from the foregoing population of
cells, where the population was prepared from a composition of
cells that had been stored frozen and was then thawed before the
preparation.
[0014] A number of aspects provided herein relate to any of the
above-described human stem cells. Such aspects include: a purified
population of the human stem cells; cells differentiated from the
human stem cells (e.g., purified populations of differentiated
cells). Such differentiated stem cells include, but are not limited
to, pancreatic beta cells, neural stem cells, cortical neurons,
dopaminergic neurons, oligodendrocytes or oligodendrocyte
progenitor cells, hepatocytes or hepatocyte stem cells, or cardiac
muscle cells. Other related aspects include methods: a method for
storing the human stem cells by suspending them in a
cryopreservation medium and freezing the resulting suspension; a
method for generating differentiated cells (including any of the
foregoing differentiated cells) by differentiating the human stem
cells; a method for introducing differentiated cells (e.g.,
differentiated cells substantially free of other cell types) into a
human subject, where the differentiated cells share the same genome
as the subject or are immunocompatible with the subject. Further
related aspects include: a composition comprising the human stem
cells and a cryopreservation medium; a composition comprising the
human stem cells and a medium comprising a purified growth factor
(e.g., at a concentration of about 4 ng/ml to about 100 ng/ml). In
various embodiments, such growth factors may include one or more of
bFGF, FGF-2, PDGF, EGF, IGF, insulin, TGFb-1, activin A, Noggin,
BDNF, NGF, NT-1, NT-2, or NT-3, IGF, IGFI, IGFII, or a member of
the FGF family of growth factors.
[0015] In yet another aspect provided herein is a composition
comprising at least one of the following components: [0016] i. a
purified polypeptide comprising the amino acid sequence of a
protein transduction domain and an Oct3/4 polypeptide; [0017] ii. a
carrier reagent and a purified Oct3/4 polypeptide; [0018] iii. a
purified polypeptide comprising the amino acid sequence of a
protein transduction and a Sox2 polypeptide; [0019] iv. a carrier
reagent and a purified Sox2 polypeptide; [0020] v. a purified
polypeptide comprising the amino acid sequence of a protein
transduction domain and a Klf4 polypeptide; [0021] vi. a carrier
reagent and a purified Klf4 polypeptide; [0022] vii. a purified
polypeptide comprising the amino acid sequence of a protein
transduction domain and a c-Myc polypeptide; [0023] viii. a carrier
reagent and a purified c-Myc; or [0024] any combination of (i) to
(viii).
[0025] In some embodiments, the above-mentioned composition
contains at least two, three, or four of components (i) to (viii).
In a further aspect provided herein is a method for generating
human stem cells by forcing expression of polypeptides in human
postnatal cells, wherein the polypeptides comprise an Oct3/4
polypeptide, a Sox2 polypeptide, and a Klf4 polypeptide. In some
embodiments, the human postnatal cells used in the method were
passaged four or fewer times after preparation from a biological
sample. In some embodiments, the human postnatal cells were
prepared from a composition comprising human postnatal cells that
had been stored frozen and were then thawed. In one embodiment, the
human postnatal cells are from an adult. In some embodiments, the
human postnatal cells to be used in the method comprise adult human
bone marrow-derived mononuclear cells, neonatal human skin
fibroblasts, umbilical vein endothelial cells, umbilical artery
smooth muscle cells, postnatal skeletal muscle cells, postnatal
adipose cells, postnatal peripheral blood mononuclear cells, cord
blood mononuclear cells, or placental cells. In some embodiments,
the human postnatal cells used in this method have been passaged
four or fewer times after preparation from a biological sample. In
some embodiments, the postnatal human cells are cultured at a
density of about 10.sup.3 cells/cm.sup.2 to about 10.sup.4
cells/cm.sup.2 prior to the forced expression. In some embodiments,
the human postnatal cells are cultured in the presence of a serum
concentration of 5% or less (e.g., 2% or less). In some
embodiments, the human postnatal cells are cultured in the presence
of one or more of bFGF, FGF-2, PDGF, EGF, IGF, insulin, TGFb-1,
activin A, Noggin, BDNF, NGF, NT-1, NT-2, NT-3, or an FGF-growth
factor family member prior to the forced expression.
[0026] In some embodiments, forcing expression of the Oct3/4, Sox2,
and Klf4 polypeptides is carried out by introducing into the human
postnatal cells one or more expression vectors encoding the Oct3/4,
Sox2, and Klf4 polypeptides. Such vectors include, e.g.,
recombinant retroviruses, lentiviruses, or adenoviruses; retroviral
expression vectors, lentiviral expression vectors, nucleic acid
expression vectors, or plasmid expression vectors. In other
embodiments, where recombinant retroviruses are used for forced
expression, the method includes introducing into the population of
cultured human cells an expression vector for expression of a
mouse-derived cationic amino acid transporter (mCAT) polypeptide
prior to introducing the one or more retroviral vectors encoding
the Oct 3/4, Sox2, and Klf4 polypeptides.
[0027] In some embodiments, this method does not include forcing
the expression of a c-Myc polypeptide. In other embodiments, the
method includes forcing expression of a c-Myc polypeptide. In one
embodiment, the method does not include forcing expression of a
TERT polypeptide.
[0028] In some embodiments, this method also includes contacting
the postnatal human cells with a histone deacetylase inhibitor.
[0029] In some embodiments, forcing expression of the Oct3/4, Sox2,
and Klf4 polypeptides, comprises introducing into the human
postnatal cells one or more expression vectors In some embodiments,
the above method for generating human stem cells also includes
isolating, after the forced expression, one or more colonies of
cells smaller in size than surrounding cells, and identifying at
least one of the one or more colonies that expresses alkaline
phosphatase, nanog, TDGF1, Dnmt3b, FoxD3, GDF3, CYP26A1, TERT, and
zfp4.
[0030] In some embodiments, the method comprises forcing expression
of the Oct 3/4, Sox2, and Klf4 polypeptides, by introducing into a
culture of the human postnatal cells: (i) a first purified
polypeptide comprising the amino acid sequence of the Oct3/4
polypeptide; (ii) a second purified polypeptide comprising the
amino acid sequence of the Sox2 polypeptide, and (iii) a third
purified polypeptide comprising the amino acid sequence of the Klf4
polypeptide. In one embodiment, at least one of the just-mentioned
polypeptides further comprises a protein transduction domain.
[0031] In other embodiments, forcing expression of the Oct 3/4,
Sox2, and Klf4 polypeptides in the human postnatal cells is done by
contacting them with at least one of: [0032] i. a purified
polypeptide comprising the amino acid sequence of a protein
transduction domain and an Oct3/4 polypeptide; [0033] ii. a carrier
reagent and a purified Oct3/4 polypeptide; [0034] iii. a purified
polypeptide comprising the amino acid sequence of a protein
transduction and a Sox2 polypeptide; [0035] iv. a carrier reagent
and a purified Sox2 polypeptide; [0036] v. a purified polypeptide
comprising the amino acid sequence of a protein transduction domain
and a Klf4 polypeptide; [0037] vi. a carrier reagent and a purified
Klf4 polypeptide; [0038] vii. a purified polypeptide comprising the
amino acid sequence of a protein transduction domain and a c-Myc
polypeptide; or [0039] any combination of (i) to (vii).
[0040] In some embodiments, the human stem cells generated by this
method are capable of forming a teratoma. In some embodiments, the
human stem cells generated by this method are pluripotent, and thus
capable of generating ectoderm, mesoderm, and endoderm.
[0041] In another aspect provided herein is a method for
identifying an agent that stimulates pluripotency or multipotency
in human somatic cells (e.g., postnatal human somatic cells)
comprising: [0042] (i) providing first and second cultured human
somatic cells; [0043] (ii) contacting the first cultured human
somatic cell with a test agent; [0044] (iii) contacting the second
cultured human somatic cell with a negative control agent; [0045]
(iv) determining expression levels of an embryonic stem cell marker
gene in the contacted first and second cultured cells; and [0046]
(v) comparing the expression levels determined in step (iii) and
indicating that the test agent stimulates pluripotency or
multipotency if the embryonic stem cell marker gene expression
level in the contacted first cultured cell is greater than that
determined in the contacted second cultured cell, and indicating
that the test agent fails to stimulate multipotency or pluripotency
if the expression level of the embryonic stem cell marker gene in
the contacted first cultured cell is the same or less than that
determined in the contacted second cultured cell, wherein
determining the expression levels of the embryonic stem cell marker
gene comprises determining the expression levels of Tert or
Cyp26A1.
[0047] comparing the expression levels determined in step (iii) and
indicating that the test agent stimulates pluripotency or
multipotency if the embryonic stem cell marker gene expression
level in the contacted first cultured cell is greater than that
determined in the contacted second cultured cell, and indicating
that the test agent fails to stimulate multipotency or pluripotency
if the expression level of the embryonic stem cell marker gene in
the contacted first cultured cell is the same or less than that
determined in the contacted second cultured cell, wherein embryonic
stem cell marker gene comprises Tert or Cyp26A1.
[0048] In a further aspect provided herein is a method for
performing cell transplantation in a subject in need thereof,
comprising: [0049] (i) identifying a donor that is immunocompatible
with the subject; [0050] (ii) generating an induced pluripotent
stem cell line from postnatal cells of the donor; and [0051] (iii)
transplanting one or more cells differentiated from the induced
pluripotent stem cell line into the subject. In some embodiments,
the donor is identified as immunocompatible if the HLA genotype
matches the HLA genotype of the recipient. In one embodiment, the
immunocompatible donor is identified by genotyping a blood sample
from the immunocompatible donor. In some embodiments, the induced
pluripotent stem cell line is induced from a mononuclear blood
cell.
[0052] In some embodiments of the human stem cells, compositions,
and methods described herein, an Oct3/4 polypeptide comprises an
amino acid sequence at least 70% identical (e.g., 75%, 80%, 85%,
90%, 95%, or 100%) identical to SEQ ID NO:7, the Sox2 polypeptide
comprises an amino acid sequence least 70% identical (e.g., 75%,
80%, 85%, 90%, 95%, or 100%) to SEQ ID NO:9, the Klf4 polypeptide
comprises an amino acid at least 70% (e.g., 75%, 80%, 85%, 90%,
95%, or 100%) identical to SEQ ID NO:11, or a c-Myc polypeptide at
least 70% (e.g., 75%, 80%, 85%, 90%, 95%, or 100%) identical to SEQ
ID NO:13. In other embodiments, an Oct3/4 polypeptide comprises an
amino acid sequence at least 70% identical (e.g., 75%, 80%, 85%,
90%, 95%, or 100%) identical to SEQ ID NO:6, the Sox2 polypeptide
comprises an amino acid sequence least 70% identical (e.g., 75%,
80%, 85%, 90%, 95%, or 100%) to SEQ ID NO:8, the Klf4 polypeptide
comprises an amino acid at least 70% (e.g., 75%, 80%, 85%, 90%,
95%, or 100%) identical to SEQ ID NO:10, or a c-Myc polypeptide at
least 70% (e.g., 75%, 80%, 85%, 90%, 95%, or 100%) identical to SEQ
ID NO:12. In some embodiments, the Oct3/4 polypeptide comprises the
amino acid sequence of human Oct3/4 or mouse Oct3/4 polypeptide,
the Sox2 polypeptide comprises the amino acid sequence of human
Sox2 or mouse Sox2; and the Klf4 polypeptide comprises the amino
acid sequence of human Klf4 or mouse Klf4. In some embodiments, the
Oct3/4 polypeptide is an Oct family member other than Oct3/4, the
Sox2 polypeptide is a Sox family member other than Sox2, the Klf4
polypeptide is a Klf family member other than Klf4, and the c-Myc
polypeptide is a c-Myc family member other than c-Myc. In some
embodiments, the c-Myc polypeptide has inducible activity. In one
embodiment, the c-Myc polypeptide is a c-Myc-estrogen receptor
(c-Myc-ER) fusion polypeptide.
INCORPORATION BY REFERENCE
[0053] All publications, patents, and patent applications mentioned
in this specification are herein incorporated by reference to the
same extent as if each individual publication, patent, or patent
application was specifically and individually indicated to be
incorporated by reference.
BRIEF DESCRIPTION OF THE DRAWINGS
[0054] The novel features of the invention are set forth with
particularity in the appended claims. A better understanding of the
features and advantages of the present invention will be obtained
by reference to the following detailed description that sets forth
illustrative embodiments, in which the principles of the invention
are utilized, and the accompanying drawings of which:
[0055] FIG. 1 is an overview of an approach to the induction
process and uses of cells.
[0056] FIG. 2 shows the relative expression of Nanog and Tert genes
in human adult bone-marrow derived cells following introduction of
four genes. Oct3/4, Sox2, Klf4 and c-Myc were introduced into cells
established from mononuclear cells derived from human adult bone
marrow under low serum conditions. RNA was extracted from the
colonies obtained, and the expression of human Nanog and human Tert
genes was demonstrated by quantitative PCR. Fibroblasts and
mesenchymal stem cells in which the four genes were not introduced
were used as controls in the experiment. The amount of gene
expression is provided as a relative value in which the amount of
expression was normalized by the amount of expression of the human
hypoxanthine phosphoribosyltransferase (HPRT) gene, and by setting
as one the amount of HPRT gene expression in Alkaline Phosphatase
(ALP)-positive colonies induced from a neonatal skin fibroblast. It
was confirmed that the expression of Nanog and Tert was
significantly higher in colonies in which four genes (Oct3/4, Sox2,
Klf4 and c-Myc) were introduced and which were positive for
ALP.
[0057] FIG. 3 shows the relative expression of Nanog and Tert genes
in neonatal fibroblasts following introduction of four genes.
Oct3/4, Sox2, Klf4 and c-Myc, were introduced into primary culture
fibroblasts derived from neonatal skin; RNA was extracted from the
colonies obtained; and the amount expressed of the human Nanog and
human Tert genes was determined by quantitative PCR. Parental
fibroblasts and mesenchymal stem cells in which four genes were not
introduced were used as controls in the experiment. Gene expression
was normalized using the same procedure outlined in FIG. 2. It was
confirmed that the expression of Nanog and Tert was significantly
high in colonies in which four genes were introduced and which were
positive for ALP.
[0058] FIG. 4 shows the relative expression of Nanog and Tert genes
in mouse adult bone-marrow-derived cells following introduction of
three genes and treatment with histone deacetylase (HDAC)
inhibitor. Three genes (Oct3/4, Sox2, and Klf4) were introduced
into mouse bone marrow-derived cells established under low serum
conditions. The cells were also treated with MS-275 (0.1 or 1.0
.mu.M), an HDAC inhibitor. RNA was extracted from the colonies
obtained, and the amount of Nanog expression was determined by
quantitative PCR. From the cells in which three genes were
introduced and which were treated with a histone deacetylase
inhibitor, ALP-positive cell group (colonies) were formed, and it
was confirmed that the expression of Nanog in these colonies was
significantly higher than the ALP-negative colonies. In the figure,
W1, W2, W3, W4, W5 and W6 represent the designation of each well of
the 6-well plate used in Example 12.
[0059] FIG. 5 shows the characterization of human iPS clone 1-8.
The morphology of its parental fibroblast (lot. 5F0438) is shown in
Panel a; the morphology human iPS clone 1-8 cells cultured on
murine embryonic fibroblast (MEF) feeder cells is shown in Panel b;
the morphology of human iPS clone 1-8 cells in mTeSR1 medium is
shown in Panel c; clone 2-4 cells in mTeSR1 medium are shown in
Panel d; and clone 3-2 cells in mTeSR1 medium are shown in Panel e.
The growth curve of clone 1-8 is shown in Panels f and g. Arrows
indicate the dates of examinations. The square indicates the period
for counting cell numbers to estimate cell proliferation rate.
Panel h is a multicolor karyogram image indicating a normal
karyotype of iPS clone 1-8 derived cell at day 101.
[0060] FIG. 6 shows the characterization of transcription factors,
cell surface antigens and ALP activity in human iPS clone 1-8.
Human iPS cells (clone 1-8) were stained for Nanog (Panel a),
SSEA-3 (Panel b), SSEA-4 (Panel c), TRA-1-60 (Panel d), TRA-1-81
(Panel e), CD9 (Panel f), CD24 (Panel g), Thy-1 (also called CD90)
(Panel h). Green fluorescent staining indicates that human iPS
clone 1-8 expresses all of these surface antigens. ALP staining
indicates that iPS clone 1-8 is ALP positive. Arrows illustrate
regions of green fluorescent staining.
[0061] FIG. 7 shows the RT-PCR analysis of gene expression of human
iPS clone 1-8 cells. Panel a depicts a RT-PCR analysis of hES
marker gene expression in clone 1-8 and its parental fibroblast
(NeoFB). Genes were detected at 30 cycles except for CYP26A1 (35
cycles). Panel b depicts the silencing of four transgenes in clone
1-8. Crude fibroblasts obtained 17 days after gene transduction
were used as control. "Exo" primer sets selectively detected the
expression of the exogenous genes; and "total" primer sets detected
both endogenous and exogenous gene expression.
[0062] FIG. 8 shows a scatter plot analysis of the global gene
expression of human iPS clone 1-8 cells. The scatter plots show a
comparison of global gene expression between human iPS clone-1-8
cells cultured in mTeSR1 and H14 hES cells with MEFs (GSM151741
from public database GEO) (Panel a), or between clones 1-8 and
their parental fibroblasts (Panel b). Symbols of ES cell specific
genes were pointed with lines in both scatter plots. Expression
intensity was shown in colorimetric order from red (high) to green
(low). Arrows indicate representative regions of color.
[0063] FIG. 9 shows global gene expression of different cell lines
and gene trees based on global gene expression analysis. Cells were
clustered in the gene tree based on a set of genes identified by
the International Stem Cell Initiative (see Table 21). Samples were
designated "I-8 mTeSR" for clone-1-8 cultured in mTeSR; "1-8CM" for
clone 1-8 cultured in MEF-conditioned medium; "I-8 mTeSR(f&t)"
for clone 1-8 cultured in mTeSR after freeze-thaw treatment;
"1-8MEF" for clone 1-8 cultured on MEF; "2-4 mTeSr" for clone 2-4
cultured in mTeSR medium; "2-4MEF" for clone 2-4 cultured on MEF;
"3-2 mTeSR" for clone 3-2 cultured in mTeSR medium; "5F0438" or
"5F0416" for the parental fibroblasts; "hES1," "hES2," "hES3"
(GSM194307, GSM194308, GSM194309, respectively) for Sheff 4 line
cultured on MEF; "hES4," or "hES5" (GSM194313, GSM194314,
respectively) for Sheff 4 line cultured on matrigel; "hES6," or
"hES7" (GSM151739, GSM151741) for H14 line cultured on MEF;
"Fibroblasts1" for GSM96262; "Fibroblasts2" for GSM96263, and
"Fibroblasts3" for GSM96264, respectively. Expression intensity was
shown in colorimetric order from red (high) to green (low).
[0064] FIG. 10 shows global gene expression of different cell lines
and gene trees based on the global gene expression analysis. Cells
were clustered in the gene tree based on a set of genes correlated
with Nanog gene expression in human ES cells (seven GEO data)
between the ratio of 0.99 and 1 when compared with fibroblasts
(three GEO data). Samples were designated "1-8 mTeSR" for clone-1-8
cultured in mTeSR; "1-8CM" for clone 1-8 cultured in
MEF-conditioned medium, "5F0438" for the parental fibroblasts,
"hES1," "hES2," "hES3" (GSM194307, GSM194308, GSM194309,
respectively) for Sheff 4 line cultured on MEF; "hES4," "hES5"
(GSM194313, GSM194314, respectively) for Sheff 4 line cultured on
matrigel" "hES6," "hES7" (GSM151739, GSM151741, respectively) for
H14 line cultured on MEF; "Fibroblasts 1" for GSM96262,
"Fibroblasts2" for GSM96263, and "Fibroblasts3" for GSM96264,
respectively. Expression intensity was shown in colorimetric order
from red (high) to green (low).
[0065] FIG. 11 shows the methylation analysis of promoters in human
iPS 1-8. The Oct3/4 promoter (including the distal enhancer
(Oct3/4-Z1) and the proximal promoter region (Oct3/4-Z2)) and parts
of the Nanog promoter (including the proximal promoter region
(Nanog-Z1, -Z2)), were analyzed for the methylation of CpG (Panel
a). Panel b depicts the ratio of methylation on CpG shown by
circles, as indicated by the percentage.
[0066] FIG. 12 shows the teratoma-formation ability of cells
derived from human iPS-1-8 mTeSR cells cultured for 94 days. Human
iPS-1-8 mTeSR cells were injected into SCID mouse testes and
analyzed 56 days after injection. Panel a depicts HE and alcian
blue staining of formaldehyde-fixed teratoma tissues. The teratomas
contained tissues representative of the three germ layers; ne:
neural epithelium, ca: cartilage, et: endodermal tract. Tissues
originated from transplant were distinguished from host tissues by
HuNu staining (Panels b-d). Nestin-expressing neural epithelium is
depicted in Panel b; Collagen II expressing chondrocyte is depicted
in Panel c; alpha-fetoprotein expressing endodermal tract is
depicted in Panel d. Arrows indicate representative regions of
staining.
[0067] FIG. 13 shows the teratoma-formation ability of cells that
had been cultured under varying conditions. Teratoma 1 (Panel T-1)
was derived from human iPS-1-8 mTeSR cells cultured for 94 days.
The human iPS-1-8 mTeSR cells were injected into SCID mouse testes
and analyzed 56 days after injection. Teratoma 2 (Panel T-2) was
derived from human iPS-1-8 mTeSR cells cultured for 102 days. The
human iPS-1-8 mTeSR cells were injected into SCID mouse testes and
analyzed 48 days after injection. In teratoma-1 (Panel T-1), smooth
muscle cells (positive for .alpha.-SMA) and secretary epithelium
(positive for MUC-1) were observed in addition to three germ layers
observed in FIG. 12. Arrows indicate representative regions of
staining.
[0068] FIG. 14 shows the teratoma-formation ability of cells that
had been cultured under varying conditions. Teratoma 3 (Panel T3)
was derived from human iPS-1-8 mTeSR cells cultured for 114 days.
Human iPS-1-8 mTeSR cells were injected into SCID mouse testis and
analyzed 42 days after injection. Three germ layers similar to
FIGS. 12 and 13 were observed. T-F1 and F2 figure shows teratoma
that were derived from freeze-thawed iPS-1-8 mTeSR cells cultured
for 134 days (passage 19). Human iPS-1-8 mTeSR cells were injected
into SCID mouse testes and analyzed 46 days (Panel T-F1) and 48
days (Panel T-F2) after injection. Tissues consisting of three germ
layers were observed. Melanocytes were also observed in T-F2
experiment. Pluripotency was maintained even after freezing and
thawing. Arrows indicate representative regions of staining.
[0069] FIG. 15 shows Southern blot and PCR analyses of transgenes
detected in human iPS clone 1-8. Oct3/4, Sox2, and Klf4 transgenes
were detected by Southern blot analysis. Human iPS clone-1-8 was
estimated to have approximately ten copies of both Oct3/4
transgenes and Sox2 transgenes, and a single copy of Klf4
transgene. For the c-Myc transgene, genomic PCR analysis was
performed. The primer set was designed to include the entire second
intron. Black arrows indicate the position of the transgene of
interest. The white arrow indicates the position of endogenous
c-Myc.
[0070] FIG. 16 shows hES maker gene expression profile in ALP
positive colonies induced by four genes (Oct4, Sox2, Klf4 and
c-Myc). Colonies were stained for ALP at 17 days after 4 gene
transduction. All ALP(+) colonies were dissected and evaluated for
hES marker gene expression. Panel a shows the number of colonies
expressing Nanog, TDGF1, Dnmt3b, Zfp42, FoxD3, TERT, CYP26A1, and
GDF3. Panel b shows the morphologies of octa-positive colonies.
Panels c-d show the number of hES cell marker genes categorized by
individual experiments.
[0071] FIG. 17-FIG. 23 show morphologies of four gene (Oct4, Sox2,
Klf4 and c-Myc) induced colonies categorized by gene expression
profile of ES cell related 8 genes (Nanog, TDGF1, Dnmt3b, Zfp42,
FoxD3, TERT, CYP26A1, and GDF3) as well as ALP activity. Circles
indicate the picked-up colony.
[0072] FIG. 24 is a graphic representation of the human Oct3/4
predicted mutation tolerance map.
[0073] FIG. 25 is a graphic representation of the human Sox2
predicted mutation tolerance map.
[0074] FIG. 26 is a graphic representation of the human Klf4
predicted mutation tolerance map.
[0075] FIG. 27 is a graphic representation of the human c-Myc
predicted mutation tolerance map.
[0076] FIG. 28 shows the use of transgenes to induce ALP positive
colonies from mouse embryonic fibroblasts. The gene combination of
(Sox2, c-Myc, and Klf4), and (Oct4, Sox2 and c-Myc) can induce ALP
colonies on day 12.
[0077] FIG. 29 shows the use of transgenes to induce ALP positive
colonies from Mouse adult neural stem cells. In comparison to MEF
cells, adult neural stem cells do not require expression of
exogenous Sox2 to induce ALP colonies.
[0078] FIG. 30 shows the use of three or four transgenes to induce
ALP positive colonies from mouse bone marrow derived cells. ALP
colonies can be induced without c-Myc or Klf4.
[0079] FIG. 31 shows the use of two or four transgenes to induce
ALP positive colonies from mouse bone marrow derived cells. The
combination of Sox2 and cMyc can induce ALP colonies.
DETAILED DESCRIPTION OF THE INVENTION
TABLE-US-00001 [0080] TABLE OF CONTENTS Page I. Overview 16 II.
Preparation of Cells 17 A. Description of cells that can be induced
17 B. Collection of Cells 18 III. Induction 22 A. Overview 22 B.
Cell Culture 22 C. Induction Factors 26 D. HDAC Inhibitor 27 E. IF
Expression Vectors 30 1. Recombinant Viruses 31 2. Nucleic Acid
Vectors 37 3. Protein Transduction 38 F. Induction Factor Sequences
39 G. Subcloning Induced Cell Colonies 50 H. Passaging and
Maintaining Induced Cells 51 IV. Analysis of Induced Cells 51 A.
Methylation Analysis 53 B. Self-renewal Assay 53 C. Karyotype
Analysis 54 D. Teratoma Analysis 54 E. Gene Expression 55 V.
Description of Induced Cells 55 VI. Cell Differentiation 59 VII.
Cell Therapies 63 VIII. Analytical Methods 65 IX. Storage of Cells
68 X. Examples 68
I. Overview
[0081] The present disclosure features induced multipotent and
pluripotent stem cells and related methods and compositions.
Pluripotent stem cells have the ability to differentiate into cells
of all three germ layers (ectoderm, mesoderm and endoderm); in
contrast, multipotent stem cells can give rise to one or more
cell-types of a particular germ layer(s), but not necessarily all
three.
[0082] The process of inducing cells to become multipotent or
pluripotent is based on forcing the expression of polypeptides,
particularly proteins that play a role in maintaining or regulating
self-renewal and/or pluripotency of ES cells. Examples of such
proteins are the Oct3/4, Sox2, Klf4, and c-Myc transcription
factors, all of which are highly expressed in ES cells. Forced
expression may include introducing expression vectors encoding
polypeptides of interest into cells, transduction of cells with
recombinant viruses, introducing exogenous purified polypeptides of
interest into cells, contacting cells with a non-naturally
occurring reagent that induces expression of an endogenous gene
encoding a polypeptide of interest (e.g., Oct3/4, Sox2, Klf4, or
c-Myc), or any other biological, chemical, or physical means to
induce expression of a gene encoding a polypeptide of interest
(e.g., an endogenous gene Oct3/4, Sox2, Klf4, or c-Myc). Some basic
steps to induce the cells are shown in FIG. 1. These steps may
involve: collection of cells from a donor, e.g., a human donor, or
a third party (100); induction of the cells, e.g., by forcing
expression of polypeptides such as Oct3/4, Sox2, Klf4, and c-Myc
(110); identifying multipotent or pluripotent stem cells (120);
isolating colonies (130); and optionally, storing the cells (140).
Interspersed between all of these steps are steps to maintain the
cells, including culturing or expanding the cells. In addition,
storage of the cells can occur after many steps in the process.
Cells may later be used in many contexts, such as therapeutics or
other uses.(150).
[0083] Embryonic stem (ES) cells are both self-renewing and
pluripotent. The induced cells may also be self-renewing and
pluripotent. However, in contrast to ES cells, the induced cells
can be derived from a wide range of cells and tissue, including
non-embryonic tissue.
[0084] The induced cells (e.g., induced multipotent or pluripotent
stem cells) have many uses. They may be subjected to conditions
that enable them to generate differentiated cells, e.g., neurons,
hepatocytes, or cardiomyocytes. They may also give rise to other
types of stem cells, e.g., neural stem cells, hepatic stem cells,
or cardiac stem cells, that have the ability differentiate into
other cells of a specific lineage. The induced cells, and cells
differentiated from them, are also useful for medical therapies
such as cell replacement therapies. Since the induced cells can be
induced from non-embryonic cells, a cell therapy can involve
providing a subject with cells derived from his or her own tissue,
thereby lessening the possibility of immune rejection.
[0085] This disclosure describes induced multipotent and
pluripotent stem cells, their preparation, and their storage. The
disclosure further describes cells differentiated from the induced
multipotent and pluripotent stem cells, their preparation, and
their storage. Also described are the use of the induced cells, or
of cells differentiated from them, for cell therapies. Analytical
methods and methods of cell banking are also provided.
II. Preparation of Cells
[0086] A. Description of cells that can be induced
[0087] The multipotent or pluripotent cells may be induced from a
wide variety of mammalian cells. Examples of suitable populations
of mammalian cells include those that include, but are not limited
to: fibroblasts, bone marrow-derived mononuclear cells, skeletal
muscle cells, adipose cells, peripheral blood mononuclear cells,
macrophages, hepatocytes, keratinocytes, oral keratinocytes, hair
follicle dermal cells, gastric epithelial cells, lung epithelial
cells, synovial cells, kidney cells, skin epithelial cells or
osteoblasts.
[0088] The cells can also originate from many different types of
tissue, e.g., bone marrow, skin (e.g., dermis, epidermis), muscle,
adipose tissue, peripheral blood, foreskin, skeletal muscle, or
smooth muscle. The cells can also be derived from neonatal tissue,
including, but not limited to: umbilical cord tissues (e.g., the
umbilical cord, cord blood, cord blood vessels), the amnion, the
placenta, or other various neonatal tissues (e.g., bone marrow
fluid, muscle, adipose tissue, peripheral blood, skin, skeletal
muscle etc.).
[0089] The cells can be derived from neonatal or post-natal tissue
collected from a subject within the period from birth, including
cesarean birth, to death. For example, the tissue may be from a
subject who is >10 minutes old, >1 hour old, >1 day old,
>1 month old, >2 months old, >6 months old, >1 year
old, >2 years old, >5 years old, >10 years old, >15
years old, >18 years old, >25 years old, >35 years old,
>45 years old, >55 years old, >65 years old, >80 years
old, <80 years old, <70 years old, <60 years old, <50
years old, <40 years old, <30 years old, <20 years old or
<10 years old. The subject may be a neonatal infant. In some
cases, the subject is a child or an adult. In some examples, the
tissue is from a human of age 2, 5, 10 or 20 hours. In other
examples, the tissue is from a human of age 1 month, 2 months, 3
months, 4 months, 5 months, 6 months, 9 months or 12 months. In
some cases, the tissue is from a human of age 1 year, 2 years, 3
years, 4 years, 5 years, 18 years, 20 years, 21 years, 23 years, 24
years, 25 years, 28 years, 29 years, 31 years, 33 years, 34 years,
35 years, 37 years, 38 years, 40 years, 41 years, 42 years, 43
years, 44 years, 47 years, 51 years, 55 years, 61 years, 63 years,
65 years, 70 years, 77 years, or 85 years old.
[0090] The cells may be from non-embryonic tissue, e.g., at a stage
of development later than the embryonic stage. In other cases, the
cells may be derived from an embryo. In some cases, the cells may
be from tissue at a stage of development later than the fetal
stage. In other cases, the cells may be derived from a fetus.
[0091] The cells are preferably from a human subject but can also
be derived from non-human subjects, e.g., non-human mammals.
Examples of non-human mammals include, but are not limited to,
non-human primates (e.g., apes, monkeys, gorillas), rodents (e.g.,
mice, rats), cows, pigs, sheep, horses, dogs, cats, or rabbits.
[0092] The cells may be collected from subjects with a variety of
disease statuses. The cells can be collected from a subject who is
free of an adverse health condition. In other cases, the subject is
suffering from, or at high risk of suffering from, a disease or
disorder, e.g., a chronic health condition such as cardiovascular
disease, eye disease (e.g., macular degeneration), auditory
disease, (e.g., deafness), diabetes, cognitive impairment,
schizophrenia, depression, bipolar disorder, dementia,
neurodegenerative disease, Alzheimer's Disease, Parkinson's
Disease, multiple sclerosis, osteoporosis, liver disease, kidney
disease, autoimmune disease, arthritis, or a proliferative disorder
(e.g., a cancer). In other cases, the subject is suffering from, or
at high risk of suffering from, an acute health condition, e.g.,
stroke, spinal cord injury, burn, or a wound. In certain cases, a
subject provides cells for his or her future use (e.g., an
autologous therapy), or for the use of another subject who may need
treatment or therapy (e.g., an allogeneic therapy). In some cases,
the donor and the recipient are immunohistologically compatible or
HLA-matched.
[0093] The cells to be induced can be obtained from a single cell
or a population of cells. The population may be homogeneous or
heterogeneous. The cells may be a population of cells found in a
human cellular sample, e.g., a biopsy or blood sample. Often, the
cells are somatic cells. The cells may be a cell line. In some
cases, the cells are derived from cells fused to other cells. In
some cases, the cells are not derived from cells fused to other
cells. In some cases, the cells are not derived from cells
artificially fused to other cells. In some cases, the cells are not
a cell that has undergone the procedure known as somatic cell
nuclear transfer (SCNT) or a cell descended from a cell that
underwent SCNT.
[0094] The cellular population may include both differentiated and
undifferentiated cells. In some cases, the population primarily
contains differentiated cells. In other cases, the population
primarily contains undifferentiated cells, e.g., undifferentiated
stem cells. The undifferentiated cells within the population may be
induced to become pluripotent or multipotent. In some cases,
differentiated cells within the cellular population are induced to
become pluripotent or multipotent.
[0095] The cellular population may include undifferentiated stem
cells or naive stem cells. In some cases, the undifferentiated stem
cells are stem cells that have not undergone epigenetic
inactivating modification by heterochromatin formation due to DNA
methylation or histone modification of at least four genes, at
least three genes, at least two genes, at least one gene, or none
of the following: Nanog, Oct3/4, Sox2 and Tert. Activation, or
expression of such genes, e.g., Tert, Nanog, Oct3/4 or Sox2, may
occur when human pluripotent stem cells are induced from
undifferentiated stem cells present in a human postnatal
tissue.
[0096] B. Collection of Cells
[0097] Methods for obtaining human somatic cells are well
established, as described in, e.g., Schantz and Ng (2004), A Manual
for Primary Human Cell Culture, World Scientific Publishing Co.,
Pte, Ltd. In some cases, the methods include obtaining a cellular
sample, e.g., by a biopsy (e.g., a skin sample), blood draw, or
alveolar or other pulmonary lavage. It is to be understood that
initial plating densities from of cells prepared from a tissue may
be varied based on such variable as expected viablility or
adherence of cells from that particular tissue. Methods for
obtaining various types of human somatic cells include, but are not
limited to, the following exemplary methods:
[0098] 1. Bone Marrow
[0099] The donor is given a general anesthetic and placed in a
prone position. From the posterior border of the ilium, a
collection needle is inserted directly into the skin and through
the iliac surface to the bone marrow, and liquid from the bone
marrow is aspirated into a syringe. The somatic stem cells are
enriched by isolating bone marrow cells from an osteogenic zone of
bone marrow. A mononuclear cell fraction is then prepared from the
aspirate by density gradient centrifugation. The collected crude
mononuclear cell fraction is then cultured prior to use in the
methods described herein for induction.
[0100] 2. Postnatal Skin
[0101] Skin tissue containing the dermis is harvested, for example,
from the back of a knee or buttock. The skin tissue is then
incubated for 30 minutes at 37.degree. C. in 0.6%
trypsin/Dulbecco's Modified Eagle's Medium (DMEM)/F-12 with 1%
antibiotics/antimycotics, with the inner side of the skin facing
downward.
[0102] After the skin tissue is turned over, tweezers are used to
lightly scrub the inner side of the skin. The skin tissue is finely
cut into 1 mm.sup.2 sections using scissors and is then centrifuged
at 1200 rpm and room temperature for 10 minutes. The supernatant is
removed, and 25 ml of 0.1% trypsin/DMEM/F-12/1% antibiotics,
antimycotics, is added to the tissue precipitate. The mixture is
stirred at 200-300 rpm using a stirrer at 37.degree. C. for 40
minutes. After confirming that the tissue precipitate is fully
digested, 3 ml fetal bovine serum (FBS) (manufactured by JRH) is
added, and filtered sequentially with gauze (Type I manufactured by
PIP), a 100 .mu.m nylon filter (manufactured by FALCON) and a 40
.mu.m nylon filter (manufactured by FALCON). After centrifuging the
resulting filtrate at 1200 rpm and room temperature for 10 minutes
to remove the supernatant, DMEM/F-12/1% antibiotics, antimycotics
is added to wash the precipitate, and then centrifuged at 1200 rpm
and room temperature for 10 minutes. The cell fraction thus
obtained is then cultured prior to induction.
[0103] Dermal stem cells can be enriched by isolating dermal
papilla from scalp tissue. Human scalp tissues (0.5-2 cm or less)
are rinsed, trimmed to remove excess adipose tissues, and cut into
small pieces. These tissue pieces are enzymatically digested in
12.5 mg/ml dispase (Invitrogen, Carlsbad, Calif.) in DMEM for 24
hours at 4.degree. C. After the enzymatic treatment, the epidermis
is peeled off from the dermis; and hair follicles are pulled out
from the dermis. Hair follicles are washed with phosphate-buffered
saline (PBS); and the epidermis and dermis are removed. A
microscope may be used for this procedure. Single dermal papilla
derived cells are generated by culturing the explanted papilla on a
plastic tissue culture dish in the medium containing DMEM and 10%
FCS for 1 week. When single dermal papilla cells are generated,
these cells are removed and cultured in FBM supplemented with FGM-2
SingleQuots (Lonza) or cultured in the presence of 20 ng/ml EGF, 40
ng/ml FGF-2, and B27 without serum.
[0104] Epidermal stem cells can be also enriched from human scalp
tissues (0.5-2 cm.sup.2 or less). Human scalp issues is rinsed,
trimmed to remove excess adipose tissues, and cut into small
pieces. These tissue pieces are enzymatically digested in 12.5
mg/ml dispase (Invitrogen, Carlsbad, Calif.) in Dulbecco's modified
Eagle's medium (DMEM) for 24 hours at 4.degree. C. After the
enzymatic treatment, the epidermis is peeled off from the dermis;
and hair follicles are pulled out from the dermis. The bulb and
intact outer root sheath (ORS) are dissected under the microscope.
After the wash, the follicles are transferred into a plastic dish.
Then the bulge region is dissected from the upper follicle using a
fine needle. After the wash, the bulge is transferred into a new
dish and cultured in medium containing DMEM/F12 and 10% FBS. After
the cells are identified, culture medium is changed to the
EpiLife.TM. Extended-Lifespan Serum-FreeMedium (Sigma).
[0105] 3. Postnatal Skeletal Muscle
[0106] After the epidermis of a connective tissue containing muscle
such as the lateral head of the biceps brachii muscle or the
sartorius muscle of the leg is cut and the muscle tissue is
excised, it is sutured. The whole muscle obtained is minced with
scissors or a scalpel, and then suspended in DMEM (high glucose)
containing 0.06% collagenase type IA and 10% FBS, and incubated at
37.degree. C. for 2 hours.
[0107] Cells are collected by centrifugation from the minced
muscle, and suspended in DMEM (high glucose) containing 10% FBS.
After passing the suspension through a microfilter with a pore size
of 40 .mu.m and then a microfilter with a pore size of 20 .mu.m,
the cell fraction obtained may be cultured as crude purified cells
containing undifferentiated stem cells, and used for the induction
of human pluripotent stem cells as described herein.
[0108] 4. Postnatal Adipose Tissue
[0109] Cells derived from adipose tissue for use in the present
invention may be isolated by various methods known to a person
skilled in the art. For example, such a method is described in U.S.
Pat. No. 6,153,432, which is incorporated herein in its entirety. A
preferred source of adipose tissue is omental adipose tissue. In
humans, adipose cells are typically isolated by fat aspiration.
[0110] In one method of isolating cells derived from adipose cells,
adipose tissue is treated with 0.01% to 0.5%, e.g., 004% to 0.2%,
0.1% collagenase; 0.01% to 0.5%, e.g., 0.04%, or 0.2% trypsin;
and/or 0.5 ng/ml to 10 ng/ml dispase, or an effective amount of
hyaluronidase or DNase (DNA digesting enzyme), and about 0.01 to
about 2.0 mM, e.g., about 0.1 to about 1.0 mM, or 0.53 mM
ethylenediaminetetraacetic acid (EDTA) at 25 to 50.degree. C.,
e.g., 33 to 40.degree. C., or 37.degree. C. for 10 minutes to 3
hours, e.g., 30 minutes to 1 hour, or 45 minutes.
[0111] Cells are passed through nylon or a cheese cloth mesh filter
of 20 microns to 800 microns, more preferably 40 microns to 400
microns, and most preferably 70 microns. Then the cells in the
culture medium are subjected to differential centrifugation
directly or using Ficoll or Percoll or another particle gradient.
The cells are centrifuged at 100 to 3000.times.g, more preferably
200 to 1500.times.g, most preferably 500.times.g for 1 minute to 1
hours, more preferably 2 to 15 minutes and most preferably 5
minutes, at 4 to 50.degree. C., preferably 20 to 40.degree. C. and
more preferably about 25.degree. C.
[0112] The adipose tissue-derived cell fraction thus obtained may
be cultured according to the method described herein as crude
purified cells containing undifferentiated stem cells, and used for
the induction of human pluripotent or multipotent stem cells.
[0113] 5. Blood
[0114] About 50 ml to about 500 ml vein blood or cord blood is
collected, and a mononuclear cell fraction is obtained by the
Ficoll-Hypaque method, as described in, e.g., Kanof et al., (1993),
Current Protocols in Immunology (J. E. Coligan, A. M. Kruisbeek, D.
H. Margulies, E. M. Shevack, and W. Strober, eds.), ch.
7.1.1.-7.1.5, John Wiley & Sons, New York).
[0115] After isolation of the mononuclear cell fraction,
approximately 1.times.10.sup.7 to 1.times.10.sup.8 human peripheral
blood mononuclear cells are suspended in a RPMI 1640 medium
containing 10% fetal bovine serum, 100 .mu.g/ml streptomycin and
100 units/ml penicillin, and after washing twice, the cells are
recovered. The recovered cells are resuspended in RPMI 1640 medium
and then plated in a 100 mm plastic petri dish at a density of
about 1.times.10.sup.7 cells/dish, and incubated in a 37.degree. C.
incubator at 8% CO.sub.2. After 10 minutes, cells remaining in
suspension are removed and adherent cells are harvested by
pipetting. The resulting adherent mononuclear cell fraction is then
cultured prior to the induction period as described herein. In some
cases, the peripheral blood-derived or cord blood-derived adherent
cell fraction thus obtained may be cultured according to the method
described herein as crude purified cells containing
undifferentiated stem cells, and used for the induction of human
pluripotent or multipotent stem cells.
[0116] Macrophages in the peripheral blood can be enriched by
culturing the mononuclear cell fraction in low-glucose DMEM
supplemented with 10% heat-inactivated fetal bovine serum (FBS; JRH
Biosciences, Lenexa, Kans.), 2 mM L-glutamine, 50 U/ml penicillin,
and 50 .mu.g/ml streptomycin. In order to expand macrophages,
peripheral blood mononuclear cells are spread at a density of
2.times.10.sup.6/ml on plastic plates that have been treated with
10 .mu.g/ml FN (Sigma, St. Louis, Mo.) overnight at 4.degree. C.
The cells are then cultured without any additional growth factors
at 37.degree. C. and 5% CO2 in a humidified atmosphere. The medium
containing floating cells is changed every 3 days. Macrophages with
observable fibroblastic features may be used for the induction
experiments.
[0117] In some cases, a cell fraction from peripheral blood, cord
blood, or bone marrow is expanded, as described in U.S. patent
application Ser. No. 11/885,112, and then used in the induction
methods described herein.
III. Induction
[0118] A. Overview
[0119] During the induction process, forced expression of certain
polypeptides is carried out in cultured cells for a period of time,
after which the induced cells are screened for a number of
properties that characterize multipotent and pluripotent stem cells
(e.g., morphological, gene expression). Induced cells that meet
these screening criteria may then be subcloned and expanded. In
some cases, the cells to be induced may be cultured for a period of
time prior to the induction procedure. Alternatively, the cells to
be induced may be used directly in the induction process without a
prior culture period. In some cases, different cell culture media
are used at different points prior to, during, and after the
induction process. For example, one type of culture medium may be
used after collection of tissue and/or directly before the
induction process, while a second type of media is used during
and/or after the induction process. At times, a third type of
culture medium is used during and/or after the induction
process.
[0120] B. Cell Culture
[0121] After collection, tissue or cellular samples can be cultured
in any medium suitable for the specific cells or tissue collected.
Some representative media that the tissue or cells can be cultured
in include but are not limited to: multipotent adult progenitor
cell (MAPC) medium; FBM (manufactured by Lonza); Embryonic Stem
cell (ES) ES medium; Mesenchymal Stem Cell Growth Medium (MSCGM)
(manufactured by Lonza); MCDB202 modified medium; Endothelial Cell
Medium kit-2 (EBM2) (manufactured by Lonza); Iscove's Modified
Dulbecco's Medium (IMDM) (Sigma); Dulbecco's Modified Eagle Medium
(DMEM); MEF-conditioned ES (MC-ES); and mTeSR.TM. (available, e.g.,
from StemCell Technologies, Vancouver, Canada), See, e.g., Ludwig
et al., (2006), Nat Biotechnol., 24(2):185-187. In other cases,
alternative culture conditions for growth of human ES cells are
used, as described in, e.g., Skottman et al., (2006), Reproduction,
132(5):691-698.
[0122] MAPC (2% FBS) medium may comprise: 60% Dulbecco's Modified
Eagle's Medium-low glucose, 40% MCDB 201, Insulin Transferrin
Selenium supplement, (0.01 mg/ml insulin; 0.0055 mg/ml transferrin;
0.005 .mu.g/ml sodium selenite), 1.times. linolenic acid albumin (1
mg/mL albumin; 2 moles linoneic acid/mole albumin), 1 nM
dexamethasone, 2% fetal bovine serum, 1 nM dexamethasone, 10.sup.-4
M ascorbic acid, and 10 .mu.g/ml gentamycin
[0123] FBM (2% FBS) medium may comprise: MCDB202 modified medium,
2% fetal bovine serum, 5 .mu.g/ml insulin, 50 mg/ml gentamycin, and
50 ng/ml amphotericin-B.
[0124] ES medium may comprise: 40% Dulbecco's Modified Eagle's
Medium (DMEM) 40% F12 medium, 2 mM L-glutamine, 1.times.
non-essential amino acids (Sigma, Inc., St. Louis, Mo.), 20%
Knockout Serum Replacement.TM. (Invitrogen, Inc., Carlsbad,
Calif.), and 10 .mu.g/ml gentamycin.
[0125] MC-ES medium may be prepared as follows. ES medium is
conditioned on mitomycin C-treated murine embryonic fibroblasts
(MEFs), for 20 to 24 hours, harvested, filtered through a
0.45-.mu.M filter, and supplemented with about 0.1 mM
.beta.-mercaptoethanol, about 10 ng/ml bFGF or FGF-2, and,
optionally, about 10 ng/ml activin A. In some cases, irradiated
MEFs are used in place of the mitomycin C-treated MEFs. In other
cases, STO (ATCC) or human fibroblast cells are used in place of
the MEFs.
[0126] Cells may be cultured in medium supplemented with a
particular serum. In some embodiments, the serum is fetal bovine
serum (FBS). The serum can also be fetal calf serum (FCS). In some
cases, the serum may be human serum (e.g., human AB serum).
Mixtures of serum may also be used, e.g. mixture of FBS and Human
AB, FBS and FCS, or FCS and Human AB.
[0127] After collection of tissue and preparation of cells, it may
be useful to promote the expansion of tissue stem cells or
progenitor cells that may be present among the prepared cells by
use of suitable culture conditions. In some cases, a low-serum
culture or serum-free medium (as described herein) may facilitate
the expansion of tissue stem cells or progenitor cells. Suitable
culture media include, but are not limited to, MAPC, FBM, or
MSCGM.
[0128] Primary culture ordinarily occurs immediately after the
cells are isolated from a donor, e.g., human. The cells can also be
sub-cultured after the primary culture. A "second" subculture
describes primary culture cells subcultured once, a "third"
subculture describes primary cultures subcultured twice, a "fourth"
subculture describes primary cells subcultured three times, etc. In
some cases, the primary cells are subjected to a second subculture,
a third subculture, or a fourth subculture. In some cases, the
primary cells are subjected to less than four subcultures. The
culture techniques described herein may generally include culturing
from the period between the primary culture and the fourth
subculture, but other culture periods may also be employed.
Preferably, cells are cultured from the primary culture to the
second subculture. In some cases, the cells may be cultured for
about 1 to about 12 days e.g., 2 days, 3 days, 4.5 days, 5 days,
6.5 days, 7 days, 8 days, 9 days, 10 days, or any other number of
days from about 1 day to about 12 days prior to undergoing the
induction methods described herein. In other cases, the cells may
be cultured for more than 12 days, e.g. from about 12 days to about
20 days; from about 12 days to about 30 days; or from about 12 days
to about 40 days. In some embodiments, the cells to be induced are
passaged four or fewer times (e.g., 3, 2, 1, or 0 times) prior to
induction.
[0129] In some cases, prior to induction cells are cultured at a
low density, e.g., from about 1.times.10.sup.3 cells/cm.sup.2 to
about 1.times.10.sup.4 cells/cm.sup.2. In other cases, prior to
induction (e.g., just prior to induction), cells are cultured at a
density of about 1.times.10.sup.3 cells/cm.sup.2 to about
3.times.10.sup.4 cells/cm.sup.2; or from about 1.times.10.sup.4
cells/cm.sup.2 to about 3.times.10.sup.4 cells/cm.sup.2.
[0130] Often the cells and/or tissue are cultured in a first
medium, as described above, prior to and/or during the introduction
of induction factors to the cells; and then the cells are cultured
in a second or third medium during and/or after the introduction of
the induction factors to the cells. The second or third medium may
be MEF-Conditioned (MC)-ES, mTeSR1.TM. medium, or other ES cell
medium, as described in, e.g., Skottman et al., (2006),
Reproduction, 132(5):691-698.
[0131] In many examples, the cells are cultured in MAPC, FBM or
MSCGM medium prior to the initiation of forced expression of genes
or polypeptides in the cells (e.g., immediately after a retroviral
infection period); and then, following the initiation of the forced
expression, the cells are cultured in MC-ES medium, mTeSR1.TM.
medium, or other ES cell medium as described herein.
[0132] Culture of cells may be carried out under low serum culture
conditions prior to, during, or following the introduction of
induction factors. A "low serum culture condition" refers to the
use of a cell culture medium containing a concentration of serum
ranging from 0% (v/v) (i.e., serum-free) to about 5% (v/v), e.g.,
0% to 2%, 0% to 2.5%, 0% to 3%, 0% to 4%, 0% to 5%, 0.1% to 2%,
0.1% to 5%, 0%, 0.1%, 0.5%, 1%, 1.2%, 1.5%, 2%, 2.5%, 3%, 3.5%, 4%,
or 5%. In some embodiments, a low serum concentration is from about
0% (v/v) to about 2% (v/v). In some cases, the serum concentration
is about 2%. In other embodiments, cells are cultured under a "high
serum condition," i.e., greater than 5% (v/v) serum to about 20%
(v/v) serum, e.g., 6%, 7%, 8%, 10%, 12%, 15%, or 20%. Culturing
under high serum conditions may occur prior to, during, and/or
after the introduction of induction factors. Media with low
concentrations of serum may be particularly useful to enrich
undifferentiated stem cells. For example, MSCs are often obtained
by isolating the non-hematopoietic cells (e.g., interstitial cells)
adhering to a plastic culture dish when tissue, e.g., bone marrow,
fat, muscle, or skin etc., is cultured in a culture medium
containing a high-concentration serum (5% or more). However, even
under these culture conditions, a very small number of
undifferentiated cells can be maintained, especially if the cells
were passaged under certain culture conditions (e.g., low passage
number, low-density culturing or low oxygen).
[0133] When either low or high serum conditions are used for
culturing the cells, one or more growth factors such as fibroblast
growth factor (FGF)-2; basic FGF (bFGF); platelet-derived growth
factor (PDGF), epidermal growth factor (EGF); insulin-like growth
factor (IGF); IGF II; or insulin can be included in the culture
medium. Other growth factors that can be used to supplement cell
culture media include, but are not limited to one or more:
Transforming Growth Factor .beta.-1 (TGF .beta.-1), Activin A,
Noggin, Brain-derived Neurotrophic Factor (BDNF), Nerve Growth
Factor (NGF), Neurotrophin (NT)-1, NT-2, or NT-3. In some cases,
one or more of such factors is used in place of the bFGF or FGF-2
in the MC-ES medium or other cell culture medium.
[0134] The concentration of growth factor(s) (e.g., FGF-2, bFGF,
PDGF, EGF, IGF, insulin, IGF II, TGF .beta.-1, Activin A, Noggin,
BDNF, NGF, NT-1, NT-2, NT-3) in the culture media described herein
(e.g., MAPC, FBM, MC-ES, MSCGM, IMDM, mTeSR1.TM.) may be from about
4 ng/ml to about 50 ng/ml, e.g., about 2 ng/ml, 3 ng/ml, 4 ng/ml, 5
ng/ml, 6 ng/ml, 7 ng/ml, 8 ng/ml, 10 ng/ml, 12 ng/ml, 14 ng/ml, 15
ng/ml, 17 ng/ml, 20 ng/ml, 25 ng/ml, 30 ng/ml, 35 ng/ml, 40 ng/ml,
45 ng/ml, or 50 ng/ml. The concentration of growth factors may also
be from about 4 ng/ml to about 10 ng/ml; from about 4 ng/ml to
about 20 ng/ml; from about 10 ng/ml to about 30 ng/ml; from about 5
ng/ml to about 40 ng/ml; or from about 10 ng/ml to about 50 ng/ml.
In other cases, higher concentrations of growth factors may be
used, e.g., from about 50 ng/ml to about 100 ng/ml; or from about
50 ng/ml to about 75 ng/ml.
[0135] The growth factors may be used alone or in combination. For
example, FGF-2 may be added alone to the medium; in another
example, both PDGF and EGF are added to the culture medium. Often,
growth factors appropriate for a particular cell type may be used.
For example, dermal cells may be cultured in the presence of about
20 ng/ml EGF and/or about 40 ng/ml FGF-2, while epidermal cells may
be cultured in the presence of about 50 ng/ml EGF and/or 5 ug/ml
Insulin.
[0136] The induced cells may be maintained in the presence of a
rho, or rho-associated, protein kinase (ROCK) inhibitor to reduce
apoptosis. A ROCK inhibitor may be particularly useful when the
cells are subjected to a harsh treatment, such as an enzymatic
treatment. For example, the addition of Y-27632 (Calbiochem; water
soluble) or Fasudil (HA1077: Calbiochem), an inhibitor of Rho
associated kinase (Rho associated coiled coil-containing protein
kinase) may be used to culture the human pluripotent and
multipotent stem cells of the present invention. In some cases the
concentration of Y-27632 or Fasudil, is from about 2.5 .mu.M to
about 20 .mu.M, e.g., about 2.5 .mu.M, 5 .mu.M, 10 .mu.M, 15 .mu.M,
or 20 .mu.M.
[0137] The induced cells may be cultured in a maintenance culture
medium in a 37.degree. C., 5% CO.sub.2 incubator (e.g., under an
atmospheric oxygen level), with medium changes preferably every
day. In some embodiments, in order to culture and grow human
pluripotent stem cells induced from the undifferentiated stem cells
of the present invention present in a human postnatal tissue, it is
preferred that the cells are subcultured every 5 to 7 days in a
culture medium containing the additives described herein on a
MEF-covered plastic culture dish or a matrigel-coated plastic
culture dish. Examples of maintenance culture media for induced
cells include any and all complete ES cell media (e.g., MC-ES). The
maintenance culture medium may be supplemented with b-FGF or FGF2.
In some cases, the maintenance culture medium is supplemented with
other factors, e.g., IGF-II, Activin A or other growth factor
described herein, see, e.g., Bendall et al., (2007), Nature,
30:448(7157):1015-21. In some embodiments, the induced cells are
cultured and observed for about 14 days to about 40 days, e.g., 15,
16, 17, 18, 19, 20, 23, 24, 27, 28, 29, 30, 31, 33, 34, 35, 36, 37,
38 days, or other period from about 14 days to about 40 days, prior
to identifying and selecting candidate multipotent or pluripotent
stem cell colonies based on morphological characteristics.
[0138] Morphological characteristics for identifying candidate
multipotent or pluripotent stem cell colonies include, but are not
limited to, a rounder, smaller cell size relative to surrounding
cells and a high nucleus-to-cytoplasm ratio. The size of the
candidate induced cell may be from about 5 .mu.m to about 10 .mu.m;
from about 5 .mu.m to about 15 .mu.m; from about 5 .mu.m to about
30 .mu.m; from about 10 .mu.m to about 30 .mu.m; or from about 20
.mu.m to about 30 .mu.m. A high nucleus-to-cytoplasm ratio may be
from about 1.5:1 to about 10:1, e.g., about 1.5:1; about 2:1; about
3:1; about 4:1; about 5:1; about 7:1; about 8:1; about 9.5:1; or
about 10:1. In some cases, the induced cell clones display a
flattened morphology relative to mouse ES cells. For example,
candidate induced cells derived from peripheral blood cells or from
cells cultured in feeder-free media may exhibit a flattened
morphology compared to surrounding cells. Another morphological
characteristic for identifying induced cell clones is the formation
of small monolayer colonies within the space between parental cells
(e.g., between fibroblasts).
[0139] The induced cells can be plated and cultured directly on
tissue culture-grade plastic. Alternatively, cells are plated and
cultured on a coated substrate, e.g., a substrate coated with
fibronectin, gelatin, Matrigel.TM. (BD Bioscience), collagen, or
laminin. In some cases, untreated petri-dishes may be used.
Suitable cell culture vessels include, e.g., 35 mm, 60 mm, 100 mm,
and 150 mm cell culture dishes, 6-well cell culture plates, and
other size-equivalent cell culture vessels. In some cases, the
cells are cultured with feeder cells. For example, the cells may be
cultured on a layer, or carpet, of MEFs (e.g., irradiated or
mitomycin-treated MEFs).
[0140] Typically, the induced cells may be plated (or cultured) at
a low density, which may be accomplished by splitting the cells
from about 1:8 to about 1:3, e.g., about 1:8; about 1:6; about 1:5;
about 1:4; or about 1:3. Cells may be plated at a density of from
about 10.sup.3 cells/cm.sup.2 to about 10.sup.4 cells/cm.sup.2. In
some examples, the cells may be plated at a density of from about
1.5.times.10.sup.3 cells/cm.sup.2 to about 10.sup.4 cells/cm.sup.2;
from about 2.times.10.sup.3 cells/cm.sup.2 to about 10.sup.4
cells/cm.sup.2; from about 3.times.10.sup.3 cells/cm.sup.2 to about
10.sup.4 cells/cm.sup.2; from about 4.times.10.sup.3 cells/cm.sup.2
to about 10.sup.4 cells/cm.sup.2; or from about 10.sup.3
cells/cm.sup.2 to about 9.times.10.sup.3 cells/cm.sup.2. In some
embodiments, the cells may be plated at a density greater than
10.sup.4 cells/cm.sup.2, e.g., from about 1.25.times.10.sup.4
cells/cm.sup.2 to about 3.times.10.sup.4 cells/cm.sup.2.
[0141] C. Induction Factors
[0142] Inducing a cell to become multipotent or pluripotent can be
accomplished in a number of ways. In some embodiments, the methods
for induction of pluripotency or multipotency in one or more cells
include forcing expression of a set of induction factors. Forced
expression may include introducing expression vectors encoding
polypeptides of interest into cells, introducing exogenous purified
polypeptides of interest into cells, or contacting cells with a
non-naturally occurring reagent that induces expression of an
endogenous gene encoding a polypeptide of interest.
[0143] In some cases, the set of IFs includes one or more: an
Oct3/4 polypeptide, a Sox2 polypeptide, a Klf4 polypeptide, or a
c-Myc polypeptide. In some cases, the set does not include a c-Myc
polypeptide. For example, the set of IFs can include one or more
of: an Oct3/4 polypeptide, a Sox2 polypeptide, and a Klf4
polypeptide, but not a c-Myc polypeptide. In some cases, the set of
IFs does not include polypeptides that might increase the risk of
cell transformation or the risk of inducing cancer. The ability of
c-Myc to induce cell transformation has been described, see, e.g.,
Adhikary et al., (2005), Nat. Rev. Mol Cell Biol.,
6(8):635-645.
[0144] In some cases, the set includes a c-Myc polypeptide. In
certain cases, the c-Myc polypeptide is a constitutively active
variant of c-Myc. In some instances, the set includes a c-Myc
polypeptide capable of inducible activity, e.g., a c-Myc-ER
polypeptide, see, e.g., Littlewood, et al., (1995), Nucleic Acid
Res., 23(10):1686-90.
[0145] In other cases, the set of IFs includes: an Oct3/4
polypeptide, a Sox2 polypeptide, and a Klf4 polypeptide, but not a
TERT polypeptide, a SV40 Large T antigen polypeptide, HPV16 E6
polypeptide, a HPV16 E7 polypeptide, or a Bmi1 polypeptide. In some
cases, the set of IFs does not include a TERT polypeptide. In some
cases, the set of IFs does not include a SV40 Large T antigen. In
other cases, the set of IFS does not include a HPV16 E6 polypeptide
or a HPV16 E7 polypeptide.
[0146] In some cases, the set of IFs includes three IFs, wherein
two of the three IFs are an Oct3/4 polypeptide and a Sox2
polypeptide. In other cases, the set of IFs includes two IFs, e.g.,
a c-Myc polypeptide and a Sox2 polypeptide or an Oct3/4 and a Klf4
polypeptide. In some cases, the set of IFs is limited to Oct 3/4,
Sox2, and Klf4 polypeptides. In other cases, the set of IFs may be
limited to a set of four IFs: an Oct3/4 polypeptide, a Sox2
polypeptide, a Klf4 polypeptide, and a c-Myc polypeptide.
[0147] A set of IFs may include IFs in addition to an Oct 3/4, a
Sox2, and a Klf4 polypeptide. Such additional IFs include, but are
not limited to Nanog, TERT, LIN28, CYP26A1, GDF3, FoxD3, Zfp42,
Dnmt3b, Ecat1, and Tc11 polypeptides. In some cases, the set of
additional IFs does not include a c-Myc polypeptide. In some cases,
the set of additional IFs does not include polypeptides that might
increase the risk of cell transformation or of inducing cancer.
[0148] Forced expression of IFs may be maintained for a period of
at least about 7 days to at least about 40 days, e.g., 8 days, 9
days, 10 days, 11 days, 12 days, 13 days, 14 days, 15 days, 16
days, 17 days, 18 days, 19 days, 20 days, 21 days, 25 days, 30
days, 33 days, or 37 days.
[0149] The efficiency of inducing pluripotency in cells of a human
population of cells is from at least about 0.001% to at least about
0.1% of the total number of parental cells cultured initially,
e.g., 0.002%, 0.0034%, 0.004%, 0.005%, 0.0065%, 0.007%, 0.008%,
0.01%, 0.04%, 0.06%, 0.08%, or 0.09%. At times, depending on the
age of the donor, the origin of the tissue, or the culture
conditions, higher efficiencies may be achieved.
[0150] D. HDAC Inhibitor
[0151] Induction of the cells may be accomplished by combining
histone deacetylase (HDAC) inhibitor treatment with forced
expression of sets of IFs. The cells to be induced may be
undifferentiated stem cells present in a human postnatal tissue. In
other cases, the cells to be induced are differentiated cells or
are a mixture of differentiated and undifferentiated cells.
[0152] The HDAC may be combined with the forced expression of a
specific set of IFs, e.g., Oct3/4, Sox2, and Klf4. For example, a
human somatic cell is induced to become pluripotent after HDAC
inhibitor treatment is combined with forced expression of Oct3/4,
Sox2 and Klf4 or forced expression of Oct3/4, Sox2, Klf4, and
c-Myc. In some cases, human pluripotent stem cells can be induced
by introducing three genes (e.g., Oct3/4, Sox2 and Klf4) or three
genes (e.g., Oct3/4, Sox2 and Klf4) plus the c-Myc gene or a HDAC
inhibitor into undifferentiated stem cells present in a human
postnatal tissue in which each gene of Tert, Nanog, Oct3/4 and Sox2
has not undergone epigenetic inactivation. In still other cases,
human pluripotent stem cells are induced by introducing three genes
(e.g., Oct3/4, Sox2 and Klf4) or three genes (e.g., Oct3/4, Sox2
and Klf4) plus the c-Myc gene or a histone deacetylase inhibitor
into undifferentiated stem cells after the undifferentiated stem
cells were amplified by a primary culture or a second subculture,
or a subculture in a low density and subculturing in a culture
medium comprising a low-concentration serum.
[0153] Cells may be treated with one or more HDACs for about 2
hours to about 5 days, e.g., 3 hours, 6 hours, 12 hours, 14 hours,
18 hours, 1 day, 2 days, 3 days, or 4 days. Treatment with HDAC
inhibitor may be initiated prior to beginning forced expression of
IFs in the cells. In some cases, HDAC inhibitor treatment begins
during or after forced expression of IFs in the cells. In other
cases, HDAC inhibitor treatment begins prior to forced expression
and is maintained during forced expression.
[0154] Suitable concentrations of an HDAC inhibitor range from
about 0.001 nM to about 10 mM, depending on the particular HDAC
inhibitor to be used, but are selected so as to not significantly
decrease cell survival in the treated cells. The HDAC concentration
may range from 0.01 nM, to 1000 nM. In some embodiments, the HDAC
concentration ranges from about 0.01 nM to about 1000 nM, e.g.,
about 0.05 nM, 0.1 nM, 0.5 nM, 0.75 nM, 1.0 nM, 1.5 nM, 10 nM, 20
nM, 40 nM, 50 nM, 100 nM, 200 nM, 300 nM, 500 nM, 600 nM, 700 nM,
800 nM, or other concentration from about 0.01 nM to about 1000 nM.
Cells are exposed for 1 to 5 days or 1 to 3 days. For example,
cells are exposed 1 day, 2 days, 3 days, 4 days or 5 days.
[0155] Multiple varieties of HDAC inhibitors can be used for the
induction experiments. In a preferred embodiment, the HDAC
inhibitor MS-275 is used. Examples of suitable HDAC inhibitors
include, but are not limited to, any the following:
[0156] A. Trichostatin A and its analogs, for example: trichostatin
A (TSA); and trichostatin C (Koghe et al., (1998), Biochem.
Pharmacol, 56:1359-1364).
[0157] B. Peptides, for example: oxamflatin
[(2E)-5-[3-[(phenylsulfonyl)aminophenyl]-pent-2-ene-4-inohydroxamic
acid (Kim et al., (1999), Oncogene, 18:2461-2470); Trapoxin A
(cylco-(L-phenylalanyl-L-phenylalanyl-D-pipecolinyl-L-2-amino-8-oxo-9,10--
epoxy-decanoyl) (Kijima et al., (1993), J. Biol. Chem.
268:22429-22435); FR901228, depsipeptide (Nakajima et al., (1998).
Ex. Cell Res., 241:126-133); FR225497, cyclic tetrapeptide (H. Mori
et al., (2000), PCT International Patent Publication WO 00/08048);
apicidin, cyclic tetrapeptide
[cyclo-(N--O-methyl-L-tryptophanyl-L-isoleucinyl-D-pipecolinyl-L-2-amino--
8-oxodecanoyl)] (Darkin-Rattray et al., (1996), Proc. Natl. Acad.
Sci. U.S.A., 93:13143-13147; apicidin Ia, apicidin Ib, apicidin Ic,
apicidin IIa, and apicidin IIb (P. Dulski et al., PCT International
Patent Publication WO 97/11366); HC-toxin, cyclic tetrapeptide
(Bosch et al., (1995), Plant Cell, 7:1941-1950); WF27082, cyclic
tetrapeptide (PCT International Patent Publication WO 98/48825);
and chlamydocin (Bosch et al., supra).
[0158] C. Hybrid polar compounds (HPC) based on hydroxamic acid,
for example: salicyl hydroxamic acid (SBHA) (Andrews et al.,
(2000), International J. Parasitology, 30:761-8); suberoylanilide
hydroxamic acid (SAHA) (Richon et al., (1998), Proc. Natl. Acad.
Sci. U.S.A., 95: 3003-7); azelaic bishydroxamic acid (ABHA)
(Andrews et al., supra); azelaic-1-hydroxamate-9-anilide (AAHA)
(Qiu et al., (2000), Mol. Biol. Cell, 11:2069-83); M-carboxy
cinnamic acid bishydroxamide (CBHA) (Ricon et al., supra);
6-(3-chlorophenylureido) carpoic hydroxamic acid, 3-Cl-UCHA)
(Richon et al., supra); MW2796 (Andrews et al., supra); and MW2996
(Andrews et al., supra).
[0159] D. Short chain fatty acid (SCFA) compounds, for example:
sodium butyrate (Cousens et al., (1979), J. Biol. Chem.,
254:1716-23); isovalerate (McBain et al., (1997), Biochem. Pharm.,
53:1357-68); valproic acid; valerate (McBain et al., supra);
4-phenyl butyric acid (4-PBA) (Lea and Tulsyan, (1995), Anticancer
Research, 15:879-3); phenyl butyric acid (PB) (Wang et al., (1999),
Cancer Research 59: 2766-99); propinate (McBain et al., supra);
butylamide (Lea and Tulsyan, supra); isobutylamide (Lea and
Tulsyan, supra); phenyl acetate (Lea and Tulsyan, supra);
3-bromopropionate (Lea and Tulsyan, supra); tributyrin (Guan et
al., (2000), Cancer Research, 60:749-55); arginine butyrate;
isobutyl amide; and valproate.
[0160] E. Benzamide derivatives, for example: MS-275
[N-(2-aminophenyl)-4-[N-(pyridine-3-yl-methoxycarbonyl)aminomethyl]benzam-
ide] (Saito et al., (1999), Proc. Natl. Acad. Sci. U.S.A.,
96:4592-7); and a 3'-amino derivative of MS-275 (Saito et al.,
supra); and CI-994.
[0161] A histone deacetylase inhibitor treatment may be carried
out, for example, as follows. The concentration of the HDAC
inhibitor may depend on a particular inhibitor, but is preferably
0.001 nM to about 10 mM, and more preferably about 0.01 nM to about
1000 nM. The effective amount or the dosage of a histone
deacetylase inhibitor is defined as the amount of the histone
deacetylase inhibitor that does not significantly decrease the
survival rate of cells, specifically undifferentiated stem cells.
Cells are exposed for 1 to 5 days or 1 to 3 days. The exposure
period may be less than one day. In a specific embodiment, cells
are cultured for about 1 to 5 days, and then exposed to an
effective amount of a histone deacetylase inhibitor. However, the
histone deacetylase inhibitor may be added at the start of
culturing. Within such a time frame, a gene-carrying vehicle such
as a vector containing a nucleic acid encoding three genes (Oct3/4,
Sox2 and Klf4) is introduced into cultured cells by a known
method.
[0162] E. IF Expression Vectors
[0163] Forced expression of the IFs may comprise introducing one or
more mammalian expression vectors encoding an Oct3/4, a Sox2, and a
Klf4 polypeptide to a population of cells. The IFs may be
introduced into the cells as exogenous genes. In some cases, the
exogenous genes are integrated into the genome of a host cell and
its progeny. In other cases, the exogenous genes persist in an
episomal state in the host cell and its progeny. Exogenous genes
are genes that are introduced to the cell from an external source.
A gene as used herein is a nucleic acid that normally includes an
open reading frame encoding a polypeptide of interest, e.g., an IF.
The gene preferably includes a promoter operably linked to an open
reading frame. In some cases, a natural version of the gene may
already exist in the cell but an additional "exogenous gene" is
added to the cell to induce polypeptide expression.
[0164] The one or more mammalian expression vectors may be
introduced into greater than 20% of the total population of cells,
e.g., 25%, 30%, 35%, 40%, 44%, 50%, 57%, 62%, 70%, 74%, 75%, 80%,
90%, or other percent of cells greater than 20%. A single mammalian
expression vector may contain two or more of the just-mentioned
IFs. In other cases, one or more expression vectors encoding an Oct
3/4, Sox2, Klf4, and c-Myc polypeptide are used. In some
embodiments, each of the IFs to be expressed is encoded on a
separate mammalian expression vector.
[0165] In some cases, the IFs are genetically fused in frame with a
transport protein amino acid sequence, e.g., that of a VP22
polypeptide as described in, e.g., U.S. Pat. Nos. 6,773,920,
6,521,455, 6,251,398, and 6,017,735. In particular, VP22
polypeptide encompasses polypeptides corresponding to amino acids
60-301 and 159-301 of the full HSV1 VP22 sequence (1-301), whose
sequence is disclosed in FIG. 4 in WO 97/05265. Homologous proteins
and fragments based on sequences of VP22 protein homologues from
other herpes viruses are described in U.S. Pat. No. 6,017,735. Such
VP22 sequences confer intercellular transport of VP22 fusion
polypeptides from cells that have been transfected with a VP22
fusion polypeptide expression vector to neighboring cells that have
not been transfected or transduced. See, e.g., Lemken et al.,
(2007), Mol. Ther., 15(2):310-319. Accordingly, the use of vectors
encoding IF-VP22 fusion polypeptides can significantly increase the
functional efficiency of transfected mammalian expression vectors
in the induction methods described herein.
[0166] Examples of suitable mammalian expression vectors include,
but are not limited to: recombinant viruses, nucleic acid vectors,
such as plasmids, bacterial artificial chromosomes, yeast
artificial chromosomes, human artificial chromosomes, cDNA, cRNA,
and PCR product expression cassettes. Examples of suitable
promoters for driving expression of IFs include, but are not
limited to, retroviral LTR elements; constitutive promoters such as
CMV, HSV1-TK, SV40, EF-1.alpha., .beta.-actin; PGK, and inducible
promoters, such as those containing Tet-operator elements. In some
cases, one or more of the mammalian expression vectors encodes, in
addition to an IF, a marker gene that facilitates identification or
selection of cells that have been transfected or infected. Examples
of marker genes include, but are not limited to, genes encoding
fluorescent proteins, e.g., EGFP, DS-Red, YFP, and CFP; genes
encoding proteins conferring resistance to a selection agent, e.g.,
the neo.sup.R gene, and the blasticidin resistance gene.
[0167] 1. Recombinant Viruses
[0168] Forced expression of an IF may be accomplished by
introducing a recombinant virus carrying DNA or RNA encoding an IF
to one or more cells. For ease of reference, at times a virus will
be referred to herein by the IF it is encoding. For example, a
virus encoding an Oct3/4 polypeptide, may be described as an
"Oct3/4 virus." In certain cases, a virus may encode more than one
copy of an IF or may encode more than one IF, e.g., two IFs, at a
time.
[0169] Combinations or sets of recombinant viruses may be
introduced to the cells for force expression of various sets of
IFs. In some cases, the set of IFs expressed by the recombinant
viruses includes one or more: an Oct3/4 polypeptide, a Sox2
polypeptide, a Klf4 polypeptide, or a c-Myc polypeptide. In some
cases, the set does not include a c-Myc polypeptide. For example,
the set of IFs can include: an Oct3/4 polypeptide, a Sox2
polypeptide, and a Klf4 polypeptide, but not a c-Myc polypeptide.
In some cases, the set of IFs does not include polypeptides that
might increase the risk of cell transformation or the risk of
inducing cancer. The ability of c-Myc to induce cell transformation
has been described, see, e.g., Adhikary et al., (2005), Nat. Rev.
Mol. Cell Biol., 6(8):635-645.
[0170] In some cases, the set of IFs to be expressed includes a
c-Myc polypeptide. In certain cases, the c-Myc polypeptide is a
constitutively active variant of c-Myc. In some instances, the set
includes a c-Myc polypeptide capable of inducible activity, e.g., a
c-Myc-ER polypeptide, see, e.g., Littlewood, et al., (1995),
Nucleic Acid Res., 23(10): 1686-90.
[0171] In other cases, the set of IFs to be expressed includes: an
Oct3/4 polypeptide, a Sox2 polypeptide, and a Klf4 polypeptide, but
not a TERT polypeptide, a SV40 Large T antigen polypeptide, HPV16
E6 polypeptide, a HPV16 E7 polypeptide, or a Bmi1 polypeptide. In
some cases, the set of IFs does not include a TERT polypeptide. In
some cases, the set of IFs does not include a SV40 Large T antigen.
In other cases, the set of IFS does not include a HPV16 E6
polypeptide or a HPV16 E7 polypeptide.
[0172] In some cases, the set of IFs includes three IFs, wherein
two of the three IFs are an Oct3/4 polypeptide and a Sox2
polypeptide. In other cases, the set of IFs includes two IFs,
wherein the two polypeptides are a c-Myc polypeptide and a Sox2
polypeptide. In some cases, the set of IFs is limited to Oct 3/4,
Sox2, and Klf4 polypeptides. In other cases, the set of IFs may be
limited to a set of four IFs: an Oct3/4 polypeptide, a Sox2
polypeptide, a Klf4 polypeptide, and a c-Myc polypeptide.
[0173] A set of IFs may include IFs in addition to an Oct 3/4, a
Sox2, and a Klf4 polypeptide. Such additional IFs include, but are
not limited to Nanog, TERT, LIN28, CYP26A1, GDF3, FoxD3, Zfp42,
Dnmt3b, Ecat1, and Tcl1 polypeptides. In some cases, the set of
additional IFs does not include a c-Myc polypeptide. In some cases,
the set of additional IFs does not include polypeptides that might
increase the risk of cell transformation or of inducing cancer.
[0174] Individual viruses may be added to the cells sequentially in
time or simultaneously. In some cases, at least one virus, e.g., an
Oct3/4 virus, a Sox2 virus, a Klf4 virus, or a c-Myc virus, is
added to the cells at a time different from the time when one or
more other viruses are added. In some examples, the Oct3/4 virus,
Sox2 virus and KlF4 virus are added to the cells simultaneously, or
very close in time, and the c-Myc virus is added at a time
different from the time when the other viruses are added.
[0175] At least two recombinant viruses may be added to the cells
simultaneously or very close in time. In some examples, Oct3/4
virus and Sox2 virus are added simultaneously, or very close in
time, and the Klf4 virus or c-Myc virus is added at a different
time. In some examples, Oct3/4 virus and Sox2 virus; Oct3/4 virus
and Klf4 virus; Oct3/4 virus and c-Myc virus; Sox2 virus and Klf4
virus; Sox2 virus and c-Myc virus; or Klf4 and c-Myc virus are
added simultaneously or very close in time.
[0176] In some cases, at least three viruses, e.g., an Oct3/4
virus, a Sox2 virus, and a Klf4 virus, are added to the cells
simultaneously or very close in time. In other instances, at least
four viruses, e.g., Oct3/4 virus, Sox2 virus, Klf4 virus, and c-Myc
virus are added to the cells simultaneously or very close in
time.
[0177] At times, the efficiency of viral infection can be improved
by repetitive treatment with the same virus. In some cases, one or
more Oct3/4 virus, Sox2 virus, Klf4 virus, or c-Myc virus is added
to the cells at least two, at least three, or at least four
separate times.
[0178] Examples of recombinant viruses include, but are not
limited, to retroviruses (including lentiviruses); adenoviruses;
and adeno-associated viruses. Often, the recombinant retrovirus is
murine moloney leukemia virus (MMLV), but other recombinant
retroviruses may also be used, e.g., Avian Leukosis Virus, Bovine
Leukemia Virus, Murine Leukemia Virus (MLV), Mink-Cell
focus-Inducing Virus, Murine Sarcoma Virus, Reticuloendotheliosis
virus, Gibbon Abe Leukemia Virus, Mason Pfizer Monkey Virus, or
Rous Sarcoma Virus, see, e.g., U.S. Pat. No. 6,333,195.
[0179] In other cases, the recombinant retrovirus is a lentivirus
(e.g., Human Immunodeficiency Virus-1 (HIV-1); Simian
Immunodeficiency Virus (SIV); or Feline Immunodeficiency Virus
(FIV)), See, e.g., Johnston et al., (1999), Journal of Virology,
73(6):4991-5000 (FIV); Negre D et al., (2002), Current Topics in
Microbiology and Immunology, 261:53-74 (SIV); Naldini et al.,
(1996), Science, 272:263-267 (HIV).
[0180] The recombinant retrovirus may comprise a viral polypeptide
(e.g., retroviral env) to aid entry into the target cell. Such
viral polypeptides are well-established in the art, see, e.g., U.S.
Pat. No. 5,449,614. The viral polypeptide may be an amphotropic
viral polypeptide, e.g., amphotropic env, that aids entry into
cells derived from multiple species, including cells outside of the
original host species. See, e.g., id. The viral polypeptide may be
a xenotropic viral polypeptide that aids entry into cells outside
of the original host species. See, e.g., id. In some embodiments,
the viral polypeptide is an ecotropic viral polypeptide, e.g.,
ecotropic env, that aids entry into cells of the original host
species. See, e.g., id.
[0181] Examples of viral polypeptides capable of aiding entry of
retroviruses into cells include but are not limited to: MMLV
amphotropic env, MMLV ecotropic env, MMLV xenotropic env, vesicular
stomatitis virus-g protein (VSV-g), HIV-1 env, Gibbon Ape Leukemia
Virus (GALV) env, RD114, FeLV-C, FeLV-B, MLV 10A1 env gene, and
variants thereof, including chimeras. See e.g., Yee et al., (1994),
Methods Cell Biol., Pt A:99-112 (VSV-G); U.S. Pat. No. 5,449,614.
In some cases, the viral polypeptide is genetically modified to
promote expression or enhanced binding to a receptor.
[0182] In general, a recombinant virus is produced by introducing a
viral DNA or RNA construct into a producer cell. In some cases, the
producer cell does not express exogenous genes. In other cases, the
producer cell is a "packaging cell" comprising one or more
exogenous genes, e.g., genes encoding one or more gag, pol, or env
polypeptides and/or one or more retroviral gag, pol, or env
polypeptides. The retroviral packaging cell may comprise a gene
encoding a viral polypeptide, e.g., VSV-g that aids entry into
target cells. In some cases, the packaging cell comprises genes
encoding one or more lentiviral proteins, e.g., gag, pol, env, vpr,
vpu, vpx, vif, tat, rev, or nef. In some cases, the packaging cell
comprises genes encoding adenovirus proteins such as E1A or E1B or
other adenoviral proteins. For example, proteins supplied by
packaging cells may be retrovirus-derived proteins such as gag,
pol, and env; lentivirus-derived proteins such as gag, pol, env,
vpr, vpu, vpx, vif, tat, rev, and nef; and adenovirus-derived
proteins such as E1A and E1B. In many examples, the packaging cells
supply proteins derived from a virus that differs from the virus
from which the viral vector derives.
[0183] Packaging cell lines include but are not limited to any
easily-transfectable cell line. Packaging cell lines can be based
on 293T cells, NIH3T3, COS or HeLa cell lines. Packaging cells are
often used to package virus vector plasmids deficient in at least
one gene encoding a protein required for virus packaging. Any cells
that can supply a protein or polypeptide lacking from the proteins
encoded by such virus vector plasmid may be used as packaging
cells. Examples of packaging cell lines include but are not limited
to: Platinum-E (Plat-E); Platinum-A (Plat-A); BOSC 23 (ATCC CRL
11554); and Bing (ATCC CRL 11270), see, e.g., Morita et al.,
(2000), Gene Therapy, 7:1063-1066; Onishi et al., (1996),
Experimental Hematology, 24:324-329; U.S. Pat. No. 6,995,009.
Commercial packaging lines are also useful, e.g., Ampho-Pak 293
cell line, Eco-Pak 2-293 cell line, RetroPack PT67 cell line, and
Retro-X Universal Packaging System (all available from
Clontech).
[0184] The retroviral construct may be derived from a range of
retroviruses, e.g., MMLV, HIV-1, SIV, FIV, or other retrovirus
described herein. The retroviral construct may encode all viral
polypeptides necessary for more than one cycle of replication of a
specific virus. In some cases, the efficiency of viral entry is
improved by the addition of other factors or other viral
polypeptides. In other cases, the viral polypeptides encoded by the
retroviral construct do not support more than one cycle of
replication, e.g., U.S. Pat. No. 6,872,528. In such circumstances,
the addition of other factors or other viral polypeptides can help
facilitate viral entry. In an exemplary embodiment, the recombinant
retrovirus is HIV-1 virus comprising a VSV-g polypeptide but not
comprising a HIV-1 env polypeptide.
[0185] The retroviral construct may comprise: a promoter, a
multi-cloning site, and/or a resistance gene. Examples of promoters
include but are not limited to CMV, SV40, EF1.alpha., .beta.-actin;
retroviral LTR promoters, and inducible promoters. The retroviral
construct may also comprise a packaging signal (e.g., a packaging
signal derived from the MFG vector; a psi packaging signal).
Examples of some retroviral constructs known in the art include but
are not limited to: pMX, pBabeX or derivatives thereof. See e.g.,
Onishi et al., (1996), Experimental Hematology, 24:324-329. In some
cases, the retroviral construct is a self-inactivating lentiviral
vector (SIN) vector, see, e.g., Miyoshi et al., (1998), J. Virol.,
72(10):8150-8157. In some cases, the retroviral construct is LL-CG,
LS-CG, CL-CG, CS-CG, CLG or MFG. Miyoshi et al., (1998), J. Virol.,
72(10):8150-8157; Onishi et al., (1996), Experimental Hematology,
24:324-329; Riviere et al., (1995), PNAS, 92:6733-6737. Virus
vector plasmids (or constructs), include: pMXs, pMXs-IB, pMXs-puro,
pMxs-neo (pMXs-IB is a vector carrying the blasticidin-resistant
gene in stead of the puromycin-resistant gene of pMXs-puro)
Kimatura et al., (2003), Experimental Hematology, 31: 1007-1014; M
F G Riviere et al., (1995), Proc. Natl. Acad. Sci. U.S.A.,
92:6733-6737; pBabePuro; Morgenstern et al., (1990), Nucleic Acids
Research, 18:3587-3596; LL-CG, CL-CG, CS-CG, CLG Miyoshi et al.,
(1998), Journal of Virology, 72:8150-8157 and the like as the
retrovirus system, and pAdex1 Kanegae et al., (1995), Nucleic Acids
Research, 23:3816-3821 and the like as the adenovirus system. In
exemplary embodiments, the retroviral construct comprises
blasticidin (e.g., pMXs-IB), puromycin (e.g., pMXs-puro,
pBabePuro); or neomycin (e.g., pMXs-neo). See, e.g., Morgenstern et
al., (1990), Nucleic Acids Research, 18:3587-3596.
[0186] The retroviral construct may encode one or more IFs. In an
exemplary embodiment, pMX vectors encoding Oct3/4, Sox2, Klf4, or
c-Myc polypeptides, or variants thereof, are generated or obtained.
For example, Oct3/4 is inserted into pMXs-puro to create
pMX-Oct3/4; Sox2 is inserted into pMXs-neo to create pMX-Sox2; Klf4
is inserted into pMXs-IB to create pMX-Klf4; and c-Myc is inserted
into pMXs-IB to create pMX-c-Myc.
[0187] Methods of producing recombinant viruses from packaging
cells and their uses are well-established, see, e.g, U.S. Pat. Nos.
5,834,256; 6,910,434; 5,591,624; 5,817,491; 7,070,994; and
6,995,009, incorporated herein by reference. Many methods begin
with the introduction of a viral construct into a packaging cell
line. The viral construct may be introduced by any method known in
the art, including but not limited to: the calcium phosphate method
(see, e.g., Kokai, Japanese Unexamined Patent Publication No.
2-227075, the lipofection method Felgner et al., (1987), Proc.
Natl. Acad. Sci. U.S.A., 84:7413-7417, the electroporation method,
microinjection, Fugene transfection, and the like, and any method
described herein.
[0188] In one example, pMX-Oct3/4, pMX-Sox2, pMX-Klf4 or pMX-c-Myc
is introduced into PlatE cells by Fugene HD (Roche) transfection.
The cell culture medium may be replaced with fresh medium
comprising FBM (Lonza) supplemented with FGM-2 Single Quots
(Lonza). In some embodiments, the medium is replaced from about 12
to about 60 hours following the introduction of the viral
construct, e.g., from about 12 to about 18 hours; about 18 to about
24; about 24 to about 30; about 30 to about 36; about 36 to about
42; about 42 to about 48; about 48 to about 54; or about 54 to
about 60 hours following introduction of the viral construct to the
producer cells. The medium may be replaced from about 24 to about
48 hours after introduction of the viral construct to the producer
cells. The supernatant can be recovered from about 4 to about 24
hours following the addition of fresh media, e.g., about 4 hours.
In some cases, the supernatant may be recovered about every 4 hours
following the addition of fresh media. The recovered supernatant
may be passed through a 0.45 uM filter (Millipore). In some cases,
the recovered supernatant comprises retrovirus derived from one or
more: pMX-Oct3/4, pMX-Sox2, pMX-Klf4 or pMX-c-Myc.
[0189] Adenoviral transduction may be used to force expression of
the sets of IFs. Methods for generating adenoviruses and their use
are well established as described in, e.g., Straus, The Adenovirus,
Plenum Press (NY 1984), 451 496; Rosenfeld, et al., (1991),
Science, 252:431-434; U.S. Pat. Nos. 6,203,975, 5,707,618, and
5,637,456. In other cases, adenoviral-associated viral transduction
is used to force expression of the sets of IFs. Methods for
preparing adeno-associated viruses and their use are well
established as described in, e.g., U.S. Pat. Nos. 6,660,514 and
6,146,874.
[0190] In an exemplary embodiment, an adenoviral construct is
obtained or generated, wherein the adenoviral construct, e.g.,
Adeno-X, comprises DNA encoding Oct3/4, Sox2, Klf4, or c-Myc. An
adenoviral construct may be introduced by any method known in the
art, e.g., Lipofectamine 2000 (Invitrogen) or Fugene HD (Roche),
into HEK 293 cells. In some cases, the method further comprises (1)
collecting the cells when they exhibit a cytopathic effect (CPE),
such effect occurring from about 10 to about 20 days, e.g., about
11, 13, 14, 15, 18, or 20 days after transfection (2) subjecting
the cells to from about 2 to about 5 freeze-thaw cycles, e.g.,
about 3, (3) collecting the resulting virus-containing liquid; (4)
purifying the virus using an adenovirus purification kit (Clontech)
and (5) storing the virus at -80.degree. C. In some cases, the
titer, or plaque-forming unit (PFU), of the adenoviral stocks is
determined using an Adeno-X rapid titer kit (Clontech), as
described herein.
[0191] The cells may be infected with a recombinant retrovirus that
naturally targets a different cell type or cells originating from a
different host. To aid infection efficiency, an exogenous receptor
may be first introduced into the human cells. For example, an
exogenous mouse receptor may be added to human cells, e.g.,
postnatal dermal fibroblasts, in order help entry of murine moloney
leukemia virus (MMLV). The exogenous receptor may improve infection
efficiency by facilitating viral entry, especially if the receptor
recognizes a viral polypeptide, e.g., MMLV env, or HIV env.
Examples of exogenous receptors include but are not limited to any
receptor recognized by a specific retrovirus or lentivirus known in
the art. For example, a murine receptor, mCAT1, GenBank Accession
No NM.sub.--007513 protein is used in order to aid MMLV infection
of a human target cell.
[0192] The exogenous receptor may be introduced by methods
described herein. Methods of introducing the exogenous receptor
include but are not limited to: calcium phosphate transfection,
Lipofectamine transfection, Fugene transfection, microinjection, or
electroporation. In exemplary embodiments, a virus, e.g.,
recombinant adenovirus or retrovirus (including lentivirus), is
used to introduce the exogenous receptor to the target cell. In a
further exemplary embodiment, a recombinant adenovirus is used to
introduce mCAT1 to human cells and then a recombinant retrovirus,
e.g., MMLV, is used to introduce the IF genes, e.g., Oct 3/4, a
Sox2, a Klf4, or c-Myc, to the cells.
[0193] In some cases, a solution of adenovirus comprising DNA
encoding the mCAT1 protein, e.g., an adenovirus generated by using
a pADEX-mCAT1 construct, is generated or obtained. The adenovirus
solution can comprise Hanks' balanced salt solution. In exemplary
embodiments, infection of cells is accomplished by: (1) contacting
the p-ADEX-mCAT1 adenovirus solution with cells, e.g., human,
non-embryonic fibroblasts, at a multiplicity of infection (m.o.i.)
(virus to cell ratio) from about 1 m.o.i. to about 50 m.o.i., e.g.,
about 1 m.o.i., about 5 m.o.i., about 7.5; m.o.i., about 10 m.o.i.,
about 15 m.o.i., about 20 m.o.i., about 30 m.o.i., about 40 m.o.i.,
or about 50 m.o.i.; (2) incubating the cells with the adenovirus
solution at room temperature from about 15 minutes to about 2
hours, e.g., about 15 minutes, about 30 minutes, about 45 minutes,
about 1 hour, about 1.25 hours, about 1.5 hours, about 1.75 hours,
or about 2 hours; and (3) culturing the somatic cell population in
culture medium from about 24 hours to about 60 hours, e.g., about
24 hours, about 30 hours, about 36 hours, about 42 hours, about 48
hours, about 54 hours, or about 60 hours.
[0194] The cells can be infected using a wide variety of methods.
In some cases, the infection of cells occurs by (1) combining one
or more, two or more, three or more, or all four: pMX-Oct3/4
retrovirus, pMX-Sox2 retrovirus, pMX-Klf4, or pMX-c-Myc to obtain a
retrovirus solution (2) supplementing the retrovirus solution with
from about 2 ug/ml to about 15 ug/ml Polybrene, e.g., about 2
ug/ml, about 3 ug/ml, about 5 ug/ml, about 7 ug/ml, about 10 ug/ml,
about 12 ug/ml, or about 15 ug/ml Polybrene; (3) contacting the
retroviral solution with the somatic cells, at a m.o.i.
(virus-to-cell ratio) of from about 0.5 m.o.i. to about 10 m.o.i.,
e.g., about 0.5 m.o.i., about 1 m.o.i., about 2 m.o.i., about 5
m.o.i., about 7.5 m.o.i., or about 10 m.o.i.; (4) allowing the
contacting of step (3) to continue at 37.degree. C. from about 2
hours to about 24 hours, e.g., about 2 hours, about 3 hours, about
4 hours, about 5 hours, about 6 hours, about 7 hours, about 9
hours, about 10 hours, about 11 hours, about 12 hours, about 14
hours, about 15 hours, about 16 hours, about 17 hours, about 18
hours, about 19 hours, about 20 hours, about 21 hours, about 22
hours, about 23 hours, or about 24 hours; (5) soon after the
contacting of step (4), changing the medium to MC-ES medium, as
described herein; and (6) changing the MC-ES medium with fresh
medium every 1 to 2 days. In some cases, infection of somatic cells
occurs by following steps (1) through (6) described herein, with
the added step of pre-incubating the somatic cells for a length of
time, e.g., about 48 hours, prior to contacting the cells with the
retroviral solution. Such pre-incubation may be necessary when the
somatic cell expresses an exogenous receptor that was introduced by
viral transduction, transfection, or other method. Thus, in some
embodiments, if an adenovirus or lentivirus is used to introduce an
exogenous receptor, e.g., mCAT1, to the somatic cell; such cells
may need to be cultured for a length of time from at least about 30
hours to at least about 60 hours, e.g., about 30, about 35, about
40, about 48, about 52, about 55, or about 60 hours.
[0195] The infection of cells may be accomplished by any method
known in the art. e.g., Palsson, B., et al., (1995), WO95/10619;
Morling, F. J. et al., (1995), Gene Therapy, 2:504-508; Gopp et
al., (2006), Methods Enzymol, 420:64-81. For example, the infection
may be accomplished by spin-infection or "spinoculation" methods
that involve subjecting the cells to centrifugation during the
period closely following the addition of virus to the cells. In
some cases, virus may be concentrated prior to the infection, e.g.,
by ultracentrifugation. In some cases, other technologies may be
used to aid or improve entry of retroviruses into the target cell.
For example, the retrovirus may be contacted with a liposome or
immunoliposome to aid or direct entry into a specific cell type.
See, e.g., Tan et al., (2007), Mol. Med. 13(3-4):216-226.
[0196] The methods of infecting cells described herein may be used
to infect cells expressing an exogenous receptor, e.g., mCAT1 or
other exogenous receptor described herein. Depending on how the
exogenous receptor was introduced, the preincubation period of the
cells prior to infection may need to be varied. In some cases,
cells that do not express an exogenous receptor are used. Some
recombinant retroviruses, e.g., VSV-G pseudotyped recombinant
retroviruses, may not need the aid of an exogenous receptor in
order to efficiently enter cells. In some examples, VSV-G
pseudotyped recombinant retrovirus is introduced to cells following
the method described herein, except that the timing of the
preculturing of the cells may vary.
[0197] 2. Nucleic Acid Vectors
[0198] Nucleic acid vector transfection (e.g., transient
transfection) methods may be used to introduce IFs into human
cells. Methods for preparation of transfection-grade nucleic acid
expression vectors and transfection methods are well established.
See, e.g., Sambrook and Russell (2001), "Molecular Cloning: A
Laboratory Manual," 3.sup.rd ed, (CSHL Press); and Current
Protocols in Molecular Biology, John Wiley & Sons, N.Y. (2005),
9.1-9.14. Examples of high efficiency transfection efficiency
methods include "nucleofection," as described in, e.g., Trompeter
(2003), J Immunol. Methods, 274(1-2):245-256, and in international
patent application publications WO2002086134, WO200200871, and
WO2002086129, transfection with lipid-based transfection reagents
such as Fugene.RTM. 6 and Fugene.RTM. HD (Roche), DOTAP, and
Lipofectamine.TM. LTX in combination with the PLUS.TM. (Invitrogen,
Carlsbad, Calif.), Dreamfect.TM. (OZ Biosciences, Marseille,
France), GeneJuice.TM. (Novagen, Madison, Wis.), polyethylenimine
(see, e.g., Lungwitz et al., (2005), Eur. J Pharm. Biopharm.,
60(2):247-266), and GeneJammer.TM. (Stratagene, La Jolla, Calif.),
and nanoparticle transfection reagents as described in, e.g., U.S.
patent application Ser. No. 11/195,066.
[0199] 3. Protein Transduction
[0200] The induction methods may use protein transduction to
introduce at least one of the IFs directly into cells. In some
cases, protein transduction method includes contacting cells with a
composition containing a carrier agent and at least one purified
polypeptide comprising the amino acid sequence of one of the
above-mentioned IFs. Examples of suitable carrier agents and
methods for their use include, but are not limited to, commercially
available reagents such as Chariot.TM. (Active Motif, Inc.,
Carlsbad, Calif.) described in U.S. Pat. No. 6,841,535;
Bioport.RTM. (Gene Therapy Systems, Inc., San Diego, Calif.),
GenomeONE (Cosmo Bio Co., Ltd., Tokyo, Japan), and ProteoJuice.TM.
(Novagen, Madison, Wis.), or nanoparticle protein transduction
reagents as described in, e.g., in U.S. patent application Ser. No.
10/138,593.
[0201] The protein transduction method may comprise contacting a
cells with at least one purified polypeptide comprising the amino
acid sequence of one of the above-mentioned IFs fused to a protein
transduction domain (PTD) sequence (IF-PTD fusion polypeptide). The
PTD domain may be fused to the amino terminal of an IF sequence;
or, the PTD domain may be fused to the carboxy terminal of an IF
sequence. In some cases, the IF-PTD fusion polypeptide is added to
cells as a denatured polypeptide, which may facilitate its
transport into cells where it is then renatured. Generation of PTD
fusion proteins and methods for their use are established in the
art as described in, e.g., U.S. Pat. Nos. 5,674,980, 5,652,122, and
6,881,825. See also, Becker-Hapak et al., (2003), Curr Protocols in
Cell Biol, John Wiley & Sons, Inc. Exemplary PTD domain amino
acid sequences include, but are not limited to, any of the
following:
TABLE-US-00002 YGRKKRRQRRR; (SEQ ID NO: 1) RKKRRQRR; (SEQ ID NO: 2)
YARAAARQARA; (SEQ ID NO: 3) THRLPRRRRRR; (SEQ ID NO: 4) and
GGRRARRRRRR. (SEQ ID NO: 5)
[0202] In some cases, individual purified IF polypeptides are added
to cells sequentially at different times. In other embodiments, a
set of at least three purified IF polypeptides, but not a purified
c-Myc polypeptide, e.g., an Oct3/4 polypeptide, a Sox2 polypeptide,
and a Klf4 polypeptide are added to cells. In some embodiments, a
set of four purified IF polypeptides, e.g., purified Oct3/4, Sox2,
Klf4, and c-Myc polypeptides are added to cells. In some
embodiments, the purified IF polypeptides are added to cells as one
composition (i.e., a composition containing a mixture of the IF
polypeptides). In some embodiments, cells are incubated in the
presence of a purified IF polypeptide for about 30 minutes to about
24 hours, e.g., 1 hours, 1.5 hours, 2 hours, 2.5 hours, 3 hours,
3.5 hours 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 12 hours, 16
hours, 18 hours, 20 hours, or any other period from about 30
minutes to about 24 hours. In some embodiments, protein
transduction of cells is repeated with a frequency of about every
day to about every 4 days, e.g., every 1.5 days, every 2 days,
every 3 days, or any other frequency from about every day to about
every four days with the same or different IF polypeptides.
[0203] In some cases, the methods described herein utilize protein
transduction and expression vector transduction/transfection in any
combination to force expression of a set of IFs as described
herein. In some embodiments, retroviral expression vectors are used
to force expression of Oct 3/4, a Sox2, and a Klf4 polypeptides in
cells, and purified c-Myc purified polypeptide is introduced into
cells by protein transduction as described herein. HDAC inhibitor
treatment can be used in addition to the purified IF polypeptide.
In some cases, a set of at least three purified IF polypeptides,
but not a purified c-Myc polypeptide, e.g., an 3/4Oct3/4
polypeptide, a Sox2 polypeptide, and a Klf4 polypeptide are added
to cells which are also subjected to HDAC inhibitor treatment.
[0204] F. Induction Factor Sequences
[0205] Described herein are polypeptides comprising the amino acid
sequences of IFs used in the induction methods described herein,
and exogenous genes encoding such polypeptides. In some
embodiments, an IF amino acid sequence is a naturally occurring
amino acid sequence, e.g., that of: human or mouse Oct 3/4, human
or mouse Sox2, human or mouse Klf4, or human or mouse c-Myc
polypeptides. In other embodiments, the amino acid sequence of an
IF is a non-naturally occurring amino acid sequence variant of an
IF that is, nevertheless, functionally or structurally homologous
to an IF amino acid sequence, as described herein.
[0206] Evaluating the structural and functional homology of two or
polypeptides generally includes determining the percent identity of
their amino acid sequences to each other. Sequence identity between
two or more amino acid sequences is determined by conventional
methods. See, for example, Altschul et al., (1997), Nucleic Acids
Research, 25(17):3389-3402; and Henikoff and Henikoff (1982), Proc.
Natl. Acad. Sci. USA, 89:10915 (1992). Briefly, two amino acid
sequences are aligned to optimize the alignment scores using a gap
opening penalty of 10, a gap extension penalty of 1, and the
"BLOSUM62" scoring matrix of Henikoff and Henikoff (ibid.). The
percent identity is then calculated as: ([Total number of identical
matches]/[length of the longer sequence plus the number of gaps
introduced into the longer sequence in order to align the two
sequences])(100).
[0207] Those skilled in the art will appreciate that there are many
established algorithms available to align two amino acid sequences.
The "FASTA" similarity search algorithm of Pearson and Lipman is a
suitable protein alignment method for examining the level of
identity shared by an amino acid sequence disclosed herein and the
amino acid sequence of another peptide. The FASTA algorithm is
described by Pearson and Lipman (1988), Proc. Natl Acad. Sci. USA,
85:2444, and by Pearson (1990), Meth. Enzymol., 183:63. Briefly,
FASTA first characterizes sequence similarity by identifying
regions shared by the query sequence (e.g., any of SEQ ID NOs:6-13)
and a test sequence that have either the highest density of
identities (if the ktup variable is 1) or pairs of identities (if
ktup=2), without considering conservative amino acid substitutions,
insertions, or deletions. The ten regions with the highest density
of identities are then rescored by comparing the similarity of all
paired amino acids using an amino acid substitution matrix, and the
ends of the regions are "trimmed" to include only those residues
that contribute to the highest score. If there are several regions
with scores greater than the "cutoff" value (calculated by a
predetermined formula based upon the length of the sequence and the
ktup value), then the trimmed initial regions are examined to
determine whether the regions can be joined to form an approximate
alignment with gaps. Finally, the highest scoring regions of the
two amino acid sequences are aligned using a modification of the
Needleman-Wunsch-Sellers algorithm (Needleman and Wunsch (1970), J.
Mol. Biol., 48:444-453; Sellers (1974), SIAM J. Appl. Math.,
26:787), which allows for amino acid insertions and deletions.
Illustrative parameters for FASTA analysis are: ktup=, gap opening
penalty=10, gap extension penalty=1, and substitution
matrix=BLOSUM62. These parameters can be introduced into a FASTA
program by modifying the scoring matrix file ("SMATRIX"), as
explained in Appendix 2 of Pearson (1990), Meth. Enzymol.,
183:63.
[0208] Also described herein are nucleic acids (e.g., exogenous
genes) encoding Oct3/4, Sox2, Klf4, or c-Myc polypeptides, as
described herein, that hybridize specifically under low, medium, or
high stringency conditions to a probe of at least 100 nucleotides
from a nucleic acid encoding the amino acid sequence any of SEQ ID
NOs:6-13. Low stringency hybridization conditions include, e.g.,
hybridization with a 100 nucleotide probe of about 40% to about 70%
GC content; at 42.degree. C. in 2.times.SSC and 0.1% SDS. Medium
stringency hybridization conditions include, e.g., at 50.degree. C.
in 0.5.times.SSC and 0.1% SDS. High stringency hybridization
conditions include, e.g., hybridization with the above-mentioned
probe at 65.degree. C. in 0.2.times.SSC and 0.1% SDS. Under these
conditions, as the hybridization temperature is elevated, a nucleic
acid with a higher homology can be obtained. Such nucleic acids
encoding Oct 3/4, Sox2, Klf4, or c-Myc polypeptides are useful in
the forced expression of these IFs as described herein.
[0209] A number of considerations are useful to the skilled artisan
in determining if a particular amino acid sequence variant of an IF
is suitable for use in the methods described herein. These
considerations include, but are not limited to: (1) known
structure-function relationships for the IF, e.g., the presence of
modular domains such as a DNA binding domain or a transactivation
domain, which, in many cases, have been shown to be functionally
discrete and capable of independent function; (2) the presence of
amino acid sequence conservation among naturally occurring homologs
(e.g., in paralogs and orthologs) of the IF, as revealed by
sequence alignment algorithms as described herein. Notably, a
number of bioinformatic algorithms are known in the art that
successfully predict the functional effect, i.e., "tolerance" of
particular amino substitutions in the amino acid sequence of a
protein on its function. Such algorithms include, e.g., pMUT, SIFT,
PolyPhen, and SNPs3D. For a review see, e.g., Ng and Henikoff
(2006), Ann Rev Genomics Hum Genet., 7:61-80. For example, pMUT
predicts with a high degree of accuracy (about 84% overall) whether
a particular amino acid substitution at a given sequence position
affects a protein's function based on sequence homology. See
Ferrer-Costa et al., (2005), Bioinformatics, 21(14):3176-3178;
Ferrer-Costa et al., (2004), Proteins, 57(4):811-819; and
Ferrer-Costa et al., (2002), J Mol Biol, 315:771-786. The PMUT
algorithm server is publicly available on the world wide web at:
//mmb2.pcb.ub.es:8080/PMut/. Thus, for any IF polypeptide amino
acid sequence, an "amino acid substitution matrix" can be generated
that provides the predicted neutrality or deleteriousness of any
given amino acid substitution on IF polypeptide function.
[0210] Non-naturally occurring sequence variants can be generated
by a number of known methods. Such methods include, but are not
limited to, "Gene Shuffling," as described in U.S. Pat. No.
6,521,453; "RNA mutagenesis," as described in Kopsidas et al.,
(2007), BMC Biotechnology, 7:18-29; and "error-prone PCR methods."
Error prone PCR methods can be divided into (a) methods that reduce
the fidelity of the polymerase by unbalancing nucleotides
concentrations and/or adding of chemical compounds such as
manganese chloride (see, e.g., Lin-Goerke et al., (1997),
Biotechniques, 23:409-412), (b) methods that employ nucleotide
analogs (see, e.g., U.S. Pat. No. 6,153,745), (c) methods that
utilize `mutagenic` polymerases (see, e.g., Cline, J. and Hogrefe,
H. H. (2000), Strategies (Stratagene Newsletter), 13:157-161 and
(d) combined methods (see, e.g., Xu et al., (1999), Biotechniques,
27:1102-1108. Other PCR-based mutagenesis methods include those,
e.g., described by Osuna et al., (2004), Nucleic Acids Res.,
32(17):e136 and Wong et al., (2004), Nucleic Acids Res.,
10;32(3):e26), and others known in the art.
[0211] Confirmation of the retention, loss, or gain of function of
the amino acid sequence variants of an IF can be determined in
various types of assays according to the protein function being
assessed. For example, where the IF is a transcriptional activator,
e.g., an Oct3/4, function is readily assessed using cell-based,
promoter-reporter assays, where the reporter construct comprises
one or more cognate target elements for the transactivator
polypeptide to be assayed. Methods for generating promoter-reporter
constructs, introducing them into cells, and assaying various
reporter polypeptide activities, can be found in detail in, e.g.,
Current Protocols in Molecular Biology, John Wiley & Sons, N.Y.
(2005), 3.16-3.17 and 9.1-9.14, respectively). Promoter activity
can be quantified by measuring a property of the reporter
polypeptide (e.g., enzymatic activity or fluorescence), reporter
polypeptide expression (e.g., by an ELISA assay), or reporter mRNA
expression (e.g., by a fluorescent hybridization technique).
Suitable reporter polypeptides include, e.g., firefly luciferase,
Renilla luciferase, fluorescent proteins (e.g., enhanced green
fluorescent protein), .beta.-galactosidase, .beta. lactamase, ALP,
and horseradish peroxidase.
[0212] For example, luciferase activity can be detected by
providing an appropriate luminogenic substrate, e.g., firefly
luciferin for firefly luciferase or coelenterazine for Renilla
luciferase. Luciferase activity in the presence of an appropriate
substrate can be quantified by a number of standard techniques,
e.g., luminometry. See, e.g., U.S. Pat. No. 5,744,320. Fluorescent
polypeptides (e.g., EGFP) can be detected and quantified in live
cells by a number of detection methods known in the art (e.g.,
fluorimetry or fluorescence microscopy). Details of reporter assay
screens in live cells using fluorescent polypeptides, including
high-throughput screening methods, can be found, e.g., in U.S. Pat.
No. 6,875,578.
[0213] Described herein are a number of IFs that are
transcriptional activators, i.e., polypeptides that transactivate
promoters containing specific target elements to which the
transcriptional activator binds as a monomer, a multimer, or in a
heteromeric complex with other polypeptides. Naturally occurring
transcriptional activators, e.g., Klf4, are modular proteins
minimally composed of two domains as follows: a DNA binding domain
that dictates the genes to be targeted and an activation domain
that governs the nature and the extent of the transcriptional
response through interactions with the transcriptional machinery.
The two domains typically operate in an independent fashion such
that the DNA binding domain of one transcriptional activator, e.g.,
the DNA binding domain Sox2, can be attached to the transactivation
domain of another transcriptional activator, e.g., Herpes VP16, to
generate a fully functional, "chimeric" transcriptional activator,
e.g., a chimeric Sox2 transcriptional activator as described in,
e.g., Kamachi et al., (1999), Mol Cell Biol., 19(1):107-120.
[0214] In view of the guidance provided herein, a broad range of IF
sequence variants (e.g., Oct3/4, Sox2, Klf4, or c-Myc sequence
variants), operable in the methods described herein, can readily be
identified by those of ordinary skill in the art without undue
effort.
[0215] Oct3/4 Polypeptide
[0216] As referred to herein, an "Oct3/4 polypeptide" includes
human Oct 3/4, mouse Oct 3/4, or any polypeptide that: [0217] (i)
includes a DNA binding domain (DBD) that binds to the human nanog
gene Octamer element: [0218] 5'-TTTTGCAT-3'; and [0219] (ii) is
capable of transactivating a promoter comprising one or more nanog
Octamer elements. See, e.g., Kuroda et al., (2005), Mol and Cell
Biol., 25(6):2475-2485.
[0220] In some embodiments, an Oct3/4 is a polypeptide having the
above-mentioned functional properties, and comprising an amino acid
sequence at least 70% identical to SEQ ID NO:6 corresponding to the
amino acid sequence of human Oct 3/4, also known as Homo sapiens
POU class 5 homeobox 1 (POU5F1; GenBank Accession No.
NP.sub.--002692), e.g., 75%, 80%, 85%, 90%, 91%, 92%, 95%, 97%,
99%, or any other percent identical from at least 70% to 100%
identical to SEQ ID NO:6. In some embodiments, an Oct3/4 is a
polypeptide having the above-mentioned functional properties, and
comprising an amino acid sequence from at least 70% to less than
100% identical (e.g., 75%, 80%, 85%, 90%, 91%, 92%, 95%, 97%, 99%
identical) to SEQ ID NO:6, e.g., SEQ ID NO: 6 with at least one
amin amino acid substitution, deletion, or insertion. In other
embodiments, an Oct-3/4 is a polypeptide having the above-mentioned
functional properties comprising the amino acid sequence of SEQ ID
NO:6 with up to a total of 30 amino acid substitutions, deletions,
insertions, or any combination thereof, e.g., SEQ ID NO:6 with 0,
1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 15, 20, 25, or any other number
of amino acid substitutions, deletions, insertions, or any
combination thereof, from 0 to 30.
TABLE-US-00003 SEQ ID NO: 6 (Human Oct 3/4):
MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPG
VGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAG
VGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFA
KLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKL
RPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFL
QCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEA
AGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSV TTLGSPMHSN
[0221] In some embodiments, an Oct3/4 is a polypeptide having the
above-mentioned functional properties, and comprising an amino acid
sequence at least 70% identical to SEQ ID NO:7, e.g., 75%, 80%,
85%, 90%, 91%, 92%, 95%, 97%, 99%, or any other percent identical
from at least 70% to 100% identical to SEQ ID NO:7, corresponding
to amino acids 138-290 of Human Oct3/4 comprising the highly
conserved POU DNA binding domain. In some embodiments, an Oct3/4 is
a polypeptide having the above-mentioned functional properties, and
comprising an amino acid sequence from at least 70% to less than
100% identical (e.g., 75%, 80%, 85%, 90%, 91%, 92%, 95%, 97%, 99%
identical) to SEQ ID NO:7, e.g., SEQ ID NO: 7 with at least one
amino acid substitution, deletion, or insertion (e.g., 1 to 10
amino acid substitutions, deletions, or insertions).
TABLE-US-00004 SEQ ID NO: 7 (POU/DNA Binding Domain of Human Oct
3/4) DIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRF
EALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSI
ENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKR SSS
[0222] Oct3/4 polypeptides, as described herein, may include
naturally occurring or non-naturally occurring homologs of human
Oct 3/4. Examples of naturally occurring homologs of human Oct3/4
include, but are not limited to, those listed under GenBank
Accession Nos: NP.sub.--002692; NP.sub.--001108427;
NP.sub.--001093427; NP.sub.--001009178; and NP.sub.--038661, or any
other Oct family members that meet the above-mentioned structural
and functional criteria.
[0223] Examples of non-naturally occurring homologs of human Oct
3/4, include, but are not limited to those described in, e.g., Niwa
et al., (2002), Mol Cell Biol., 22(5):1526-1536; and Lunde et al.,
(2004), Curr. Biol., 14(1):48-55.
[0224] pMUT analysis of the human Oct3/4 amino acid sequence (SEQ
ID NO:6) based on a PSI-BLAST multiple alignment encompassing 250
sequences yields an amino acid substitution matrix (ASM) as shown
in Table 17. For each wild-type amino acid position in the human
Oct3/4 amino acid sequence, Table 17 shows which amino acid
substitutions (of 20 possible amino acids) are predicted to be
deleterious (bold and underlined) or neutral (plain text) to the
protein's function. Functional assays for the ability of Oct3/4
polypeptides to bind to the cognate nanog gene octamer element
(described above) and to transactivate a promoter containing one or
more nanog target elements are known in the art as described in,
e.g., Kuroda et al., (supra); and Loh et al., (2006), Nat. Genet.,
39(4):431-440.
[0225] Sox2 Polypeptide
[0226] As referred to herein, a "Sox2 polypeptide" includes human
Sox2, mouse Sox2, or any polypeptide that: [0227] (i) includes a
DNA binding domain (DBD) that binds to the human nanog gene Sox
element: [0228] 5'-TACAATG-3'; and [0229] (ii) is capable of
transactivating a promoter comprising one or more nanog gene
promoter Sox elements. See, e.g., Kuroda et al., (2005), Mol and
Cell Biol., 25(6):2475-2485.
[0230] In some embodiments, a Sox2 polypeptide is a polypeptide
having the above-mentioned functional properties, and comprising
the amino acid sequence at least 70% identical to SEQ ID NO:8
corresponding to the amino acid sequence of human Sox2, i.e.,
sex-determining region Y-box 2 protein (GenBank Accession No.
NP.sub.--003097), e.g., 75%, 80%, 85%, 90%, 91%, 92%, 95%, 97%,
99%, or any other percent identical from at least 70% to 100%
identical to SEQ ID NO:8. In some embodiments, a Sox2 polypeptide
is a polypeptide having the above-mentioned functional properties,
and comprising an amino acid sequence from at least 70% to less
than 100% identical (e.g., 75%, 80%, 85%, 90%, 91%, 92%, 95%, 97%,
99% identical) to SEQ ID NO:8, e.g., SEQ ID NO: 8 with at least one
amino acid substitution, deletion, or insertion (e.g., 1 to 10
amino acid substitutions, deletions, or insertions).
[0231] In other embodiments, a Sox2 polypeptide is a polypeptide
having the above-mentioned functional properties, and comprising
the amino acid sequence of SEQ ID NO:8 with up to a total of 30
amino acid substitutions, deletions, insertions, or any combination
thereof, e.g., SEQ ID NO:8 with 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10,
11, 15, 20, 25, or any other number of amino acid substitutions,
deletions, insertions, or any combination thereof, from 0 to
30.
TABLE-US-00005 SEQ ID NO: 8 (Human Sox2):
MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMV
WSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRAL
HMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLG
AGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRY
DVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASS
SPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQS
GPVPGTAINGTLPLSHM
[0232] In some embodiments, a Sox2 polypeptide is a polypeptide
having the above-mentioned functional properties, and comprising an
amino acid sequence at least 70% identical to SEQ ID NO:9, e.g.,
75%, 80%, 85%, 90%, 91%, 92%, 95%, 97%, 99%, or any other percent
identical from at least 70% to 100% identical to SEQ ID NO:9, amino
acids 40-115 of Human Sox2 comprising the highly conserved High
Mobility Group-Sox-TCF (HMG-Sox-TCF) motif DNA binding domain
(DBD). In some embodiments, a Sox2 polypeptide is a polypeptide
having the above-mentioned functional properties, and comprising an
amino acid sequence from at least 70% to less than 100% identical
(e.g., 75%, 80%, 85%, 90%, 91%, 92%, 95%, 97%, 99% identical) to
SEQ ID NO:9, e.g., SEQ ID NO: 9 with at least one amino acid
substitution, deletion, or insertion (e.g., 1 to 5 amino acid
substitutions, deletions, or insertions).
TABLE-US-00006 SEQ ID NO: 9 (HMG-Sox2-TCF DBD)
RVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRP
FIDEAKRLRALHMKEHPDYKYRPRRK
[0233] Sox2 polypeptides, as described herein, may include
naturally occurring or non-naturally occurring homologs of human
Sox2. Examples of naturally occurring homologs of human Sox2
include, but are not limited to, those listed under GenBank
Accession Nos: NP.sub.--001098933; NP.sub.--035573, ACA58281;
BAA09168; NP.sub.--001032751; and NP.sub.--648694, or any other Sox
family members that meet the above-mentioned structural and
functional criteria.
[0234] Examples of non-naturally occurring homologs of human Sox2,
include, but are not limited to those described in, e.g., Kamachi
et al., (1999), Mol Cell Biol., 19(1):107-120.
[0235] pMUT analysis (described above) of the human Sox2 amino acid
sequence (SEQ ID NO:8) based on a PSI-BLAST multiple alignment
encompassing 250 sequences yields an ASM (Table 18) showing amino
acid substitutions predicted to be deleterious or neutral to the
protein's function. Functional assays for the ability of Sox2
polypeptides to bind to the nanog gene Sox element and to
transactivate a promoter containing one or more nanog Sox elements
are known in the art as described in, e.g., Kuroda et al.,
(supra).
[0236] Klf4 Polypeptide
[0237] As referred to herein, a "Klf4 polypeptide" includes human
Klf4, mouse Klf4, or any polypeptide that:
[0238] (i) includes a zinc-finger DNA binding domain (DBD) that
binds to a Klf target element, e.g., [0239] 5'-GAGGTCC-3' OR
5'-GGGGTGT-3'; and [0240] (ii) is capable of transactivating a
promoter comprising one or more of the above-mentioned target
elements. See, e.g., Nakatake et al., (2006), Mol Cell Biol.,
24(20):7772-7782.
[0241] In some embodiments, a Klf4 polypeptide is a polypeptide
having the above-mentioned functional properties, and comprising
the amino acid sequence at least 70% identical to SEQ ID NO:10
corresponding to the amino acid sequence of human Klf4, i.e.,
Kruppel-Like Factor 4 (GenBank Accession No. NP.sub.--004226),
e.g., 75%, 80%, 85%, 90%, 91%, 92%, 95%, 97%, 99%, or any other
percent identical from at least 70% to 100% identical to SEQ ID
NO:10. In some embodiments, a Klf4 polypeptide is a polypeptide
having the above-mentioned functional properties, and comprising an
amino acid sequence from at least 70% to less than 100% identical
(e.g., 75%, 80%, 85%, 90%, 91%, 92%, 95%, 97%, 99% identical) to
SEQ ID NO:10, e.g., SEQ ID NO:10 with at least one amino acid
substitution, deletion, or insertion (e.g., 1 to 10 amino acid
substitutions, deletions, or insertions).
[0242] In other embodiments, a Klf polypeptide is a polypeptide
having the above-mentioned functional properties, and comprising
the amino acid sequence of SEQ ID NO:10 with up to a total of 30
amino acid substitutions, deletions, insertions, or any combination
thereof, e.g., SEQ ID NO:10 with 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10,
11, 15, 20, 25, or any other number of amino acid substitutions,
deletions, insertions, or any combination thereof, from 0 to
30.
TABLE-US-00007 SEQ ID NO: 10 (Human Klf4):
MAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLP
GRPYDLAAATVATDLESGGAGAACGGSNLAPLPRRETEEFNDLLDLDFIL
SNSLTHPPESVAATVSSSASASSSSSPSSSGPASAPSTCSFTYPIRAGND
PGVAPGGTGGGLLYGRESAPPPTAPFNLADINDVSPSGGFVAELLRPELD
PVYIPPQQPQPPGGGLMGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSH
PVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGR
QLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQ
VPPLHYQELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTK
SSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQ
KCDRAFSRSDHLALHMKRHF
[0243] In some embodiments, a Klf4 polypeptide is a polypeptide
having the above-mentioned functional properties, and comprising an
amino acid sequence at least 70% identical to SEQ ID NO:11, e.g.,
75%, 80%, 85%, 90%, 91%, 92%, 95%, 97%, 99%, or any other percent
identical from at least 70% to 100% identical to SEQ ID NO:11,
amino acids 382-469 of Human Klf4 comprising the highly conserved
Zinc Finger motif DNA binding domain (ZF-DBD). In some embodiments,
a Klf4 polypeptide is a polypeptide having the above-mentioned
functional properties, and comprising an amino acid sequence from
at least 70% to less than 100% identical (e.g., 75%, 80%, 85%, 90%,
91%, 92%, 95%, 97%, 99% identical) to SEQ ID NO:11, e.g., SEQ ID
NO:11 with at least one amino acid substitution, deletion, or
insertion (e.g., 1 to 5 amino acid substitutions, deletions, or
insertions).
TABLE-US-00008 SEQ ID NO: 11 (Human Klf4-ZF-DBD)
KRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARS
DELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRH
[0244] Klf4 polypeptides, as described herein, may include
naturally occurring or non-naturally occurring homologs of human
Klf4. Examples of naturally occurring homologs of human Klf4
include, but are not limited to, those listed under listed under
GenBank Accession Nos: NP.sub.--001017280, NP.sub.--057354 (Klf2);
AAP36222 (Klf5); NP.sub.--034767; and NP.sub.--446165, or any other
Klf family members that meet the above-mentioned structural and
functional criteria. Examples of non-naturally occurring Klf4
polypeptides include, but are not limited to, those having the
above-mentioned functional properties and comprising an amino acid
sequence at least 70%, e.g., 75%, 80%, 85%, 90%, or a percent from
70% to 100% identical to SEQ ID NO:10 or SEQ ID NO:11.
[0245] In some embodiments, a Klf4 polypeptide is a non-naturally
occurring polypeptide having the above-mentioned functional
properties.
[0246] pMUT analysis (described above) of the human Klf4 amino acid
sequence (SEQ ID NO:10) based on a PSI-BLAST multiple alignment
encompassing 136 sequences yields an ASM (Table 19) showing amino
acid substitutions predicted to be deleterious or neutral to the
protein's function. Functional assays for the ability of Klf4
polypeptides to bind to any of the above-mentioned target elements
and to transactivate a promoter containing one or more of the
target elements are known in the art as described in, e.g.,
Nakatake et al., (supra).
[0247] c-Myc Polypeptide
[0248] As referred to herein, a "c-Myc polypeptide" includes human
c-Myc, mouse c-Myc, or any polypeptide that: [0249] (i) includes a
basic helix-loop-helix leucine zipper domain and binds to a target
element comprising the sequence: 5'-CACGTG-3'; or
5'-C/GACCACGTGGTG/C-3' and [0250] (ii) is capable of
transactivating a promoter comprising one or more of the
above-mentioned target elements. See, e.g., Cowling et al., (2006),
Seminars in Canc. Biol., 16:242-252.
[0251] In some embodiments, a c-Myc polypeptide is a polypeptide
having the above-mentioned functional properties, and comprising an
amino acid sequence at least 70% identical to SEQ ID NO:12
corresponding to the amino acid sequence of human c-Myc, i.e.,
myelocytomatosis viral oncogene homolog (GenBank Accession No.
NP.sub.--002458), e.g., 75%, 80%, 85%, 90%, 91%, 92%, 95%, 97%,
99%, or any other percent identical from at least 70% to 100%
identical to SEQ ID NO:12. In some embodiments, a c-Myc polypeptide
is a polypeptide having the above-mentioned functional properties,
and comprising an amino acid sequence from at least 70% to less
than 100% identical (e.g., 75%, 80%, 85%, 90%, 91%, 92%, 95%, 97%,
99% identical) to SEQ ID NO:12, e.g., SEQ ID NO:12 with at least
one amino acid substitution, deletion, or insertion (e.g., 1 to 10
amino acid substitutions, deletions, or insertions).
[0252] In other embodiments, a c-Myc polypeptide is a polypeptide
having the above-mentioned functional properties, and comprising
the amino acid sequence of SEQ ID NO:12 with up to a total of 30
amino acid substitutions, deletions, insertions, or any combination
thereof, e.g., SEQ ID NO:12 with 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10,
11, 15, 20, 25, or any other number of amino acid substitutions,
deletions, insertions, or any combination thereof, from 0 to
30.
TABLE-US-00009 SEQ ID NO: 12 (Human c-Myc):
MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQ
QQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGD
NDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMW
SGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAA
SECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSP
EPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG
GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQ
ISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELE
NNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLR NSCA
[0253] In some embodiments, a c-Myc polypeptide is a polypeptide
having the above-mentioned functional properties, and comprising an
amino acid sequence at least 70% identical to SEQ ID NO:13, e.g.,
75%, 80%, 85%, 90%, 91%, 92%, 95%, 97%, 99%, or any other percent
identical from at least 70% to 100% identical to SEQ ID NO:13,
amino acids 370-454 of Human c-Myc comprising the highly conserved
basic helix-loop-helix (bHLH)-leucine zipper (LZ) DNA binding
domain. In some embodiments, a Klf4 polypeptide is a polypeptide
having the above-mentioned functional properties, and comprising an
amino acid sequence from at least 70% to less than 100% identical
(e.g., 75%, 80%, 85%, 90%, 91%, 92%, 95%, 97%, 99% identical) to
SEQ ID NO:13, e.g., SEQ ID NO:13 with at least one amino acid
substitution, deletion, or insertion (e.g., 1 to 5 amino acid
substitutions, deletions, or insertions).
TABLE-US-00010 SEQ ID NO: 13 (Human c-Myc bHLH-LZ domain)
KRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYIL
SVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
[0254] c-Myc polypeptides, as described herein, may include
naturally occurring or non-naturally occurring homologs of human
c-Myc. Examples of naturally occurring homologs of human c-Myc
include, but are not limited to, those listed under listed under
GenBank Accession Nos: NP.sub.--001005154, NP.sub.--036735,
NP.sub.--034979, P0C0N9, and NP.sub.--001026123, or any other c-Myc
family members that meet the above-mentioned structural and
functional criteria. Examples of non-naturally occurring homologs
of human c-Myc include, but are not limited to, those described in,
e.g., Chang et al., (2000), Mol Cell Biol., 20:4309-4319.
[0255] pMUT analysis (described above) of the human c-Myc amino
acid sequence (SEQ ID NO:12) based on a PSI-BLAST multiple
alignment encompassing 250 sequences yields an ASM (Table 20)
showing amino acid substitutions predicted to be deleterious or
neutral to the protein's function. Functional assays for the
ability of c-Myc polypeptides to bind to any of the above-mentioned
target elements and to transactivate a promoter containing one or
more of the target elements are known in the art as described in,
e.g., Gu et al., (1993), Proc. Natl. Acad. Sci. USA,
90:2935-2939.
[0256] In some cases, any of the Oct3/4, Sox2, Klf4, or c-Myc
polypeptide DNA binding domains are fused to the Herpes VP16
transactivation domain to generate chimeric fusion proteins that
can be used as induction factors in the induction methods described
herein. In one embodiment the Herpes VP16 transactivation domain
comprises the following amino acid sequence:
TABLE-US-00011 TKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNG
WSNGSYSMMQDQLGYPQHSTTAPITDVSLGDELRLDGEEVDMTPADALDD
FDLEMLGDVESPSPGMTHDPVSYGALDVDDFEFEQMFTDALGIDDFGG
[0257] In some embodiments, any of the Oct 3/4, Sox2, Klf4, or
c-Myc polypeptides, or combinations thereof are provided as
polypeptide transduction compositions for use in the induction
methods described herein. Such compositions contain at least one of
the following: [0258] (i) a purified 3/4Oct3/4 polypeptide
comprising a protein transduction domain at the amino or carboxy
terminus; [0259] (ii) a carrier reagent and a purified 3/4Oct3/4
polypeptide; [0260] (iii) a purified Sox2 polypeptide comprising a
protein transduction domain and the amino acid sequence of a Sox2
polypeptide; [0261] (iv) a carrier reagent and a purified Sox2
polypeptide; [0262] (v) a purified Klf4 polypeptide comprising a
protein transduction domain; [0263] (vi) a carrier reagent and a
purified Klf4 polypeptide; [0264] (vii) a purified c-Myc
polypeptide comprising a protein transduction domain [0265] (viii)
a carrier reagent and a purified c-Myc-polypeptide [0266] (ix) any
combination of (i) to (vi) where the composition is substantially
free of a purified polypeptide comprising the amino acid of a c-Myc
polypeptide.
[0267] In some embodiments, the protein transduction domain is
fused to the amino terminal of an IF sequence. In other
embodiments, the PTD domain is fused to the carboxy terminal of an
IF sequence. In some embodiments, the IF-PTD fusion polypeptide is
added to cells as a denatured polypeptide, which may facilitate its
transport into cells where it is then renatured. The generation of
PTD fusion proteins and methods for their use are known the art as
described in, e.g., U.S. Pat. Nos. 5,674,980, 5,652,122, 6,881,825.
See also, Becker-Hapak et al., (2003), Curr. Protocols in Cell
Biol., John Wiley & Sons, Inc. Exemplary PTD domain amino acid
sequences include, but are not limited to, any of the
following:
TABLE-US-00012 YGRKKRRQRRR; (SEQ ID NO: 1) RKKRRQRR; (SEQ ID NO: 2)
YARAAARQARA; (SEQ ID NO: 3) THRLPRRRRRR; (SEQ ID NO: 4) and
GGRRARRRRRR. (SEQ ID NO: 5)
[0268] Examples of suitable carrier agents and methods for their
use include, but are not limited to those described in U.S. Pat.
No. 6,841,535.
[0269] G. Subcloning Induced Cell Colonies
[0270] Cell colonies may be subcloned, by any method known in the
art, to obtain a pure population of human stem cells, which
contains a higher proportion of the generated human stem cells
relative to the total cell population than that found in the total
cell population before purification. In some cases, the induced
cells are cultured and observed for about 14 days to about 40 days,
e.g., 15 days, 16 days, 17 days, 18 days, 19 days, 20 days, 23
days, 24 days, 27 days, 28 days, 29 days, 30 days, 31 days, 33
days, 34 days, 35 days, 36 days, 37 days, 38 days, or other period
from about 14 days to about 40 days prior to identifying and
selecting clones comprising "induced cells" based on morphological
characteristics, as described herein. The induced cells may be
cultured in a maintenance culture medium in a 37.degree. C., 5%
CO.sub.2 incubator, with medium changes about every 1 to 2 days,
preferably every day. Examples of maintenance culture media include
any and all complete ES media (e.g., MC-ES). The maintenance
culture medium may be supplemented with b-FGF or FGF2. In some
cases, the maintenance culture medium is supplemented with other
factors, e.g., IGF-II or Activin A.
[0271] After washing cell cultures with a physiological buffer,
e.g., Hank's balanced salt solution, colonies displaying the
morphological characteristics of interest are surrounded by a
cloning ring coated with silicone grease on the bottom side. About
100 .mu.l (or 50 .mu.l to 150 .mu.l) of "Detachment Medium For
Primate ES Cells" (manufactured by ReproCELL, Tokyo Japan) may be
then added to the cloning ring and incubated at 37.degree. C. for
about 20 minutes to form a cell suspension. The cell suspension in
the ring containing the detached colonies may be added to about 2
ml of MC-ES medium (or other medium described herein), and plated
in one well of a MEF-coated 24-well plate or other cell culture
vessel of equivalent surface area. After culturing the
colony-derived cells in a 5% CO.sub.2 (atmospheric O.sub.2) cell
culture incubator at 37.degree. C. for about 14 hours, the medium
is replaced. Subsequently, the medium is replaced about every two
days until about 8 days later when a second subculture is carried
out.
[0272] In some embodiments, in the first subculture, the medium is
removed, the cells are washed with Hank's balanced salt solution,
and Detachment Medium For Primate ES Cells (ReproCell, Tokyo,
Japan) is then added to the cells and incubated at 37.degree. C.
for 10 minutes. After the incubation, MC-ES medium (2 ml) is added
to the resulting cell suspension to quench the activity of the
Detachment Medium. The cell suspension is then transferred to a
centrifuge tube, and centrifuged at 200.times.g at 4.degree. C. for
5 minutes. The supernatant is removed, the cell pellet is
resuspended in MC-ES medium, and the resuspended cells are plated
on four wells of a MEF-coated 24-well plate and cultured for about
seven days until a second subculture is prepared.
[0273] In the second subculture, prepared by the method described
above, cells are plated on a 60 mm cell culture dish coated with
Matrigel.TM. at a concentration of 20 .mu.g/cm2. About eight days
later (approximately 5 weeks after initiating forced expression of
IFs), a third subculture is prepared in which cells are plated on
two Matrigel.TM.-coated 60 mm cell culture dishes, one of which can
subsequently be used for gene expression analysis and the other for
continued passaging as described below. One of the subcultures is
used for gene expression analysis, as described herein, and the
other is passaged as needed to maintain a cell line derived from
the induced cell clone.
[0274] H. Passaging and Maintaining Induced Cells
[0275] After subcloning, the induced cells may be subcultured about
every 5 to 7 days. In some cases, the cells are washed with Hank's
balanced salt solution, and dispase or Detachment Medium For
Primate ES Cells is added, and incubated at 37.degree. C. for 5 to
10 minutes. When approximately more than half of the colonies are
detached, MC-ES medium is added to quench enzymatic activity of the
detachment medium, and the resulting cell/colony suspension is
transferred to a centrifuge tube. Colonies in the suspension are
allowed to settle on the bottom of the tube, the supernatant is
carefully removed, and MC-ES medium is then added to resuspend the
colonies. After examining the size of the colonies, any extremely
large ones are broken up into smaller sizes by slow up and down
pipetting. Appropriately sized colonies are plated on a
matrigel-coated plastic culture dish with a base area of about 3 to
6 times that before subculture. For example, the cells may be split
from about 1:6 to about 1:3, e.g., about 1:6, 1:5, 1:4, or 1:3.
[0276] Examples of culture media useful for culturing human
pluripotent stem cells induced from undifferentiated stem cells
present in a human postnatal tissue of the present invention
include, but are not limited to, the ES medium, and a culture
medium suitable for culturing human ES cells such as
MEF-conditioned ES medium (MC-ES) or other medium described herein,
e.g., mTeSR1.TM.. In some examples, the cells are maintained in the
presence of a ROCK inhibitor, as described herein.
IV. Analysis of Induced Cells
[0277] Cell colonies subcultured from those initially identified on
the basis of morphological characteristics may be assayed for any
of a number of properties associated with pluripotent stem cells,
including, but not limited to, expression of ALP activity,
expression of ES cell marker genes, expression of protein markers,
hypomethylation of Oct3/4 and Nanog promoters relative to a
parental cells, long term self-renewal, normal diploid karyotype,
and the ability to form a teratoma comprising ectodermal,
mesodermal, and endodermal tissues.
[0278] A number of assays and reagents for detecting ALP activity
in cells (e.g., in fixed cells or in living cells) are known in the
art. In an exemplary embodiment, colonies to be analyzed are fixed
with a 10% formalin neutral buffer solution at room temperature for
about 5 minutes, e.g., for 2 to 5 minutes, and then washed with
PBS. A chromogenic substrate of ALP, 1 step BCIP
(5-Bromo-4-Chloro-3'-Indolyphosphate p-Toluidine Salt) and NBT
(Nitro-Blue Tetrazolium Chloride) manufactured by Pierce (Rockford,
Ill.) is then added and reacted at room temperature for 20 to 30
minutes. Cells having ALP activity are stained blue-violet.
[0279] Putative iPS cell colonies tested for ALP activity may then
be assayed for expression of a series of human embryonic stem cell
marker (ESCM) genes including, but not limited to, Nanog, TDGF1,
Dnmt3b, Zfp42, FoxD3, GDF3, CYP26A1, TERT, Oct 3/4, Sox2, Sal14,
and HPRT. See, e.g., Assou et al., (2007), Stem Cells, 25:961-973.
Many methods for gene expression analysis are known in the art.
See, e.g., Lorkowski et al., (2003), Analysing Gene Expression, A
Handbook of Methods: Possibilities and Pitfalls, Wiley-VCH.
Examples of suitable nucleic acid-based gene expression assays
include, but are not limited to, quantitative RT-PCR (qRT-PCR),
microarray hybridization, dot blotting, RNA blotting, RNAse
protection, and SAGE.
[0280] In some embodiments, levels of ESCM gene mRNA expression
levels in putative iPS cell colonies are determined by qRT-PCR.
Putative iPS cell colonies are harvested, and total RNA is
extracted using the "Recoverall total nucleic acid isolation kit
for formaldehyde- or paraformaldehyde-fixed, paraffin-embedded
(FFPE) tissues" (manufactured by Ambion, Austin, Tex.). In some
instances, the colonies used for RNA extraction are fixed colonies,
e.g., colonies that have been tested for ALP activity. The colonies
can be used directly for RNA extraction, i.e., without prior
fixation. In an exemplary embodiment, after synthesizing cDNA from
the extracted RNA, the target gene is amplified using the
TaqMan.RTM. PreAmp mastermix (manufactured by Applied Biosystems,
Foster City, Calif.). Real-time quantitative PCR is performed using
an ABI Prism 7900HT using the following PCR primer sets (from
Applied Biosystems) for detecting mRNA of the above-mentioned ESCM
genes: Nanog, Hs02387400_g1, Dnmt3b, Hs00171876_m1, FoxD3,
Hs00255287_s1, Zfp42, Hs01938187_s1, TDGF1, Hs02339499_g1, TERT,
Hs00162669_m1, GDF3, Hs00220998_m1, CYP26A1, Hs00175627_m1, GAPDH,
Hs99999905_m1).
[0281] Putative iPS cell colonies may be assayed by an
immunocytochemistry method for expression of protein markers
including, but not limited to, SSEA-3, SSEA-4, TRA-1-60, TRA-1-81,
CD9, CD24, Thy-1, and Nanog. A wide range of immunocytochemistry
assays, e.g., fluorescence immunocytochemistry assays, are known as
described in, e.g., Harlow et al., (1988), Antibodies: A Laboratory
Manual 353-355, Cold Spring Harbor Laboratory, Cold Spring Harbor,
N.Y., and see also, The Handbook--A Guide to Fluorescent Probes and
Labeling Technologies (2004), Molecular Probes, Inc., Eugene,
Oreg.
[0282] In an exemplary embodiment, expression of one or more of the
above-mentioned protein markers in putative iPS cell colonies is
assayed as follows. Cultured cells are fixed with 10% formaldehyde
for 10 min and blocked with 0.1% gelatin/PBS at room temperature
for about an hour. The cells are incubated overnight at 4.degree.
C. with primary antibodies against SSEA-3 (MC-631; Chemicon),
SSEA-4 (MC813-70; Chemicon), TRA-1-60 (ab16288; abcam), TRA-1-81
(ab16289; abcam), CD9 (M-L13; R&D systems), CD24 (ALB9; abcam),
Thy1 (5E10; BD Bioscience), or Nanog (MAB1997; R&D Systems).
For Nanog staining, cells are permeabilized with 0.1% Triton
X-100/PBS before blocking. The cell colonies are washed with PBS
three times, then incubated with AlexaFluor 488-conjugated
secondary antibodies (Molecular Probes) and Hoechst 33258 (Nacalai)
at room temperature for 1 h. After further washing, fluorescence is
detected with a fluorescence microscope, e.g., Axiovert 200M
microscope (Carl Zeiss).
[0283] A. Methylation Analysis
[0284] In some embodiments, a characteristic of the induced cells
is reduced methylation of the genomic promoters of Oct3/4 and Nanog
relative to those of their parental cells. Suitable Oct3/4 promoter
regions to be analyzed include, but are not limited to, the Oct3/4
proximal promoter including conserved region 1 (CR1) and the Oct3/4
promoter distal enhancer including CR4. Suitable Nanog promoter
regions to be analyzed include, but are not limited to, the Nanog
proximal promoter including the Oct3/4 and Sox2 binding sites. See,
e.g., Rodda et al., (2005), J. Biol. Chem., 280:24731-24737 and
Yang et al., (2005), J Cell Biochem., 96:821-830. A number of
methods for the quantitative analysis of genomic DNA are known as
described in, e.g., Brena et al., (2006), J Mol. Med.,
84(5):365-377. In an exemplary embodiment, genomic DNA isolated
from putative induced cells and cells used for a comparison is
isolated and treated with bisulfite. Bisulfite-treated genomic DNA
is then PCR-amplified with primers containing a T7 promoter
sequence. Afterwards, RNA transcripts are generated using T7
polymerase and then treated with RNAse A to generate
methylation-specific cleavage products. Methylation of individual
CpG sites is assessed by MALDI-TOF mass spectrometry of the
cleavage products. A detailed description of the method is provided
in, e.g., Ehich et al., (2005), Proc. Natl. Acad. Sci. USA,
102:15785-15790.
[0285] B. Self-Renewal Assay
[0286] One of the characteristics of stem cells is their ability to
proliferate continuously without undergoing senescence.
Accordingly, induced cells are assessed for their ability to be
passaged continuously in vitro. In some cases, the induced cells
are assayed for their ability to be passaged for at least about 30
to at least about 100 times in vitro, e.g., about 33, 35, 40, 45,
51, 56, 60, 68, 75, 80, 90, 93, 100, or any other number of
passages from at least about 30 to at least about 100 passages.
[0287] In another evaluation, induced cells are assayed for their
ability to proliferate for a period of about 30 days to about 500
days from initiation of forced expression of IFs in parental cells,
e.g., 40 days, 50 days, 60 days, 70 days, 80 days, 100 days, 150
days, 180 days, 200 days, 250 days, 300 days, 400 days, 450 days or
any other period from about 30 days to about 500 days from
initiation of forced expression of IFs in the parental cells. In
some embodiments, long-term self-renewal of induced cells is
determined when the cells are passaged in a defined medium (e.g.,
mTeSR1 medium) and in the absence of feeder cells, e.g., mTeSR1
medium as described herein. In other embodiments, cells are
passaged in MC-ES medium as described herein.
[0288] C. Karyotyne Analysis
[0289] As another possible analysis, induced cells are assessed for
diploidy and a normal, stable karyotype, e.g., stable after the
cells of have been passaged for at least one year in vitro. A
number of karotype analysis methods are known in the art. In some
embodiments, the karyotype analysis method is multicolor FISH as
described in, e.g., Bayani et al., (2004), Curr. Protoc. Cell
Biol., Chapter 22:Unit 22.5. In other embodiments, the karyotype
analysis includes a molecular karyotype analysis as described in,
e.g., Vermeesch et al., (2007), Eur. J. Hum. Genet., 15(11):
1105-1114. In an exemplary embodiment, induced cells are pretreated
with 0.02 .mu.g/ml colecemid for about 2 to about 3 hours,
incubated with about 0.06 to about 0.075M KCl for about 20 minutes,
and then fixed with Camoy's fixative. Afterwards, for multicolor
FISH analysis, cells are hybridized with multicolor FISH probes,
e.g., those in the Star*FISH.COPYRGT. Human Multicolour FISH
(M-FISH) Kit from Cambio, Ltd (Cambridge, UK).
[0290] D. Teratoma Analysis
[0291] It is generally believed that pluripotent stem cells have
the ability to form a teratoma, comprising ectodermal, mesodermal,
and endodermal tissues, when injected into an immunocompromised
animal. Induced cells or induced pluripotent stem cells (iPS) or ES
cell-like pluripotent stem cells may refer to cells having an in
vitro long-term self-renewal ability and the pluripotency of
differentiating into three germ layers, and said pluripotent stem
cells may form a teratoma when transplanted into a test animal such
as mouse.
[0292] The induced cells may be assessed for pluripotency in a
teratoma formation assay in an immunocompromised animal model. The
immunocompromised animal may be a rodent that is administered an
immunosuppressive agent, e.g., cyclosporin or FK-506. For example,
the immunocompromised animal model may be a SCID mouse. About
0.5.times.10.sup.6 to about 2.0.times.10.sup.6, e.g.,
0.6.times.10.sup.6, 0.8.times.10.sup.6, 1.0.times.10.sup.6,
1.2.times.10.sup.6, 1.5.times.10.sup.6, 1.7.times.10.sup.6, or
other number of induced cells from about 0.5.times.10.sup.6 to
about 2.0.times.10.sup.6 induced cells/mouse may be injected into
the medulla of a testis of a 7- to 8-week-old immunocompromised
animal. After about 6 to about 8 weeks, the teratomas are excised
after perfusing the animal with PBS followed by 10% buffered
formalin. The excised teratomas are then subjected to
immunohistological analysis. One method of distinguishing human
teratoma tissue from host (e.g., rodent) tissue includes
immunostaining for the human-specific nuclear marker HuNu.
Immunohistological analysis includes determining the presence of
ectodermal (e.g., neuroectodermal), mesodermal, and endodermal
tissues. Protein markers for ectodermal tissue include, but are not
limited to, nestin, GFAP, and integrin .beta.1. Protein markers for
mesodermal tissue include, but are not limited to, collagen II,
Brachyury, and osteocalcin. Protein markers for endodermal tissue
include, but are not limited to, .alpha.-fetoprotein (.alpha.-FP)
and HNF3beta.
[0293] E. Gene Expression
[0294] In some embodiments, gene expression analysis is performed
on putative iPS cell colonies. Such gene expression analysis may
include a comparison of gene expression profiles from a putative
iPS cell colony with those of one or more cell types, including but
not limited to, (i) parental cells, i.e., one or more cells from
which the putative iPS cell colony was induced; (ii) a human ES
cell line; or (iii) an established iPS cell line. As known in the
art, gene expression data for human ES cell lines are available
through public sources, e.g., on the world wide web in the NCBI
"Gene Expression Omnibus" database. See, e.g., Barrett et al.,
(2007), Nuc. Acids Research, D760-D765. Thus, in some embodiments,
comparison of gene expression profiles from a putative iPS colony
to those of an ES cell line entails comparison experimentally
obtained data from a putative iPS cell colony with gene expression
data available through public databases. Examples of human ES cell
lines for which gene expression data are publicly available
include, but are not limited to, hE14 (GEO data set accession
numbers GSM151739 and GSM151741), Sheff4 (GEO Accession Nos
GSM194307, GSM194308, and GSM193409), h_ES 01 (GEO Accession No.
GSM194390), h_H9 (GEO Accession No. GSM194392), and h_ES BG03 (GEO
Accession No. GSM194391).
[0295] It is also possible to accomplish gene expression by
analyzing the total RNA isolated from one or more iPS cell lines by
a nucleic acid microarray hybridization assay. Examples of suitable
microarray platforms for global gene expression analysis include,
but are not limited to, the Human Genome U133 plus 2.0 microarray
(Affymetrix) and the Whole Human Genome Oligo Micoarray (Agilent).
A number of analytical methods for comparison of gene expression
profiles are known as described in, e.g., Suarez-Farinas et al.,
(2007), Methods Mol Biol., 377:139-152, Hardin et al., (2007), BMC
Bioinformatics, 8:220-232, Troyanskaya et al., (2002),
Bioinformatics, 18(11):1454-1461, and Knudsen (2002), A Biologist's
Guide to Analysis of DNA Microarray Data, John Wiley & Sons. In
some embodiments, gene expression data from cells produced by the
methods described herein are compared to those obtained from other
cell types including, but not limited to, human ES cell lines,
parental cells, and multipotent stem cell lines. Suitable
statistical analytical metrics and methods include, but are not
limited to, the Pearson Correlation, Euclidean Distance,
Hierarchical Clustering (See, e.g., Eisen et al., (1998), Proc.
Natl. Acad. Sci. USA, 95(25):14863-14868), and Self Organizing Maps
(See, e.g., Tamayo et al., (1999), Proc. Natl. Acad. Sci. USA,
96(6):2907-2912.
V. Description of Induced Cells
[0296] The induced cells may share certain properties associated
with pluripotent or multipotent stem cells, including, but not
limited to: expression of ALP activity, expression of ES cell
marker genes, expression of protein markers, higher or lower
expression of genetic markers compared to ES cells or parental
cells, hypomethylation of certain promoters (e.g., Oct3/4 and
Nanog) relative to parental cells, long-term self-renewal ability,
normal diploid karyotype, morphological characteristics and the
ability to form a teratoma comprising ectodermal, mesodermal, and
endodermal tissue. The compositions of induced cells may include
the cells and another component such as a supplement to culture
medium.
[0297] The induced cells may be positive for alkaline phosphatase
(ALP) activity. They may express ALP and express from 2 to 10
(e.g., 3, 4, 5, 6, 7, 8, 9, or 10) of the following ES cell marker
genes: TDGF1, Dnmt3b, FoxD3, GDF3, Cyp26a1, TERT, zfp42, Sox2, Oct
3/4, and Nanog. In some cases, the induced cells express Tert or
Cyp26a1. In some cases, the induced cells express both Tert and
Cyp26a1. In some cases, the induced cells are positive for ALP
activity, and express all of the foregoing ES-cell marker genes. In
some cases, the induced cells are positive for ALP activity and
express Nanog. In some cases, the induced cells are positive for
ALP activity and express one or more: TERT, CYP26A1, or GDF3. In
some cases, the induced cells are positive for ALP activity and
express one or more: Nanog, TDGF, and Dnmt3b
[0298] The induced cells may express two or more of the following
marker proteins: SSEA-3, SSEA-4, TRA-1-60, TRA-1-81, CD9, CD24, or
Thy-1. In some cases, the induced cells express all of the
foregoing marker proteins. In exemplary embodiments, the human
pluripotent stem cells express cell surface antigens SSEA-3,
SSEA-4, TRA-1-60, TRA-1-81, CD9, CD24, and CD90, and ES cell marker
genes Nanog, Oct3/4, TDGF1, Dnmt3b, GABRB3, GDF3, Zfp42, ALP, CD9,
and Thy-1.
[0299] The induced cells may exhibit a difference in the expression
level, e.g., a higher or lower expression level, of one or more
genes (e.g., endogenous genes), compared to the expression levels
of those genes in one or more embryonic stem cells, e.g., a human
embryonic stem cell. Preferably, differences in gene expression are
statistically significant by one or more statistical tests (e.g.,
Student's t-test or other parametric or non-parametric tests). For
example, the difference in expression may have a p value of less
than or equal to 0.05, less than or equal to 0.01, or less or equal
to 0.001.
[0300] The number of genes exhibiting different expression levels
in the induced cells and embryonic stem cells, can be, e.g., 1 to
1000 genes, 1 to 700 genes, 1 to 500 genes, 1 to 300 genes, 1 to
200 genes, 1 to 100 genes, 1 to 50 genes, 3 to 20 genes, 5 to 20
genes, 5 to 50 genes, 10 to 50 genes, 20 to 50 genes, 30 to 100
genes, or 50 to 100 genes, 1 or more genes, 2 or more genes, 3 or
more genes, 5 or more genes, 10 or more genes, 15 or more genes, 20
or more genes, 50 or more genes, 70 or more genes, or 100 or more
genes, 500 or more genes, 1000 or more genes, 9 genes, 12 genes, 42
genes, 70 genes, or 100 genes. The differences in gene expression
levels may be at least 2 fold, e.g., at least 3 fold, 4 fold, 5
fold, 6 fold, 7 fold, 10 fold, 2 to 50 fold, 2 to 30 fold, 2 to 20
fold, 2 to 10 fold, or 2 to 5 fold.
[0301] In some cases, the genes exhibiting different expression
levels in the induced cells and embryonic stem cells exhibit a
higher level of expression in the induced cells than in human
embryonic stem cells. In some cases, the genes expressing the
higher level of expression in the induced cells are 1 or more, 2 or
more, 3 or more, 4 or more, 5 or more, 10 or more, 15 or more, 25
or more, 50 or more, 75 or more, 100 or more, or 200 or more of the
genes listed in Tables 13, 15, or 16. In some cases, the genes
exhibiting a different expression level from in the induced cells
compared to the embryonic stem cells are expressed at a higher
level in human embryonic stem cells compared to the induced cells.
In some cases, the genes expressed at a higher level in human
embryonic stem cells are a 1 or more, 2 or more, 3 or more, 4 or
more, 5 or more, 10 or more, 15 or more, 25 or more, 50 or more, 75
or more, 100 or more, or 200 or more of the genes listed in Table
14.
[0302] In certain cases, a gene or a set of genes exhibits a higher
expression level in the induced cells when compared to embryonic
stem cells and when compared to the parental cells, e.g.,
fibroblasts. For example, the genes exhibiting higher expression in
the induced cells than in both embryonic stem cells and parental
cells are 1 or more, 2 or more, 3 or more, 4 or more, 5 or more, 10
or more, 15 or more, 25 or more, 50 or more, 75 or more, 100 or
more, or 200 or more of the genes listed in Table 15.
[0303] A gene or set of genes may be expressed in the induced cells
at a level that is closer to the expression level in parental cells
(e.g., fibroblasts) than its expression level in embryonic stem
cells. A gene or set of genes may, for example, exhibit a higher
expression level in the induced cells when compared to embryonic
stem cells but not when compared to parental cells, e.g.,
fibroblasts. Genes exhibiting higher expression level in the
induced cells than in embryonic cells but not the parental cells
may be 1 or more, 2 or more, 3 or more, 4 or more, 5 or more, 10 or
more, 15 or more, 25 or more, 50 or more, 75 or more, 100 or more,
or 200 or more of the genes listed in Table 16.
[0304] The lengths of the telomeres within the induced cells may be
shorter than that of telomeres at the ends of chromosomes within
embryonic stem cells. In some cases, the telomeres in the induced
cells are at least 0.1 kB, at least 0.25 kB, at least 0.5 kB, at
least 1 kB, at least 2 kB, at least 3 kB, at least 4 kB, or at
least 5 kB shorter than telomeres within embryonic stem cell lines.
In certain instances, the induced cells have telomeres that are
shorter than at least 1, at least 2, at least 3, at least 4, at
least 5, at least 6, at least 8, at least 10, or at least 15
embryonic stem cell lines.
[0305] The induced cells may comprise exogenous genes (or
transgenes) encoding IFs. The induced cells may comprise exogenous
genes encoding any set of IFs described herein. For example, the
induced cells may comprise four exogenous genes encoding Oct 3/4,
Sox2, Klf4, and c-Myc polypeptides. In some cases, the induced
cells comprise four exogenous genes encoding Oct 3/4, Sox2, Klf4,
and c-Myc polypeptides, but not other exogenous genes encoding
induction factors. In other cases, the induced cells may comprise
exogenous genes encoding Oct 3/4, Sox2, and Klf4 polypeptides, but
not an exogenous gene encoding a c-Myc polypeptide. In some cases,
the induced cells contain exogenous genes consisting essentially of
three genes encoding Oct 3/4, Sox2, and Klf4 polypeptides. In some
cases, the human pluripotent stem cells carry at least a single
copy of exogenous genes encoding Oct3/4, Sox2, Klf4, and c-Myc. In
some cases, any of the induced cells containing exogenous genes
also contain an exogenous gene encoding a polypeptide comprising
the amino acid sequence of mouse-derived cationic transporter 1
(mCAT-1), a receptor for ecotropic retroviruses.
[0306] At some point after introduction of exogenous genes, one or
more of the exogenous genes may be silenced. In some cases, the
Oct3/4 exogenous gene is silenced; the Klf4 exogenous gene is
silenced; the Sox2 exogenous gene is silenced; or the c-Myc
transgene is silenced. In some cases, all four exogenous genes
(e.g., Oct3/4; Sox2; Klf4; and c-Myc) are silenced. In some cases,
all three exogenous genes (e.g., Oct3/4; Sox2; and Klf4) are
silenced.
[0307] The induced cells may share all of the identifying
characteristics of induced pluripotent stem (iPS) cell lines: 1-8;
2-4; or 3-2, described herein. Cell line iPS 1-8 is deposited with
the International Patent Organism Depositary (IPOD) in compliance
with the terms of the Budapest Treaty. The certificate number for
the deposit is FERM BP-10956. The address of IPOD is as
follows:
[0308] International Patent Organism Depositary (IPOD)
[0309] AIST Tsukuba Central 6
[0310] 1-1, Higashi 1-Chome
[0311] Tsukuba-shi, Ibaraki-Ken 305-8566
[0312] Japan
[0313] In some cases, human pluripotent or multipotent stem cells
are induced from undifferentiated stem cells present in a human
postnatal tissue in which the Tert, Nanog, Oct3/4 and Sox2 genes
have not undergone epigenetic inactivation. In some cases, the
cells are induced from differentiated cells present in tissue or
from a combination of differentiated and undifferentiated cells
present in tissue.
[0314] The promoter regions of Nanog and Oct3/4 in the induced
cells may be hypo- or de-methylated compared to the parental
fibroblasts. The induced cells may be stem cells that have
long-term self-renewal ability when cultured under human ES
cell-culture conditions.
[0315] One of the characteristics of stem cells is their ability to
proliferate continuously without undergoing senescence.
Accordingly, induced cells may be passaged continuously in vitro.
In some cases, the induced cells are able to be passaged for at
least about 30 to at least about 100 times in vitro, e.g., about
33, 35, 40, 45, 51, 56, 60, 68, 75, 80, 90, 93, 100, or other
number of passages from at least about 30 to at least about 100
passages. The induced cells may be able to proliferate for a period
of about 30 days to about 500 days from initiation of forced
expression of IFs in parental cells, e.g., 40 days, 50 days, 60
days, 70 days, 80 days, 100 days, 150 days, 180 days, 200 days, 250
days, 300 days, 400 days, 450 days, or other number of days from
about 30 to about 500 days. In some embodiments, the induced cells
proliferate for greater than 500 days.
[0316] Typically, the induced cells are able to proliferate with an
undifferentiated phenotype under atmospheric oxygen conditions,
(e.g., about 21% oxygen). In other cases, the induced cells
proliferate as undifferentiated cells under oxygen conditions
ranging from greater than 5% oxygen to about 21% oxygen. Generally,
the induced cells proliferate in colonies.
[0317] The induced cells may have in vitro pluripotency
capabilities, such as the ability to differentiate into ectoderm,
mesoderm and endoderm under conditions for inducing in vitro
differentiation of human ES cells; and such cells may further have
a potential of differentiating into primordial germ cells (e.g.,
sperm, oocytes).
[0318] In some cases, the induced human pluripotent stem cells and
the parental cells (e.g., undifferentiated stem cells present in a
human postnatal tissue) have identical or almost identical SNP
genotypes. In some cases, the induced cells and the parental cells
have the same HLA type (e.g., HLA-A, B, Cw, DR, DQ, DP, and
Bw).
[0319] The compositions provided herein may include other
components in addition to the induced cells, or in addition to the
cells differentiated from the induced cells. In some cases, the
composition comprises such cells and a cryopreservative agent,
e.g., a cryopreservation medium described in, U.S. patent
application Ser. Nos. 10/902,571; 11/142,651; or in Ha et al.,
(2005), Hum. Reprod., 20(7):1779-1785.
[0320] The composition may comprise such cells and a culture
medium, e.g., human ES culture medium. In some cases, the culture
medium is a medium comprised of one or more growth factors, for
example: FGF-2, bFGF, PDGF, EGF, IGF, or derivatives thereof. In
some examples, the composition comprises human induced pluripotent
or multipotent stem cells and a medium comprising FGF-2 or bFGF or
derivatives thereof. In other instances, the composition comprises
human induced pluripotent or multipotent stem cells and a medium
comprising human ES culture medium and FGF-2 or bFGF, or
derivatives thereof. In still another example, the composition
comprises human induced pluripotent or multipotent stem cells and
MC-ES medium described herein.
[0321] In some cases, the concentration of bFGF or FGF2 in the
culture medium is from 2 ng/ml to about 50 ng/ml, e.g., about 2
ng/ml, 3 ng/ml, 4 ng/ml, 5 ng/ml, 6 ng/ml, 7 ng/ml, 8 ng/ml, 10
ng/ml, 12 ng/ml, 14 ng/ml, 15 ng/ml, 17 ng/ml, 20 ng/ml, 25 ng/ml,
30 ng/ml, 35 ng/ml, 40 ng/ml, 45 ng/ml, 50 ng/ml. The concentration
of bFGF or FGF2 may also be from about 4 ng/ml to about 10 ng/ml;
from about 4 ng/ml to about 20 ng/ml; from about 10 ng/ml to about
30 ng/ml; from about 5 ng/ml to about 40 ng/ml; or from about 10
ng/ml to about 50 ng/ml. In other cases, higher concentrations of
bFGF or FGF2 may be used, e.g., from about 50 ng/ml to about 100
ng/ml; from about 50 ng/ml to about 75 ng/ml. Similarly, the
culture medium can contain growth factors other than bFGF or FGF2
that are concentrations from about 2 ng/ml to about 100 ng/ml, as
described herein.
VI. Cell Differentiation
[0322] The induced cells may be differentiated into cell-types of
various lineages. Examples of differentiated cells include any
differentiated cells from ectodermal (e.g., neurons and
fibroblasts), mesodermal (e.g., cardiomyocytes), or endodermal
(e.g., pancreatic cells) lineages. The differentiated cells may be
one or more: pancreatic beta cells, neural stem cells, neurons
(e.g., dopaminergic neurons), oligodendrocytes, oligodendrocyte
progenitor cells, hepatocytes, hepatic stem cells, astrocytes,
myocytes, hematopoietic cells, or cardiomyocytes.
[0323] The differentiated cells derived from the induced cells may
be terminally differentiated cells, or they may be capable of
giving rise to cells of a specific lineage. For example, induced
cells can be differentiated into a variety of multipotent cell
types, e.g., neural stem cells, cardiac stem cells, or hepatic stem
cells. The stem cells may then be further differentiated into new
cell types, e.g., neural stem cells may be differentiated into
neurons; cardiac stem cells may be differentiated into
cardiomyocytes; and hepatic stem cells may be differentiated into
hepatocytes.
[0324] There are numerous methods of differentiating the induced
cells into a more specialized cell type. Methods of differentiating
induced cells may be similar to those used to differentiate stem
cells, particularly ES cells, MSCs, MAPCs, MIAMI, hematopoietic
stem cells (HSCs). In some cases, the differentiation occurs ex
vivo; in some cases the differentiation occurs in vivo.
[0325] Any known method of generating neural stem cells from ES
cells may be used to generate neural stem cells from induced cells,
See, e.g., Reubinoff et al., (2001), Nat, Biotechnol.,
19(12):1134-40. For example, neural stem cells may be generated by
culturing the induced cells as floating aggregates in the presence
of noggin, or other bone morphogenetic protein antagonist, see
e.g., Itsykson et al., (2005), Mol. Cell Neurosci., 30(1):24-36. In
another example, neural stem cells may be generated by culturing
the induced cells in suspension to form aggregates in the presence
of growth factors, e.g., FGF-2, Zhang et al., (2001), Nat.
Biotech., (19): 1129-1133. In some cases, the aggregates are
cultured in serum-free medium containing FGF-2. In another example,
the induced cells are co-cultured with a mouse stromal cell line,
e.g., PA6 in the presence of serum-free medium comprising FGF-2. In
yet another example, the induced cells are directly transferred to
serum-free medium containing FGF-2 to directly induce
differentiation.
[0326] Neural stems derived from the induced cells may be
differentiated into neurons, oligodendrocytes, or astrocytes.
Often, the conditions used to generate neural stem cells can also
be used to generate neurons, oligodendrocytes, or astrocytes.
[0327] Dopaminergic neurons play a central role in Parkinson's
Disease and other neurodegenerative diseases and are thus of
particular interest. In order to promote differentiation into
dopaminergic neurons, induced cells may be co-cultured with a PA6
mouse stromal cell line under serum-free conditions, see, e.g.,
Kawasaki et al., (2000) Neuron, 28(1):31-40. Other methods have
also been described, see, e.g., Pomp et al., (2005), Stem Cells
23(7):923-30; U.S. Pat. No. 6,395,546, e.g., Lee et al., (2000),
Nature Biotechnol., 18:675-679
[0328] Oligodendrocytes may also be generated from the induced
cells. Differentiation of the induced cells into oligodendrocytes
may be accomplished by known methods for differentiating ES cells
or neural stem cells into oligodendrocytes. For example,
oligodendrocytes may be generated by co-culturing induced cells or
neural stem cells with stromal cells, e.g., Hermann et al (2004), J
Cell Sci. 117(Pt 19):4411-22. In another example, oligodendrocytes
may be generated by culturing the induced cells or neural stem
cells in the presence of a fusion protein, in which the Interleukin
(IL)-6 receptor, or derivative, is linked to the IL-6 cytokine, or
derivative thereof. Oligodendrocytes can also be generated from the
induced cells by other methods known in the art, see, e.g. Kang et
al., (2007) Stem Cells 25, 419-424.
[0329] Astrocytes may also be produced from the induced cells.
Astrocytes may be generated by culturing induced cells or neural
stem cells in the presence of neurogenic medium with bFGF and EGF,
see e.g., Brustle et al., (1999), Science, 285:754-756.
[0330] Induced cells may be differentiated into pancreatic beta
cells by methods known in the art, e.g., Lumelsky et al., (2001)
Science, 292:1389-1394; Assady et al., (2001), Diabetes,
50:1691-1697; D'Amour et al., (2006), Nat. Biotechnol.,
24:1392-1401; D'Amour et al., (2005), Nat. Biotechnol.
23:1534-1541. The method may comprise culturing the induced cells
in serum-free medium supplemented with Activin A, followed by
culturing in the presence of serum-free medium supplemented with
all-trans retinoic acid, followed by culturing in the presence of
serum-free medium supplemented with bFGF and nicotinamide, e.g.,
Jiang et al., (2007), Cell Res., 4:333-444. In other examples, the
method comprises culturing the induced cells in the presence of
serum-free medium, activin A, and Wnt protein from about 0.5 to
about 6 days, e.g., about 0.5, 1, 2, 3, 4, 5, 6, days; followed by
culturing in the presence of from about 0.1% to about 2%, e.g.,
0.2%, FBS and activin A from about 1 to about 4 days, e.g., about
1, 2, 3, or 4 days; followed by culturing in the presence of 2%
FBS, FGF-10, and KAAD-cyclopamine (keto-N-aminoethylaminocaproyl
dihydro cinnamoylcyclopamine) and retinoic acid from about 1 to
about 5 days, e.g., 1, 2, 3, 4, or 5 days; followed by culturing
with 1% B27, gamma secretase inhibitor and extendin-4 from about 1
to about 4 days, e.g., 1, 2, 3, or 4 days; and finally culturing in
the presence of 1% B27, extendin-4, IGF-1, and HGF for from about 1
to about 4 days, e.g., 1, 2, 3, or 4 days.
[0331] Hepatic cells or hepatic stem cells may be differentiated
from the induced cells. For example, culturing the induced cells in
the presence of sodium butyrate may generate hepatocytes, see e.g.,
Rambhatla et al., (2003), Cell Transplant, 12: 1-11. In another
example, hepatocytes may be produced by culturing the induced cells
in serum-free medium in the presence of Activin A, followed by
culturing the cells in fibroblast growth factor-4 and bone
morphogenetic protein-2, e.g., Cai et al., (2007), Hematology,
45(5): 1229-39. In an exemplary embodiment, the induced cells are
differentiated into hepatic cells or hepatic stem cells by
culturing the induced cells in the presence of Activin A from about
2 to about 6 days, e.g., about 2, about 3, about 4, about 5, or
about 6 days, and then culturing the induced cells in the presence
of hepatocyte growth factor (HGF) for from about 5 days to about 10
days, e.g., about 5, about 6, about 7, about 8, about 9, or about
10 days.
[0332] The induced cells may also be differentiated into cardiac
muscle cells. Inhibition of bone morphogenetic protein (BMP)
signaling may result in the generation of cardiac muscle cells (or
cardiomyocytes), see, e.g., Yuasa et al., (2005), Nat. Biotechnol.,
23(5):607-11. Thus, in an exemplary embodiment, the induced cells
are cultured in the presence of noggin for from about two to about
six days, e.g., about 2, about 3, about 4, about 5, or about 6
days, prior to allowing formation of an embryoid body, and
culturing the embryoid body for from about 1 week to about 4 weeks,
e.g., about 1, about 2, about 3, or about 4 weeks.
[0333] In other examples, cardiomyocytes may be generated by
culturing the induced cells in the presence of leukemia inhibitory
factor (LIF), or by subjecting them to other methods known in the
art to generate cardiomyocytes from ES cells, e.g., Bader et al.,
(2000), Circ. Res., 86:787-794, Kehat et al., (2001), J. Clin.
Invest., 108:407-414; Mummery et al., (2003), Circulation,
107:2733-2740.
[0334] Examples of methods to generate other cell-types from
induced cells include: (1) culturing induced cells in the presence
of retinoic acid, leukemia inhibitory factor (LIF), thyroid hormone
(T3), and insulin in order to generate adipoctyes, e.g., Dani et
al., (1997), J. Cell Sci., 110: 1279-1285; (2) culturing induced
cells in the presence of BMP-2 or BMP-4 to generate chondrocytes,
e.g., Kramer et al., (2000), Mech. Dev., 92:193-205; (3) culturing
the induced cells under conditions to generate smooth muscle, e.g.,
Yamashita et al., (2000), Nature, 408:92-96; (4) culturing the
induced cells in the presence of beta-1 integrin to generate
keratinocytes, e.g., Bagutti et al., (1996), Dev. Biol.,
179:184-196; (5) culturing the induced cells in the presence of
Interleukin-3 (IL-3) and macrophage colony stimulating factor to
generate macrophages, e.g., Lieschke and Dunn (1995), Exp. Hemat.,
23:328-334; (6) culturing the induced cells in the presence of IL-3
and stem cell factor to generate mast cells, e.g., Tsai et al.,
(2000), Proc. Natl. Acad. Sci. USA, 97:9186-9190; (7) culturing the
induced cells in the presence of dexamethasone and stromal cell
layer, steel factor to generate melanocytes, e.g., Yamane et al.,
(1999), Dev. Dyn., 216:450-458; (8) co-culturing the induced cells
with fetal mouse osteoblasts in the presence of dexamethasone,
retinoic acid, ascorbic acid, beta-glycerophosphate to generate
osteoblasts, e.g., Buttery et al., (2001), Tissue Eng., 7:89-99;
(9) culturing the induced cells in the presence of osteogenic
factors to generate osteoblasts, e.g., Sottile et al., (2003),
Cloning Stem Cells, 5:149-155; (10) overexpressing insulin-like
growth factor-2 in the induced cells and culturing the cells in the
presence of dimethyl sulfoxide to generate skeletal muscle cells,
e.g., Prelle et al, (2000), Biochem. Biophys. Res. Commun.,
277:631-638; (11) subjecting the induced cells to conditions for
generating white blood cells; or (12) culturing the induced cells
in the presence of BMP4 and one or more: SCF, FLT3, IL-3, IL-6, and
GCSF to generate hematopoietic progenitor cells, e.g., Chadwick et
al., (2003), Blood, 102:906-915.
[0335] In some cases, sub-populations of differentiated cells may
be purified or isolated. In some cases, one or more monoclonal
antibodies specific to the desired cell type are incubated with the
cell population and those bound cells are isolated. In other cases,
the desired subpopulation of cells expresses a reporter gene that
is under the control of a cell type specific promoter.
[0336] In a specific embodiment, the hygromycin B
phosphotransferase-EGFP fusion protein is expressed in a cell type
specific manner. The method of purifying comprises sorting the
cells to select green fluorescent cells and reiterating the sorting
as necessary, in order to obtain a population of cells enriched for
cells expressing the construct (e.g., hygromycin B
phosphotransferase-EGFP) in a cell-type-dependent manner. Selection
of desired sub-populations of cells may also be accomplished by
negative selection of proliferating cells with the herpes simplex
virus thymidine kinase/ganciclovir (HSVtk/GCV) suicide gene system
or by positive selection of cells expressing a bicistronic
reporter, e.g., Anderson et al. (2007) Mol. Ther.
(11):2027-2036.
VII. Cell Therapies
[0337] The induced cells, or cells differentiated from the induced
cells, may be used as a therapy to treat disease (e.g., a genetic
defect). The therapy may be directed at treating the cause of the
disease; or alternatively, the therapy may be to treat the effects
of the disease or condition. The induced cells may be transferred
to, or close to, an injured site in a subject; or the cells can be
introduced to the subject in a manner allowing the cells to
migrate, or home, to the injured site. The transferred cells may
advantageously replace the damaged or injured cells and allow
improvement in the overall condition of the subject. In some
instances, the transferred cells may stimulate tissue regeneration
or repair.
[0338] The transferred cells may be cells differentiated from
induced cells. The transferred cells also may be multipotent stem
cells differentiated from the induced cells. In some cases, the
transferred cells may be induced cells that have not been
differentiated.
[0339] The number of administrations of treatment to a subject may
vary. Introducing the induced and/or differentiated cells into the
subject may be a one-time event; but in certain situations, such
treatment may elicit improvement for a limited period of time and
require an on-going series of repeated treatments. In other
situations, multiple administrations of the cells may be required
before an effect is observed. The exact protocols depend upon the
disease or condition, the stage of the disease and parameters of
the individual subject being treated.
[0340] The cells may be introduced to the subject via any of the
following routes: parenteral, intravenous, intraarterial,
intramuscular, subcutaneous, transdermal, intratracheal,
intraperitoneal, or into spinal fluid.
[0341] The induced cells may be differentiated into cells and then
transferred to subjects suffering from a wide range of diseases or
disorders. Subjects suffering from neurological diseases or
disorders could especially benefit from stem cell therapies. In
some approaches, the induced cells may be differentiated into
neural stem cells or neural cells and then transplanted to an
injured site to treat a neurological condition, e.g., Alzheimer's
disease, Parkinson's disease, multiple sclerosis, cerebral
infarction, spinal cord injury, or other central nervous system
disorder, see, e.g., Morizane et al., (2008), Cell Tissue Res.,
331(1):323-326; Coutts and Keirstead (2008), Exp. Neurol.,
209(2):368-377; Goswami and Rao (2007), Drugs, 10(10):713-719.
[0342] For the treatment of Parkinson's disease, the induced cells
may be differentiated into dopamine-acting neurons and then
transplanted into the striate body of a subject with Parkinson's
disease. For the treatment of multiple sclerosis, neural stem cells
may be differentiated into oligodendrocytes or progenitors of
oligodendrocytes, which are then transferred to a subject suffering
from MS.
[0343] For the treatment of any neurologic disease or disorder, a
successful approach may be to introduce neural stem cells to the
subject. For example, in order to treat Alzheimer's disease,
cerebral infarction or a spinal injury, the induced cells may be
differentiated into neural stem cells followed by transplantation
into the injured site. The induced cells may also be engineered to
respond to cues that can target their migration into lesions for
brain and spinal cord repair, e.g., Chen et al., (2007), Stem Cell
Rev., 3(4):280-288.
[0344] Diseases other then neurological disorders may also be
treated by a stem cell therapy that uses cells differentiated from
induced cells, e.g., induced multipotent or pluripotent stem cells.
Degenerative heart diseases such as ischemic cardiomyopathy,
conduction disease, and congenital defects could benefit from stem
cell therapies, see, e.g. Janssens et al., (2006), Lancet,
367:113-121.
[0345] Pancreatic islet cells (or primary cells of the islets of
Langerhans) may be transplanted into a subject suffering from
diabetes (e.g., diabetes mellitus, type 1), see e.g., Burns et al.,
(2006) Curr. Stem Cell Res. Ther., 2:255-266. In some embodiments,
pancreatic beta cells derived from induced cells may be
transplanted into a subject suffering from diabetes (e.g., diabetes
mellitus, type 1).
[0346] In other examples, hepatic cells or hepatic stem cells
derived from induced cells are transplanted into a subject
suffering from a liver disease, e.g., hepatitis, cirrhosis, or
liver failure.
[0347] Hematopoietic cells or hematopoietic stem cells (HSCs)
derived from induced cells may be transplanted into a subject
suffering from cancer of the blood, or other blood or immune
disorder. Examples of cancers of the blood that are potentially
treated by hematopoietic cells or HSCs include: acute lymphoblastic
leukemia, acute myeloblastic leukemia, chronic myelogenous leukemia
(CML), Hodgkin's disease, multiple myeloma, and non-Hodgkin's
lymphoma. Often, a subject suffering from such disease must undergo
radiation and/or chemotherapeutic treatment in order to kill
rapidly dividing blood cells. Introducing HSCs derived from induced
cells to these subjects may help to repopulate depleted reservoirs
of cells.
[0348] In some cases, hematopoietic cells or HSCs derived from
induced cells may also be used to directly fight cancer. For
example, transplantation of allogeneic HSCs has shown promise in
the treatment of kidney cancer, see, e.g., Childs et al., (2000),
N. Engl. J. Med., 343:750-758. In some embodiments, allogeneic, or
even autologous, HSCs derived from induced cells may be introduced
into a subject in order to treat kidney or other cancers.
[0349] Hematopoietic cells or HSCs derived from induced cells may
also be introduced into a subject in order to generate or repair
cells or tissue other than blood cells, e.g., muscle, blood
vessels, or bone. Such treatments may be useful for a multitude of
disorders.
[0350] In some cases, the induced cells are transferred into an
immunocompromised animal, e.g., SCID mouse, and allowed to
differentiate. The transplanted cells may form a mixture of
differentiated cell types and tumor cells. The specific
differentiated cell types of interest can be selected and purified
away from the tumor cells by use of lineage specific markers, e.g.,
by fluorescent activated cell sorting (FACS) or other sorting
method, e.g., magnetic activated cell sorting (MACS). The
differentiated cells may then be transplanted into a subject (e.g.,
an autologous subject, HLA-matched subject) to treat a disease or
condition. The disease or condition may be a hematopoietic
disorder, an endocrine deficiency, degenerative neurologic
disorder, hair loss, or other disease or condition described
herein.
VIII. Analytical Methods
[0351] Also described herein are assay methods for identifying an
agent capable of inducing pluripotency alone or in combination with
other agents, such as the induction factors described herein, in
primary somatic cells (e.g., skin cells, mononuclear blood cells,
or bone marrow cells) or a cell line (e.g., HEK293 cells, Hela
cells, a multipotent stem cell line, or an adult stem cell line).
The methods may also include methods for identifying agents that
increase the ability of induction factors to induce pluripotency
(e.g., the efficiency of inducing pluripotency). In some
embodiments, cells to be used in the assay methods have not
undergone epigenetic inactivation of Tert, Nanog, Oct3/4 or
Sox2.
[0352] In some embodiments, the ability of a test agent to induce
pluripotency or multipotency is assessed in a primary screen
endpoint by determining the test agent's ability to induce the
expression of one or more of: alkaline phosphatase (ALP), ES marker
genes, or protein markers. In some cases, such determination is
made by comparing the test agent's inducing ability with that of a
negative control agent (e.g., an agent with limited or non-existent
ability to induce the subject gene or protein markers). In most
instances, prior to and during incubation with a test agent or
control agent, cells are cultivated in a cell culture medium suited
to the particular cell type being cultured, e.g., any of the cell
culture media for culturing cells as described herein, although it
is possible to take a sample and utilize it directly in an assay
without prior culturing steps. In some cases, after a test agent
incubation period, cells are cultured in MC-ES medium as described
herein.
[0353] Examples of ES marker genes suitable for a screening assay
include, but are not limited to, Tert, Cyp26A1, Nanog, Oct3/4, or
Sox2. The expression of a marker may be determined by detecting or
quantifying mRNA levels or protein levels by a standard method,
e.g., any of the methods mentioned herein, such as qPCR. In other
embodiments, a reporter construct containing one or more elements
from an ES marker gene promoter is introduced into the cells to be
assayed prior to contacting the cells with a test agent. Methods
for generating promoter-reporter constructs, introducing them into
cells, and assaying various reporter polypeptide activities, can be
found in detail in, e.g., Current Protocols in Molecular Biology,
John Wiley & Sons, N.Y. (2005), 3.16-3.17 and 9.1-9.14,
respectively). Where a particular cell type is difficult to
transfect by conventional methods, viral transduction can be used,
e.g., as described herein, to introduce a viral promoter-reporter
construct. Promoter activity can be quantified by measuring a
property of the reporter polypeptide (e.g., enzymatic activity or
fluorescence), reporter polypeptide expression (e.g., by an ELISA
assay), or reporter mRNA expression (e.g., by a fluorescent
hybridization technique). Suitable reporter polypeptides include,
e.g., firefly luciferase, Renilla luciferase, fluorescent proteins
(e.g., enhanced green fluorescent protein), .beta.-galactosidase,
.beta. lactamase, and horseradish peroxidase. Exemplary
promoter-reporter constructs for detecting induction of Nanog,
Sox2, Oct 3/4, TERT, or Cyp26A1 promoter activation are described
in Kuroda et al., (2005), Mol. Cell Biol., 25(6):2475-2485 (for
Nanog); Zhan et al., (2005), Cell Biochem. Biophys., 43(3):379-405
(for Oct3/4 and Sox2); and Tzukerman et al., (2000), Mol. Biol.
Cell, 11(12):4381-4391 (for hTert), and Loudig et al., (2005),
Biochem. J., 392(Pt 1):241-248. In some embodiments, the presence
of ALP activity in assayed cells is used as a preliminary test for
inducing activity of a test agent. A positive result in any of the
foregoing assays, such as a significantly higher level of activity
for a test agent than for a control agent, is taken as a
preliminary indication that a test agent has inducing activity.
Such candidate inducing agents may be further screened by testing
the cells contacted with the test agent in the primary screen in
any of the assays described herein for determining pluripotency or
multipotency, including, but not limited, determining the
expression of a panel of ES marker genes, protein markers, long
term self renewal, hypomethylation of Oct3/4, Sox2, and Nanog
promoters, ability to form teratomas, and the ability to
differentiate into cell types of ectodermal, mesodermal, or
endodermal lineage ex vivo.
[0354] The conditions for the assays may vary and depend upon the
nature of the assay protocol being utilized and the cells and agent
being employed. For such assays, the cell culture period prior to
an endpoint assay may vary from at least about 3 days to at least
about 40 days, e.g., 5, 6, 9, 10, 12, 14, 20, 21, 25, 26, 27, 30,
32, 34, 36, 38, or other period from at least about 3 days to at
least about 40 days. Additionally, in most cases the time for the
test agent incubation ranges from at least about 30 minutes to
about 40 days, e.g., 1 hour, 2 hours, 12 hours, 18 hours, 1 day, 3
days, 5 days, 7 days, 14 days, 21 days, 25 days, 30 days, 34 days,
or any other period from at least about 30 minutes to at least
about 40 days.
[0355] In some embodiments, the agent to be tested is an siRNA,
including, but not limited to, a double stranded RNA that comprises
about 19 base pairs of a target gene sequence and is capable of
inhibiting target gene expression of RNA interference. See, e.g.,
Scherr et al., (2007), Cell Cycle, 6(4):444-449. In some
embodiments, the siRNAs to be assayed include, but are not limited
to, whole-genome siRNA libraries, as described in, e.g., Miyagishi
et al., (2003), Oligonucleotides, 13(5):325-333; and Huesken et
al., (2005), Nat. Biotechnol., 8:995-1001. Suitable whole genome
siRNA libraries, e.g., arrayed siRNA libraries that are
commercially available include, the "Human Whole Genome siRNA Set
V4.0" from Qiagen (Valencia, Calif.); the "Human siGENOME siRNA
Library--Genome" from Dharmacon, Inc. (Lafayette, Colo.); and the
Silencer.RTM. Human Genome siRNA Library from Ambion (Austin,
Tex.). Methods and reagents for introducing siRNAs include, but are
not limited to, commercial reagents such as Lipofectamine.TM.
RNAiMAX (Invitrogen, Carlsbad, Calif.), TransMessenger Transfection
Reagent (Qiagen, Valencia, Calif.), or Dharma FECT.RTM. (Dharmacon,
Lafayette, Colo.). See, e.g., Krausz (2007), Mol. Biosyst.,
3(4):232-240. In some embodiments, a viral RNAi library is used as
described in, e.g., Root et al., (2006), Nat. Methods,
3(9):715-719.
[0356] Optionally, the induction test agents to be screened are
small molecules. The test molecules may be individual small
molecules of choice or in some cases, the small molecule test
agents to be screened come from a combinatorial library, i.e., a
collection of diverse chemical compounds generated by either
chemical synthesis or biological synthesis by combining a number of
chemical "building blocks." For example, a linear combinatorial
chemical library such as a polypeptide library is formed by
combining a set of chemical building blocks called amino acids in
every possible way for a given compound length (i.e., the number of
amino acids in a polypeptide compound). Millions of chemical
compounds can be synthesized through such combinatorial mixing of
chemical building blocks. Indeed, theoretically, the systematic,
combinatorial mixing of 100 interchangeable chemical building
blocks results in the synthesis of 100 million tetrameric compounds
or 10 billion pentameric compounds. See, e.g., Gallop et al.,
(1994), J. Med. Chem., 37(9), 1233-1251. Preparation and screening
of combinatorial chemical libraries are well known in the art.
Combinatorial chemical libraries include, but are not limited to:
diversomers such as hydantoins, benzodiazepines, and dipeptides, as
described in, e.g., Hobbs et al., (1993), Proc. Natl. Acad. Sci.
U.S.A., 90:6909-6913; analogous organic syntheses of small compound
libraries, as described in Chen et al., (1994), J. Amer. Chem.
Soc., 116:2661-2662; Oligocarbamates, as described in Cho, et al.,
(1993), Science, 261:1303-1305; peptidyl phosphonates, as described
in Campbell et al., (1994), J. Org. Chem., 59: 658-660; and small
organic molecule libraries containing, e.g., thiazolidinones and
metathiazanones (U.S. Pat. No. 5,549,974), pyrrolidines (U.S. Pat.
Nos. 5,525,735 and 5,519,134), benzodiazepines (U.S. Pat. No.
5,288,514).
[0357] Numerous combinatorial libraries are commercially available
from, e.g., ComGenex (Princeton, N.J.); Asinex (Moscow, Russia);
Tripos, Inc. (St. Louis, Mo.); ChemStar, Ltd. (Moscow, Russia); 3D
Pharmaceuticals (Exton, Pa.); and Martek Biosciences (Columbia,
Md.)/
[0358] In some cases, test agents to be screened for inducing
activity may be used in combination with one or more induction
factors (e.g., Oct3/4, Sox2, Klf4, or c-Myc) described herein,
e.g., 1, 2, 3, or 4 of the induction factors described herein. In
some cases, a test agent is screened in combination with one
induction factor, e.g., with Oct3/4, Sox2, Klf4, or c-Myc. In other
cases, the test agent is screened in combination with two induction
factors, e.g., Oct3/4 and Sox2; Oct3/4 and Klf4; Oct3/4 and c-Myc;
Sox2 and Klf4; Sox2 and c-Myc; or Klf4- and c-Myc. In some
embodiments, the test agent is screened in combination with three
induction factors, e.g., Oct3/4, Sox2, and Klf4; Oct3/4, Klf4, and
c-Myc; Oct3/4, Sox2, and c-Myc; or Sox2, Klf4, and c-Myc. Test
agents may also be assayed for their ability to increase the
efficiency of pluripotency induction by a set of induction factors,
e.g., a combination of Oct3/4, Sox2, Klf4, and c-Myc.
IX. Storage of Cells
[0359] The harvested tissue, the cells, the induced cells, the
induced pluripotent cells, the induced multipotent cells, cells
differentiated from the harvested tissue, or other cells described
herein may be stored. Thus, cells or materials from any point
during the processes may be stored for future completion of the
process or modification for use.
[0360] The methods of storage may be any method including the
methods described herein, e.g., using cryopreservation medium. Some
exemplary cryopreservation media include the "Cryopreservation
Medium For Primate ES Cells" (ReproCELL, Tokyo, Japan) or
mFreSR.TM. (StemCell Technologies, Vancouver, Calif.). The cells
preferably are rapidly frozen in liquid nitrogen, and stored in a
liquid nitrogen storage vessel. Other suitable cryopreservation
media and methods for cryopreservation/thawing of cells generated
by the methods described herein are provided in, e.g., U.S. patent
application Ser. Nos. 10/902,571 and 11/142,651. See also, Ha et
al., (2005), Hum. Reprod., 20(7):1779-1785.
X. Examples
[0361] The following specific examples are to be construed as
merely illustrative, and not limitative of the remainder of the
disclosure in any way whatsoever. Without further elaboration, it
is believed that one skilled in the art can, based on the
description herein, utilize the present invention to its fullest
extent. All publications cited herein are hereby incorporated by
reference in their entirety. Where reference is made to a URL or
other such identifier or address, it is understood that such
identifiers can change and particular information on the internet
can come and go, but equivalent information can be found by
searching the internet. Reference thereto evidences the
availability and public dissemination of such information.
Example 1
Preparation of Retrovirus Vector
[0362] Retrovirus vector plasmids for four genes (Oct3/4-pMx,
Sox2-pMx, Klf4-pMx and c-Myc-pMx) constructed as in Table 1 were
introduced into the packaging cell line Plat-E [Experimental
Hematology, 2003, 31 (11): 1007-1014], using Fugene HD
(manufactured by Roche). About 24 to 48 hours after introduction of
the retroviral vector plasmids, the medium was replaced with a
medium suitable for the cell to which the gene is to be introduced.
After culturing the Plat-E cells to which retrovirus vector was
introduced for more than 4 hours, the supernatant was recovered and
passed through a filter of 45 .mu.m in diameter (manufactured by
Millipore). Retrovirus vector solutions of the four genes (Oct3/4,
Sox2, Klf4 and c-Myc) were prepared by the above procedure.
[0363] Retrovirus vector plasmids for three genes (Oct3/4-pMx,
Sox2-pMx, and Klf4-pMx) were introduced into the packaging cell,
the Plat-E cell, using Fugene HD (manufactured by Roche). During 24
to 48 hours after retrovirus vector introduction, the medium was
replaced with a medium suitable for the cell to which gene is to be
introduced. After culturing the Plat-E cell to which retrovirus
vector was introduced for more than 4 hours, the supernatant was
recovered and passed through a filter of 45 .mu.m in diameter
(manufactured by Millipore). Retrovirus vector solutions of the
three genes (Oct3/4, Sox2 and Klf4) were prepared by the above
procedure.
Example 2
Preparation of Adenovirus Vector
[0364] The use of amphotropic retroviruses presents a significant
risk of infection to experimenters. This risk is of particular
concern where a retrovirus encodes an oncogenic protein (e.g.,
c-myc). Accordingly, we utilized an ecotropic retrovirus vector
that selectively recognizes a mouse receptor, mouse-derived
cationic amino acid transporter 1 (mCAT1). We infected human cells
with an adenovirus vector carrying the gene encoding mCAT 1, thus
allowing ecotropic retroviruses to selectively infect human cells
expressing the mCAT 1 receptor.
[0365] First, an adenovirus vector carrying cDNA having the
sequence of coding region of the mouse-derived cationic amino acid
transporter (mCAT1) gene was constructed. Specifically, Adeno-X
Expression System 1 kit (manufactured by TakaraBio Clontech) was
used. In Adeno-X Expression System 1 kit, based on the experimental
method attached to the kit by TakaraBio, the mCAT1 gene was
subcloned into the multi-cloning site of a vector called
pShuttle.
[0366] Subsequently, an expression cassette was excised by the
PI-Sce I site and the I-Ceu I site, cleavage sites on both ends of
the expression cassette of pShuttle, and a DNA fragment containing
the desired gene was inserted in between the PI-Sce I site and the
I-Ceu I site in the Adeno-X Viral DNA in the above kit, which was
then treated with a restriction enzyme Swa I to remove adenovirus
DNA for which integration was unsuccessful. After the plasmid was
transformed into an E. coli DH5 strain, whether the desired gene
was correctly introduced into adenovirus DNA was confirmed by
restriction enzyme treatment, PCR etc. The plasmid was prepared in
large quantities, and cleaved with the Pac I restriction enzyme.
Using the recombinant adenovirus DNA thus obtained, the gene was
introduced into the HEK293 cells (MicroBix) and plated in six wells
using Lipofectamin 2000 (manufactured by Invitrogen), and two weeks
later when the cell exhibited a cytopathic effect (CPE), the cells
were collected as they are in the medium.
[0367] Subsequently, after the cell suspension was subjected to
freezing and thawing three times, the cells were disrupted, and
virus particles present in the cells were allowed to release into
the liquid. The virus suspension thus prepared was added to one 100
mm plastic culture dish equivalent of HEK293 cells
(5.times.10.sup.6 cells) to infect the cells, the virus was
propagated. Furthermore, after virus was prepared in large
quantities using four 150 mm plate equivalent of HEK293 cells,
virus was purified using the Adenovirus Purification kit
(manufactured by Clontech), and stored frozen at -80.degree. C.
[0368] The titer (plaque forming units, PFU) of the mCAT1
adenovirus vector was determined using the Adeno-X Rapid Titer kit.
On a 24-well plate, HEK293 cells were plated at a concentration of
5.times.10.sup.4 cells/500 .mu.l per well. Fifty .mu.l of serially
diluted (from 10.sup.-2 to 10.sup.-7) virus vector was mixed with
500 .mu.l of the medium, and then used to infect the cells. After
culturing at 5% CO.sub.2 and 37.degree. C. for 48 hours, the medium
was aspirated off, the cells were dried for 5 minutes, and then
using 5001 of cold 100% methanol the cells were fixed by allowing
to stand at -20.degree. C. for 10 minutes. After aspirating off
methanol, the wells were washed three times with 500 .mu.l of
phosphate buffer containing 1% bovine serum albumin. A mouse
anti-Hexon antibody was diluted 1000-fold with phosphate buffer
containing 1% bovine serum albumin, and 2501 each of it was added
to wells.
[0369] After allowing to stand at 37.degree. C. for 1 hour, the
antibody solution was removed, and the wells were washed three
times with 500 .mu.l phosphate buffer containing 1% bovine serum
albumin. Horseradish peroxidase-labelled rat anti-mouse
immunoglobulin antibody was diluted 500-fold with phosphate buffer
containing 1% bovine serum albumin, and 2501 was added to wells.
After allowing to stand at 37.degree. C. for 1 hour, the antibody
solution was removed, and washed three times with 500 .mu.l of
phosphate buffer containing 1% bovine serum albumin. 2501 of the
DAB (diaminobenzidine) solution (10-fold DAB concentrate was
diluted with a stable peroxidase buffer) was added to wells, and
was allowed to stand at room temperature for 10 minutes. After
aspirating off DAB, 500 .mu.l of phosphate buffer was added. Using
a 20.times. objective lens, the number of brown positive cells in
six viewing fields was counted. Radius of a standard 20.times.
objective lens: 0.5 mm
[0370] Area in one viewing field: 7.853.times.10.sup.-3
cm.sup.2
[0371] Area of a well: 2 cm.sup.2
[0372] Viewing field of a well: 2 cm.sup.2/7.853.times.10.sup.3
cm.sup.2=254.7 viewing fields
[0373] (32/6).times.254.7/(0.55.times.10.sup.-5)=2.5.times.10.sup.8
ifu (infection unit)/ml
Example 3
Alkaline Phosphatase Staining
[0374] Staining for confirming alkaline phosphatase activity which
is a characteristic of pluripotent stem cells was conducted in the
following manner. After removing the culture medium, a 10% formalin
neutral buffer solution was added to wells, and cells were fixed at
room temperature for 5 minutes. After washing with a phosphate
buffer etc., a chromogenic substrate of alkaline phosphatase, 1
step NBT/BCIP (manufactured by Pierce) was added and reacted at
room temperature for 20 to 30 minutes. Cells having alkaline
phosphatase activity were all stained blue violet.
Example 4
Determination Gene Expression of a Colony by Quantitative PCR
[0375] The expression of target genes in each colony including
ALP-positive colonies was determined using quantitative PCR in the
following manner. Colonies developed by the induction of
pluripotent or multipotent stem cells were harvested, and RNA was
extracted using the Recoverall total nucleic acid isolation kit for
FFPE (manufactured by Ambion). After synthesizing cDNA from the
extracted RNA, the target gene was amplified using the Taqman
Preamp mastermix (manufactured by Applied Biosystems).
[0376] As the primers for quantitative PCR, the Taqman gene
exprESsion assay (manufactured by Applied Biosystems) was used. The
following shows the name of the target gene and the product code of
each primer. Human Hprt Hs99999909_m1, human Nanog: Hs02387400_g1,
human Tert: Hs00162669_m1, Mouse Hprt: Mm01545399_m1, mouse Nanog:
Ma02019550_s1.
[0377] As the positive control for quantitative PCR, cDNA extracted
from mesenchymal stem cells established by the following manner was
used.
[0378] One vial (2.5.times.10.sup.7 cells) of human bone
marrow-derived mononuclear cells (hBMMNCs (manufactured by Lonza),
Lot 060175A: female, 21 years old, black) was thawed in a
37.degree. C. water bath, and suspended in 10 ml of the MSCGM
medium (a growth medium for mesenchymal cells) (manufactured by
Lonza). In order to remove DMSO in the frozen solution, this was
centrifuged at 300 g and 4.degree. C. for seven minutes and the
supernatant was removed. The cell mass thus obtained was
resuspended in 10 ml of MSCGM medium, and plated on a 100 mm plate
at a density of 10.sup.5 cells/cm.sup.2 and cultured at 37.degree.
C. Seven days later, the medium was changed. At this time, the
suspended cells in the old medium were collected by centrifuging at
300 g and 4.degree. C. for five minutes, and were returned to the
cells together with the fresh medium. On day 13 when the adherent
cells became confluent, the supernatant was removed, non-adherent
cells were washed off with a phosphate buffer, and adherent cells
were collected by detaching with a 0.05% trypsin-EDTA solution and
plated at a density of 3000 cells/cm.sup.2. RNA was collected from
the cells of the third subculture, and cDNA was synthesized.
Example 5
Induction of Human Pluripotent Stem Cells from Undifferentiated
Stem Cells Present in a Postnatal Human Adult Bone Marrow
Tissue
[0379] From human adult bone marrow-derived cells (trade name:
Human Bone Marrow-Derived Mononuclear Cell) containing
undifferentiated stem cells present in a postnatal human adult bone
marrow tissue, the cells were established under low serum (2%) and
high serum (10%) culture conditions, and were used in the
experiment for inducing pluripotent stem cells. Thus, one vial each
(2.5.times.10.sup.7 cells) of frozen human bone marrow-derived
mononuclear cells (hBMMNCs (manufactured by Lonza), Lot 060809B:
female, 20 years old, white/ and hBMMNCs (manufactured by Lonza),
Lot 060470B: female, 20 years old, black) was thawed in a
37.degree. C. water bath, and suspended in 10 ml of the MAPC medium
for use in the low serum culture. In order to remove DMSO in the
frozen solution, this was centrifuged at 300 g and 4.degree. C. for
seven minutes and the supernatant was removed.
[0380] The cell mass thus obtained was resuspended, and plated at a
density of 10.sup.5 cells/cm.sup.2 on a 100 mm plate coated with 10
ng/ml fibronectin. Growth factors [10 ng/ml PDGF-BB (manufactured
by Peprotech), 10 ng/ml EGF (manufactured by Peprotech), 10 ng/ml
IGF-II (manufactured by Peprotech)] were added. Three days later,
growth factors were only added. Seven days later, the suspended
cells and the medium were collected except the adherent cells, and
centrifuged at 300 g and 4.degree. C. for five minutes. After the
supernatant was removed, the cells were resuspended in a fresh
medium. The cell suspension was returned to the original 10 cm
dish, and growth factors were added thereto. On day 10 when the
adherent cells became confluent, the supernatant was removed,
non-adherent cells were washed off with a phosphate buffer, and
adherent cells were collected by detaching with a 0.05%
trypsin-EDTA solution, and using a cell banker (manufactured by
Juji Field), the primary culture was stored frozen.
[0381] Using the human bone marrow-derived mononuclear cell of the
same lot, the cells were established using a MSCGM medium
(manufactured by Lonza) containing 10% FBS under the high serum
condition. The Human Bone Marrow-Derived Mononuclear Cells were
plated at a density of 10.sup.5 cells/cm.sup.2 in a 100 mm plate to
which 10 ml of the MSCGM medium had been added, and cultured at
37.degree. C. Seven days later, the suspended cells and the medium
were collected except the adherent cells, and centrifuged at 300 g
and 4.degree. C. for five minutes, and after the supernatant was
removed, the cells were resuspended in a fresh medium. The cell
suspension was returned to the original 10 cm dish, and culturing
was continued. On day 13 when the adherent cells became confluent,
the supernatant was removed, non-adherent cells were washed off
with a phosphate buffer. Adherent cells were collected by detaching
with a 0.05% trypsin-EDTA solution, and using a cell banker
(manufactured by Juji Field), the primary culture was stored
frozen.
[0382] One vial each of the human bone marrow-derived primary
culture cells that were established under the high serum and the
low serum conditions and stored frozen was thawed in a 37.degree.
C. incubator. Two ml of the medium used for the establishment was
added to the cells respectively, and the cells were plated at a
density of 10.sup.4 cells/cm.sup.2 on a 6-well plastic culture dish
the wells of which had been coated with matrigel (manufactured by
BD Bioscience) at a concentration of 20 .mu.g/cm.sup.2 and cultured
for 14 hours (a second subculture cells). Fourteen hours later, the
medium was removed, and the mCAT1 adenovirus vector prepared in
Example 2 at an amount equivalent to a m.o.i. of 10 in 5001 of the
Hank's balanced salt solution per well was added, and were infected
at room temperature for 30 minutes.
[0383] Two ml each of the medium used for establishment was added
to each well, and cultured at 37.degree. C. Forty eight hours after
the introduction of the mCAT-1 adenovirus vector, the medium of
each well was replaced with 2 ml of the retrovirus vector solution
(polybrene at a final concentration of 4 .mu.g/ml was added) of
four genes (Oct3/4,Sox2, Klf4, c-Myc) which were prepared in
Example 1, and cultured at 37.degree. C. for 14 hours. The virus
supernatant was removed and replaced with the MEF-conditioned ES
medium. Then medium change with the MEF-conditioned ES medium was
continued every two days. On examining fourteen days after the
introduction of the four genes, one typical colony was found in the
low serum condition group of Lot 060809B that exhibits a
characteristics of the induced pluripotent stem cells. Said colony
was composed of markedly smaller cells than the surrounding cells.
In addition to the pluripotent stem cell-like colony, a plurality
of colonies were observed in both the low serum group and the high
serum group, but they were not stained with alkaline
phosphatase.
[0384] In order to isolate the pluripotent stem cell-like colonies,
the wells were washed with the Hank's balanced salt solution, and
then colonies were surrounded by a cloning ring (manufactured by
Twaki) to the bottom of which silicone grease had been applied. One
hundred .mu.l of the Detachment Medium For Primate ES Cells
(manufactured by ReproCELL) was added in the ring and cultured at
37.degree. C. for 10 to 20 minutes. The cell suspension in the ring
containing the detached colony was added to 2 ml of the
MEF-conditioned ES medium, and plated in one well of a MEF-coated
24-well plate. After culturing at 37.degree. C. for 8 to 14 hours,
the medium was changed, and subsequently medium change was
continued every two days, and 8 days later a second subculture was
carried out.
[0385] The medium was removed, washed with the Hank's balanced salt
solution, the Detachment Medium For Primate ES Cells (manufactured
by ReproCELL) was added, cultured at 37.degree. C. for 10 minutes,
and 2 ml of the medium was added to stop the reaction. The cell
suspension was transferred to a centrifuge tube, and centrifuged at
4.degree. C. and 200 g for 5 minutes to remove the supernatant. The
cells were resuspended in the MEF-conditioned ES medium, and plated
in 4 wells of MEF-coated 24-well plate. Medium change was continued
every 2 days, and seven days after the second subculture, the cells
were subjected to alkaline phosphatase staining, and the cloned
colony-derived cells were stained blue violet.
[0386] Furthermore, by quantitative PCR, it was confirmed that
Nanog and Tert were expressed by the colony of alkaline phosphatase
activity-positive pluripotent stem cells. When compared to the
mesenchymal stem cells established in Example 4, the amount
expressed of Nanog was as much as 30-fold higher. The expression of
Tert was noted only in said pluripotent stem cells, and not in the
mesenchymal stem cells. FIG. 2 shows the relative expression of
Nanog and Tert genes in human adult bone-marrow derived cells
following introduction of four genes. Oct3/4, Sox2, Klf4 and c-Myc,
were introduced into cells established from mononuclear cells
derived from human adult bone marrow under low serum conditions.
RNA was extracted from the colonies obtained, and the expression of
human Nanog and human Tert genes was demonstrated by quantitative
PCR. Fibroblasts and mesenchymal stem cells in which the four genes
were not introduced were used as controls in the experiment. The
amount of gene expression is provided as a relative value in which
the amount of expression was normalized by the amount of expression
of the human hypoxanthine phosphoribosyltransferase (HPRT) gene,
and by setting as one the amount of HPRT gene expression in
Alkaline Phosphatase (ALP)-positive colonies induced from a
neonatal skin fibroblast. It was confirmed that the expression of
Nanog and Tert was significantly high in colonies in which four
genes (Oct3/4, Sox2, Klf4 and c-Myc) were introduced and which were
positive for ALP. As shown in FIG. 2, Nanog and Tert were not
expressed in the cells that did not form colonies, despite the
introduction of the four genes.
[0387] From the foregoing, when human adult bone marrow-derived
cells were used, the pluripotent stem cells were obtained from the
low serum culture group but not at all from the high serum culture
group (Lot 060809B and Lot 060470B) (Table 2). Also, culturing
under the low serum condition was suitable for the maintenance of
the undifferentiated cells.
Example 6
Induction of Human Pluripotent Stem Cells from Undifferentiated
Stem Cells Present in Human Neonatal Skin
[0388] Using cells (trade name: Neonatal Normal Human Skin
Fibroblasts, primary culture) derived from a human neonatal tissue,
a human tissue immediately after birth, the induction of human
pluripotent stem cells from undifferentiated stem cells present in
the skin of a human neonate was attempted.
[0389] One vial of the frozen Neonatal Normal Human Skin
Fibroblasts (primary culture, manufactured by Lonza, Lot 5F0438)
was thawed in a 37.degree. C. incubator, and was suspended in the
MCDB202 modified medium, a medium containing 2% fetal bovine serum,
5 .mu.g/ml insulin, 50 .mu.g/ml gentamycin, 50 ng/ml amphotericin-B
(FBM medium, manufactured by Lonza) to obtain 12 ml of a cell
suspension. Two ml each of the cell suspension was plated on a
6-well plastic culture dish of which bottom had been coated with
matrigel (BD Biosciences) at a concentration of 20 .mu.g/cm.sup.2
(second subculture cells).
[0390] Fourteen hours later, the medium was removed, and the mCAT1
adenovirus vector prepared in Example 2 at an amount equivalent to
a m.o.i. of 5 in 5001 of the Hank's balanced salt solution per well
was added, and was infected at room temperature for 30 minutes. To
each well, 2 ml of the FBM medium was added respectively, and
cultured at 37.degree. C. Forty eight hours after the introduction
of the mCAT-1 adenovirus vector, the medium of each well was
replaced with 2 ml of the retrovirus vector solution (polybrene at
a final concentration of 4 .mu.g/ml was added) of the four genes
(Oct3/4, Sox2, Klf4 and c-Myc) prepared in Example 1, and cultured
at 37.degree. C. for 4 hours.
[0391] The virus supernatant was removed and replaced with
MEF-conditioned ES medium. Then medium change with MEF-conditioned
ES medium was continued every two days, and fourteen days after the
introduction of the four genes, one well of the 6-well plate was
subjected to alkaline phosphatase staining. As a result, six
pluripotent stem cell-like alkaline phosphatase-positive colonies
were obtained. Alkaline phosphatase-positive colonies were composed
of markedly smaller cells than the neonatal normal human skin
fibroblasts.
[0392] Subsequently, by quantitative PCR, it was confirmed that
Nanog and Tert were expressed by the colonies of alkaline
phosphatase activity-positive pluripotent stem cells. FIG. 3 shows
the relative expression of Nanog and Tert genes in neonatal
fibroblasts following introduction of four genes. Oct3/4, Sox2,
Klf4 and c-Myc, were introduced into primary culture fibroblasts
derived from neonatal skin; RNA was extracted from the colonies
obtained; and the amount expressed of the human Nanog and human
Tert genes was determined by quantitative PCR. Parental fibroblasts
and mesenchymal stem cells in which four genes were not introduced
were used as controls in the experiment. Gene expression was
normalized using the same procedure outlined in FIG. 2. It was
confirmed that the expression of Nanog and Tert was significantly
high in colonies in which four genes were introduced and which were
positive for ALP. As shown in FIG. 3, when compared to the
mesenchymal stem cells established under the high serum (10%)
culture condition in Example 5, the neonatal normal human skin
fibroblasts before the introduction of the four genes did not
express Nanog, whereas in the case of the cells after the
introduction of the four genes, 9-fold as much in the cells that
are not forming colonies and 18-fold as much expression of Nanog in
the alkaline phosphatase activity-positive colonies were observed
(FIG. 3). On the other hand, the expression of Tert was only noted
in the alkaline phosphatase activity-positive colonies. From this,
the pluripotent stem cells may be defined by the characteristics of
alkaline phosphatase activity-positive and Nanog-positive and
Tert-positive. Also, the neonatal normal human skin fibroblasts
were confirmed to be the cells that have a relatively high
efficiency of inducing the pluripotent stem cells and that can
express Nanog by the introduction of the four genes.
[0393] Colonies of the pluripotent stem cells were isolated in the
following manner. On day 17 after gene introduction, six colonies
with a characteristic shape were selected from the remaining wells.
After washing the wells with the Hank's balanced salt solution,
colonies were surrounded by a cloning ring (manufactured by Twaki)
to the bottom of which silicone grease had been applied. One
hundred .mu.l of the Detachment Medium For Primate ES Cells
(manufactured by ReproCELL) was added in the ring and cultured at
37.degree. C. for 20 minutes. The cell suspension in the ring
containing the detached colonies was added to 2 ml of
MEF-conditioned ES medium, and plated in one well of a MEF-coated
24-well plate. After culturing at 37.degree. C. for 14 hours, the
medium was changed, and subsequently medium change was continued
every two days, and 8 days later a second subculture was carried
out. The medium was removed, the cells were washed with the Hank's
balanced salt solution, the Detachment Medium For Primate ES Cells
was added and cultured at 37.degree. C. for 10 minutes, and 2 ml of
the medium was added to stop the reaction.
[0394] The cell suspension was transferred to a centrifuge tube,
and centrifuged at 4.degree. C. and 200 g for 5 minutes, and the
supernatant was removed. The cells were resuspended in
MEF-conditioned ES medium, and plated on four wells of a MEF-coated
24-well plate. Seven days after the second subculture, in a
subculturing method described below, the cells were plated on a 60
mm plastic culture dish of which bottom had been coated with
matrigel at a concentration of 20 .mu.g/cm.sup.2. Further eight
days later (37 days after the introduction of the four genes), a
third subculture was conducted, and plated on two matrigel-coated
60 mm plastic culture dishes, and part of it was used in alkaline
phosphatase staining and RNA extraction. The result confirmed that
the cells derived from the cloned colonies are alkaline phosphatase
activity-positive and are expressing Nanog and Tert at high rate,
thereby endorsing that they are pluripotent stem cells.
[0395] The induced pluripotent stem cells were subcultured every 5
to 7 days for maintenance and growth. From the plastic culture dish
on which subculturing is to be conducted, the medium was removed,
the cells were washed with the Hank's balanced salt solution,
dispase or the Detachment Medium For Primate ES Cells was added,
and cultured at 37.degree. C. for 5 to 10 minutes. When more than
half of the colonies were detached, the ES medium was added to stop
the reaction, and the cell suspension was transferred to a
centrifuge tube. When colonies precipitated on the bottom of the
tube, the supernatant was removed, and the ES medium was added
again for suspension. After examining the size of the colonies, any
extremely large ones were divided into appropriate sizes by slowly
pipetting. Appropriately sized colonies were plated on a
matrigel-coated plastic culture dish with a base area of about 3 to
6 times that before subculture.
[0396] As shown in Table 2, the Neonatal Normal Human Skin
Fibroblasts in the lot (Lot 5F0474) other than the above lot 5F0438
exhibited a favorable induction of pluripotent stem cells. From
comparison to Example 5, cells derived from young individuals or
cells of which culturing time is short were thought to be suitable
for the induction of the pluripotent stem cells.
[0397] From the above results, when cells derived from human
neonatal tissue that is a human postnatal tissue containing
undifferentiated cells were subjected to a second subculture in a
culture medium containing 2% serum, it was possible to induce the
pluripotent stem cells.
Example 7
Induction of Human Pluripotent Stem Cells from Undifferentiated
Stem Cells Present in a Human Adult Skin
[0398] Then, using human adult tissue-derived cells (trade name:
Adult Normal Human Skin Fibroblasts, primary culture) containing
undifferentiated stem cells present in a human adult skin, the
induction of pluripotent stem cells of the present invention was
carried out.
[0399] One vial each of the frozen Adult Normal Human Skin
Fibroblasts (primary culture, manufactured by Lonza, Lot 6F3535: 28
years old, female, white, Lot 6F4026: 39 year old, female, white)
was thawed in a 37.degree. C. incubator, suspended in the FBM
medium, and 12 ml of the cell suspension was obtained,
respectively. Two ml each of the cell suspensions was plated on a
6-well plastic culture dish of which bottom had been coated with
matrigel at a concentration of 20 .mu.g/cm.sup.2 (second subculture
cells).
[0400] Fourteen hours later, the medium was removed, and the mCAT1
adenovirus vector prepared in Example 2 at an amount equivalent to
a m.o.i. of 5 in 5001 of the Hank's balanced salt solution per well
was added, and was infected at room temperature for 30 minutes. To
each well, 2 ml of the FBM medium was added, and cultured at
37.degree. C. Forty eight hours after the introduction of the
mCAT-1 adenovirus vector, the medium of each well was replaced with
2 ml of the retrovirus vector solution (polybrene at a final
concentration of 4 .mu.g/ml was added) of the four genes (Oct3/4,
Sox2, Klf4 and c-Myc) prepared in Example 1, and cultured at
37.degree. C. for 4 hours. The virus supernatant was removed and
replaced with the MEF-conditioned ES medium. Then medium change
with the MEF-conditioned ES medium was continued every two days,
and thirteen days after the introduction of the four genes,
alkaline phosphatase staining was carried out. As a result, two
pluripotent stem cell-like alkaline phosphatase-positive colonies
per well were obtained from the Lot 6F3535, whereas no alkaline
phosphatase-positive colonies were obtained from the Lot 6F4242
(Table 2).
[0401] From comparison to Example 6, the neonate-derived cells
among the skin fibroblasts had a higher efficiency of inducing the
pluripotent stem cells. Also, among the Adult Normal Human Skin
Fibroblasts, cells derived from younger donors had a higher
transformation efficiency. From the foregoing, it was demonstrated
that the efficiency of inducing the pluripotent stem cells
decreases in an age-dependent manner.
Example 8
Examination Using Neonatal Normal Human Skin Fibroblasts of the
Third Subculture
[0402] One vial of frozen Neonatal Normal Human Skin Fibroblasts
(primary culture, manufactured by Lonza, Lot 5F0439) was thawed in
a 37.degree. C. incubator, suspended in the FBM medium, and plated
on two 100 mm plastic culture dishes (a second subculture). After
culturing for six days until a 70 to 90% confluence could be
obtained, the cells were detached using a 0.025% trypsin-EDTA
solution (manufactured by Lonza), centrifuged at 4.degree. C. and
200 g for 5 minutes, and the supernatant was removed. The second
subcultured cells collected were stored frozen using the cell
banker.
[0403] The frozen second subculture cells were thawed in a
37.degree. C. incubator, suspended in 12 ml of the FBM medium,
centrifuged at 4.degree. C. and 200 g for 5 minutes, and the
supernatant was removed. The cells were suspended, and plated at a
density of 10.sup.4 cell/cm.sup.2 on a 100 mm plastic culture dish
of which bottom had been coated with matrigel at a concentration of
20 .mu.g/cm.sup.2 (a third subculture). Fourteen hours later, the
medium was removed, and the mCAT1 adenovirus vector prepared in
Example 2 at an amount equivalent to a m.o.i. of 5 in 2 ml of the
Hank's balanced salt solution was added, and was infected at room
temperature for 30 minutes. To each well, 10 ml of the FBM medium
was added, and cultured at 37.degree. C.
[0404] Forty eight hours after the introduction of the mCAT-1
adenovirus vector, the medium was removed, and replaced with 10 ml
of the retrovirus vector solution (polybrene at a final
concentration of 4 .mu.g/ml was added) of the four genes (Oct3/4,
Sox2, Klf4 and c-Myc) prepared in Example 1, and cultured at
37.degree. C. for 4 hours. The virus supernatant was removed and
replaced with the MEF-conditioned ES medium. Then medium change
with the MEF-conditioned ES medium was continued every two days,
and fourteen days after the introduction of the four genes,
alkaline phosphatase staining was carried out. As a result, five
pluripotent stem cell-like alkaline phosphatase-positive colonies
were obtained. By calculating based on the area of the bottom, this
indicates that 0.83 colony per well of the 6-well plate was
obtained (Table 2).
[0405] From comparison to Example 6, it was demonstrated that the
efficiency of inducing the pluripotent stem cells decreases with
the prolonged culture period.
Example 9
Induction of Human Pluripotent Stem Cells from Undifferentiated
Stem Cells Present in the Umbilical Cord (1)
[0406] Using the cells (trade name: Normal Human Umbilical Vein
Endothelial Cells, primary culture) derived from a human umbilical
cord, a human tissue immediately after birth, the induction of the
human pluripotent stem cells of the present invention from
undifferentiated stem cells present in the umbilical cord was
attempted.
[0407] One vial of the frozen Normal Human Umbilical Vein
Endothelial Cells (primary culture, manufactured by Lonza) was
thawed in a 37.degree. C. incubator, and suspended in the
Endothelial Cell Medium kit-2 manufactured by Lonza (2% serum)
(hereinafter referred to as EBM-2) to obtain 12 ml of the cell
suspension. About 10.sup.5/2 ml/well each of the cell suspension
was plated to a 6-well plastic culture dish the bottom of which had
been coated with matrigel at a concentration of 20 .mu.g/cm.sup.2
(second subculture). Six hours later, the medium was removed, and
the mCAT 1 adenovirus vector prepared in Example 2 at an amount
equivalent to a m.o.i. of 5 in 500 .mu.l of the Hank's balanced
salt solution per well was added, and infected at room temperature
for 30 minutes.
[0408] 2.5 ml each of the EBM-2 medium was added to each well, and
cultured at 37.degree. C. Forty eight hours after the introduction
of the mCAT-1 adenovirus vector, the medium of each well was
replaced with 2 ml each of the retrovirus vector solutions
(polybrene at a final concentration of 5 .mu.g/ml was added) of the
four genes (Oct3/4, Sox2, Klf4 and c-Myc) prepared in Example 1,
and cultured at 37.degree. C. for 4 hours. The virus supernatant
was removed and replaced with the MEF-conditioned ES medium. Then
medium change with the MEF-conditioned ES medium was continued
every two days. Twelve days after the introduction of the four
genes, colonies were confirmed.
[0409] Thirteen days after the introduction of the four genes, the
induced colonies were stained with alkaline phosphatase
activity.
[0410] From the above results, when cells derived from human
umbilical cord that is a human tissue immediately after birth
containing undifferentiated cells were subjected to a second
subculture in a culture medium containing 2% serum, it was possible
to induce the pluripotent stem cells.
Example 10
Induction of Human Pluripotent Stem Cells from Undifferentiated
Stem Cells Present in the Umbilical Cord (2)
[0411] As described below, using the cells (trade name: Normal
Human Umbilical Artery Smooth Muscle Cells, the third subculture)
derived from a human umbilical cord, a human tissue immediately
after birth, the induction of the human pluripotent stem cells of
the present invention from undifferentiated stem cells present in
the umbilical cord was attempted.
[0412] One vial of the frozen Normal Human Umbilical Artery Smooth
Muscle Cells (the third culture, manufactured by Lonza) was thawed
in a 37.degree. C. incubator, and suspended in the Smooth Muscle
Cell Medium kit-2 manufactured by Lonza (5% serum) (hereinafter
referred to as SmGM-2) to obtain 12 ml of the cell suspension.
About 10.sup.5/2 ml/well each of the cell suspension was plated to
a 6-well plastic culture dish (manufactured by Becton Dickinson) of
which bottom had been coated with matrigel (manufactured by Becton
Dickinson) at a concentration of 20 .mu.g/cm.sup.2 (the fourth
subculture). One day later, the medium was removed, and the mCAT1
adenovirus vector at an amount equivalent to a m.o.i. of 1.25 to 5
in 5001 of the Hank's balanced salt solution per well was added,
and infected at room temperature for 30 minutes. 2.5 ml each of the
SmGM-2 medium was added to each well, and cultured at 37.degree.
C.
[0413] Forty eight hours after the introduction of the mCAT-1
adenovirus vector, the medium of each well was replaced with 2 ml
each of the retrovirus vector solutions (polybrene at a final
concentration of 5 .mu.g/ml was added) of the four genes (Oct3/4,
Sox2, Klf4 and c-Myc) prepared in Example 1, and cultured at
37.degree. C. for 4 hours. The virus supernatant was removed and
replaced with the MEF-conditioned ES medium. Then medium change
with the MEF-conditioned ES medium was continued every two days.
Thirteen days after the introduction of the four genes, colonies
were confirmed. However, the induced colonies were not stained with
alkaline phosphatase activity.
[0414] From the above results, it was revealed that though the
cells derived from human umbilical cord which is a human tissue
immediately after birth contains undifferentiated cells present in
the umbilical cord, when the cells were subjected to a fourth
subculture in a culture medium containing 5% serum, the induction
of the pluripotent stem cells is more challenging.
Example 11
Induction of Mouse Pluripotent Stem Cells from Undifferentiated
Stem Cells Present in a Mouse Postnatal Tissue
[0415] Using mouse bone marrow-derived cells, a mouse postnatal
tissue, the induction of pluripotent stem cells of the present
invention from undifferentiated stem cells present in a mouse
postnatal tissue was attempted.
[0416] Femurs and tibias were extracted from 4 to 6 week-old mice
(c57BL/6N lineage, 4-week-old, female) taking utmost care not to
bring in any other tissue. By soaking the collected bone in 70%
ethanol for a short period of time, the cells that attached to the
outside of the bone were killed to prevent the contamination of
cells other than the bone marrow. After ethanol treatment, the bone
was immediately transferred to Iscove's Modified Dulbecco's Medium
(IMDM) (SIGMA) to prevent the effect of the cells inside of the
bone marrow. The outside of each bone was wiped with Kimwipe to
remove the connective tissue. All of the treated bone was
transferred to a mortar containing IMDM, and was smashed with a
pestle. After washing several times with IMDM, the bone was cut
into pieces with scissors. After further washing with IMDM several
times, bone fragments were transferred to centrifuge tubes.
[0417] After removing IMDM, 10 ml of IMDM containing 0.2%
collagenase I (manufactured by SIGMA) per bone fragments of five
mice was added, and shaken at 37.degree. C. for 1 hour. After
shaking, the suspension was stirred several times using a Pipetman,
and then the supernatant was transferred to another tube, to which
an equal amount of cold 10% FBS-containing IMDM was added to stop
the enzyme reaction. The bone fragments after enzyme treatment were
transferred to a mortar containing cold 10% FBS-containing IMDM,
and smashed again with a pestle, and after stirring several times,
the supernatant was collected. The cell suspension thus collected
was filtered by sequentially passing through a Nylon mesh of 70
.mu.m and 40 .mu.m in diameter. The cell suspension was centrifuged
at 4.degree. C. and 600 g for 7 minutes, and cells derived from the
mouse deep bone marrow were collected.
[0418] The cells derived from mouse deep bone marrow were suspended
in the MAPC medium, and plated at a density of 10.sup.5
cells/cm.sup.2. For plating of cells, a dish previously coated with
a phosphate buffer containing 10 ng/ml fibronectin (Becton
Dickinson) was used. To the medium, growth factors [10 ng/ml
PDGF-BB (manufactured by Peprotech), 10 ng/ml EGF (manufactured by
Peprotech), 1000 units/ml LIF (manufactured by Chemicon)] were
added at the time of use. Three days after plating, growth factors
were only added without changing the medium. Six days later,
non-adherent cells were washed off with the phosphate buffer, and
adherent cells were collected by detaching with a 0.05%
trypsin-EDTA solution (manufactured by Invitrogen), and using a
cell banker (manufactured by Juji Field), the cells were stored
frozen as the primary culture.
[0419] The primary culture cells that had been stored frozen were
thawed in a 37.degree. C. water bath, and suspended in 10 ml of the
MAPC medium that is a medium containing 2% FBS. In order to remove
DMSO in the frozen solution, it was centrifuged at 4.degree. C. and
300 g for 7 minutes, and the supernatant was removed. The cell mass
obtained was resuspended, and plated at a density of
2.5.times.10.sup.3 cells/cm.sup.2 on a 12-well plastic plate having
the bottom which had been gelatin-coated with 0.1%
gelatin/phosphate buffer, and 2 ml each of the MAPC medium was
added (the second subculture).
[0420] Eight to 14 hours later, the medium was removed, and 2 ml
each of the four gene retrovirus vector solution prepared as in
Example 1 was added thereto and cultured at 37.degree. C. for 4 to
14 hours. Then the virus solution was removed, and replaced with
the mouse ES medium [the ES medium to which a final concentration
of 0.3% FBS (manufactured by Invitrogen), 1000 units/ml LIF
(manufactured by Chemicon), and 0.1 mM 2-mercaptoethanol were
added]. Then medium change with the mouse ES medium was continued
every three days, and 5 to 7 days after the introduction of the
four genes, said pluripotent stem cells formed colonies comprising
mouse ES cell-like small cells. The colonies of the induced
pluripotent stem cells were stained blue violet by alkaline
phosphatase activity.
[0421] From the remaining wells of the 12-well plate, the mouse
pluripotent stem cells were subcultured, and subculture was
continued to a gelatin-coated 100 mm plate. From the seventh
subculture cells, RNA was extracted using the RNeasy mini kit
(manufactured by QIAGEN) and cDNA was synthesized. Using the cDNA,
quantitative PCR was conducted to confirm the expression of
Nanog.
[0422] The mouse pluripotent stem cells of the seventh subculture
were subcutaneously transplanted to the back of three syngeneic
C57BL/6N mice at 3.times.10.sup.5 cells/mouse, and 38 days later
the teratoma that formed was extracted. Teratoma was formed in all
three mice. From the extracted teratoma, slices were prepared, and
differentiation potential into three germ layers was analyzed by
immunological staining and histological staining (HE stain, alcian
blue stain). As a result, MAP2-positive cells (the nervous system)
and GFAP-positive cells (the nervous system) as the ectodermic
system, skeletal muscle cells (myocytes) and cartilage tissues as
the mesodermic system, and intestinal tract tissues as the
endodermic system were observed.
[0423] In order to maintain and grow the mouse pluripotent stem
cells, they were subcultured every 3 to 4 days. The medium was
removed from the plastic culture dish in which subculture is
carried out, washed with phosphate buffer, a 0.05% trypsin-EDTA
solution was added, and cultured at 37.degree. C. for 5 minutes.
When the cells detached, the ES medium was added to stop the
reaction, and the cell suspension was transferred to a centrifuge
tube. By centrifuging at 200 g for 5 minutes, the supernatant was
removed, and after suspending the precipitate in the mouse ES
medium, the cells were plated in a gelatin-coated plate at a
density of 10.sup.4 cells/cm.sup.2. The pluripotent stem cells
induced from the cells derived from the mouse bone marrow cultured
in low serum in the same subculture method could be cultured for a
long time.
[0424] As described above, pluripotent stem cells were induced from
the postnatal mouse bone marrow-derived cells established under the
low serum condition.
Example 12
Induction of Mouse Pluripotent Stem Cells by the Introduction of
Three Genes and Histone Deacetylase Inhibitor Treatment
[0425] Using cells derived from mouse bone marrow that is a mouse
postnatal tissue, the induction of pluripotent stem cells was
carried out with the introduction of three genes and histone
deacetylase inhibitor treatment.
[0426] The primary culture cells derived from mouse bone marrow
containing undifferentiated stem cells that had been stored frozen
after preparing in a manner similar to Example 11 were plated at a
density of 5.times.10.sup.3 cells/cm.sup.2 on a 24-well plastic
plate (manufactured by Becton Dickinson) having the bottom which
had been gelatin-coated with a 0.1% gelatin/phosphate buffer, and 2
ml each of the MAPC medium was added.
[0427] Eight hours later, the medium was removed, 2 ml each of the
three gene (human Oct3/4, Sox2 and Klf4) retrovirus vector solution
prepared as in Example 1 were added, and after further adding
MS-275, a histone deacetylase inhibitor, at a final concentration
of 1 or 0.1 .mu.M, they were cultured at 37.degree. C. for 14
hours. Then after removing the virus solution, 2 ml each of the
MAPC medium containing MS-275, a histone deacetylase inhibitor, at
a final concentration of 1 or 0.1 .mu.M was added. Three days
later, the medium was replaced with the mouse ES medium [a final
concentration of 0.3% FBS (manufactured by Invitrogen), 1000
units/ml LIF (manufactured by Chemicon) and 0.1 mM
2-mercaptoethanol were added to the ES medium at the time of
use].
[0428] Medium change with the mouse ES medium was continued every 2
to 3 days. Twelve days after the introduction of three genes (human
Oct3/4, Sox2 and Klf4) retrovirus vector, the cells were
subcultured from each well of the 24-well plastic plate to each
well of a 6-well plastic plate. A portion of it was also cultured
in a 24-well plastic plate. Fifteen days after said three gene
introduction and MS-275 treatment, the pluripotent stem cells
formed colonies composed of mouse ES cell-like small cells. The
colonies of said pluripotent stem cells were stained blue violet by
alkaline phosphatase activity.
[0429] Then, the amount expressed of the Nanog gene was confirmed
by quantitative PCR, and the expression of mouse Nanog of colonies
of pluripotent stem cells having alkaline phosphatase activity was
confirmed (FIG. 4). FIG. 4 shows the relative expression of Nanog
and Tert genes in mouse adult bone-marrow-derived cells following
introduction of three genes and treatment with histone deacetylase
(HDAC) inhibitor. Three genes (Oct3/4, Sox2, and Klf4) were
introduced into mouse bone marrow-derived cells established under
low serum conditions. The cells were also treated with MS-275 (0.1
or 1.0 .mu.M), an HDAC inhibitor. RNA was extracted from the
colonies obtained, and the amount of Nanog expression was
determined by quantitative PCR. From the cells in which three genes
were introduced and which were treated with a histone deacetylase
inhibitor, ALP-positive cell group (colonies) were formed, and it
was confirmed that the expression of Nanog in these colonies was
significantly higher than the ALP-negative colonies. In the figure,
W1, W2, W3, W4, W5 and W6 represent the designation of each well of
the 6-well plate used in Example 12.
[0430] Eighteen days after said three gene introduction and MS-275
treatment, the pluripotent stem cells were subcultured from each
well of the 6-well plate to a gelatin-coated 100 mm plate.
Subculture was continued similarly.
[0431] Twenty nine days after said three gene introduction and
MS-275 treatment, the mouse pluripotent stem cells were
subcutaneously transplanted to the back of syngeneic C57BL/6N mice
at 2.times.10.sup.7 cells/mouse, and 34 days later the teratoma
that formed was extracted. From the extracted teratoma, slices were
prepared, and differentiation potential into three germ layers was
analyzed by immunological and histological staining (HE stain,
alcian blue stain). As a result, GFAP-positive cells (the nervous
system) and keratin producing cells (skin cells) as the ectodermic
system, smooth muscle actin-positive cells (smooth muscle cells),
bone tissues and cartilage tissues as the mesodermic system, and
intestinal tract tissues (endodermal epithelium positive for MUC-1)
as the endodermic system were observed.
Example 13
Induction of Mouse Pluripotent Stem Cells by the Introduction of
Three Genes
[0432] Then, using cells derived from mouse bone marrow that is a
mouse postnatal tissue, the induction of mouse pluripotent stem
cells was carried out with the introduction of three genes.
[0433] The primary culture cells derived from mouse bone marrow
containing undifferentiated stem cells that had been stored frozen
after preparing in Example 11 were plated at a density of
1.times.10.sup.4 cells/cm.sup.2 on a 24-well plastic plate
(manufactured by Becton Dickinson) having the bottom which had been
gelatin-coated with a 0.1% gelatin/phosphate buffer solution, and 2
ml each of the MAPC medium was added.
[0434] Two days later, the medium was removed, 2 ml each of the
three gene (human Oct3/4, Sox2 and Klf4) retrovirus vector solution
prepared as in Example 1 were added, and after culturing at
37.degree. C. for 1 day, the virus solution was removed, and 2 ml
each of the MAPC medium was added. Three days later, the medium was
replaced with the mouse ES medium [a final concentration of 0.3%
FBS (manufactured by Invitrogen), 1000 units/ml LIF (manufactured
by Chemicon) and 0.1 mM 2-mercaptoethanol were added to the ES
medium at the time of use]. Then medium change with the mouse ES
medium was continued every 2 to 3 days. Eleven days after the
introduction of three gene (human Oct3/4, Sox2 and Klf4) retrovirus
vector, the cells were subcultured from each well of the 24-well
plastic plate to each well of a 6-well plastic plate.
[0435] Then medium change with the mouse ES medium was continued
every 2 to 3 days. Nineteen days after said three gene
introduction, the pluripotent stem cells formed colonies composed
of mouse ES cell-like small cells. In order to confirm the alkaline
phosphatase activity, the medium was removed and then a 10%
formalin neutral buffer solution was added to wells, and fixed at
room temperature for 5 minutes. After washing with a phosphate
buffer etc., the 1 step NBT/BCIP solution (manufactured by Pierce)
comprising a chromogenic substrate of alkaline phosphatase was
added and reacted at room temperature for 20 to 30 minutes. The
colonies of said pluripotent stem cells were stained blue violet by
alkaline phosphatase activity.
[0436] Then, the amount expressed of the Nanog gene was confirmed
by quantitative PCR, and the expression of mouse Nanog of colonies
of pluripotent stem cells having alkaline phosphatase activity was
confirmed.
[0437] Using cells derived from mouse bone marrow that is a mouse
postnatal tissue, the induction of pluripotent stem cells was
carried out with the introduction of three genes.
[0438] The primary culture cells derived from mouse bone marrow
containing undifferentiated stem cells that had been stored frozen
after preparing in Example 11 were plated at a density of
1.times.10.sup.4 cells/cm.sup.2 on a 6-well plastic plate
(manufactured by Becton Dickinson) the bottom of which had been
gelatin-coated with a 0.1% gelatin/phosphate buffer solution, and
the MAPC medium was added in 2 ml portions.
[0439] Two days later, the medium was removed, the three gene
(human Oct3/4, Sox2 and Klf4) retrovirus vector solution prepared
as in Example 1 were added in 2 ml portions, and after culturing at
37.degree. C. for 1 day, the virus solution was removed, and the
MAPC medium was added in 2 ml portions. Three days later, the
medium was replaced with the mouse ES medium [a final concentration
of 0.3% FBS (manufactured by Invitrogen), 1000 units/ml LIF
(manufactured by Chemicon) and 0.1 mM 2-mercaptoethanol were added
to the ES medium at the time of use]. Medium change with the mouse
ES medium was continued every 2 to 3 days. Nine days after the
introduction of three gene (human Oct3/4, Sox2 and Klf4) retrovirus
vector, the cells were subcultured from each well of the 6-well
plastic plate to each well of a 10 cm plastic dish.
[0440] Medium change with the mouse ES medium was continued every 2
to 3 days. Seven days after said three gene introduction, the
pluripotent stem cells formed colonies composed of mouse ES
cell-like small cells. In order to confirm the alkaline phosphatase
activity, the medium was removed and then a 10% formalin neutral
buffer solution was added to wells, and fixed at room temperature
for 5 minutes. After washing with a phosphate buffer etc., the 1
step NBT/BCIP (manufactured by Pierce), a chromogenic substrate of
alkaline phosphatase, was added and reacted at room temperature for
20 to 30 minutes. The colonies of said pluripotent stem cells were
stained blue violet by alkaline phosphatase activity.
[0441] Then, the amount expressed of the Nanog gene was confirmed
by quantitative PCR, and the expression of mouse Nanog of colonies
of pluripotent stem cells having alkaline phosphatase activity was
confirmed.
[0442] Forty nine days after said three gene introduction, the
mouse pluripotent stem cells were subcutaneously transplanted on
the back of syngeneic C57BL/6N mice at 2.times.10.sup.7
cells/mouse, and 13 and 17 days later the teratoma that formed was
extracted. Slices were prepared from the extracted teratoma, and
differentiation potential into three germ layers was analyzed by
immunological and histological staining (HE stain, alcian blue
stain). As a result, GFAP-positive cells (the nervous system) and
keratin producing cells as the ectodermic system, smooth muscle
actin-positive cells (smooth muscle cells), bone tissues and
cartilage tissues as the mesodermic system, and intestinal tract
tissues (endodermal epithelium positive for MUC-1) as the
endodermic system were observed.
[0443] Likewise, after said three gene introduction, the mouse
pluripotent stem cells which were single-sorted based on GFP and
SSEA-1 positive with FACSAria, were subcutaneously transplanted on
the back of syngeneic C57BL/6N mice at 2.times.10.sup.7
cells/mouse, and 13 and 14 days later the teratoma that formed was
extracted. Slices were prepared from the extracted teratoma, and
differentiation potential into three germ layers was analyzed by
immunological and histological staining (HE stain, alcian blue
stain). As a result, neural tube derived cells positive for GFAP,
Nestin or Neurofilament as ectodermic system and cartilage tissues
as the mesodermic system, and intestinal tract tissues (endodermal
epithelium positive for MUC-1 and alpha-fetoprotein) as the
endodermic system were observed.
[0444] From the above results, pluripotent stem cell were obtained
by the forced expression of each of three genes of Oct3/4, Sox2,
and Klf4 in undifferentiated stem cell present in a postnatal
tissue. The pluripotent stem cells showed an in vitro long-term
self-renewal ability, and were expressed ES cell marker, Nanog
expression and alkaline phosphatase activity, and the ability of
differentiation of tissues derivative from all three germ layers
(ectoderm, mesoderm and endoderm).
Example 14
Long Term Expansion and Characterization of Human Induced
Pluripotent Stem Cells
[0445] Human induced pluripotent stem (iPS) cell line generated
from neonatal human skin fibroblasts (lot # 5F0438) in Example 6
which was termed iPS-1-8 was further sub-cloned with cloning
cylinder and 0.25% trypsin-EDTA as described in Example 6. Nine
sub-clones which were termed human iPS-1-1, 1-2, 1-3, 1-4, 1-5,
1-6, 1-7, 1-8 and 1-9 were obtained. One of nine sub clones, termed
human iPS-1-8 clone, was successfully expanded on MEF feeder cells
in human ES medium supplemented with 0.1 mM 2-mercaptoethanol and
10 ng/ml bFGF or in mTeSR1 defined medium (Stem cell Technologies)
on matrigel (BD Biosciences)-coated culture dishes. Medium was
changed for human iPS-1-8 clone culture everyday and usually
treated with 5 to 20 .mu.M of Y-27632 (Calbiochem) to avoid cell
apoptosis triggered by the passaging procedures. For the passage to
continue the culture, human induced pluripotent stem cells were
washed with Hanks's balanced solution, incubated in 0.25%
trypsin-EDTA (Gibco) at 37.degree. C. for 3 minutes, and then added
the culture medium to terminate the trypsin activity. Human induced
pluripotent stem cells were centrifuged at 300.times.g at room
temperature or 4.degree. C. for 5 minutes and the supernatant was
removed. Precipitated human induced pluripotent stem cells were
re-suspended into culture medium. The pluripotent stem cells were
usually split into new culture dishes using 1:4 to 1:6 splits.
Human iPS-1-8 clone was frozen using Cell freezing solution for ES
cells (Reprocell) according to the manufacture's manual.
[0446] Human iPS-1-8 clone was morphologically indistinguishable
from typical human ES cell colonies with defined edges that consist
of small, round, and compact cells when cultured on mitomycin-C
treated mouse embryonic fibroblasts (MEFs) (FIG. 5). FIG. 5 shows
the characterization of human iPS clone 1-8. The morphology of its
parental fibroblast (lot. 5F0438) is shown in Panel a; the
morphology human iPS clone 1-8 cells cultured on murine embryonic
fibroblast (MEF) feeder cells is shown in Panel b; the morphology
of human iPS clone 1-8 cells in mTeSR1 medium is shown in Panel c;
clone 2-4 cells in mTeSR1 medium are shown in Panel d; and clone
3-2 cells in mTeSR1 medium are shown in Panel e. The growth curve
of clone 1-8 is shown in Panels f and g. Arrows indicate the dates
of examinations. The square indicates the period for counting cell
numbers to estimate cell proliferation rate. Panel h is a
multicolor karyogram image indicating a normal karyotype of iPS
clone 1-8 derived cell at day 101.
[0447] Human iPS-1-8 clone actively proliferated in mTeSR1 medium.
Human iPS-1-8 clone derived cells cultured in mTeSR1 medium was
termed human iPS-1-8 mTeSR cells. Human iPS-1-8 clone was able to
be passaged more than 30 times, and cultured for more than half
year after four factor infections (FIG. 5f, g). Human iPS-1-8 mTeSR
cells were able to be stored in liquid nitrogen and re-cultured in
mTeSR medium in the presence of 5 to 20 .mu.M of Y-27632.
Population doubling time of human iPS-1-8 mTeSR cells was
approximately 48.5 hours when analyzed between passages 19 to 26
which correspond to days 123 to 148 after four factor
infection.
[0448] Karyotype analysis of long-term cultured human iPS-1-8 clone
(1-8 mTeSR) was performed using giemsa stain and multicolor-FISH
analysis. Human iPS cells were pretreated with 0.02 .mu.g/ml
colecemid for 2 hours, followed by incubation with 0.075 M KCl for
20 minutes, and then fixed with Camoy's fixative. For
multicolor-FISH analysis, cells were hybridized with the multicolor
FISH probe (Cambio) and analyzed under DMRA2 fluorescent microscope
(Leica). Human iPS-1-8 mTeSR cells mainly maintained a normal
karyotype (46XY) after long-term culture in mTeSR (68%) without any
chromosomal translocation or deletion (FIG. 5h, Table 3).
[0449] For alkaline phosphatase staining, cells were fixed with 10%
formalin neutral buffer solution (Wako) at room temperature for 5
minutes, washed with PBS, and incubated with alkaline phosphatase
substrate 1 step NBT/BCIP (Pierce) at room temperature for 20-30
minutes. Cells having alkaline phosphatase activity were stained in
blue violet. For immunocytochemistry, cultured cells were fixed
with 10% formaldehyde for 10 minutes and blocked with 0.1%
gelatin/PBS at room temperature for 1 hour. The cells were
incubated overnight at 4.degree. C. with primary antibodies against
SSEA-3 (MC-631; Chemicon), SSEA-4 (MC813-70; Chemicon) TRA-1-60
(abcam), TRA-1-81 (abcam), CD9 (M-L13; R&D systems), CD24
(ALB9; abcam), CD90 (5E10; BD bioscience), or Nanog (R&D
systems). For Nanog staining, cells were permeabilized with 0.1%
Triton X-100/PBS before blocking. The cells were washed with PBS
for three times, and then incubated with AlexaFluor 488-conjugated
secondary antibodies (Molecular Probes) and Hoechst 33258 at room
temperature for 1 hour. After further washing, fluorescence was
detected with an Axiovert 200M microscope (Carl Zeiss).
[0450] Human iPS-1-8 mTeSR cells were positive for alkaline
phosphatase (hereinafter referred to as "ALP") activity and the
carbohydrate antigens SSEA-3 and SSEA-4, the keratin sulfate
antigens TRA-1-60 and TRA-1-81, and the protein antigens CD9, CD24,
Thy-1 (CD90) staining (FIG. 6). FIG. 6 shows the characterization
of transcription factors, cell surface antigens and ALP activity in
human iPS clone 1-8. Human iPS cells (clone 1-8) were stained for
Nanog (Panel a), SSEA-3 (Panel b), SSEA-4 (Panel c), TRA-1-60
(Panel d), TRA-1-81 (Panel e), CD9 (Panel f), CD24 (Panel g), Thy-1
(also called CD90) (Panel h). Green fluorescent staining indicates
that human iPS clone 1-8 expresses all of these surface antigens.
ALP staining indicates that iPS clone 1-8 is ALP positive. Arrows
illustrate regions of green fluorescent staining.
[0451] Total RNA was isolated from human iPS-1-8 clone, its
parental fibroblasts, and crude fibroblasts obtained on 17 days
after gene transduction by using RNeasy (Qiagen). cDNA was
synthesized by SuperScript III (Invitrogen). Gene expressions were
detected by PCR using Extaq (Takara). Sequences of the primers were
described in Table 4. "Exo" primer sets selectively detected
exogenous expression and "total" primer sets i endogenous
expression
[0452] Human iPS-1-8 clone expressed human ES marker genes Nanog,
TERT, Sal14, Zfp42, GDF3, Dnmt3b, TDGF1, GABRB3, and CYP26A1 though
the parental fibroblasts expressed none of those marker genes (FIG.
7a). In contrast to crude fibroblasts, the human iPS-1-8 clone
down-regulated forced expression of four genes, Oct4, Sox2, Klf4,
and c-Myc (FIG. 7b). FIG. 7 shows the RT-PCR analysis of gene
expression of human iPS clone 1-8 cells. Panel a depicts a RT-PCR
analysis of hES marker gene expression in clone 1-8 and its
parental fibroblast (NeoFB). Genes were detected at 30 cycles
except for CYP26A1 (35 cycles). Panel b depicts the silencing of
four transgenes in clone 1-8. Crude fibroblasts obtained 17 days
after gene transduction were used as control. "Exo" primer sets
selectively detected the expression of the exogenous genes; and
"total" primer sets detected both endogenous and exogenous gene
expression.
[0453] Human iPS cells cultured in both mTeSR1 on matrigel (1-8
mTeSR) and MEF-conditioned medium on matrigel (1-8CM) and its
parental fibroblasts (5F0438) were analyzed for global gene
expression. The microarray study was carried out using the
Affymetrix Human Genome U133 Plus 2.0 gene expression arrays
(Affymetrix, Santa Clara, Calif.). The GeneChip.RTM. Human Genome
U133 Plus 2.0 Array provides comprehensive coverage of the
transcribed human genome on a single array and analyzes the
expression level of over 47,000 transcripts and variants, including
38,500 well-characterized human genes. Briefly, total RNA was
extracted from cells with RNAeasy (Qiagen). Biotin-labelled cRNA
was reverse transcribed from 1 .mu.g of total RNA according to
Affymetrix technical protocols. Fifteen micrograms of cRNA was
fragmented and hybridized to a Affymetrix U133 plus 2 GeneChip
arrays at 45.degree. C. for 16 hours and then washed and stained
using the Affimetrix Fluidics (Affymetrix). The assays were scanned
in the Affimetrix GCS3000 scanner, and the images obtained were
analyzed using the GCOS software. Data from this experiment and GEO
were investigated with the GeneSpring 7.3.1. software.
[0454] For scatter plot analyses, human induced pluripotent stem
cell clone-1-8, cultured in mTeSR1 on matrigel (1-8 mTeSR) and its
parental fibroblasts (5F0438) were analyzed based on a set of
21,080 genes with present flag call (P<0.04) or marginal flag
call (0.04.ltoreq.P<0.06) for both clone 1-8 and H14 hES line
which is data from GEO (GSM151741), were used as a representative
of human ES cells for comparison purposes. FIG. 8 shows a scatter
plot analysis of the global gene expression of human iPS clone 1-8
cells. Scatter plots show a comparison of global gene expression
between human iPS clone-1-8 cells cultured in mTeSR1 and H14 hES
cells with MEFs (GSM151741 from public database GEO) (Panel a), or
between clone 1-8 and its parental fibroblasts (Panel b). Symbols
of ES cell specific genes were pointed with lines in both scatter
plots. Expression intensity was shown in colorimetric order from
red (high) to green (low). Arrows indicate representative regions
of color.
[0455] For cluster analysis, DNA microarray data for clone-1-8
cultured in mTeSR1 (1-8 mTeSR), clone 1-8 cultured in
MEF-conditioned medium (1-8CM) and its parental fibroblasts
(5F0438) were compared with DNA microarray data for Sheff 4 line
cultured on MEF (hES 1:GSM194307, hES2: GSM194308, hES3:
GSM194309), Sheff 4 line cultured on matrigel (hES4: GSM194313,
hES5: GSM194314), H14 line cultured on MEF (hES6: GSM151739, hES7:
GSM151741), and three fibroblasts (GSM96262 for Fibroblasts1,
GSM96263 for Fibroblasts2 and GSM96264 for Fibroblasts3).
[0456] The global gene expression profiles of the human iPS lines
(1-8, 2-4, and 3-2) and their parental fibroblasts were analyzed
using microarray technology. Hierarchical cluster analysis using
the gene set defined by the International Stem Cell Initiative (see
Table 21) revealed that the human iPS lines (1-8, 2-4, and 3-2)
clustered with human ES cell lines but separated from their
parental skin-derived cells (FIG. 9). FIG. 9 shows global gene
expression of different cell lines and gene trees based on global
gene expression analysis. Cells were clustered in the gene tree
based on a set of genes identified by the International Stem Cell
Initiative (see Table 21). Samples were designated "1-8 mTeSR" for
clone-1-8 cultured in mTeSR; "1-8CM" for clone 1-8 cultured in
MEF-conditioned medium; "1-8 mTeSR(f&t)" for clone 1-8 cultured
in mTeSR after freeze-thaw treatment; "1-8MEF" for clone 1-8
cultured on MEF; "2-4 mTeSr" for clone 2-4 cultured in mTeSR
medium; "2-4MEF" for clone 2-4 cultured on MEF; "3-2 mTeSR" for
clone 3-2 cultured in mTeSR medium; "5F0438" or "5F0416" for the
parental fibroblasts; "hES1," "hES2," "hES3" (GSM194307, GSM194308,
GSM194309, respectively) for Sheff 4 line cultured on MEF; "hES4,"
or "hES5" (GSM194313, GSM194314, respectively) for Sheff 4 line
cultured on matrigel; "hES6," or "hES7" (GSM151739, GSM151741) for
H14 line cultured on MEF; "Fibroblasts1" for GSM96262;
"Fibroblasts2" for GSM96263, and "Fibroblasts3" for GSM96264,
respectively. Expression intensity was shown in colorimetric order
from red (high) to green (low).
[0457] The Pearson correlation coefficient was 0.675 between human
ES cell lines sheff4 and H14, and 0.835 between human iPS cell line
1-8 and human ES cell line H14 (FIG. 9). Similar Pearson
correlation efficients were observed between the global gene
expression profiles of iPS lines 1-8, 2-4, and 3-2 and the hES cell
lines This analysis indicates that human iPS cell line 1-8 had a
similar gene expression pattern to the human ES cell lines H14.
[0458] Scatter plot analysis between human iPS cell line (clone
1-8) and human ES cell line H14 indicates that the human ES cell
marker genes, Nanog, Oct3/4, TDGF1, Dnmt3b, GABRB3, GDF3, Zfp42,
ALP, CD9, and Thy-1 showed high correlation between human iPS cell
line and human ES cell line H14 (FIG. 8a). In contrast, clone1-8
was different from the parental neonatal fibroblasts (FIG. 8b).
This was confirmed by the cluster analysis using the Nanog-related
genes. Pearson correlation coefficient was 0.908 between human iPS
cell line 1-8 and human ES cell line H14 and 0.100 between human
iPS cell line 1-8 and its parental fibroblasts (FIG. 10). FIG. 10
shows global gene expression of different cell lines and gene trees
based on the global gene expression analysis. Cells were clustered
in the gene tree based on a set of genes correlated with Nanog gene
expression in human ES cells (seven GEO data) between the ratio of
0.99 and 1 when compared with fibroblasts (three GEO data). Samples
were designated "1-8 mTeSR" for clone-1-8 cultured in mTeSR;
"1-8CM" for clone 1-8 cultured in MEF-conditioned medium, "5F0438"
for the parental fibroblasts, "hES1," "hES2," "hES3" (GSM194307,
GSM194308, GSM194309, respectively) for Sheff 4 line cultured on
MEF; "hES4," "hES5" (GSM194313, GSM194314, respectively) for Sheff
4 line cultured on matrigel" "hES6," "hES7" (GSM151739, GSM151741,
respectively) for H14 line cultured on MEF; "Fibroblasts 1" for
GSM96262, "Fibroblasts2" for GSM96263, and "Fibroblasts3" for
GSM96264, respectively. Expression intensity was shown in
colorimetric order from red (high) to green (low). Global gene
expression data for the 1-8, 2-4, and 3-2 cell lines and their
parental fibroblasts were deposited in the Gene Expression Omnibus
(GEO) database under accession number GSE9709. These analyses
reveal that human iPS cell line is very similar to human ES cell
lines in terms of gene expression.
[0459] The promoter regions of Nanog and Oct3/4 in clones 1-8 and
2-4 were analyzed for methylation of individual CpG sites. Ten
nanograms of bisulfite-treated genomic DNA was PCR-amplified with
primers containing a T7-promoter and transcripts treated with RNase
A. As fragments originating from a methylated CpG sequence
contained a G instead of an A-base, they had a 16 Da higher
molecular weight than those resulting from the corresponding
non-methylated CpG. This mass difference was detected using a
MALDI-TOF mass spectrometer (Autoflex, Bruker Daltonics). The
spectra produced by the mass spectrometer were analyzed using the
EpiTYPER (Sequenom). The percentage methylation of individual CpG
sites was calculated using the area under the peak of the signal
from the unmethylated and methylated fragments. The percentage
methylation of individual CpG sites was calculated using the area
under the peak of the signal from the unmethylated and methylated
fragments. Table 9 lists up locations and sizes in genome
corresponding to the amplicons used for the methylation analyses.
Table 10 lists up the primer sets using for methylation
analyses.
[0460] The Oct3/4 proximal promoter including conserved region 1
(CR1), the Oct3/4 promoter distal enhancer including CR4 and the
Nanog proximal promoter including Oct3/4 and Sox2 binding sites
were examined (FIG. 11a). As shown in FIG. 11b,
cytosine-phosphate-guanosine (CpG) dinucleotides in these regions
were demethylated in clones 1-8 and 2-4 derived cells compared to
the parental fibroblasts.
[0461] Human iPS-1-8 mTeSR cell-suspension (0.5 to 2.times.10.sup.6
cells/mouse) was injected into the medulla of left testis of 7 to 8
week old SCID mice (CB17, Oriental Yeast) using a Hamilton syringe.
After 6 to 8 weeks, the teratomas were excised under perfusion with
PBS followed with 10% buffered formalin, and subjected to the
histological analysis. Human iPS-1-8 mTeSR cells gave rise to
teratomas 4 to 8 weeks after transplantation into testes of SCID
mice.
[0462] Teratomas were embedded in the mounting medium, and
sectioned at 10 .mu.m on a cryostat. Serial sections were stained
with hematoxylin-eosin (HE) to visualize the general morphology.
For the detection of cartilage, alcian blue staining was employed
or combined with HE.
[0463] For immunostaining, sections were treated with Immunoblock
(Dainippon-Sumitomo) for 30 minutes to block non-specific binding.
Slides were incubated with the following primary antibodies: anti
Nestin polyclonal antibody (PRB-570C, COVANCE, 1:300), anti Type II
collagen polyclonal antibody (LB-1297, LSL, 1:200), anti Smooth
muscle actin polyclonal antibody (RB-9010-R7, LAB VISION, 1:1),
anti .alpha.-Fetoprotein polyclonal antibody (A0008, DAKO, 1:500),
anti MUC-1 polyclonal antibody (RB-9222-P0, LAB VISION, 1:100), and
anti Human nuclei monoclonal antibody (HuNu) (MAB1281, CHEMICON,
1:300). For Type II collagen, before the treatment with primary
antibody a section was incubated with Hyaluronidase (25 mg/mL) for
30 minutes. Localization of antigens was visualized by using
appropriate secondary antibodies (Alexa fluor 594 and 688,
Molecular Probes, 1:600). Nuclei were stained with DAPI.
Immunostained teratoma sections were analyzed under a fluorescence
microscope (Axio Imager Z1, Zeiss).
[0464] Teratomas of human iPS-1-8 mTeSR cells contained tissues
representative of three germ layers, neuroectoderm, mesoderm, and
endoderm. FIG. 12 shows teratoma that was derived from human
iPS-1-8 mTeSR cells cultured for 94 days (T1). Human iPS-1-8 mTeSR
cells were injected into SCID mouse testes and analyzed 56 days
after injection. HE and alcian blue staining of teratoma tissues
reveled that teratomas contained neural epitherium (positive for
nestin) cartilage (positive for collagen II), endodermal
tract(alpha-fetoprotein). Human iPS-1-8 mTeSR cell derived tissues
were distinguished from host tissues by HuNu staining. In T1
teratoma, smooth muscle cells (positive for alpha-SMA) and
secretary epithelium (positive for MUC-1) were also observed (FIG.
13). Human iPS-1-8 mTeSR cells which were cultured for 102 days and
114 days, were injected into SCID mouse testes and analyzed 48 days
and 42 days (T3) after injection, respectively (T2, FIG. 13, T3,
FIG. 14). Tissues representative of three germ layers,
neuroectoderm, mesoderm and endoderm, were observed. To confirm
whether human iPS can be cryopreserved, human iPS-1-8 mTeSR cells
were frozen down, stored in liquid nitrogen and recultured. These
cells were injected into SCID mouse testes and analyzed 46 days
(T-F1) and 48 days (T-F2) after injection. Tissues representative
of three germ layers, neuroectoderm, mesoderm and endoderm, were
observed. Melanocytes were also observed in the T-F2 teratoma (FIG.
14). Thus, pluripotency was maintained via freezing and
thawing.
[0465] Both southern blot analysis and genomic PCR analysis
indicated human iPS-1-8 clone carried four transgenes. In southern
blot analysis cDNA fragments were prepared by restriction enzyme
digestion (XhoI for POU5F1, NotI for Sox2, PstI for KIF4) from the
corresponding pMX vector plasmids. These fragments were purified as
[32P]-labeled probes with agarose gel electrophoresis and a
QIAquick gel extraction kit (QIAGEN). Genomic DNA was prepared from
the human iPS clone 1-8 and its parental fibroblasts. Five .mu.g of
each genomic DNA was digested with KpnI (POU5F1, Sox2, and Klf4).
Fragments were separated on a 0.8% agarose gel, blotted onto
HybondXL membrane (GE Healthcare), and hybridized with
[32P]-labeled probes. Human iPS clone-1-8 was shown to carry
approximately ten copies of both Oct3/4 transgenes and Sox2
transgenes, and a single copy of Klf4 transgene (FIG. 15). In
genomic PCR analysis, primer set indicated as c-Myc-total in Table
4 was designed so that the amplicon included whole second intron of
c-Myc. Thus, amplicon size of the transgene (338 bp) was smaller
than amplicon of endogene (1814 bp). Vector plasmid and the
parental fibroblast genome, crude cultured fibroblast genome
obtained from 17 days culture post infection were used as a control
template. The genomic PCR confirmed clone-1-8 cells carries c-Myc
transgene (FIG. 15).
[0466] SNP genotyping was performed with the use of the GeneChip
Human Mapping 500K Array Set (Affymetrix) according to the
manufacture's protocol. Human iPS-1-8 mTeSR cells cultured in
mTeSR1 on matrigel, its parental fibroblasts (5F0438), and
fibroblast (5F0416) derived from a different donor were analyzed
for this assay. The array set includes a StyI and a NspI chip. Two
aliquots of 250 ng of DNA each were digested with NspI and StyI,
respectively. Each enzyme preparation was hybridized to the
corresponding SNP array (262,000 and 238,000 on the NspI and StyI
array respectively). The 93% call rate threshold at P=0.33 (dynamic
Model algorithm confidence threshold) with the Dynamic Model
algorithm 138 was used in individual assays.
[0467] To confirm whether human iPS-1-8 mTeSR cells were generated
from fibroblasts (5F0438), we compared SNP genotyping between human
iPS-1-8 mTeSR cells and the employed fibroblasts (Table 5). SNPs of
human iPS-1-8 mTeSR cells were consistent to that of parental cells
in 464,069 (99.17%) of 467,946 of called SNPs and different from
that of parental cells in 3,877 (0.83%) of them. In contrast, SNPs
of human iPS-1-8 mTeSR cells were consistent to that of unrelated
donor cells (5F0416) only in 284,950 (60.50%) of 470,960 of called
SNPs and different from that of the unrelated cells in 186,010
(39.50%) of them. Thus, human iPS-1-8 clone (1-8 mTeSR) and
parental cells had almost the same SNP genotype to each other,
strongly suggesting that both cells originated from a single
donor.
[0468] HLA DNA typing was performed by utilizing hybridization of
PCR-amplified DNA with sequence specific oligonucleotide probes
(SSOP) (Luminex). To investigate the DNA mutation ratio associated
with the process of pluripotent stem cell induction, genome-wide
single-nucleotide polymorphism array analysis was performed for
human iPS clone 1-8 (n=2), its parental skin-derived cells (n=2),
and skin cells derived from another donor (n=1). No marked
differences were observed between human iPS clone 1-8 and the
parental cells (Table 5). Consistent with these observations, HLA
genotypes of human iPS cell lines 1-8, 2-4, and 3-2 were identical
to those of their respective parental cells. Assays were performed
to determine the HLA-A, HLA-B, HLA-Cw, HLA-DR, HLA-DQ, HLA-DP and
Bw loci according to manufacturer's instructions. Human iPS cells
are promising materials in cell transplantation therapies, they
would overcome immune rejection, because human iPS cells can be
directly generated from subjects' cells and must be the identical
HLA type. We carried out HLA typing of human iPS-1-8 clone (1-8
mTeSR), parental cells (5F0438), and unrelated fibroblasts
(5F0416). As expected, HLA type of iPS-1-8 clone was completely
identical to that of 5F0438 but not 5F0416 (Table 6).
[0469] From the foregoing, human pluripotent stem cell were
obtained by the forced expression of each of four genes of Oct3/4,
Sox2, Klf4, and c-Myc in undifferentiated stem cell present in a
human postnatal tissue. The human pluripotent stem cells showed an
in vitro long-term self-renewal ability and the pluripotency of
differentiation into ectoderm, mesoderm and endoderm. The human
pluripotent stem cells were expressed cell surface antigens SSEA-3,
SSEA-4, TRA-1-60, TRA-1-81, CD9, CD24, and CD90, and ES cell marker
genes Nanog, Oct3/4, TDGF1, Dnmt3b, GABRB3, GDF3, Zfp42, ALP, CD9,
and Thy-1. The promoter regions of Nanog and Oct3/4 in the human
pluripotent stem cells were demethylated compared to the parental
fibroblasts. The human pluripotent stem cells carries at least a
single copy of Oct3/4, Sox2, Klf4, and c-Myc transgene. The induced
human pluripotent stem cells and the parental cells
(undifferentiated stem cell present in a human postnatal tissue)
had almost the same SNP genotype each other, and HLA type of the
induced human pluripotent stem cell was completely identical to
that of the parental cell (undifferentiated stem cell present in a
human postnatal tissue).
Example 15
Gene Expression Profile of Primary Culture of 4 Genes Introduced
Neonatal Fibroblast
[0470] Two lots of neonatal fibroblasts (5F0416 and 5F0474) were
seeded at 103 cells/cm2 or 104 cells/cm2 into 35 mm diameter wells
of 6 well plates and cultured in FBM supplemented with FGM-2
SingleQuots (manufactured by Lonza) before the four genes
transduction. Cells were infected with mCAT1-adenovirus vectors at
2.times.105 ifu/well and then infected with the retroviral vectors
carrying four genes as described in Example 6. Eight wells were
prepared for this study (2 different lot and 2 different densities
in duplicate).
[0471] Seventeen days post 4-gene infection, cells were fixed and
stained for alkaline phosphatase (ALP) as described in Example 3.
In total, 163 ALP positive(+) colonies were observed in four
independent experiments. All 163 ALP(+) colonies and 18
ALP-negative (ALP(-)) colonies were dissected, and total RNA from
these colonies were extracted using a RecoverAll Total Nucleic Acid
Isolation kit (manufactured by Ambion). After the cDNA preparation,
genes of interest were amplified using Taqman preamp (manufactured
by Applied Biosystems). Real-time quantitative PCR was performed
with ABI PRISM 7900HT (manufactured by Applied Biosystems) using
PCR primer sets (manufactured by Applied Biosystems, Nanog,
Hs02387400_g1, Dnmt3b, Hs00171876_m1, FoxD3, Hs00255287_s1, Zfp42,
Hs01938187_s1, TDGF1, Hs02339499_g1, TERT, Hs00162669_m1, GDF3,
Hs00220998_m1, CYP26A1, Hs00175627_m1, GAPDH, Hs99999905_m1) to
determine gene expression of human ES cell markers in colonies.
Eight genes (Nanog, TDGF1, Dnmt3b Zfp42 FoxD3, GDF3, CYP26A1 and
TERT genes) which were reported to express in human ES cells were
selected as a pluripotent stem cell marker genes. A standard curves
was generated for each primer pair. All expression values were
normalized against GAPDH.
[0472] It is known that mouse ES cells and mouse iPS cells form
multilayered/aggregated colonies. Thus we first analyzed the mouse
ES cell like aggregated colonies which were induced by ectopic
expression of four gene in human fibroblasts (e.g., colony #1-2-F
and #1-2-B in FIG. 23). However, these colonies are all ALP(-).
Next we analyzed the Nanog gene expression in colonies. Nanog gene
expression was observed in 161 out of 163 ALP positive colonies and
16 out of 18 ALP negative colonies. On the other hand expression of
TERT and CYP26A1 genes were observed only in 26 and 24 colonies out
of 163 ALP positive colonies respectively (FIG. 16a). Genes such as
Nanog, TDGF, and Dnmt3b which are well know to be close association
with the pluripotent state in human ES cells, and to be strongly
downregulated upon their differentiation had higher tendency to be
induced by the four gene transduction.
[0473] ALP positive colonies can be categorized into 40 groups
based on the gene expression pattern of the eight human marker
genes (Table 7). When colonies are categorized by the total number
of eight marker genes expression, the distribution of colony number
followed a normal distribution suggesting the presence of a
stochastic process in the colony induction (FIG. 16c,d). In
addition the efficiency of human ES cell marker gene expression in
human fibroblasts was affected by the donor difference.
[0474] Quantitative gene expression analysis of colonies formed 17
days after infection indicated that the transgenes c-Myc and Oct4
showed high expression in all the analyzed colonies (Table 11). In
addition endogenous Nanog expression was very high in most of the
ALP positive colonies, including cells lacking expression of one or
more of the eight human ES cell marker genes (Table 11). These
results indicate that the process of pluripotent stem cell
induction from human skin fibroblasts is slower than that described
for mouse iPS cell generation. Only 4 out of 163 ALP positive
colonies were positive for Nanog, TDGF1, Dnmt3b, Zfp42, FoxD3,
GDF3, Cyp26a1 and TERT (octa-positive colony). Cells in these
octa-positive colonies showed common features: 1) small size with
the high nucleus to cytoplasm ratio and 2) formation of small
monolayer colonies within the space between fibroblasts (FIG. 16c).
These features are consistent to the feature of human ES cells.
However, these three features were also observed in some of ALP(+)
colonies which lacked one or more ES cell marker expression. In
addition, the large colony with these three features lack ALP
expression (FIG. 23 colony #7-1-1). ALP (+) colonies with
fibroblastic feature (colony #5-1-7, #3-1-214, #3-2-233, #3-1-212,
#3-1-215, #5-1-4 in FIGS. 17-23 and Table 7, 11) usually lacked one
or more ES cell marker gene expressions.
[0475] These results indicate that induced pluripotent stem cells
can be isolated from small monolayer colonies comprising small
cells with high nucleus to cytoplasm ratio not from fibroblastic
colonies, defused colonies or multilayered colonies. Table 8
summarizes all of experiments and results on the ALP positive
colony number using human neonatal fibroblasts.
Example 16
Generation of Human iPS-2-4 Clone from Human Neonatal Skin
Fibroblasts
[0476] Adenovirus vector plasmids for mCAT1 were transfected into
293 cells. The mCAT1-adenoviruses were isolated from these cells by
three freeze-thaw cycles, purified using Adenovirus purification
kit (Clontech) and stored at -80.degree. C. The titer of the vector
stocks was determined by Adeno-X rapid titer kit (Clontech).
[0477] The replication deficient MMLV derived retrovirus vector pMx
was used for the ectopic expression of human Oct3/4, Sox-2, c-Myc
and Klf4. Recombinant retroviruses were generated by transfecting
vectors to the Plat-E packaging system (Morita et al., (2000), Gene
Therapy, 7:1063-1066) followed by incubation in FBM (Lonza)
supplemented with FGM-2 SingleQuots (Lonza). Between 24 and 48
hours after the transfection, supernatant from the Plat-E culture
was collected several times at intervals of at least 4 hours and
passed through a 0.45 .mu.m filter.
[0478] For MEF-conditioned medium (MEF-CM) preparation, human ES
medium (DMEM/F12 (Gibco) supplemented with 20% Knockout Serum
Replacement (KSR, Invitrogen), 2 mM L-glutamine (Sigma), 1.times.
nonessential amino acids (Sigma), 10 .mu.g/ml gentamycin), 10 ng/ml
bFGF was conditioned on mitomycin-C treated MEF (Reprocell) for
20-24 hours, harvested, filtered through a 0.45 .mu.m filter and
supplemented with 0.1 mM 2-mercaptoethanol (Sigma) and 10 ng/ml
bFGF before use.
[0479] Using cells (trade name: Neonatal Normal Human Skin
Fibroblasts, primary culture) derived from a human neonatal tissue,
a human tissue immediately after birth, the induction of human
pluripotent stem cells from undifferentiated stem cells present in
the skin of a human neonate was attempted.
[0480] Human neonatal dermal fibroblasts (Lonza; lot 5F0416) were
cultured in FBM supplemented with FGM-2 SingleQuots. Three days
before the 4 gene introduction, fibroblasts were seeded at 103
cells/cm2 into 6 well plates. Eighteen hours later, the cells were
mixed with the mCAT1 adenovirus vector solution in 500 .mu.l Hanks'
balanced salt solution, and incubated at room temperature for 30
min. The cells were then added to 2 ml of medium and cultured for
48 hrs. Subsequently, the cells were incubated in 2 ml of the
retrovirus/polybrene solution (mixture of equal volumes of the
retrovirus vector suspension for each of the four genes (Oct3/4,
Sox2, Klf4 and c-Myc) prepared in Example 1, supplemented with 5
.mu.g/ml of polybrene) at 37.degree. C. for 4 hrs to overnight. The
virus supernatant was replaced with MEF-conditioned ES medium. Then
medium was changed every days.
[0481] On day 33 after gene introduction, a colony with a
characteristic shape was picked with forceps from a well. The
picked colony was transferred into a matrigel-coated well in a
24-well plate and maintained in mTeSR1 defined medium supplemented
with 10 .mu.M Y-27632. Fourteen hours later the medium was changed.
Medium change was continued every days. At day 54 after the
infection a second culture was carried out. At day 67, human
iPS-2-4 clone was sub-cloned and designated as human iPS-2-4
sub-clone.
[0482] For passaging, medium was removed, and the cells were washed
with the Hank's balanced salt solution followed by the treatment
with 0.25% trysin-EDTA at 37.degree. C. for 3 minutes. Fresh medium
was added to stop the reaction. The cell suspension was centrifuged
at 4.degree. C. and 200.times.g for 5 minutes, and the supernatant
was removed. The cells were resuspended in mTeSR1 defined medium
supplemented with 10 .mu.M Y-27632 and plated.
[0483] Human iPS-2-4 sub-clone was successfully expanded in mTeSR1
defined medium (Stem cell Technologies) on matrigel (BD
Biosciences)-coated culture dishes. We termed cells derived from
the sub-clone iPS-2-4 and cultured in mTeSR1 medium as human
iPS-2-4 mTeSR cells. Medium was changed for human iPS-2-4 mTeSR
cell culture everyday and usually treated with Y-27632 (Calbiochem)
to avoid cell apoptosis after passaging. For passaging, cells were
washed with Hanks's balanced solution, incubated in 0.25%
trypsin-EDTA (Gibco) at 37.degree. C. for 3 minutes, and then added
the culture medium. Cells were centrifuged at 300.times.g at room
temperature or 4.degree. C. for 5 minutes and the supernatant was
removed. The cells were re-suspended into culture medium. Human
iPS-2-4 mTeSR cells were morphologically indistinguishable from
typical human ES cells and human iPS-1-8 mTeSR cells, which grown
in colonies with defined edges consisting of small, round cells
with a high nucleus to cytoplasm ratio.
[0484] Fifty nine days post 4-gene infection, a part of cells were
fixed and stained for alkaline phosphatase (ALP) as described in
Example 3. Colonies consisting of cells were positive for ALP and
Total RNA from colonies was extracted using a RecoverAll Total
Nucleic Acid Isolation kit (manufactured by Ambion). After the cDNA
preparation, genes of interest were amplified using Taqman preamp
(manufactured by Applied Biosystems). Real-time quantitative PCR
was performed with ABI PRISM 7900HT (manufactured by Applied
Biosystems) using PCR primer sets (manufactured by Applied
Biosystems, Nanog, Hs02387400_g1, Dnmt3b, Hs00171876_m1, FoxD3,
Hs00255287_s1, Zfp42, Hs01938187_s1, TDGF1, Hs02339499_g1, TERT,
Hs00162669_m1, GDF3, Hs00220998_m1, CYP26A1, Hs00175627_m1, GAPDH,
Hs99999905_m1) to determine gene expression of human ES cell
markers in colonies. Clone-2-4 showed expression of ES cell marker
genes (Table 12). As observed for the iPS 1-8 line, both southern
blot analysis and genomic PCR analysis indicated the 2-4 line
contained integrated Oct 3/4, Sox2, Klf4, and c-Myc transgenes.
Likewise, the 2-4 iPS line expressed the cell surface markers CD24,
CD90, TRA 1-60, TRA-1-81, SSEA3, and SSEA4; had a normal karyotype;
HLA genotypes identical to its parental cells, a global gene
expression pattern similar to that of the 1-8 line; and an Oct 3/4
and Nanog promoter hypomethylation as observed in the 1-8 line.
[0485] From the above results, human pluripotent stem cell were
obtained by the forced expression of each of four genes of Oct3/4,
Sox2, Klf4, and c-Myc in undifferentiated stem cell present in a
human postnatal tissue. The human pluripotent stem cells showed an
in vitro long-term self-renewal ability, and expressed the ES cell
marker genes Nanog, Oct3/4, TDGF1, Dnmt3b, GABRB3, GDF3, Zfp42,
ALP, CD9, and Thy-1.
Example 17
Generation of Human iPS-3-2 Clone from Human Neonatal Skin
Fibroblasts
[0486] According to Example 16, human neonatal dermal fibroblasts
(Lonza; lot 5F0438) were cultured in FBM supplemented with FGM-2
SingleQuots. Three days before the 4 gene introduction, fibroblasts
were seeded at 103 cells/cm2 into 6 well plates. Eighteen hours
later, the cells were mixed with the mCAT1 adenovirus vector
solution in 5001 Hanks' balanced salt solution, and incubated at
room temperature for 30 min. The cells were then added to 2 ml of
medium and cultured for 48 hrs. Subsequently, the cells were
incubated in 2 ml of the retrovirus/polybrene solution (mixture of
equal volumes of the retrovirus vector suspension for each of the
four genes (Oct3/4, Sox2, Klf4 and c-Myc) prepared in Example 1,
supplemented with 5 .mu.g/ml of polybrene) at 37.degree. C. for 4
hrs to overnight. The virus supernatant was replaced with
MEF-conditioned ES medium. Then medium was changed every days.
[0487] On day 21 after gene introduction, a colony with a
characteristic shape was directly picked with forceps from one of
dishes. The picked colony was transferred into a matrigel-coated
well in a 24-well plate and maintained in mTeSR1 defined medium
supplemented with 10 .mu.M Y-27632.
[0488] Fourteen hours later the medium was changed. Medium change
was continued every days. 40 days after the infection, a second
subcloning was carried out, and cells were successfully expanded in
mTeSR1 defined medium (Stem cell Technologies) on matrigel-coated
culture dishes. Medium was changed everyday and usually treated
with Y-27632 (Calbiochem) to avoid cell apoptosis after passaging.
For passaging, cells were washed with Hanks's balanced solution,
incubated in 0.25% trypsin-EDTA (Gibco) at 37.degree. C. for 5
minutes, and then added the culture medium. Cells were centrifuged
at 300.times.g at room temperature for 5 minutes and the
supernatant was removed. The cells were re-suspended into culture
medium.
[0489] Cells were morphologically indistinguishable from typical
human ES cells, human iPS-1-8 mTeSR cells, and human iPS-2-4 mTeSR
cells, which grow in colonies with well defined edges and consist
of small, round cells with a high nucleus to cytoplasm ratio. Thus
we termed this clone as human iPS-3-2 clone. Human iPS-3-2 clone
actively proliferated in mTeSR1 medium. We termed these cells
derived from human iPS-3-2 clone which culture in mTeSR1 medium as
human iPS-3-2 mTeSR cells.
[0490] Forty eight days post 4-gene infection, cells were fixed and
stained for alkaline phosphatase (ALP) as described in Example 3.
Total RNA from colonies were extracted using a RecoverAll Total
Nucleic Acid Isolation kit (manufactured by Ambion). After the cDNA
preparation, genes of interest were amplified using Taqman preamp
(manufactured by Applied Biosystems). Real-time quantitative PCR
was performed with ABI PRISM 7900HT (manufactured by Applied
Biosystems) using PCR primer sets (manufactured by Applied
Biosystems, Nanog, Hs02387400_g1, Dnmt3b, Hs00171876_m1, FoxD3,
Hs00255287_s1, Zfp42, Hs01938187_s1, TDGF1, Hs02339499_g1, TERT,
Hs00162669_m1, GDF3, Hs00220998_m1, CYP26A1, Hs00175627_m1, GAPDH,
Hs99999905_m1) to determine gene expression of human ES cell
markers in colonies. Clone 3-2 showed expression of ES cell marker
genes (Table 12). Genomic PCR analysis indicated the 3-2 line
contained integrated Oct 3/4, Sox2, Klf4, and c-Myc transgenes.
Likewise, the 3-2 iPS line had HLA genotypes identical to its
parental cells and a global gene expression pattern similar to that
of the 1-8 line.
[0491] From the above results, human pluripotent stem cell were
obtained by the forced expression of each of four genes of Oct3/4,
Sox2, Klf4, and c-Myc in undifferentiated stem cell present in a
human postnatal tissue. The human pluripotent stem cells showed an
in vitro long-term self-renewal ability, and were expressed ES cell
marker genes Nanog, Oct3/4, TDGF1, Dnmt3b, GABRB3, GDF3, Zfp42,
ALP, CD9, and Thy-1.
Example 18
Induction of Human Pluripotent Stem Cells by Forced Expression of
Oct3/4 Sox2 and Klf4 by Retroviral Transduction Plus HDAC Inhibitor
Treatment (Prophetic Example)
[0492] Human postnatal dermal fibroblasts are cultured in FBM
supplemented with FGM-2 SingleQuots. Three days before retroviral
transduction and histone deacetylase inhibitor treatment, the
fibroblasts are seeded at 103 cells/cm2 into 6 well cell culture
plates. Eighteen hours later, the cells are incubated for 30
minutes at room temperature, with occasional shaking, in 5001
Hanks' balanced salt solution containing the mCAT1 adenovirus
vector (described in Example 2) at an MOI of 5. Afterwards, 2 ml of
FBM medium are added to each well and the cells are cultured for 48
hrs. Subsequently, the cells are incubated in 2 ml of the
retrovirus/polybrene solution (a mixture of equal volumes of the
retrovirus vectors encoding Oct3/4, Sox2, and Klf4 as described in
Examples 1 and 5) at an m.o.i. of approximately 10 for each virus
prepared, supplemented with 5 .mu.g/ml of polybrene) at 37.degree.
C. for 4 hrs to overnight. The virus supernatant is then replaced
with MC-ES medium supplemented with the histone deacetylase
inhibitor MS-275 at a final concentration of 1 .mu.M. On the
following day, the medium is replaced with MC-ES medium, and is
replaced daily afterwards.
[0493] Between days 17-33 after viral transduction plus MS-275
treatment, a colony with a characteristic shape (e.g., small,
round, and having a high nucleus to cytoplasm ratio) is picked from
a well with forceps. The picked colony is then transferred into a
matrigel-coated well in a 24-well plate and maintained in mTeSR1
defined medium supplemented with 10 .mu.M Y-27632. Fourteen hours
later the medium is replaced. Afterwards, the medium is changed
daily. At days 38-54 after viral transduction plus MS-275
treatment, a second subculture is carried out. For passaging, the
medium is removed, and the cells are washed with the Hank's
balanced salt solution followed by the treatment with 0.25%
trysin-EDTA at 37.degree. C. for 3-5 minutes. Fresh medium is added
to stop the reaction. The cell suspension is centrifuged at
4.degree. C. and 200.times.g for 5 minutes, and the supernatant is
then removed. The cells are resuspended in mTeSR1 defined medium
supplemented with 10 .mu.M Y-27632 and plated in a matrigel-coated
well of a 6-well culture dish.
[0494] The resulting human iPS clones are expanded in mTeSR1
defined medium on matrigel (BD Bioscience)-coated culture dishes.
The culture medium is changed daily for human iPS cell culture. For
passaging human iPS cell lines, cells are washed with Hanks's
balanced solution, incubated in 0.25% trypsin-EDTA (Gibco) at
37.degree. C. for 3-5 minutes, and then added the culture medium.
The resulting cell suspension is then centrifuged at 300.times.g at
room temperature or 4.degree. C. for 5 minutes and the supernatant
is removed. The cells are re-suspended into culture medium and
plated as described above. After passaging, the medium is
supplemented with 10 .mu.M Y-27632 (Calbiochem) to avoid cell
apoptosis. The resulting human iPS cells are morphologically
indistinguishable from typical human ES cells and human iPS-1-8
mTeSRcells grow in colonies with defined edges and consisting of
small, round cells with a high nucleus to cytoplasm ratio.
According to all analyses described as in Examples 14-15, the
resulting human iPS cells show an in vitro long-term self-renewal
ability and are very similar to typical human ES cells in many
characteristics.
Example 19
Induction of Human Pluripotent Stem Cells by Forced Expression of
Oct3/4, Sox2, and Klf4 by Retroviral Transduction (Prophetic
Example)
[0495] Human postnatal dermal fibroblasts are cultured in FBM
supplemented with FGM-2 SingleQuots. Three days before retroviral
transduction, the fibroblasts are seeded at 103 cells/cm2 into 6
well cell culture plates. Eighteen hours later, the cells are
incubated for 30 minutes at room temperature, with occasional
shaking, in 500 .mu.l Hanks' balanced salt solution containing the
mCAT1 adenovirus vector (described in Example 2) at an MOI of 5.
Afterwards, 2 ml of FBM medium are added to each well and the cells
are cultured for 48 hrs. Subsequently, the cells are incubated in 2
ml of the retrovirus/polybrene solution (a mixture of equal volumes
of the retrovirus vectors encoding Oct3/4, Sox2, and Klf4 as
described in Examples 1 and 5) at an m.o.i. of approximately 10 for
each virus prepared, supplemented with 5 .mu.g/ml of polybrene) at
37.degree. C. for 4 hrs to overnight. The virus supernatant is then
replaced with MC-ES medium. On the following day, the medium is
replaced with MC-ES medium, and is replaced daily afterwards.
[0496] Between days 17-33 after viral transduction, a colony with a
characteristic shape (e.g., small, round, and having a high nucleus
to cytoplasm ratio) is picked from a well with forceps. The picked
colony is then transferred into a matrigel-coated well in a 24-well
plate and maintained in mTeSR1 defined medium supplemented with 10
.mu.M Y-27632. Fourteen hours later the medium is replaced.
Afterwards, the medium is replaced daily. At days 38-54 after viral
transduction, a second subculture is carried out. For passaging,
the medium is removed, and the cells are washed with the Hank's
balanced salt solution followed by the treatment with 0.25%
trysin-EDTA at 37.degree. C. for 3-5 minutes. Fresh medium is added
to stop the reaction. The cell suspension is centrifuged at
4.degree. C. and 200.times.g for 5 minutes, and the supernatant is
then removed. The cells are resuspended in mTeSR1 defined medium
supplemented with 10 .mu.M Y-27632 and plated in four
matrigel-coated wells of a 6-well culture dish.
[0497] The resulting human iPS clones is expanded in mTeSR1 defined
medium on matrigel (BD Bioscience)-coated culture dishes. The
culture medium is changed daily for human iPS cell culture. For
passaging human iPS cell lines, cells are washed with Hanks's
balanced solution, incubated in 0.25% trypsin-EDTA (Gibco) at
37.degree. C. for 3-5 minutes, and then added the culture medium.
The resulting cell suspension is then centrifuged at 300.times.g at
room temperature or 4.degree. C. for 5 minutes and the supernatant
is removed. The cells are re-suspended in culture medium and plated
as described above. After passaging, the medium is supplemented
with 10 .mu.M Y-27632 (Calbiochem) to avoid cell apoptosis. The
resulting human iPS cells are morphologically indistinguishable
from typical human ES cells and human iPS-1-8 mTeSRcells, which
grow in colonies with defined edges and consisting of small, round
cells with a high nucleus to cytoplasm ratio. According to all
analyses described as in Examples 14-15, the resulting human iPS
cells show an in vitro long-term self-renewal ability and are very
similar to typical human ES cells in many characteristics.
Example 20
Assay for Identifying siRNAs that Induce Pluripotency ("Inducing
siRNAs") in Combination with a Subset of Induction Factors Using a
Tert Reporter Construct (Prophetic Example)
[0498] A whole human genome siRNA library is used in a primary
screen to identify siRNAs having the ability to induce pluripotency
or increase the induction of pluripotency in a human adult
fibroblast population when used in combination with a subset of
three induction factors selected from Oct 3/4, Sox2, Klf4, and
c-Myc. The screen utilizes a reporter assay for activation of the
iPS-marker gene Tert to identify candidate siRNAs capable of
complementing the inducing activity of a subset of three induction
factors selected from Oct 3/4, Sox2, Klf4, and c-Myc. For example,
a test siRNA may be used in combination with Oct 3/4, Klf4, and
c-Myc to identify siRNAs that complement the missing Sox2 activity.
In a secondary screen, the candidate inducing siRNAs are tested
again in the same assay, and the expression of another, iPS-marker
gene Cyp26A1, is also assayed in the tested cells.
[0499] Generation of a Tert Promoter Reporter Retrovirus:
[0500] A 0.5 kb fragment of the human tert promoter is PCR
amplified from human genomic DNA with using an upstream primer
hTERT-475F:
TABLE-US-00013 (SEQ ID NO: 14)
5'-GCAGCCCTGGGTCTCCAGATCTGGCCAGC-3'
and a downstream primer hTERT+49R:
TABLE-US-00014 5'GGTGGCCGGGGCCAGGGCTAGCCACGTGC-3' (SEQ ID NO:
15)
[0501] Primers are numbered by the number of bases upstream (+) or
downstream (-) of the start of hTERT exon 1 (chromosome 5, base
1306027 on human July 2003 genome assembly on the world wide web at
genome.ucsc.edu). See, e.g., Padmanabhan et al., (2006), Journal of
Nuclear Medicine, 47(2) 270-277.
[0502] The amplified fragment is then subcloned 5' to the luc2P ORF
in the promoterless pGL4.11[luc2P] vector (Promega, Madison, Wis.).
The entire tert-luc2 reporter cassette is then PCR amplified,
subcloned into the pMX retroviral vector, validated by sequencing,
and packaged in Plat-A cells (see Morita et al., (2000), Gene
Therapy, 7(12): 1063-1066) to generate a Tert-luc reporter ("TLR")
ecotropic retrovirus, as described in Example 1.
[0503] Cell Culture, Viral Infection, and siRNA Transfection
[0504] Adult or neonatal normal Human Skin Fibroblasts (Lonza) of
6.times.105 cells in 10 ml of medium are plated with FBM medium in
a dish with 10 cm diameter cell culture plates at a density of 104
cells/cm2. Adult or neonatal normal Human Skin Fibroblasts (Lonza)
are plated with FBM medium in a dish with 10 cm diameter cell
culture plates at a density of 104 cells/cm2 in 10 ml of medium per
a dish. Human postnatal dermal fibroblasts are cultured in FBM
supplemented with FGM-2 SingleQuots. Eighteen hours later, the
cells are incubated at room temperature, with occasional shaking,
for 30 minutes with 3 ml of FBM medium or Hanks' balanced salt
solution containing the mCAT1 adenovirus vector (described in
Example 2) at an MOI of 1 to 5. Afterwards, 12 ml of complete FBM
medium are added to each dish and the cells are cultured for 48
hrs. Forty eight hours later, the medium is removed, and a mixture
of the TLR retrovirus, and retroviruses encoding any three of Oct
3/4, Sox2, Klf4, and c-Myc prepared as described above is added,
each virus at an m.o.i. of about 10-50 in 3 ml of the medium per a
dish is added, and the infection is continued at room temperature
for 30 minutes. Afterwards 12 ml of the FBM medium was added, and
the plates are incubated at 37 C. Twenty four hours after the
addition of the TLR retrovirus and retroviruses encoding any three
of Oct 3/4, Sox2, Klf4, and c-Myc, cells are plated with FBM medium
in 384 or 96-well cell culture plates coated with matrigel (20
g/cm2) at a density of 104 cells/cm2 in 25 or 100 .mu.l of medium
per well. The resulting cells are cultured in FBM supplemented with
FGM-2 SingleQuots. Twenty four hours later, the medium of each well
is replaced with 50 or 200 .mu.l (for 384 or 96-well, respectively)
of a mixture containing antibiotic-free Opti-MEM.RTM. I Reduced
Serum medium (Invitrogen), Lipofectamine.TM.-RNAiMax transfection
reagent (Invitrogen), mixed according to the manufacturer's
protocol with 4 siRNAs to a human gene target, with a final
concentration of 50 nM for each siRNA ("test siRNA wells"). Thus,
siRNAs against a total of approximately 25,000 target human genes
(i.e. most, if not all, expressed sequences) are tested in the
assay. As a "negative control" in the assay, 20 wells ("negative
control wells") of cells transduced as described above are
transfected with 20 sets of scrambled siRNAs (checked for lack of
homology to vector or mammalian sequences).
[0505] Luciferase Assay of TLR Plus siRNA-Treated Human
Fibroblasts
[0506] After 48 hours, cell lysates are prepared from each well,
and luciferase activity is measured in the presence of luciferin
and ATP (Sigma, St. Louis, Mo.), as a measure of nanog promoter
activity in Ad-nanog-luc-infected cells, using a Berthold-Lumat
B9501 luminometer (Berthold-Lumat, St Albans, Herts, UK).
Luciferase activity from each of the test siRNA wells is compared
to the mean luciferase activity determined for the negative control
wells. Where siRNA wells are determined to have significantly
higher luciferase activity than the mean negative control well
value, the corresponding siRNA sequences ("candidate inducing
siRNAs") are tested in a secondary screen.
[0507] Secondary Screens
[0508] In one secondary screen, cells are plated in a 48 well
format using the same cell culture conditions as described above.
After 24 hours, wells are transfected with the candidate inducing
siRNAs (n=10 per target gene) identified in the primary screen, but
adjusting the volumes for a 48 well culture format. Cells are then
cultured for a further 72 hours. Afterwards, medium is removed,
cells are washed with Hanks Buffered Saline solution and the level
of Cyp26a1 mRNA is determined by qRT-PCR.
Example 21
Assay for Identifying siRNAs that Induce Pluripotency ("Inducing
siRNAs") in Combination with a Subset of Induction Factors Using
qRT-PCR (Prophetic Example)
[0509] A whole human genome siRNA library is used in a primary
screen to identify siRNAs having the ability to induce pluripotency
or increase the induction of pluripotency in a human adult
fibroblast population when used in combination with a subset of
three induction factors selected from Oct 3/4, Sox2, Klf4, and
c-Myc. The screen utilizes a qRT-PCR assay for detecting expression
of the iPS marker gene Tert to identify candidate siRNAs capable of
complementing the inducing activity of a subset of three induction
factors selected from Oct 3/4, Sox2, Klf4, and c-Myc. For example,
a test siRNA may be used in combination with Oct 3/4, Klf4, and
c-Myc to identify siRNAs that complement the missing Sox2 activity.
In a secondary screen, the candidate inducing siRNAs are tested
again in the same assay, and the expression of another, iPS-marker
gene Cyp26A1, is also assayed in the tested cells.
[0510] Cell Culture, Viral Infection, and siRNA Transfection
[0511] Adult or neonatal normal Human Skin Fibroblasts (Lonza) are
plated with FBM medium in a dish with 10 cm diameter cell culture
plates at a density of 104 cells/cm2 in 10 ml of medium per a dish.
Human postnatal dermal fibroblasts are cultured in FBM supplemented
with FGM-2 SingleQuots. Eighteen hours later, the cells are
incubated, with occasional shaking, for 30 minutes at room
temperature with 3 ml of FBM medium or Hanks' balanced salt
solution containing the mCAT1 adenovirus vector (described in
Example 2) at an MOI of 1 to 5. Afterwards, 12 ml of complete FBM
medium are added to each dish and the cells are cultured for 48
hrs. Forty eight hours later, the medium is removed, and a mixture
of the TLR retrovirus, and retroviruses encoding any three of Oct
3/4, Sox2, Klf4, and c-Myc prepared as described above is added,
each virus at an m.o.i. of about 10-50 in 3 ml of the medium per a
dish is added, and the infection is continued at room temperature
for 30 minutes. Afterwards 12 ml of the FBM medium was added, and
the plates are incubated at 37 C. Twenty four hours after the
addition of the TLR retrovirus and retroviruses encoding any three
of Oct 3/4, Sox2, Klf4, and c-Myc, cells are plated with FBM medium
in 384 or 96-well cell culture plates coated with matrigel (20
g/cm.sup.2) at a density of 10.sup.4 cells/cm.sup.2 in 25 or 100
.mu.l of medium per well. The resulting cells are cultured in FBM
supplemented with FGM-2 SingleQuots. Twenty four hours later, the
medium of each well is replaced with 50 or 200 .mu.l (for 384 or
96-well, respectively) of a mixture containing antibiotic-free
Opti-MEM.RTM. I Reduced Serum medium (Invitrogen),
Lipofectamine.TM.-RNAiMax transfection reagent (Invitrogen), mixed
according to the manufacturer's protocol with 4 siRNAs to a human
gene target, with a final concentration of 50 nM for each siRNA
("test siRNA wells"). Thus, siRNAs against a total of approximately
25,000 target human genes (i.e. most, if not all, expressed
sequences) are tested in the assay. As a "negative control" in the
assay, 20 wells ("negative control wells") of cells transduced as
described above are transfected with 20 sets of scrambled siRNAs
(checked for lack of homology to vector or mammalian
sequences).
[0512] Total RNA from colonies is extracted using the RecoverAll
Total Nucleic Acid Isolation kit (manufactured by Ambion). After
reverse transcription, Tert or CYP26A1 are amplified using the
Taqman preamp (manufactured by Applied Biosystems). Real-time
quantitative PCR is then performed with an ABI PRISM 7900HT device
(manufactured by Applied Biosystems) using PCR primer sets TERT,
Hs00162669_m1 and CYP26A1, Hs00175627_m1 (available from Applied
Biosystems).
[0513] Where siRNA wells are determined to induce a higher level of
Tert mRNA expression relative to the negative control level, the
corresponding siRNA sequences ("candidate inducing siRNAs") are
tested in a secondary screen.
[0514] Secondary Screens
[0515] In one secondary screen, cells are plated in a 48 well
format using the same cell culture conditions as described above.
After 24 hours, wells are transfected with the candidate inducing
siRNAs (n=10 per target gene) identified in the primary screen, but
adjusting the volumes for a 48 well culture format. Cells are then
cultured for a further 72 hours. Afterwards, medium is removed,
cells are washed with Hanks Buffered Saline solution and the level
of Cyp26A1 mRNA is determined by qRT-PCR as described above.
Candidate inducing siRNAs identified as inducing expression of both
Tert and Cyp26A1 when used in combination with other induction
factors are then further tested to determine if they are indeed
capable of inducing pluripotency when used in combination with the
corresponding subset of induction factors used in the primary
screen.
Example 22
Induction of Human Pluripotent Stem Cells from Fibroblasts
Including at Least One Chimeric IF-VP16 Polypeptide (Prophetic
Example)
[0516] The induction protocol and assays are carried out as
described in Example 7, but a retrovirus expressing a chimeric
human Sox2-VP16 fusion polypeptide is used, instead of full length
human Sox2 retrovirus, as one of the four IFs. The Sox2-VP16 fusion
polypeptide comprises amino acids 1-183 of human Sox2, which
includes the Sox2 DNA binding domain, and amino acids 411-490 of
the herpes VP16 protein (GenBank Accession No. AAA45864), a strong
transactivator domain (see, e.g., Sadowski et al (1988), Nature,
6;335(6190):563-564) fused to the C-terminal of the human Sox2
fragment. The sequence of the Sox2-VP16 fusion protein is:
TABLE-US-00015 (SEQ ID NO: 16)
MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMV
WSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRAL
HMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLG
AGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHSTTAPITDVSLGDELRL
DGEEVDMTPADALDDFDLEMLGDVESPSPGMTHDPVSYGALDVDDFEFEQ
MFTDALGIDDFGG
Example 23
Induction of Human Pluripotent Stem Cells from Fibroblasts Using a
Combination of Viral Expression of Oct 3/4 Sox2 and Klf4 and
Protein Transduction of c-Myc (Prophetic Example)
[0517] Cell culture and infection with Oct 3/4, Sox2, and Klf4
retroviruses are performed as described in Example 7, but after the
four hour viral infection incubation, the three virus-containing
polybrene solution is replaced with MC-medium containing a purified
human c-Myc-PTD fusion polypeptide comprising the amino acid
sequence of human c-Myc:
TABLE-US-00016 SEQ ID NO: 12 (Human c-Myc):
MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQ
QQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGD
NDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMW
SGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAA
SECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSP
EPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG
GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQ
ISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELE
NNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLR NSCA
fused at its N-terminus with a protein transduction domain having
the amino acid sequence:
TABLE-US-00017 YGRKKRRQRRR; (SEQ ID NO: 1) RKKRRQRR; (SEQ ID NO: 2)
YARAAARQARA; (SEQ ID NO: 3) THRLPRRRRRR; (SEQ ID NO: 4)
GGRRARRRRRR; (SEQ ID NO: 5) or KKKKKKKK (SEQ ID NO: 17)
[0518] Subcloning and purification of the c-Myc-PTD fusion protein
are performed essentially as described in Becker-Hapak et al.,
(2003), Curr. Protocols Cell Biol., Unit 20.2, John Wiley &
Sons. After the retroviral infection period (with Oct 3/4, Sox2,
and Klf4 retroviruses), the polybrene-viral solution is removed and
replaced with 2 ml of MC-ES medium containing purified c-Myc-PTD
fusion polypeptide at a concentration of 100 nM, and the cultured
is incubated for about three hours at 37.degree. C. Afterwards, the
medium is replaced with MC-ES medium, and the induction protocol
and assays are continued as described in Example 7. Forced
expression of c-Myc by protein transduction, avoids potential long
term undesirable effects (e.g., cell transformation or risk of
inducing cancer) of introducing an exogenous c-Myc gene, especially
where the exogenous gene is integrated into the genome, e.g.,
following retroviral transduction.
Example 24
Induction of Human Pluripotent Stem Cells from Fibroblasts Using
Protein Transduction of Oct 3/4 Sox2 Klf4 and c-Myc (Prophetic
Example)
[0519] Human postnatal dermal fibroblasts are cultured in FBM
supplemented with FGM-2 SingleQuots. Three days before protein
transduction, the fibroblasts are seeded at 10.sup.3 cells/cm.sup.2
into 6 well cell culture plates.
[0520] Subcloning and purification of the Oct 3/4, Sox2, Klf4, and
c-Myc fusion proteins are performed essentially as described in
Becker-Hapak et al., (2003), Curr. Protocols Cell Biol., Unit 20.2,
John Wiley & Sons. Induction is initiated by replacing the
culture medium with 2 ml of MC-ES medium containing purified fusion
proteins (100 nM each) of Oct 3/4 (SEQ ID NO:6), Sox2 (SEQ ID
NO:8), Klf4 (SEQ ID NO:10), and c-Myc (SEQ ID NO:12) fused at their
N-termini with a protein transduction domain having the amino acid
sequence:
[0521] YGRKKRRQRRR (SEQ ID NO:1); RKKRRQRR (SEQ ID NO:2);
YARAAARQARA (SEQ ID NO:3); THRLPRRRRRR (SEQ ID NO:4); GGRRARRRRRR
(SEQ ID NO:5); or KKKKKKKK (SEQ ID NO:17). The cells are then
incubated with the fusion proteins for about three hours at
37.degree. C. Afterwards, the medium is replaced with MC-ES medium
supplemented with 10 .mu.M Y-27632. During the induction period the
medium is replaced daily with MC-ES medium containing 100 nM of
each of the fusion proteins for one hour, and the medium is then
replaced with MC-ES medium free of fusion proteins until the
following day. After the induction period, assays are performed as
described in Example 7 to identify induced pluripotent stem cell
candidates.
Example 25
Induction of Human Pluripotent Stem Cells from Fibroblasts Using
Protein Transduction of Oct 3/4, Sox2, and Klf4 Plus HDAC Inhibitor
Treatment (Prophetic Example)
[0522] Human postnatal dermal fibroblasts are cultured in FBM
supplemented with FGM-2 SingleQuots. Three days before protein
transduction, the fibroblasts are seeded at 10.sup.3 cells/cm.sup.2
into 6 well cell culture plates.
[0523] Subcloning and purification of the Oct 3/4, Sox2, Klf4, and
c-Myc fusion proteins are performed essentially as described in
Becker-Hapak et al., (2003), Curr. Protocols Cell Biol., Unit 20.2,
John Wiley & Sons. Induction is initiated by replacing the
culture medium with 2 ml of MC-ES medium containing purified fusion
proteins (100 nM each) of Oct 3/4 (SEQ ID NO:6), Sox2 (SEQ ID
NO:8), and Klf4 (SEQ ID NO:10 fused at their N-termini with a
protein transduction domain having the amino acid sequence:
TABLE-US-00018 YGRKKRRQRRR; (SEQ ID NO: 1) RKKRRQRR; (SEQ ID NO: 2)
YARAAARQARA; (SEQ ID NO: 3) THRLPRRRRRR; (SEQ ID NO: 4)
GGRRARRRRRR; (SEQ ID NO: 5) or KKKKKKKK. (SEQ ID NO: 17)
[0524] The cells are then incubated with the fusion proteins for
about three hours at 37.degree. C. Afterwards, the medium is
replaced with MC-ES medium supplemented with the is then replaced
with MC-ES medium supplemented with the histone deacetylase
inhibitor MS-275 at a final concentration of 1 .mu.M, and the Rho
kinase inhibitor 10 .mu.M Y-27632. During the subsequent induction
period the medium is replaced daily with MC-ES medium containing
100 nM of each of the fusion proteins for one hour, and the medium
is then replaced with fusion protein-free MC-ES medium containing
10 .mu.M Y-27632 on subsequent days until the end of the induction
period (about 14 days after the beginning of induction). After the
induction period, assays are performed as described in Example 7 to
identify induced pluripotent stem cell candidates.
Example 26
Induction of Mouse Pluripotent Stem Cells by Forced Expression of
Three or Four Exogenous Genes by Retroviral Transduction
[0525] Murine embryonic Fibroblasts (MEFs) were plated into 12-well
plates, seeded at a density of 5000 cells/cm.sup.2 in MEF medium
(DMEM supplemented with 10% FBS and gentamycin) and cultured
overnight (approximately 16 hours). The cells were then incubated
in a 1 ml retrovirus/polybrene solution. The retrovirus/polybrene
solution included a mixture of 0.25 ml of each retrovirus vectors
encoding either four factors (Oct3/4, Sox2, Klf4 and c-Myc); three
factors (the four factors minus either Oct3/4, Sox2, Klf4 or
c-Myc); or two factors (Oct3/4 and Sox2) supplemented with 5
.mu.g/ml of polybrene. For two or three genes transduction, culture
media was added to virus carring solution up to 1 ml. Cells were
infected with each virus prepared, at 37.degree. C. The "Oct4a" is
equivalent to "Oct3/4." The virus supernatant was then replaced
with mouse ES_medium on the following day. Media was changed every
2-3 days.
[0526] Approximately 12 days after viral transduction, colonies
were subjected to alkaline phosphatase (ALP) staining, and the
cloned colony-derived cells were stained blue violet. The number
ALP positive colonies were recorded, as indicated by FIG. 28.
ALP-positive colonies were observed in the samples that had
received the four factors (Oct3/4, Sox2, Klf4 and c-Myc); any
combination of three factors; and two factors (Oct3/4 and
Sox2).
Example 27
Induction of Mouse Pluripotent Stem Cells by Forced Expression of
Two, Three, or Four Exogenous Genes by Retroviral Transduction into
Mouse-Derived Neural Stem Cells
[0527] Adult mouse-derived neural stem cells (NSC) were isolated
from the subventricular zones of 9-week-old C57BL/6 mice (Oriental
Yeast, Tokyo, Japan) as previously described (Reynolds et al.,
1992). In brief, adult mouse brains were dissociated into single
cells by trypsin digestion, and the cells were suspended in
Dulbecco's modified Eagle's medium/Ham's F-12 medium (DMEM/F12;
Invitrogen) containing 100 lg/mL human transferrin (Sigma), 20 nM
progesterone (Sigma), 100 .mu.M putrescine (Sigma), 30 nM sodium
selenite (Sigma), and 5 lg/mL insulin (Sigma). The suspended cells
were plated in tissue culture dishes. The cells were maintained in
an undifferentiated proliferative state by culturing them as
free-floating neurospheres in NSC medium (DMEM/F12 containing 100
lg/mL human transferrin, 20 nM progesterone, 100 lM putrescine, 30
nM sodium selenite, 5 lg/mL insulin, 20 ng/mL human basic
fibroblast growth factor (bFGF; Sigma), and 20 ng/mL epidermal
growth factor (EGF; Sigma)). The NSCs were seeded at 10.sup.4
cells/cm2 as a monolayer on Ornitin/Lamin coated 12-well cell
culture plates one day before infection, and cultured in 1 ml of
NSC medium. After over night, the cells were incubated in 1 ml of
the retrovirus/polybrene solution. The retrovirus/polybrene
solution included a mixture of 0.25 ml of each retrovirus vectors
encoding either four factors (Oct3/4, Sox2, Klf4 and c-Myc); three
factors (the four factors minus either Sox2 or c-Myc); or two
factors (Oct3/4 and Klf4) supplemented with 5 .mu.g/ml of
polybrene). For two or three genes transduction, culture media was
added to virus carring solution up to 1 ml. Cells were infected at
37.degree. C. The virus supernatant was then replaced with mouse
ES_medium on the following day. Media was changed every 2-3
days.
[0528] Approximately 12 days after viral transduction, colonies
were subjected to alkaline phosphatase (ALP) staining, and the
cloned colony-derived cells were stained blue violet. The number
ALP positive colonies were recorded, as indicated by FIG. 28.
ALP-positive colonies were observed in the samples that had
received the four factors (Oct3/4, Sox2, Klf4 and c-Myc); both
combinations of three factors; and two factors (Oct3/4 and Klf4)
(as shown in FIG. 29).
Example 28
Induction of Mouse Pluripotent Stem Cells by Forced Expression of
Three or Four Exogenous Genes by Retroviral Transduction
[0529] Adult mouse-derived bone marrow cells (Losac) were obtained
using the same procedure described in Example 5 relating to FIG. 4.
One day before retroviral transduction, the cells were seeded at
10.sup.4 cells/cm.sup.2 into 6-well cell culture plates and
cultured in 2 ml of low serum medium. Over night later, the cells
were incubated in 2 ml of the retrovirus/polybrene solution (a
mixture of 0.5 ml of each retrovirus vectors encoding either four
factors (Oct3/4, Sox2, Klf4 and c-Myc); three factors (the four
factors minus either Sox2, Oct3/4, Klf4 or c-Myc) supplemented with
5 .mu.g/ml of polybrene). The virus supernatant was replaced the
next day with mouse ES_medium. At this time, some samples also were
treated with either 10 ng/ml FGF or 0.1 .mu.M MS-275 for three
days. On the following day, the medium was replaced with mouse
ES_medium and was replaced every 2-3 days afterwards.
[0530] Approximately 9 or 15 days after viral transduction,
colonies were subjected to alkaline phosphatase (ALP) staining, and
the cloned colony-derived cells were stained blue violet. The
number of ALP-positive colonies was recorded, as indicated in FIG.
30. Of the samples analyzed on Day 15, ALP-positive colonies were
observed in the samples that had received the four factors (Oct3/4,
Sox2, Klf4 and c-Myc) and samples that received four factors minus
either c-Myc, Oct3/4, or Klf4 (FIG. 28).
[0531] ALP-positive colonies were also observed in the four-gene
transduction samples analyzed on Day 9 after the viral
transduction, but this number was less than the number of colonies
observed in the four-gene transduction samples from Day 15. On Day
9, in the four-gene transduction samples, more colonies were
observed in samples that were exposed to MS-275 compared to samples
that were not exposed to MS-275.
Example 29
Induction of Mouse Pluripotent Stem Cells by Forced Expression of
Two or Four Exogenous Genes by Retroviral Transduction
[0532] Adult mouse-derived bone marrow cells (Losac) were obtained
using the same procedure described in Example 5 relating to FIG. 4.
Retroviral transduction was performed following the methods
described in Example 30. However, in this experiment,
retrovirus/polybrene solution included a mixture of equal volumes
of the retrovirus vectors encoding either four factors (Oct3/4,
Sox2, Klf4 and c-Myc); or different combinations of two factors (as
show in FIG. 31).
[0533] Approximately 15 days after viral transduction, colonies
were subjected to alkaline phosphatase (ALP) staining, and the
cloned colony-derived cells were stained blue violet. The number of
ALP-positive colonies was recorded, as indicated in FIG. 31.
ALP-positive colonies were observed in the samples that had
received the four factors (Oct3/4, Sox2, Klf4 and c-Myc) and
samples that received the combination of Sox2 and c-Myc (FIG.
31)
Example 30
Analysis of Global Gene Expression Differences in iPS Cells Versus
Human ES Cell Lines and Parental Fibroblasts
[0534] The global gene expression data obtained for iPS cell lines,
1-8, 2-4, and 3-2, as described in Examples 14, 16, and 17,
respectively (GEO accession number GSE9709) were compared to global
gene expression data for human ES cell (hES cell) lines: Sheff4
cultured on MEF; Sheff4 cultured on matrigel, and the H14 line
cultured on MEF; and the iPS line parental fibroblasts. The gene
expression data were compared to identify genes that were: (1)
expressed at a significantly higher level in the iPS cell lines
than in the hES cell lines; (2) expressed at a significantly higher
level in the hES cell lines than in the iPS cell lines; (3)
expressed at a significantly higher level in the iPS cell lines
than in the hES cell lines and the parental fibroblasts; and (4)
expressed at a significantly higher level in the iPS cell lines
than in the hES cell lines, but not expressed at a significantly
higher level than in the parental fibroblasts. Data were compared
by Student's t-test with a cut-off of p.ltoreq.0.01. The results
are shown in Tables 13-16.
[0535] Table 13 shows a list of genes expressed at a five fold or
higher level in the iPS cell lines than in the hES cell lines
(p.ltoreq.0.01). Table 14 shows a list of genes expressed at a two
fold or higher level in the hES cell lines than in the iPS cell
lines (p.ltoreq.0.01). Table 15 shows a list of genes expressed at
a five fold or higher level in the iPS cell lines than in both the
hES cell lines and in the parental fibroblasts (p.ltoreq.0.01).
Table 16 shows a list of genes expressed at a five fold or higher
level in the iPS cell lines than in the hES cell lines, but not
expressed at a significantly higher level than in the parental
fibroblasts (p.gtoreq.0.05).
[0536] These results indicated that notwithstanding the overall
similarity in global gene expression between the iPS cell lines and
the hES cell lines as described in Example 14, iPS lines do exhibit
significant gene expression differences with respect to hES cell
lines.
Example 31
Oct3/4 Polypeptide Amino Acid Sequence Variants (Prophetic
Example)
[0537] Based on Table 17 (PMUT analysis of Human Oct3/4), any of
the following Oct3/4 amino acid sequence variants are generated by
site-directed mutagenesis and used in conjunction with a Sox2
polypeptide and a Klf4 polypeptide; or with Sox2, Klf4, and c-Myc
polypeptides to induce multipotent or pluripotent stem cells as
described in previous examples.
[0538] The amino acid sequence of SEQ ID NO:6 with any of the
following pairs of amino acid substitutions: Oct3/4
variant.sup.2AA-1 (H4.fwdarw.N and F9.fwdarw.I); Oct3/4
variant.sup.2AA-2 (P15.fwdarw.M and G18.fwdarw.L); and Oct3/4
variant.sup.2AA-3 (I60.fwdarw.F and L84.fwdarw.V).
[0539] The amino acid sequence of SEQ ID NO:6 with the following
set of 10 amino acid substitutions (Oct3/4 variant.sup.10AA):
H4.fwdarw.N, F9.fwdarw.I, P15.fwdarw.M, G18.fwdarw.L, I60.fwdarw.F,
L84.fwdarw.V, P62.fwdarw.S, V101.fwdarw.I, G109.fwdarw.I, and
P112.fwdarw.I.
[0540] The amino acid sequence of SEQ ID NO:6 with the following
set of 20 amino acid substitutions (Oct3/4 variant.sup.20AA):
H4.fwdarw.N, F9.fwdarw.I, P15.fwdarw.M, G18.fwdarw.L, I60.fwdarw.F,
P62.fwdarw.S, Q79.fwdarw.D, L84.fwdarw.V, V101I, G109.fwdarw.I,
P112.fwdarw.I, G161.fwdarw.L, D166.fwdarw.E, L169.fwdarw.I,
V173.fwdarw.F, F175.fwdarw.A, E 215.fwdarw.D, E219.fwdarw.D,
A223.THETA.M, V227.THETA.F.
[0541] The amino acid sequence of SEQ ID NO:6 with the following
set of 25 amino acid substitutions (Oct3/4 variant.sup.25AA):
H4.fwdarw.N, F9.fwdarw.I, P15.fwdarw.M, G18.fwdarw.L, V51.fwdarw.I,
I60.fwdarw.F, P62.fwdarw.S, C63.fwdarw.S, Y67.fwdarw.F,
Q79.fwdarw.D, L84.fwdarw.V, L90.fwdarw.M, Q94.fwdarw.D,
V101.fwdarw.I, G109.fwdarw.I, P112.fwdarw.I, G161.fwdarw.L,
D166.fwdarw.E, L169.fwdarw.I, V173.fwdarw.F, F175.fwdarw.A,
E215.fwdarw.D, E219.fwdarw.D, A223.fwdarw.M, V227.fwdarw.F.
[0542] Table 1 shows the name of gene, the NCBI number, the virus
vector in which said gene was inserted, insert size, the
restriction site at the 5'-end, the restriction site at the 3'-end,
the length of the translated region, the length of the
3'-untranslated region, clone ID, and the supplier of the four
genes or the three genes and the receptor of mouse ecotropic
retrovirus vector (mCAT: mouse-derived cationic amino acid
transporter) used in Examples.
TABLE-US-00019 TABLE 1 Construction data Name Gene- 5'-end 3'-end
Length of 3'- of inserted Insert restriction restriction translated
untranslated gene NCBI No. virus vector size site site region
region Clone ID Supplier human NM_002701 pMXs-puro 1411 EcoRI Xho1
1083 274 6578897 Open Oct3/4 Biosystems human BC013923 pMXs-neo
1172 EcoRI Xho1 954 143 2823424 Open Sox2 Biosystems human BC058901
pMXs-IB 1876 EcoRI Xho1 1365 473 6012670 Open c-Myc Biosystems
human BC029923 pMXs-IB 1591 EcoRI EcoRI 1413 38 5111134 Open Klf4
Biosystems mCAT1 NM_007513 Adeno-X 2032 BssS1 BssS1 1869 132
A830015 RIKEN N05 FANTOM clone
[0543] Table 2 summarizes the number of alkaline
phosphatase-positive colonies of Examples 4 to 7. For cell type,
the number of subculture is attached. The day of four gene
introduction is a day when a retrovirus vector was infected. Lot
No. is that of Lonza products. Age of donors is based on the donor
information of Lonza products. The number of colonies is the number
of colonies composed of alkaline phosphatase-positive small cells
per 10 cm.sup.2.
TABLE-US-00020 TABLE 2 Examples 5 to 8 and 10, Number of alkaline
phosphatase (ALP)-positive colonies formed by gene introduction No.
of Serum passages at the Cell concentration time of gene Example
Cell type Donor age Lot No. (%) introduction Colony count* 8
Neonatal skin fibroblast Neonate 5F0439 2 3 0.8 6 Neonatal skin
fibroblast Neonate 5F0438 2 2 6.0 6 Neonatal skin fibroblast
Neonate 5F0438 2 2 6.0 6 Neonatal skin fibroblast Neonate 5F0474 2
2 4.0 6 Neonatal skin fibroblast Neonate 5F0438 2 2 7.0 6 Neonatal
skin fibroblast Neonate 5F0474 2 2 9.5 7 Adult skin fibroblast 28
6F3535 2 2 2.0 7 Adult skin fibroblast 39 6F4026 2 2 0.0 5 Adult
BM-derived cell (low serum) 20 060470B 2 2 0.0 5 Adult BM-derived
cell (low serum) 20 060809B 2 2 0.0 5 Adult BM-derived cell (low
serum) 20 060809B 2 2 0.2 5 Adult BM-derived cell (low serum) 20
060809B 2 2 0.0 5 Adult BM-derived mesenchymal 20 060809B 10 2 0.0
stem cell (high serum) 5 Adult BM-derived mesenchymal 20 060470B 10
2 0.0 stem cell (high serum) 10 Neonatal umbilical cord artery
Neonate 5F0442 5 4 0.0 smooth muscle cell *The number of colonies
composed of alkaline phosphatase-positive small cells per 10
cm.sup.2. "BM" in Table 2 means "Bone Marrow".
[0544] Table 3 summarizes the distribution of the karyotype of
clone 1-8 at day 101. After the Giemsa stain, chromosome numbers
were counted. 67 of 100 cells showed normal karyotype.
TABLE-US-00021 TABLE 3 Karyotype Analysis Chromosome no. Cell no 44
1 45 22 46 67 47 7 48 1 89 1 136 1
One hundred cells were analyzed in human iPS cells (clone 1-8
mTeSR)
[0545] Table 4 shows primer sequences used in FIG. 7 and FIG.
15.
TABLE-US-00022 TABLE 4 Primer Sequences for RT-PCR Forward primer
sequence Reverse primer sequence HPRT AGTCTGGCTTATATCCAACACTTCG
GACTTTGCTTTCCTTGGTCAGG Nanog TACCTCAGCCTCCAGCAGAT
TGCGTCACACCATTGCTATT TERT AGCCAGTCTCACCTTCAACCGC
GGAGTAGCAGAGGGAGGCCG Sall4 AAACCCCAGCACATCAACTC GTCATTCCCTGGGTGGTTC
Zfp42 TTGGAGTGCAATGGTGTGAT TCTGTTCACACAGGCTCCAG GDF3
GGCGTCCGCGGGAATGTACTTC TGGCTTAGGGGTGGTCTGGCC Dnmt3b
GCAGCGACCAGTCCTCCGACT AACGTGGGGAAGGCCTGTGC TDGF1
ACAGAACCTGCTGCCTGAAT AGAAATGCCTGAGGAAAGCA GABRB3
CTTGACAATCGAGTGGCTGA TCATCCGTGGTGTAGCCATA CYP26A1
AACCTGCACGACTCCTCGCACA AGGATGCGCATGGCGATTCG Oct4-total
GAGAAGGAGAAGCTGGAGCA AATAGAACCCCCAGGGTGAG Oct4-exo
AGTAGACGGCATCGCAGCTTGG GGAAGCTTAGCCAGGTCCGAGG Sox2-total
CAGGAGAACCCCAAGATGC GCAGCCGCTTAGCCTCG Sox2-exo ACACTGCCCCTCTCACACAT
CGGGACTATGGTTGCTGACT Klf4-total ACCCTGGGTCTTGAGGAAGT
ACGATCGTCTTCCCCTCTTT Klf4-exo CTCACCCTTACCGAGTCGGCG
GCAGCTGGGGCACCTGAACC c-Myc-total TCCAGCTTGTACCTGCAGGATCTGA
CCTCCAGCAGAAGGTGATCCAGACT c-Myc-exo AGTAGACGGCATCGCAGCTTGG
CCTCCAGCAGAAGGTGATCCAGACT
[0546] Table 5 summarizes SNP genotyping of human iPS clone 1-8 and
fibroblasts (5F0438 and 5F04156) which were analyzed using the
GeneChip Human Mapping 500K Array Set. SNPs of clone 1-8 were
consistent to that of parental cells in 464,069 (99.17%) of 467,946
of called SNPs and different from that of parental cells in 3,877
(0.83%) of them. In contrast, SNPs of clone 1-8 mTeSR were
consistent to that of unrelated donor cells (5F0416) only in
284,950 (60.50%) of 470,960 of called SNPs and different from that
of the unrelated cells in 186,010 (39.50%) of them.
TABLE-US-00023 TABLE 5 SNP genotyping Consistent SNP (%) between
human iPS clone 1-8, its parental skin-derived cells (5F0438), and
skin cells derived from a different donor (5F0416) iPS 1-8_01 iPS
1-8_02 5F0438_01 5F0438_02 iPS 1-8_02 99.41 5F0438_01 99.17 99.26
5F0438_02 99.44 99.44 99.32 5F0416 60.50 60.75 60.72 60.47
[0547] Table 6. The HLA-A, HLA-B, HLA-Cw and HLA-DR types of human
iPS1-8 (1-8 mTeSR), iPS 2-4 (mTeSR), and iPS 3-2 9mTeSR); and
fibroblasts (5F0438 and 5F0416) were classified using hybridization
of PCR-amplified DNA with sequence specific oligonucleotide probes
(SSOP) (Luminex).
TABLE-US-00024 TABLE 6 HLA genotyping ID A allele B allele Cw
allele DRB1 allele DQB1 allele DPB1 allele 5F0438 *0101/ *0206/
*3801/09 *3905 *0602/ *0702/ *0802 *1104/43/ *0301/ *0402 *0402/
*0501 5F0416 *0201/ -- *1501/ *5101/ *0303/ *0401/ *0401/33/38
*0801/26 *0302/ *0402 *0201 *0301/ iPS 1-8 *0101/ *0206/ *3801/09
*3905 *0602/ *0702/ *0802 *1104/43/ *0301/ *0402 *0402/ *0501/ iPS
2-4 *0201/ -- *1501/ *5101/ *0303/ *0401/ *0401/33/38 *0801/26
*0302/ *0402 *0201 *0301/ iPS 3-2 *0101/ *0206/ *3801/09 *3905
*0802/ *0702/ *0802 *1104/43/ *0301/ *0402 *0402/ *0501 ID HLA-A
HLA-B HLA-Cw HLA-DR HLA-DQ HLA-DP Bw 5F0438 A1 A2 B38 B39 Cw6 Cw7
DR8.2 DR11 DQ7 DQ4 DP4 DP5 4/6 5F0416 A2 -- B62 B51 Cw9 Cw4 DR4.1
DR8.1 DQ8 DQ4 DP2 DP3 4/6 iPS 1-8 A1 A2 B38 B39 Cw6 Cw7 DR8.2 DR11
DQ7 DQ4 DP4 DP5 4/6 iPS 2-4 A2 -- B62 B51 Cw9 Cw4 DR4.1 DR8.1 DQ8
DQ4 DP2 DP2 4/6 iPS 3-2 A1 A2 B38 B39 Cw6 Cw7 DR8.2 DR11 DQ7 DQ4
DP4 DP5 4/6
[0548] Table 7 summarized hES cell marker gene expression patterns
in colonies. Colonies were stained for alkaline phosphatase at 17
days post 4 genes transduction. All ALP(+) colonies and 18 ALP(-)
colonies were dissected and determined their hES marker gene
expression by RT-PCR. Each colony was categorized and counted the
number. "+" represents gene expression, and "-" represents no
detection by a 40 cycle RT-PCR using amplified cDNA samples.
TABLE-US-00025 TABLE 7 Gene expression patterns in ALP(+) and
ALP(-) colonies Gene expression patterns in ALP(+) colonies No.
Group No. of gene of No. expressed Nanog TDGF1 Dnmt3b Zfp42 FoxD3
GDF3 CYP26A1 TERT colony 1 8 + + + + + + + + 4 2 7 + + + + + + + -
7 3 7 + + + + + + - + 11 4 7 + + + + + - + + 1 5 6 + + + + + + - -
25 6 6 + + + + + - + - 4 7 6 + + + + + - - + 3 8 6 + + + + - + - +
2 9 6 + + + + - + + - 3 10 6 + + + - + + + - 1 11 6 + + + - - + + +
1 12 5 + + + + + - - - 22 13 5 + + + + - + - - 9 14 5 + + + + - - +
- 2 15 5 + + + - + + - - 4 16 5 + + + - + - + - 2 17 5 + + + - - +
+ - 1 18 5 + + - + + + - - 2 19 5 + + - + + - - + 1 20 4 + + + + -
- - - 9 21 4 + + + - + - - - 3 22 4 + + + - - + - - 5 23 4 + + - +
+ - - - 7 24 4 + - + + + - - - 1 25 4 + - + - + + - - 2 26 4 + - -
+ + + - - 1 27 3 + + + - - - - - 1 28 3 + + - + - - - - 3 29 3 + +
- - + - - - 4 30 3 + + - - - - - + 1 31 3 + - + + - - - - 1 32 3 +
- + - + - - - 2 33 3 + - + - - + - - 1 34 3 + - - + + - - - 1 35 3
+ - - - + + - - 1 36 2 + + - - - - - - 4 37 2 + - + - - - - - 5 38
2 + - - + - - - - 2 39 1 + - - - - - - - 2 40 0 - - - - - - - - 2
41 6 + + + + + - + - 1 42 6 + + - + + + - + 1 43 5 + + + + + - - -
3 44 5 + + - + + - - + 6 45 4 + + + - + - - - 1 46 4 + + - + + - -
- 1 47 4 + + + - - - - + 1 48 2 + - - - - - - + 1 49 1 + - - - - -
- - 1 50 1 - + - - - - - - 1 51 0 - - - - - - - - 1
[0549] Table 8 summarizes the number of alkaline
phosphatase-positive colonies of the experiments using neonatal
fibroblasts. The date of four gene introduction is a day when a
retrovirus vector was infected. The donor indicates lot number of
Lonza products. The number of colonies is the number of colonies
composed of alkaline phosphatase-positive small cells per 10
cm.sup.2. ND: not determined.
TABLE-US-00026 TABLE 8 List of experiments experimental ALP
staining conditions number of cell density colony donor
(cells/cm.sup.2) (/10 cm.sup.2) notes 5F0439 1 .times. 10.sup.4 0.8
5F0438 1 .times. 10.sup.4 6.0 iPS clone#1-8 5F0438 1 .times.
10.sup.4 6.0 5F0474 1 .times. 10.sup.4 4.0 5F0438 1 .times.
10.sup.4 7.0 5F0474 1 .times. 10.sup.4 9.5 5F0474 1 .times.
10.sup.4 13.3 5F0416 1 .times. 10.sup.3 19.0 5F0416 1 .times.
10.sup.4 17.5 5F0474 1 .times. 10.sup.4 14.0 5F0416 1 .times.
10.sup.3 3.0 5F0416 1 .times. 10.sup.4 9.0 5F0416 1 .times.
10.sup.3 21.0 ALP(+) 5F0416 1 .times. 10.sup.4 21.5 colony 5F0474 1
.times. 10.sup.3 17.0 classification 5F0474 1 .times. 10.sup.4 19.5
5F0416 1 .times. 10.sup.3 ND iPS clone #2-4 5F0416 1 .times.
10.sup.4 ND 5F0474 1 .times. 10.sup.3 ND 5F0474 1 .times. 10.sup.4
ND 5F1195 1 .times. 10.sup.3 ND 5F0438 1 .times. 10.sup.3 ND iPS
clone #3-2
[0550] Table 9 lists up locations and sizes in genome corresponding
to amplicons using for methylation analyses of the promoter regions
of Nanog and Oct3/4. Columns A, B and C indicate amplicon name,
locations and sizes in genome corresponding to amplicons,
respectively.
TABLE-US-00027 TABLE 9 Promoter regions in methylation analysis
amplicon location in genome size of name corresponding to amplicon
amplicon Nanog-z1 chr12: 7832645-7832959 315 Nanog-z2 chr12:
7832877-7833269 393 Oct3/4-z1 chr6: 31248581-31249029 449 Oct3/4-z2
chr6_qb1_hap2: 2388299-2388525 227
[0551] Table 10 lists up the primer sets using for methylation
analyses of the promoter regions of Nanog and Oct3/4. Columns A and
B indicate names of primers and sequences of primers (capital for
gene-specific sequences, lower case for tag sequences),
respectively.
TABLE-US-00028 TABLE 10 Primer sequences for methylation analyses
names of sequences of primers (capital for gene-specific primers
sequences, lower case for tag sequences) Nanog-z1-L
aggaagagagGGAATTTAAGGTGTATGTATTTTTTATTTT Nanog-z1-R
cagtaatacgactcactatagggagaaggctATAACCCACCCCTATAATCCCAAT A
Nanog-z2-L aggaagagagGTTAGGTTGGTTTTAAATTTTTGAT Nanog-z2-R
cagtaatacgactcactatagggagaaggctTTTATAATAAAAACTCTATCACCTT AAACC
Oct3/4-z1-L aggaagagagTAGTAGGGATTTTTTGGATTGGTTT Oct3/4-z1-R
cagtaatacgactcactatagggagaaggctAAAACTTTTCCCCCACTCTTATATT AC
Oct3/4-z2-L aggaagagagGGTAATAAAGTGAGATTTTGTTTTAAAAA Oct3/4-z2-R
cagtaatacgactcactatagggagaaggctCCACCCACTAACCTTAACCTCTAA
[0552] Table 11 summarizes relative mRNA expression in ALP positive
colonies of Examples 15. Numbers of colonies are corresponding to
FIG. 16-23. Colony #5-2-32, #5-2-49, #5-2-51, #7-2-37 expressed all
analyzed human ES cell markers. In contrast, fibroblastic colonies
#3-1-212, #3-1-215, #5-1-4 expressed only Nanog though it highly
expressed transgenes.
TABLE-US-00029 TABLE 11 Relative mRNA expression of ES cell markers
in ALP positive colonies no. of Nanog GDF3 CYP26A1 TERT c-Myc
Oct3/4 genes ALP mean SD mean SD mean SD mean SD mean SD mean SD 8
ALP(+) 9.3 .+-. 1.5 4.8 .+-. 0.3 27.2 .+-. 12.5 0.2 .+-. 0.0 1121.1
.+-. 25.3 39.3 .+-. 1.5 8 ALP(+) 15.9 .+-. 5.7 242.9 .+-. 78.8 3.0
.+-. 0.3 3.7 .+-. 0.5 1106.3 .+-. 51.8 770.6 .+-. 9.3 8 ALP(+) 27.1
.+-. 2.2 419.2 .+-. 24.7 73.5 .+-. 8.2 2.5 .+-. 0.1 1329.4 .+-.
272.1 101.6 .+-. 5.1 8 ALP(+) 36.9 .+-. 7.8 171.3 .+-. 20.0 110.1
.+-. 15.4 6.2 .+-. 1.1 566.9 .+-. 22.1 30.9 .+-. 2.4 7 ALP(+) 21.0
.+-. 2.4 59.2 .+-. 10.2 0.0 .+-. 0.0 0.12 .+-. 0.09 436 .+-. 12
25.0 .+-. 1.2 7 ALP(+) 127.6 .+-. 6.0 259.7 .+-. 3.9 0.0 .+-. 0.0
0.6 .+-. 0.3 59.2 .+-. 1.2 9.1 .+-. 0.1 7 ALP(+) 32.6 .+-. 8.4 34.0
.+-. 5.0 0.0 .+-. 0.0 1.1 446.9 .+-. 15.8 14.9 .+-. 0.1 7 ALP(+)
9.5 .+-. 1.0 3.4 .+-. 0.9 0.0 .+-. 0.0 1.6 .+-. 0.1 1052.8 .+-.
129.5 17.1 .+-. 0.3 7 ALP(+) 141.5 .+-. 64.3 328.8 .+-. 54.1 0.0
.+-. 0.0 7.0 .+-. 0.7 9796.2 .+-. 275.5 324.2 .+-. 29.8 7 ALP(+)
78.0 .+-. 16.6 188.2 .+-. 3.8 0.0 .+-. 0.0 67.6 .+-. 7.1 9714.4
.+-. 15.7 258.7 .+-. 13.3 7 ALP(+) 55.5 .+-. 12.2 151.3 .+-. 21.2
0.0 .+-. 0.0 5.2 .+-. 0.1 285.3 .+-. 49.6 24.8 .+-. 3.2 7 ALP(+)
0.1 .+-. 0.1 0.1 .+-. 0.1 0.0 .+-. 0.0 1.1 .+-. 0.0 13065.1 .+-.
769.8 241.8 .+-. 0.7 7 ALP(+) 10.9 .+-. 2.6 67.9 .+-. 12.3 0.0 .+-.
0.0 4.4 .+-. 0.8 171.5 .+-. 2.3 578.7 .+-. 13.4 7 ALP(+) 0.1 .+-.
0.0 0.4 .+-. 0.1 0.0 .+-. 0.0 0.7 .+-. 0.5 3176.2 .+-. 751.2 233.4
.+-. 17.7 7 ALP(+) 51.5 .+-. 14.4 126.4 .+-. 1.1 0.0 .+-. 0.0 2.5
.+-. 0.3 1446.0 .+-. 421.7 33.8 .+-. 2.6 7 ALP(+) 0.7 .+-. 0.1 0.0
.+-. 0.0 5.0 0.5 .+-. 0.2 6049.2 .+-. 396.9 3.8 .+-. 0.3 6 ALP(+)
14.6 .+-. 1.1 0.0 .+-. 0.0 0.0 .+-. 0.0 40.0 .+-. 5.7 27086.4 .+-.
3870.8 530.6 .+-. 84.1 6 ALP(+) 20.1 .+-. 5.9 0.0 .+-. 0.0 0.0 .+-.
0.0 1.9 .+-. 1.0 9125.8 .+-. 883.7 7.5 .+-. 0.7 6 ALP(+) 1.1 .+-.
0.4 0.0 .+-. 0.0 0.0 .+-. 0.0 20.6 .+-. 0.6 8344.9 .+-. 2054.5 6.7
.+-. 0.5 6 ALP(+) 103.4 .+-. 11.7 195.3 .+-. 17.7 0.0 .+-. 0.0 18.1
.+-. 1.8 95692.9 .+-. 5109.8 2843.9 .+-. 113.9 6 ALP(+) 50.8 .+-.
3.6 291.3 .+-. 43.9 0.0 .+-. 0.0 20.2 .+-. 2.9 29701.1 .+-. 4821.3
483.1 .+-. 13.9 6 ALP(+) 50.3 .+-. 14.5 34.3 .+-. 3.6 10.4 .+-. 2.0
1.3 .+-. 0.1 533.8 .+-. 24.8 30.2 .+-. 1.2 5 ALP(+) 9.3 .+-. 0.5
0.0 .+-. 0.0 0.0 .+-. 0.0 0.0 .+-. 0.0 16848.2 .+-. 1742.0 4.7 .+-.
0.2 5 ALP(+) 126.4 .+-. 65.3 0.0 .+-. 0.0 0.0 .+-. 0.0 28.7 .+-.
4.9 23614.4 .+-. 388.9 310.9 .+-. 19.2 4 ALP(+) 3.7 .+-. 1.3 0.0
.+-. 0.0 0.0 .+-. 0.0 0.0 .+-. 0.0 2927.9 .+-. 412.5 130.3 .+-.
10.1 4 ALP(+) 1.9 .+-. 0.3 0.0 .+-. 0.0 0.0 .+-. 0.0 0.0 .+-. 0.0
19433.2 .+-. 297.0 4.2 .+-. 0.5 4 ALP(+) 17.4 .+-. 5.1 0.0 .+-. 0.0
0.0 .+-. 0.0 0.0 .+-. 0.0 1959.8 .+-. 379.9 8.5 .+-. 0.7 3 ALP(+)
2.2 .+-. 0.3 0.0 .+-. 0.0 0.0 .+-. 0.0 0.0 .+-. 0.0 6065.6 .+-.
704.9 3.4 .+-. 0.3 3 ALP(+) 1.9 .+-. 0.3 0.0 .+-. 0.0 0.0 .+-. 0.0
0.0 .+-. 0.0 4572.6 .+-. 303.7 7.4 .+-. 0.1 3 ALP(+) 1.4 .+-. 0.2
0.0 .+-. 0.0 0.0 .+-. 0.0 0.0 .+-. 0.0 53755.3 .+-. 10897.7 22.9
.+-. 3.0 3 ALP(+) 5.6 .+-. 2.9 0.0 .+-. 0.0 0.0 .+-. 0.0 807.1 .+-.
13.4 25595.8 .+-. 2002.8 414.9 .+-. 22.6 6 ALP(-) 0.5 .+-. 0.1 0.07
0.0 .+-. 0.0 0.01 .+-. 0.01 5873.2 .+-. 156.2 226.3 .+-. 12.9 5
ALP(-) 0.8 .+-. 0.2 0.0 .+-. 0.0 0.0 .+-. 0.0 0.5 .+-. 0.2 8698.4
.+-. 492.3 58.7 .+-. 2.6 5 ALP(-) 6.9 .+-. 1.1 0.0 .+-. 0.0 0.0
.+-. 0.0 0.7 .+-. 0.1 9350.1 .+-. 201.0 2.1 .+-. 0.1 5 ALP(-) 7.2
.+-. 2.0 0.0 .+-. 0.0 0.0 .+-. 0.0 7.3 .+-. 1.8 26133.6 .+-. 3528.5
8.0 .+-. 0.1 5 ALP(-) 0.2 .+-. 0.1 0.0 .+-. 0.0 0.0 .+-. 0.0 0.5
.+-. 0.1 5211.8 .+-. 618.7 370.7 .+-. 7.8 5 ALP(-) 2.5 .+-. 0.5 0.0
.+-. 0.0 0.0 .+-. 0.0 0.5 .+-. 0.1 8971.8 .+-. 110.3 266.6 .+-.
21.4 5 ALP(-) 3.4 .+-. 0.9 0.0 .+-. 0.0 0.0 .+-. 0.0 11.8 .+-. 3.4
9748.3 .+-. 530.0 7.3 .+-. 0.1 4 ALP(-) 0.2 .+-. 0.1 0.0 .+-. 0.0
0.0 .+-. 0.0 14.6 .+-. 1.9 7681.0 .+-. 286.9 261.0 .+-. 26.0 2
ALP(-) 0.6 .+-. 0.3 0.0 .+-. 0.0 0.0 .+-. 0.0 8.2 .+-. 0.6 53887.9
.+-. 1343.2 13.3 .+-. 1.2 1 ALP(-) 3.4 .+-. 0.5 0.0 .+-. 0.0 0.0
.+-. 0.0 0.0 .+-. 0.0 7721.3 .+-. 437.0 52.1 .+-. 2.3 1 ALP(-) 0.0
.+-. 0.0 0.0 .+-. 0.0 0.0 .+-. 0.0 0.0 .+-. 0.0 96049.6 .+-. 2394.1
23.7 .+-. 2.1 0 ALP(-) 0.0 .+-. 0.0 0.0 .+-. 0.0 0.0 .+-. 0.0 0.0
.+-. 0.0 1454.7 .+-. 371.7 11.6 .+-. 0.3 clone1-8 (Std) 1.0 1.0 1.0
1.0 1.0 1.0
[0553] Table 12 summarizes relative mRNA expression in clone-2-4
and 3-2. Total RNA was extracted from clones 2-4 and 3-2.
Expression of ES cell marker genes were determined by qRT-PCR as
described in Example 16 and 17. Both clone-2-4 and -3-2 showed ES
cell marker gene expression. All expression values were normalized
against human iPS clone-1-8 (day 94).
TABLE-US-00030 TABLE 12 relative mRNA expression in clone-2-4 and
3-2. #3-2_day48 #2-4_day59 #1-8_day82 #1-8_day94 Nanog 4.21 .+-.
1.11 2.88 .+-. 0.43 2.41 1.00 .+-. 0.24 TERT 1.52 .+-. 0.50 1.94
.+-. 0.14 0.69 1.00 .+-. 0.70 GDF3 6.42 .+-. 0.16 6.65 .+-. 0.05
0.92 1.00 .+-. 0.49 CYP26A1 72.45 .+-. 14.92 49.12 .+-. 0.06 62.50
1.00 .+-. 0.01 TDGF1 2.55 .+-. 0.10 3.53 .+-. 0.05 3.53 1.00 .+-.
0.01 Dnmt3b 2.66 .+-. 0.04 0.96 .+-. 0.02 0.91 1.00 .+-. 0.01 Foxd3
1.16 .+-. 0.08 0.59 .+-. 0.17 1.14 1.00 .+-. 0.18 Zfp42 0.98 .+-.
0.15 0.76 .+-. 0.01 2.44 1.00 .+-. 0.02 Myc 6.14 .+-. 0.58 4.58
.+-. 0.16 3.82 1.00 .+-. 0.05 Oct3/4 2.00 .+-. 0.07 1.08 .+-. 0.01
1.33 1.00 .+-. 0.00
TABLE-US-00031 TABLE 13 Genes Expressed at a 5 fold or Greater
Level in iPS Cell Lines versus hES Cell Lines (p .ltoreq. 0.01)
Systematic Name Genbank Description 235940_at AW983691 chromosome 9
open reading frame 64 239206_at BE552138 complement component
(3b/4b) receptor 1-like 239205_s_at BE552138 complement component
(3b/4b) receptor 1 (Knops blood group) /// complement component
(3b/4b) receptor 1-like /// similar to complement component (3b/4b)
receptor 1 isoform F precursor 215101_s_at BG166705 chemokine
(C--X--C motif) ligand 5 AFFX-r2-Ec-bioD- AFFX-ThrX-M -- 3_at
AFFX-M27830_5_at AFFX-M27830_3 -- 210697_at AF070651 zinc finger
protein 257 213122_at AI096375 TSPY-like 5 223551_at AF225513
protein kinase (cAMP-dependent, catalytic) inhibitor beta
214974_x_at AK026546 chemokine (C--X--C motif) ligand 5 237552_at
BF056473 CDNA clone IMAGE: 4667929 212575_at BF966155 chromosome 19
open reading frame 6 229328_at T90358 Zinc finger protein 540
231120_x_at AL569326 protein kinase (cAMP-dependent, catalytic)
inhibitor beta 235075_at AI813438 desmoglein 3 (pemphigus vulgaris
antigen) 211906_s_at AB046400 serpin peptidase inhibitor, clade B
(ovalbumin), member 4 225061_at N45231 DnaJ (Hsp40) homolog,
subfamily A, member 4 217230_at AF199015 villin 2 (ezrin) 225908_at
AI829927 isoamyl acetate-hydrolyzing esterase 1 homolog (S.
cerevisiae) 232881_at AI500353 GNAS1 antisense 239951_at AI734093
Transcribed locus 1554333_at BC031044 DnaJ (Hsp40) homolog,
subfamily A, member 4 1553276_at NM_152476 zinc finger protein 560
1553970_s_at BC042510 carboxyl ester lipase (bile salt-stimulated
lipase) 219837_s_at NM_018659 cytokine-like 1 228063_s_at AW025330
nucleosome assembly protein 1-like 5 208542_x_at NM_007153 zinc
finger protein 208 243110_x_at AI868441 neuropeptide W 239319_at
BE542563 Hypothetical protein LOC728342 215826_x_at AK023017
hypothetical BC37295_3 1555229_a_at BC007010 complement component
1, s subcomponent 235779_at AW467077 Hypothetical protein LOC284408
220638_s_at NM_012116 Cas-Br-M (murine) ecotropic retroviral
transforming sequence c 232315_at AU149712 Zinc finger-like
222546_s_at AW204755 EPS8-like 2 235913_at AI285722 zinc
finger-like 215019_x_at AW474158 zinc finger protein 528
210362_x_at AF230409 promyelocytic leukemia 231299_at AI494590
centaurin, gamma 3 214336_s_at AI621079 coatomer protein complex,
subunit alpha 210171_s_at S68134 cAMP responsive element modulator
219807_x_at NM_016154 RAB4B, member RAS oncogene family 205827_at
NM_000729 cholecystokinin 1559503_a_at AA350425 Similar to zinc
finger protein 91 228062_at AW025330 nucleosome assembly protein
1-like 5 223789_s_at AF116627 GTP binding protein 2 215634_at
AF007137 Clone 23618 mRNA sequence 201679_at BE646076 ARS2 protein
213695_at L48516 paraoxonase 3 1553219_a_at NM_015365 Alport
syndrome, mental retardation, midface hypoplasia and elliptocytosis
chromosomal region, gene 1 1552470_a_at NM_148914 abhydrolase
domain containing 11 216884_at S69182 protein tyrosine phosphatase,
non-receptor type 12 237215_s_at N76327 transferrin receptor (p90,
CD71) 209040_s_at U17496 proteasome (prosome, macropain) subunit,
beta type, 8 (large multifunctional peptidase 7) 214090_at BF732462
PRKC, apoptosis, WT1, regulator 223629_at BC001186 protocadherin
beta 5 216971_s_at Z54367 plectin 1, intermediate filament binding
protein 500 kDa 201008_s_at AA812232 thioredoxin interacting
protein 233754_x_at AC007228 zinc finger protein 71 200621_at
NM_004078 cysteine and glycine-rich protein 1 208978_at U36190
cysteine-rich protein 2 1552914_a_at NM_025240 CD276 molecule
1559051_s_at AK097148 chromosome 6 open reading frame 150
212105_s_at BF313832 DEAH (Asp-Glu-Ala-His) box polypeptide 9
222814_s_at AI916361 zinc finger, HIT type 2 236562_at N29327 zinc
finger protein 439 1562245_a_at AL833487 MRNA; cDNA DKFZp686H1629
(from clone DKFZp686H1629) 203872_at NM_001100 actin, alpha 1,
skeletal muscle 222935_x_at AW139759 solute carrier family 39 (zinc
transporter), member 8 1555695_a_at AF388368 clarin 1 207080_s_at
NM_004160 peptide YY 243195_s_at BF438407 zinc finger protein 551
220179_at NM_022357 dipeptidase 3 207099_s_at NM_000390
choroideremia (Rab escort protein 1) 222898_s_at BE350882
delta-like 3 (Drosophila) 226539_s_at BF436337 -- 229332_at
AI653050 4-hydroxyphenylpyruvate dioxygenase-like 207852_at
NM_002994 chemokine (C--X--C motif) ligand 5 1554334_a_at BC031044
DnaJ (Hsp40) homolog, subfamily A, member 4 1555731_a_at AF393369
adaptor-related protein complex 1, sigma 3 subunit AFFX-r2-Ec-bioC-
AFFX-ThrX-5 -- 5_at 215337_at AK022508 mediator complex subunit 24
211124_s_at AF119835 KIT ligand 1553873_at NM_153270 kelch-like 34
(Drosophila) 201796_s_at BE790854 valyl-tRNA synthetase 235942_at
AI272059 LOC401629 /// LOC401630 202873_at BF034973 ATPase, H+
transporting, lysosomal 42 kDa, V1 subunit C1 244178_at AW451792
COMM domain containing 7 215172_at AL050040 protein tyrosine
phosphatase, non-receptor type 20B /// protein tyrosine
phosphatase, non-receptor type 20A 228251_at BE467577 UBX domain
containing 1 224463_s_at BC006128 chromosome 11 open reading frame
70 206797_at NM_000015 N-acetyltransferase 2 (arylamine
N-acetyltransferase) 212278_x_at BF588511 ubiquitin protein ligase
E3A (human papilloma virus E6-associated protein, Angelman
syndrome) 1555766_a_at AF493870 guanine nucleotide binding protein
(G protein), gamma 2 211107_s_at AB017332 aurora kinase C
214519_s_at NM_005059 relaxin 2 226504_at AA522720 family with
sequence similarity 109, member B 216469_at AL163202 similar to
zinc finger protein 43 (HTF6) 221123_x_at NM_018660 zinc finger
protein 395 1568574_x_at AB019562 Secreted phosphoprotein 1
(osteopontin, bone sialoprotein I, early T-lymphocyte activation 1)
215989_at BE258133 chromobox homolog 2 (Pc class homolog,
Drosophila) 205195_at NM_001283 adaptor-related protein complex 1,
sigma 1 subunit 223994_s_at BC000154 solute carrier family 12
(potassium/chloride transporters), member 9 205095_s_at NM_005177
ATPase, H+ transporting, lysosomal V0 subunit a1 1554777_at
BI092935 zinc finger protein 42 homolog (mouse) 217494_s_at
AF023139 phosphatase and tensin homolog (mutated in multiple
advanced cancers 1), pseudogene 1 201169_s_at BG326045 basic
helix-loop-helix domain containing, class B, 2 214123_s_at AI126492
chromosome 4 open reading frame 10 229896_at H41907 CDNA clone
IMAGE: 6106200 211214_s_at BC003614 death-associated protein kinase
1 203402_at AL520102 potassium voltage-gated channel,
shaker-related subfamily, beta member 2 205920_at NM_003043 solute
carrier family 6 (neurotransmitter transporter, taurine), member 6
212937_s_at M20776 collagen, type VI, alpha 1 200796_s_at BF594446
myeloid cell leukemia sequence 1 (BCL2-related) 1558697_a_at
BI600341 KIAA0430 232771_at Z83850 Nik related kinase 1559501_at
BC037580 CDNA clone IMAGE: 5262521 238750_at AW083576 chemokine
(C-C motif) ligand 28 239818_x_at AA576947 tribbles homolog 1
(Drosophila) 1555765_a_at AF493872 guanine nucleotide binding
protein (G protein), gamma 4 233573_s_at AK001080 WD repeat domain
6 206220_s_at NM_007368 RAS p21 protein activator 3 212113_at
AI927479 hypothetical LOC552889 205577_at NM_005609 phosphorylase,
glycogen; muscle (McArdle syndrome, glycogen storage disease type
V) 201130_s_at L08599 cadherin 1, type 1, E-cadherin (epithelial)
219911_s_at NM_016354 solute carrier organic anion transporter
family, member 4A1 227598_at AI762857 chromosome 7 open reading
frame 29 226654_at AF147790 mucin 12, cell surface associated
205461_at NM_006861 RAB35, member RAS oncogene family 221285_at
NM_006011 ST8 alpha-N-acetyl-neuraminide
alpha-2,8-sialyltransferase 2 203027_s_at AI189359 mevalonate
(diphospho) decarboxylase 243639_at R51605 Transcribed locus
211162_x_at AF116616 stearoyl-CoA desaturase (delta-9-desaturase)
213667_at AB002307 Snf2-related CBP activator protein 1559361_at
AF086401 Full length insert cDNA clone ZD75H06 218000_s_at
NM_007350 pleckstrin homology-like domain, family A, member 1
209260_at BC000329 stratifin 211530_x_at M90686 HLA-G
histocompatibility antigen, class I, G AFFX-r2-Bs-dap-
AFFX-r2-Bs-phe-M -- M_at 239947_at AI969304 Transcribed locus
215955_x_at Y10388 Rho GTPase activating protein 26 227806_at
BG285710 chromosome 16 open reading frame 74 220259_at NM_024927
pleckstrin homology domain containing, family H (with MyTH4 domain)
member 3 1560154_a_at AK026500 CDNA: FLJ22847 fis, clone KAIA686
AFFX-r2-Bs-dap-5_at AFFX-r2-Bs-phe-5 -- 223708_at AF329838 C1q and
tumor necrosis factor related protein 4 215581_s_at AK022303
minichromosome maintenance complex component 3 associated protein
1552399_a_at NM_145696 BRF1 homolog, subunit of RNA polymerase III
transcription initiation factor IIIB (S. cerevisiae) 221310_at
NM_004115 fibroblast growth factor 14 234939_s_at AL161953 PHD
finger protein 12 218944_at NM_023078 pyrroline-5-carboxylate
reductase-like 206673_at NM_007223 G protein-coupled receptor 176
205910_s_at NM_001807 carboxyl ester lipase (bile salt-stimulated
lipase) 206232_s_at NM_004775 UDP-Gal: betaGlcNAc beta
1,4-galactosyltransferase, polypeptide 6 212009_s_at AL553320
stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein)
204815_s_at AI924903 DEAH (Asp-Glu-Ala-His) box polypeptide 34
234237_s_at AL137611 hypothetical protein FLJ20294 229502_at
AW242403 choline dehydrogenase 1554776_at AF450454 zinc finger
protein 42 homolog (mouse) 242070_at AI014470 hypothetical protein
LOC728485 1554508_at BC029917 phosphoinositide-3-kinase adaptor
protein 1 210935_s_at AF274954 WD repeat domain 1 236741_at
AW299463 WD repeat domain 72 205081_at NM_001311 cysteine-rich
protein 1 (intestinal) 1555240_s_at AF493879 guanine nucleotide
binding protein (G protein), gamma 12 205824_at NM_001541 heat
shock 27 kDa protein 2 230033_at BF436398 chromosome 19 open
reading frame 51 206832_s_at NM_004186 sema domain, immunoglobulin
domain (Ig), short basic domain, secreted, (semaphorin) 3F
223083_s_at AW057545 egl nine homolog 2 (C. elegans) 235234_at
AA359612 FLJ36874 protein 206604_at NM_004561 ovo-like
1(Drosophila) 1555829_at BC001224 family with sequence similarity
62 (C2 domain containing) member B 1555434_a_at BC015770 solute
carrier family 39 (zinc transporter), member 14 205196_s_at
NM_001283 adaptor-related protein complex 1, sigma 1 subunit
1564706_s_at AF110329 glutaminase 2 (liver, mitochondrial)
242519_at BF432331 Selenoprotein P, plasma, 1 205344_at NM_006574
chondroitin sulfate proteoglycan 5 (neuroglycan C) 201123_s_at
NM_001970 eukaryotic translation initiation factor 5A 220825_s_at
NM_018240 kin of IRRE like (Drosophila) 224805_s_at BF508824
chromosome 15 open reading frame 17 224033_at AF130083 --
1564339_a_at AF279779 cholinergic receptor, muscarinic 3 ///
similar to cholinergic receptor, muscarinic 3 216031_x_at T53900
hematological and neurological expressed 1-like 202627_s_at
AL574210 serpin peptidase inhibitor, clade E (nexin, plasminogen
activator inhibitor type 1), member 1 221628_s_at AF326966
cytokine-like nuclear factor n-pac 201432_at NM_001752 catalase
223285_s_at AW044319 ST6
(alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosamini-
de alpha-2,6-sialyltransferase 4 1555800_at BC038422 zinc finger
protein 533 209261_s_at BF000629 nuclear receptor subfamily 2,
group F, member 6 1553055_a_at NM_144975 schlafen family member 5
233492_s_at AC005587 olfactory receptor, family 2, subfamily A,
member 4 /// olfactory receptor, family 2, subfamily A, member 7
/// similar to rho guanine nucleotide exchange factor 5 205867_at
NM_002834 protein tyrosine phosphatase, non-receptor type 11
(Noonan syndrome 1) 1554417_s_at AY113699 anterior pharynx
defective 1 homolog A (C. elegans) 223799_at AF253976 KIAA1826
214040_s_at BE675337 gelsolin (amyloidosis, Finnish type)
201045_s_at BF513857 RAB6A, member RAS oncogene family ///
RAB6C-like 1557910_at BG612458 heat shock protein 90 kDa alpha
(cytosolic), class B member 1 204823_at NM_014903 neuron navigator
3 1553852_at NM_152564 vacuolar protein sorting 13 homolog B
(yeast) 1557924_s_at S76738 alkaline phosphatase, liver/bone/kidney
221807_s_at BG399562 TraB domain containing 1552995_at NM_145659
interleukin 27 1567013_at AF323119 nuclear factor
(erythroid-derived 2)-like 2 216360_x_at AK000238 ribosomal RNA
processing 12 homolog (S. cerevisiae) 242676_at AA401733
Transcribed locus 205925_s_at NM_002867 RAB3B, member RAS oncogene
family 232751_at AL121893 retinoblastoma binding protein 9
1555680_a_at AY033891 spermine oxidase 231452_at AW510925 HRAS-like
suppressor family, member 5 210068_s_at U63622 aquaporin 4
205384_at NM_005031 FXYD domain containing ion transport regulator
1 (phospholemman) 213171_s_at AL121753 matrix metallopeptidase 24
(membrane-inserted) 210732_s_at AF342816 lectin,
galactoside-binding, soluble, 8 (galectin 8) 203890_s_at BF686824
death-associated protein kinase 3 209756_s_at AI871354 v-myc
myelocytomatosis viral related oncogene, neuroblastoma derived
(avian) 232506_s_at AK026504 chromosome 15 open reading frame 41
211708_s_at BC005807 stearoyl-CoA desaturase (delta-9-desaturase)
1556670_at AK098715 CDNA FLJ25849 fis, clone TST08968 1558214_s_at
BG330076 catenin (cadherin-associated protein), alpha 1, 102 kDa
1555559_s_at AF419247 ubiquitin specific peptidase 25 209458_x_at
AF105974 hemoglobin, alpha 1 /// hemoglobin, alpha 2 222385_x_at
AF346602 Sec61 alpha 1 subunit (S. cerevisiae) 228102_at AA127691
Neuropilin 2 229284_at R60683 Methionine adenosyltransferase II,
beta 227759_at W92036 proprotein convertase subtilisin/kexin type 9
208621_s_at BF663141 villin 2 (ezrin) 211538_s_at U56725 heat shock
70 kDa protein 2 218832_x_at NM_004041 arrestin, beta 1 229289_at
AL517395 hypothetical protein BC004941 1553698_a_at NM_145257
chromosome 1 open reading frame 96 209427_at AF064238 smoothelin
214971_s_at AV695711 ST6 beta-galactosamide
alpha-2,6-sialyltranferase 1 235854_x_at AA167669 Rho-associated,
coiled-coil containing protein kinase 1 217601_at AL523184
nucleoporin 188 kDa 205715_at NM_004334 bone marrow stromal cell
antigen 1 207532_at NM_006891 crystallin, gamma D 239852_at
AL532029 methylmalonic aciduria (cobalamin deficiency) cb1A type
206997_s_at NM_004807 heparan sulfate 6-O-sulfotransferase 1 ///
similar to Heparan-sulfate 6-O- sulfotransferase 1 (HS6ST-1)
219424_at NM_005755 Epstein-Barr virus induced gene 3 225322_s_at
AL514147 chromosome 17 open reading frame 70 221414_s_at NM_030931
defensin, beta 126 214154_s_at AA888057 plakophilin 2 1562527_at
AF519622 hypothetical protein LOC283027 221213_s_at NM_017661
suppressor of hairy wing homolog 4 (Drosophila) 214007_s_at
AW665024 twinfilin, actin-binding protein, homolog 1 (Drosophila)
1556834_at BC042986 CDNA clone IMAGE: 5296106 227757_at AL563297
cullin 4A 236340_at AI769947 Transcribed locus, strongly similar to
XP_001146557.1 hypothetical protein [Pantroglodytes] 204698_at
NM_002201 interferon stimulated exonuclease gene 20 kDa
1554383_a_at BC028121 translocation associated membrane protein 2
210978_s_at BC002616 transgelin 2 234773_x_at AL442080 MRNA; cDNA
DKFZp434A0226 (from clone DKFZp434A0226) 208504_x_at NM_018931
protocadherin beta 11 214008_at N25562 Twinfilin, actin-binding
protein, homolog 1 (Drosophila) 209875_s_at M83248 secreted
phosphoprotein 1 (osteopontin, bone sialoprotein I, early
T-lymphocyte activation 1) 1555821_a_at BC016043 AKT1 substrate 1
(proline-rich) 216915_s_at S69182 protein tyrosine phosphatase,
non-receptor type 12 1568905_at BC030750 CDNA clone IMAGE: 4795773
233421_s_at AU146738 nucleoporin 133 kDa 232490_s_at U67085 prune
homolog (Drosophila) 227419_x_at AW964972 placenta-specific 9
242948_x_at T97602 Transcribed locus 227175_at AI806486 Myeloid
cell leukemia sequence 1 (BCL2-related) 209213_at BC002511 carbonyl
reductase 1 208262_x_at NM_000243 Mediterranean fever 227486_at
AI086864 5'-nucleotidase, ecto (CD73) 239239_at W58601 Transcribed
locus 236574_at AI304870 Hypothetical protein LOC284373 219360_s_at
NM_017636 transient receptor potential cation channel, subfamily M,
member 4 1558423_at BE715671 hypothetical LOC349114 221408_x_at
NM_018932 protocadherin beta 12 1562234_a_at AF397731 neuron
navigator 3 /// similar to neuron navigator 3 226632_at AL513673
cytoglobin 216831_s_at AF018283 runt-related transcription factor
1; translocated to, 1 (cyclin D-related) 206932_at NM_003956
cholesterol 25-hydroxylase 213210_at AI005317 TAF6-like RNA
polymerase II, p300/CBP-associated factor (PCAF)-associated factor,
65 kDa 201167_x_at D13989 Rho GDP dissociation inhibitor (GDI)
alpha 212016_s_at AA679988 polypyrimidine tract binding protein 1
203324_s_at NM_001233 caveolin 2 214828_s_at AL157851 CGI-96
protein /// similar to CGI-96 219298_at NM_024693 enoyl Coenzyme A
hydratase domain containing 3 233305_at AF193756 EF-hand calcium
binding protein 1 216985_s_at AJ002077 syntaxin 3 214738_s_at
BE792298 NIMA (never in mitosis gene a)-related kinase 9 231789_at
AV722990 protocadherin beta 15 200841_s_at AI142677
glutamyl-prolyl-tRNA synthetase 204570_at NM_001864 cytochrome c
oxidase subunit VIIa polypeptide 1 (muscle) 226983_at AA626717 zinc
finger protein 777 212938_at M20776 collagen, type VI, alpha 1
230255_at AI936907 gamma-aminobutyric acid (GABA) A receptor, delta
211363_s_at AF109294 methylthioadenosine phosphorylase 219430_at
NM_020155 G protein-coupled receptor 137 210990_s_at U77706
laminin, alpha 4 205259_at NM_000901 nuclear receptor subfamily 3,
group C, member 2 217294_s_at U88968 enolase 1, (alpha) 211922_s_at
AY028632 catalase 204018_x_at NM_000558 hemoglobin, alpha 1 ///
hemoglobin, alpha 2 211823_s_at D86862 paxillin 219593_at NM_016582
solute carrier family 15, member 3 223143_s_at AI742378 chromosome
6 open reading frame 166 243347_at AW003107 -- 222896_at AA196034
transmembrane protein 38A 213767_at U43586 kinase suppressor of ras
1 206595_at NM_001323 cystatin E/M 203508_at NM_001066 tumor
necrosis factor receptor superfamily, member 1B 238125_at AI740544
ADAM metallopeptidase with thrombospondin type 1 motif, 16
209958_s_at AF095771 Bardet-Biedl syndrome 9 225800_at AI990891
JAZF zinc finger 1 233900_at U46120 Expressed unknown mRNA
238692_at AL040935 BTB (POZ) domain containing 11 201048_x_at
NM_002869 RAB6A, member RAS oncogene family 206390_x_at NM_002619
platelet factor 4 (chemokine (C--X--C motif) ligand 4) 210572_at
BC003126 protocadherin alpha 2 231881_at AU145225 caldesmon 1
1567274_at Z36814 -- 1555034_at AF482697 clarin 1 210587_at
BC005161 inhibin, beta E 210298_x_at AF098518 four and a half LIM
domains 1 209727_at M76477 GM2 ganglioside activator 213550_s_at
AA993683 transmembrane and coiled-coil domains 6 231013_at W80446
-- 213807_x_at BE870509 met proto-oncogene (hepatocyte growth
factor receptor) 206665_s_at NM_001191 BCL2-like 1 206882_at
NM_005071 solute carrier family 1 (high affinity
aspartate/glutamate transporter), member 6 1555716_a_at AY072911
coxsackie virus and adenovirus receptor 244852_at AU119545 dermatan
sulfate epimerase-like 211082_x_at Z25427 MAP/microtubule
affinity-regulating kinase 2 203726_s_at NM_000227 laminin, alpha 3
213928_s_at AI742626 HIV-1 Rev binding protein 217051_s_at AF257501
synovial sarcoma translocation, chromosome 18 206488_s_at NM_000072
CD36 molecule (thrombospondin receptor) 222508_s_at AU135021
hypothetical protein FLJ10154 211529_x_at M90684 HLA-G
histocompatibility antigen, class I, G 220108_at NM_004297 guanine
nucleotide binding protein (G protein), alpha 14 203676_at
NM_002076 glucosamine (N-acetyl)-6-sulfatase (Sanfilippo disease
IIID) 1558775_s_at AU142380 neutral sphingomyelinase (N-SMase)
activation associated factor 209555_s_at M98399 CD36 molecule
(thrombospondin receptor) 1561367_a_at BC035104 CDNA clone IMAGE:
5262438 211272_s_at AF064771 diacylglycerol kinase, alpha 80 kDa
217248_s_at AL365343 solute carrier family 7 (cationic amino acid
transporter, y+ system), member 8 201156_s_at AF141304 RAB5C,
member RAS oncogene family 211022_s_at BC002521 alpha
thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S.
cerevisiae) AFFX- AFFX- actin, beta HSAC07/X00351_5_at
HSAC07/X00351_5 218931_at NM_022449 RAB17, member RAS oncogene
family 240407_at AW450035 Homo sapiens, clone IMAGE: 5171705, mRNA
214505_s_at AF220153 four and a half LIM domains 1 213363_at
AW170549 Homo sapiens, clone IMAGE: 5244869, mRNA 1555724_s_at
BC010946 transgelin 230112_at AB037820 membrane-associated ring
finger (C3HC4) 4 209136_s_at BG390445 ubiquitin specific peptidase
10 203047_at NM_005990 serine/threonine kinase 10 227137_at N25937
Chromosome 10 open reading frame 46 212125_at NM_002883 Ran GTPase
activating protein 1 243409_at AI005407 forkhead box L1
1568646_x_at BC038199 zinc finger protein 208 217370_x_at S75762
fusion (involved in t(12; 16) in malignant liposarcoma) 87100_at
AI832249 abhydrolase domain containing 2 211016_x_at BC002526 heat
shock 70 kDa protein 4 241661_at AA001021 jumonji domain containing
1C 222611_s_at AA969958 paraspeckle component 1 210930_s_at
AF177761 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2,
neuro/glioblastoma derived oncogene homolog (avian) 213722_at
AW007161 SRY (sex determining region Y)-box 2 228901_at AI040910
Cyclin-dependent kinase 9 (CDC2-related kinase) 208850_s_at
AL558479 Thy-1 cell surface antigen 212574_x_at AC004528 chromosome
19 open reading frame 6 204952_at NM_014400 LY6/PLAUR domain
containing 3 204876_at NM_014699 zinc finger protein 646 213014_at
BG222394 mitogen-activated protein kinase 8 interacting protein 1
219928_s_at NM_012189 calcium binding tyrosine-(Y)-phosphorylation
regulated (fibrousheathin 2) 204895_x_at NM_004532 mucin 4, cell
surface associated 208275_x_at NM_003577 undifferentiated embryonic
cell transcription factor 1 200917_s_at BG474541 signal recognition
particle receptor (`docking protein`) 213643_s_at AK022846 inositol
polyphosphate-5-phosphatase, 75 kDa 232001_at AW193600 hypothetical
gene supported by AY007155 223828_s_at AF222694 lectin,
galactoside-binding, soluble, 12 (galectin 12) 210654_at AF021233
tumor necrosis factor receptor superfamily, member 10d, decoy with
truncated death domain 208721_s_at BF967271 anaphase promoting
complex subunit 5 206208_at NM_000717 carbonic anhydrase IV
1553535_a_at NM_002883 Ran GTPase activating protein 1 206531_at
NM_004647 D4, zinc and double PHD fingers family 1 1563719_a_at
AK024924 CDNA: FLJ21271 fis, clone COL01751 236731_at BF223086
leucine zipper protein pseudogene 1 1555337_a_at AF307097 zinc
finger protein 317 222936_s_at AF151904 chromosome 1 open reading
frame 121 209999_x_at AI056051 suppressor of cytokine signaling 1
1555730_a_at D00682 cofilin 1 (non-muscle) 1566764_at AL359055 MRNA
full length insert cDNA clone EUROIMAGE 2344436 215315_at AC003682
zinc finger protein 549 211019_s_at D63807 lanosterol synthase
(2,3-oxidosqualene-lanosterol cyclase) 226913_s_at BF527050 SRY
(sex determining region Y)-box 8 217569_x_at AA017093 -- 231146_at
AI300541 family with sequence similarity 24, member B 208478_s_at
NM_004324 BCL2-associated X protein 210892_s_at BC004472 general
transcription factor II, i 206100_at NM_001874 carboxypeptidase M
216926_s_at AC003030 KIAA0892 222511_x_at AW140098 Fas (TNFRSF6)
associated factor 1 202662_s_at NM_002223 inositol
1,4,5-triphosphate receptor, type 2 1552667_a_at NM_005489 SH2
domain containing 3C 228851_s_at AV726322 endosulfine alpha
AFFX-r2-Bs-dap-3_at AFFX-r2-Bs-phe-3 -- 206552_s_at NM_003182
tachykinin, precursor 1 (substance K, substance P,
neurokinin 1, neurokinin 2, neuromedin L, neurokinin alpha,
neuropeptide K, neuropeptide gamma) 233757_x_at AK026906 CDNA:
FLJ23253 fis, clone COL04706 213943_at X99268 twist homolog 1
(acrocephalosyndactyly 3; Saethre-Chotzen syndrome) (Drosophila)
209198_s_at BC004291 synaptotagmin XI 1553138_a_at NM_152363
ankyrin repeat domain 41 232915_at AW571715 DEAD (Asp-Glu-Ala-Asp)
box polypeptide 49 1560224_at BF327463 AT hook containing
transcription factor 1 239959_x_at AI147520 -- 211699_x_at AF349571
hemoglobin, alpha 1 /// hemoglobin, alpha 2 228261_at BE045549
mindbomb homolog 2 (Drosophila) 206617_s_at NM_002910 renin binding
protein 207402_at NM_003433 zinc finger protein 132 224539_s_at
AF152474 protocadherin alpha subfamily C, 2 240397_x_at AI801626
Transcribed locus 208894_at M60334 major histocompatibility
complex, class II, DR alpha 229566_at AA149250 similar to
WDNM1-like protein 238742_x_at AW302207 Transcribed locus
215236_s_at AV721177 phosphatidylinositol binding clathrin assembly
protein 210256_s_at U78576 phosphatidylinositol-4-phosphate
5-kinase, type I, alpha 1555639_a_at AF315633 RNA binding motif
protein 14 1566666_at AK074225 CDNA FLJ23645 fis, clone COL02691
211899_s_at AF082185 TNF receptor-associated factor 4 222387_s_at
BG476669 vacuolar protein sorting 35 homolog (S. cerevisiae)
1553694_a_at NM_002645 phosphoinositide-3-kinase, class 2, alpha
polypeptide 203348_s_at BF060791 ets variant gene 5 (ets-related
molecule) 213548_s_at BG257762 CDV3 homolog (mouse) 219656_at
NM_016580 protocadherin 12 241198_s_at BE645435 chromosome 11 open
reading frame 70 219878_s_at NM_015995 Kruppel-like factor 13
1556748_x_at AI476341 CDNA FLJ39784 fis, clone SPLEN2002314
1554988_at BC042592 solute carrier family 9, member 11 227071_at
AI762558 zinc finger protein 414 213926_s_at AI742626 HIV-1 Rev
binding protein 234971_x_at AI521584 phospholipase C, delta 3
219899_x_at NM_014434 NADPH dependent diflavin oxidoreductase 1
215774_s_at AV650470 -- 229339_at AI093327 Transcribed locus
238013_at BF347859 pleckstrin homology domain containing, family A
(phosphoinositide binding specific) member 2 214000_s_at AI744627
Regulator of G-protein signalling 10 203729_at NM_001425 epithelial
membrane protein 3 203085_s_at BC000125 transforming growth factor,
beta 1 1558689_a_at BG701300 hypothetical gene supported by
BC030123 211668_s_at K03226 plasminogen activator, urokinase
205457_at NM_024294 chromosome 6 open reading frame 106 202639_s_at
AI689052 RAN binding protein 3 211527_x_at M27281 vascular
endothelial growth factor A 207118_s_at NM_004659 matrix
metallopeptidase 23B /// matrix metallopeptidase 23A (pseudogene)
204560_at NM_004117 FK506 binding protein 5 232591_s_at AK022883
transmembrane protein 30A 236158_at R42281 Similar to KIAA1875
protein 230257_s_at AI264325 chromosome 1 open reading frame 19
230629_s_at AI809582 E1A binding protein p400 238969_at BF512162
chromosome 3 open reading frame 55 1569895_at BC016994 Homo
sapiens, clone IMAGE: 4401848, mRNA 1554544_a_at L18865 myelin
basic protein 229901_at AI056483 zinc finger protein 488
211051_s_at BC006363 exostoses (multiple)-like 3 236657_at AW014647
Full length insert cDNA YI37C01 202017_at NM_000120 epoxide
hydrolase 1, microsomal (xenobiotic) 229746_x_at BF439451 Homo
sapiens, clone IMAGE: 3885733, mRNA 205382_s_at NM_001928
complement factor D (adipsin) 222458_s_at AI205764 chromosome 1
open reading frame 108 1553565_s_at NM_012137 dimethylarginine
dimethylaminohydrolase 1 230809_at R45446 Transcribed locus
222363_at AW979018 Transcribed locus 217767_at NM_000064 similar to
Complement C3 precursor 221279_at NM_018972 ganglioside-induced
differentiation-associated protein 1 211087_x_at Z25432
mitogen-activated protein kinase 14 204994_at NM_002463 myxovirus
(influenza virus) resistance 2 (mouse) 225245_x_at BG386566 H2A
histone family, member J 243319_at AI274981 Transcribed locus
216252_x_at Z70519 Fas (TNF receptor superfamily, member 6)
215891_s_at X61094 GM2 ganglioside activator 238493_at AI559570
zinc finger protein 506 224169_at AF257210 neuropeptide FF receptor
2 232343_at AK022200 CDNA FLJ12138 fis, clone MAMMA1000331
1569039_s_at BC029855 zinc finger protein 677 201971_s_at NM_001690
ATPase, H+ transporting, lysosomal 70 kDa, V1 subunit A 211564_s_at
BC003096 PDZ and LIM domain 4 200869_at NM_000980 ribosomal protein
L18a /// similar to ribosomal protein L18a; 60S ribosomal protein
L18a 233297_s_at AL139377 hypothetical protein LOC728591
219058_x_at NM_022164 tubulointerstitial nephritis antigen-like 1
242762_s_at AA372349 KIAA1946 1552611_a_at AL555086 Janus kinase 1
(a protein tyrosine kinase) 1554660_a_at BC036200 chromosome 1 open
reading frame 71 236771_at AW511485 chromosome 6 open reading frame
159 221943_x_at AW303136 Ribosomal protein L38 221665_s_at BC004907
EPS8-like 1 205391_x_at M28880 ankyrin 1, erythrocytic 207678_s_at
NM_007017 SRY (sex determining region Y)-box 30 215728_s_at
AL031848 acyl-CoA thioesterase 7 224346_at AF116671 -- 205822_s_at
NM_002130 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1
(soluble) 241084_x_at BF062339 dynein, cytoplasmic 1, heavy chain 1
1554757_a_at AF273055 inositol polyphosphate-5-phosphatase, 40 kDa
222542_x_at BF724826 chaperone, ABC1 activity of bc1 complex
homolog (S. pombe) 206749_at NM_001764 CD1b molecule 219558_at
NM_024524 ATPase type 13A3 240703_s_at AW591969 hect (homologous to
the E6-AP (UBE3A) carboxyl terminus) domain and RCC1 (CHC1)-like
domain (RLD) 1 231805_at AL563031 prolactin releasing hormone
receptor 232566_at AK026258 nucleolar protein family 6
(RNA-associated) 228683_s_at AI925361 potassium channel
tetramerisation domain containing 15 235271_s_at BG027325 zinc
finger protein 397 214300_s_at AI676092 topoisomerase (DNA) III
alpha 220472_at NM_014150 zinc finger, CCHC domain containing 4
214992_s_at AD000092 deoxyribonuclease II, lysosomal 236491_at
AI813346 BCL2-like 10 (apoptosis facilitator) 208474_at NM_021195
claudin 6 76897_s_at AA628140 FK506 binding protein 15, 133 kDa
238461_at AA228031 eukaryotic translation initiation factor 4E
family member 3 223567_at AB022433 sema domain, transmembrane
domain (TM), and cytoplasmic domain, (semaphorin) 6B 214975_s_at
AK001816 myotubularin related protein 1 217399_s_at AF032887
forkhead box O3 208879_x_at BG469030 PRP6 pre-mRNA processing
factor 6 homolog (S. cerevisiae) 1558662_s_at BG200452 B-cell
scaffold protein with ankyrin repeats 1 1552367_a_at AF276507
scinderin 201367_s_at AI356398 zinc finger protein 36, C3H
type-like 2 215719_x_at X83493 Fas (TNF receptor superfamily,
member 6) 200601_at U48734 actinin, alpha 4 210620_s_at BC000212
general transcription factor IIIC, polypeptide 2, beta 110 kDa
1554321_a_at BC018471 NFS1 nitrogen fixation 1 homolog (S.
cerevisiae) 210932_s_at AF293342 ring finger protein (C3H2C3 type)
6 211020_at L19659 glucosaminyl (N-acetyl) transferase 2,
I-branching enzyme (I blood group) 231698_at AV661152 hypothetical
LOC647115 216205_s_at AK021947 mitofusin 2 227316_at AI761798 CSRP2
binding protein 1555814_a_at AF498970 ras homolog gene family,
member A 235728_at AA845646 zinc finger protein 3 homolog (mouse)
238542_at AA831769 UL16 binding protein 2 238795_at AA424537
chromosome 10 open reading frame 18 213713_s_at R48779 hypothetical
protein BC008326 219703_at NM_018365 meiosis-specific nuclear
structural 1 205186_at NM_003462 dynein, axonemal, light
intermediate chain 1 225294_s_at BG340967 trafficking protein
particle complex 1 224505_s_at BC006355 phospholipase C, delta 4
203626_s_at NM_005983 S-phase kinase-associated protein 2 (p45)
217448_s_at AL117508 TOX high mobility group box family member 4
/// similar to Epidermal Langerhans cell protein LCP1 237206_at
AI452798 myocardin 210413_x_at U19557 serpin peptidase inhibitor,
clade B (ovalbumin), member 4 214190_x_at AI799984 golgi
associated, gamma adaptin ear containing, ARF binding protein 2
205924_at BC005035 RAB3B, member RAS oncogene family 242660_at
AA846789 chromosome 10 open reading frame 112 1555197_a_at AY039243
chromosome 21 open reading frame 58 225369_at AL573851 endothelial
cell adhesion molecule 238025_at AA706818 mixed lineage kinase
domain-like 235358_at AW961205 hypothetical protein LOC728485
1554628_at BC028974 zinc finger protein 57 1565347_s_at AY034078
transcription factor binding to IGHM enhancer 3 219168_s_at
NM_017701 proline rich 5 (renal) 212154_at AI380298 syndecan 2
1569486_at BC035176 CDNA clone IMAGE: 5266012 206847_s_at AF026397
homeobox A7 218260_at NM_024050 chromosome 19 open reading frame 58
1554466_a_at BC007207 chromosome 16 open reading frame 13
241611_s_at BE675600 fibronectin type III domain containing 3A
215876_at AK022254 CDNA FLJ12192 fis, clone MAMMA1000851
200756_x_at U67280 calumenin 237211_x_at AA860341 MORN repeat
containing 3 216501_at U25801 Vac14 homolog (S. cerevisiae)
207664_at NM_001464 ADAM metallopeptidase domain 2 (fertilin beta)
217465_at AK001291 NCK-associated protein 1 235136_at BF337528
ORM1-like 3 (S. cerevisiae) 201171_at NM_003945 ATPase, H+
transporting, lysosomal 9 kDa, V0 subunit e1 203892_at NM_006103
WAP four-disulfide core domain 2 218810_at NM_025079 zinc finger
CCCH-type containing 12A 241574_s_at H93038 Insulin-like growth
factor 2 mRNA binding protein 1 211811_s_at AF152484 protocadherin
alpha 6 210457_x_at AF176039 high mobility group AT-hook 1
208430_s_at NM_001390 dystrobrevin, alpha AFFX- AFFX- signal
transducer and activator of transcription 1, 91 kDa
HUMISGF3A/M97935_5_at HUMISGF3A/M97935_5 223631_s_at AF213678
chromosome 19 open reading frame 33 1555733_s_at AF393369
adaptor-related protein complex 1, sigma 3 subunit 209208_at
AF059752 mannose-P-dolichol utilization defect 1 206917_at
NM_006572 guanine nucleotide binding protein (G protein), alpha 13
213160_at D86964 dedicator of cytokinesis 2 236058_at AA573775
chromosome 1 open reading frame 172 217270_s_at AC005393
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B
1558015_s_at BU175810 ARP2 actin-related protein 2 homolog (yeast)
227971_at AI653107 Nik related kinase 204284_at N26005 protein
phosphatase 1, regulatory (inhibitor) subunit 3C 210421_s_at
AB014602 solute carrier family 24 (sodium/potassium/calcium
exchanger), member 1 220892_s_at NM_021154 phosphoserine
aminotransferase 1 221762_s_at AL162458 chromosome 20 open reading
frame 67 230926_s_at AW452022 outer dense fiber of sperm tails
2-like 210079_x_at U16953 potassium voltage-gated channel,
shaker-related subfamily, beta member 1 202859_x_at NM_000584
interleukin 8 37549_g_at U87408 Bardet-Biedl syndrome 9 224321_at
AB004064 transmembrane protein with EGF-like and two
follistatin-like domains 2 210828_s_at AF001307 aryl hydrocarbon
receptor nuclear translocator 222406_s_at AV738970 proline-rich
nuclear receptor coactivator 2 222419_x_at AW205983
ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) 207686_s_at
NM_001228 caspase 8, apoptosis-related cysteine peptidase
213597_s_at BF002474 CTD (carboxy-terminal domain, RNA polymerase
II, polypeptide A) small phosphatase-like 202226_s_at NM_016823
v-crk sarcoma virus CT10 oncogene homolog (avian) 221048_x_at
NM_017941 chromosome 17 open reading frame 80 1553191_at NM_020388
dystonin 213087_s_at BF690020 CDNA clone IMAGE: 4838699
1554327_a_at AF328554 calcium activated nucleotidase 1 233298_at
AL139377 spermatogenesis and oogenesis specific basic
helix-loop-helix 2 /// hypothetical protein LOC728591 223393_s_at
AL136805 teashirt zinc finger homeobox 3 240983_s_at AW292273
cysteinyl-tRNA synthetase 226905_at BG036514 family with sequence
similarity 101, member B 212797_at BE742268 sortilin 1 209719_x_at
U19556 serpin peptidase inhibitor, clade B (ovalbumin), member 3
221364_at NM_001510 glutamate receptor, ionotropic, delta 2
1552641_s_at NM_031921 ATPase family, AAA domain containing 3A ///
ATPase family, AAA domain containing 3B /// similar to ATPase
family, AAA domain containing 3A /// similar to AAA-ATPase TOB3
222501_s_at BE674760 replication initiator 1 1552477_a_at BC014852
interferon regulatory factor 6 222711_s_at AI761828 rhomboid 5
homolog 1 (Drosophila)
1552528_at NM_058189 chromosome 21 open reading frame 69 232498_at
AK023386 hypothetical protein KIAA1833 226876_at AI961778 family
with sequence similarity 101, member B 230747_s_at AA406435
Chromosome 18 open reading frame 17 201979_s_at NM_006247 protein
phosphatase 5, catalytic subunit 210869_s_at M29277 melanoma cell
adhesion molecule 237911_at BF057809 Transcribed locus 215037_s_at
U72398 BCL2-like 1 AFFX-DapX-5_at AFFX-DapX-5 -- 217211_at D50604
similar to cytoplasmic beta-actin 214014_at W81196 CDC42 effector
protein (Rho GTPase binding) 2 230517_at AI416964 similar to
GLI-Kruppel family member HKR1 1563312_at BI603681 CDNA clone
IMAGE: 5302682 206024_at NM_002150 4-hydroxyphenylpyruvate
dioxygenase 1552610_a_at NM_002227 Janus kinase 1 (a protein
tyrosine kinase) 224279_s_at AF295039 calcium binding
tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2) 220426_at
NM_024059 chromosome 20 open reading frame 195 1553105_s_at
NM_001943 desmoglein 2 234688_x_at AF141344 centrobin, centrosomal
BRCA2 interacting protein 210022_at BC004952 polycomb group ring
finger 1 226306_at BF984592 chromosome 6 open reading frame 1
203771_s_at AA740186 biliverdin reductase A 201465_s_at BC002646
jun oncogene 216549_s_at AL096712 TBC1 domain family, member 22B
1553229_at NM_152412 zinc finger protein 572 205065_at AU130282 --
224301_x_at BC003602 H2A histone family, member J 223616_at
BC005368 zinc finger protein 649 209629_s_at AF201942 nuclear
transport factor 2-like export factor 2 224037_at AF132198 --
91826_at AI219073 EPS8-like 1 227841_at BG260181 Cementum protein 1
216641_s_at U58994 ladinin 1 217300_at U80771 -- 1552649_a_at
NM_057178 ring finger and FYVE-like domain containing 1 221220_s_at
NM_017988 SCY1-like 2 (S. cerevisiae) 229296_at AI659477 CDNA
FLJ34873 fis, clone NT2NE2014950 212003_at BG171020 chromosome 1
open reading frame 144 218922_s_at NM_024552 LAG1 homolog, ceramide
synthase 4 237872_at AI026919 Transcribed locus 209373_at BC003179
mal, T-cell differentiation protein-like 224795_x_at AW575927
immunoglobulin kappa constant /// immunoglobulin kappa variable 1-5
/// immunoglobulin kappa variable 2-24 203065_s_at NM_001753
caveolin 1, caveolae protein, 22 kDa 239623_at N93197 hypothetical
gene supported by AK126569 231243_s_at R93946 basic
helix-loop-helix domain containing, class B, 3 234730_s_at AP001743
receptor-interacting serine-threonine kinase 4 228881_at N30347
presenilin associated, rhomboid-like 231723_at NM_013346 sorting
nexin 12 205462_s_at NM_002149 hippocalcin-like 1 200628_s_at
M61715 tryptophanyl-tRNA synthetase 230404_at AI418538 --
1563809_a_at AK094768 MCF.2 cell line derived transforming
sequence-like 204470_at NM_001511 chemokine (C--X--C motif) ligand
1 (melanoma growth stimulating activity, alpha) 205210_at NM_004257
transforming growth factor, beta receptor associated protein 1
228634_s_at BF195718 Cold shock domain protein A 210971_s_at
AB000815 aryl hydrocarbon receptor nuclear translocator-like
243358_at BF347362 insulin-like growth factor 1 receptor
1561039_a_at BC039609 zinc finger protein 81 222509_s_at BG490634
zinc finger protein 672 1552717_s_at NM_153243 centrosomal protein
170 kDa /// centrosomal protein 170 kDa-like 221754_s_at AI341234
coronin, actin binding protein, 1B 234920_at AK022466 Zinc finger
protein 7 242571_at AW962020 RALBP1 associated Eps domain
containing 2 222085_at AW452357 Hypothetical gene supported by
AK075564; BC060873 1553697_at NM_145257 chromosome 1 open reading
frame 96 1555830_s_at BC001224 family with sequence similarity 62
(C2 domain containing) member B 217010_s_at AF277724 cell division
cycle 25 homolog C (S. pombe) 214845_s_at AF257659 calumenin
218537_at NM_017885 host cell factor C1 regulator 1 (XPO1
dependent) 202790_at NM_001307 claudin 7 1559528_at BC040652
Polycomb group ring finger 3 1567105_at AF362887 -- 211772_x_at
BC006114 cholinergic receptor, nicotinic, alpha 3 219270_at
NM_024111 ChaC, cation transport regulator homolog 1 (E. coli)
207087_x_at NM_020478 ankyrin 1, erythrocytic 213714_at AI040163
calcium channel, voltage-dependent, beta 2 subunit 215649_s_at
AF217536 mevalonate kinase (mevalonic aciduria) 204638_at NM_001611
acid phosphatase 5, tartrate resistant 228208_x_at AL134573
Hypothetical LOC645944 239664_at H18857 Transcribed locus 215585_at
AK024081 KIAA0174 211613_s_at U79250 glycerol-3-phosphate
dehydrogenase 2 (mitochondrial) 214903_at AF070580 synaptotagmin II
1566472_s_at AK098125 retinol saturase (all-trans-retinol
13,14-reductase) 234155_at AK024928 CDNA: FLJ21275 fis, clone
COL01827 243952_at BF000009 TPTE pseudogene 210994_x_at AF230398
tripartite motif-containing 23 205810_s_at NM_003941
Wiskott-Aldrich syndrome-like 210455_at AF050198 chromosome 10 open
reading frame 28 211672_s_at AF019888 actin related protein 2/3
complex, subunit 4, 20 kDa 233827_s_at AK024072 suppressor of Ty 16
homolog (S. cerevisiae) 201621_at NM_005380 neuroblastoma,
suppression of tumorigenicity 1 1560020_at BC043583 DnaJ (Hsp40)
homolog, subfamily C, member 13 202290_at NM_014891 PDGFA
associated protein 1 216271_x_at AC004794 synapse defective 1, Rho
GTPase, homolog 1 (C. elegans) 210933_s_at BC004908 fascin homolog
1, actin-bundling protein (Strongylocentrotus purpuratus)
1555569_a_at BC042482 potassium channel tetramerisation domain
containing 7 221889_at AW026481 potassium channel tetramerisation
domain containing 13 37547_at U85995 Bardet-Biedl syndrome 9
205117_at X59065 fibroblast growth factor 1 (acidic) 201122_x_at
BC000751 eukaryotic translation initiation factor 5A 233638_s_at
AK026430 protein O-linked mannose
beta1,2-N-acetylglucosaminyltransferase 221035_s_at NM_031272
testis expressed 14 223318_s_at BC004393 alkB, alkylation repair
homolog 7 (E. coli) 1555609_a_at AF355465 zinc finger, matrin type
3 232675_s_at BG149850 uridine-cytidine kinase 1-like 1
1555220_a_at AB040820 aldo-keto reductase family 1, member C-like 2
220246_at NM_020397 calcium/calmodulin-dependent protein kinase ID
206943_at NM_004612 transforming growth factor, beta receptor I
(activin A receptor type II-like kinase, 53 kDa) 202779_s_at
NM_014501 ubiquitin-conjugating enzyme E2S /// similar to
Ubiquitin-conjugating enzyme E2S (Ubiquitin-conjugating enzyme
E2-24 kDa) (Ubiquitin-protein ligase) (Ubiquitin carrier protein)
(E2-EPF5) 206336_at NM_002993 chemokine (C--X--C motif) ligand 6
(granulocyte chemotactic protein 2) 210405_x_at AF153687 tumor
necrosis factor receptor superfamily, member 10b 1554339_a_at
BC038953 component of oligomeric golgi complex 3 209062_x_at
AF010227 nuclear receptor coactivator 3 234992_x_at BG170335
epithelial cell transforming sequence 2 oncogene 1557637_at
BC038734 CDNA clone IMAGE: 5267718 217711_at BF594294 TEK tyrosine
kinase, endothelial (venous malformations, multiple cutaneous and
mucosal) 1553351_at NM_130901 OTU domain containing 7A 61734_at
AI797684 reticulocalbin 3, EF-hand calcium binding domain
203994_s_at U84569 chromosome 21 open reading frame 2 1565162_s_at
D16947 microsomal glutathione S-transferase 1 231011_at AI339785 La
ribonucleoprotein domain family, member 2 206209_s_at NM_000717
carbonic anhydrase IV 209722_s_at L40378 serpin peptidase
inhibitor, clade B (ovalbumin), member 9 214369_s_at AI688812 RAS
guanyl releasing protein 2 (calcium and DAG-regulated) 205390_s_at
NM_000037 ankyrin 1, erythrocytic 204188_s_at M57707 retinoic acid
receptor, gamma 232132_at AB043635 par-6 partitioning defective 6
homolog gamma (C. elegans) 1552389_at NM_173549 chromosome 8 open
reading frame 47 211911_x_at L07950 major histocompatibility
complex, class I, B 231402_at AI830201 Transcribed locus, strongly
similar to XP_531081.2 hypothetical protein [Pantroglodytes]
215913_s_at AK023668 GULP, engulfment adaptor PTB domain containing
1 213426_s_at AA150110 Caveolin 2 233543_s_at AK021582 coiled-coil
domain containing 98 201559_s_at AF109196 chloride intracellular
channel 4 241168_at AV651242 Transcribed locus 216710_x_at AL359578
zinc finger protein 287 1555006_at BC036233 WD repeat domain 66
207453_s_at NM_012266 DnaJ (Hsp40) homolog, subfamily B, member 5
217234_s_at AF199015 villin 2 (ezrin) 214446_at NM_012081
elongation factor, RNA polymerase II, 2 209372_x_at BF971587
tubulin, beta 2A /// tubulin, beta 2B 218261_at NM_005498
adaptor-related protein complex 1, mu 2 subunit 217445_s_at
AF008655 phosphoribosylglycinamide formyltransferase,
phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole
synthetase 205595_at NM_001944 desmoglein 3 (pemphigus vulgaris
antigen) 233669_s_at AA868267 tripartite motif-containing 54
1559028_at BC037172 chromosome 21 open reading frame 15 1561330_at
BC039098 desmoglein 4 1562080_at AK057351 CDNA FLJ32789 fis, clone
TESTI2002326 234976_x_at BG324504 Solute carrier family 4, sodium
bicarbonate cotransporter, member 5 234085_at AL139377
spermatogenesis and oogenesis specific basic helix-loop-helix 2 ///
hypothetical protein LOC728591 208067_x_at NM_007125 ubiquitously
transcribed tetratricopeptide repeat gene, Y-linked 231957_s_at
AC005594 dipeptidyl-peptidase 9 1562244_at AL833487 MRNA; cDNA
DKFZp686H1629 (from clone DKFZp686H1629) 227488_at AV728999
hypothetical protein MGC16121 239407_at AI793248 CDNA clone IMAGE:
4837199 207540_s_at NM_003177 spleen tyrosine kinase 1557984_s_at
BI464019 RNA polymerase II associated protein 3 208608_s_at
NM_021021 syntrophin, beta 1 (dystrophin-associated protein A1, 59
kDa, basic component 1) 1554795_a_at BC019895 filamin binding LIM
protein 1 209950_s_at BC004300 villin-like 1558809_s_at AK094324
hypothetical protein LOC284408 225333_at AI218383 zinc finger
protein 496 204522_at NM_005510 dom-3 homolog Z (C. elegans)
218154_at NM_024736 gasdermin domain containing 1 201060_x_at
AI537887 stomatin 201012_at NM_000700 annexin A1 220889_s_at
NM_020178 carbonic anhydrase X 217729_s_at NM_001130 amino-terminal
enhancer of split 211187_at AF118079 -- 231396_s_at AA776721 family
with sequence similarity 126, member A AFFX-LysX-M_at AFFX-LysX-5
-- 222678_s_at BF057821 DCN1, defective in cullin neddylation 1,
domain containing 1 (S. cerevisiae) 220234_at NM_004056 carbonic
anhydrase VIII 1553962_s_at BI668074 ras homolog gene family,
member B 207950_s_at NM_001149 ankyrin 3, node of Ranvier (ankyrin
G) 221981_s_at AA702154 WD repeat domain 59 1568593_a_at CA431328
nudix (nucleoside diphosphate linked moiety X)-type motif 16
pseudogene 223321_s_at AF312678 fibroblast growth factor
receptor-like 1 206042_x_at NM_022804 small nuclear
ribonucleoprotein polypeptide N /// SNRPN upstream reading frame
210334_x_at AB028869 baculoviral IAP repeat-containing 5 (survivin)
216591_s_at AF080579 succinate dehydrogenase complex, subunit C,
integral membrane protein, 15 kDa /// hCG1776980 210206_s_at U33833
DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 (CHL1-like helicase
homolog, S. cerevisiae) 226786_at BF507952 regulatory factor X, 1
(influences HLA class II expression) 211561_x_at L35253
mitogen-activated protein kinase 14 211796_s_at AF043179 T cell
receptor beta variable 19 /// T cell receptor beta variable 7-2 ///
T cell receptor beta variable 5-4 /// T cell receptor beta variable
3-1 /// T cell receptor beta constant 1 216493_s_at AL023775
insulin-like growth factor 2 mRNA binding protein 3 /// similar to
insulin-like growth factor 2 mRNA binding protein 3 /// similar to
IGF-II mRNA-binding protein 3 230309_at BE876610 Transcribed locus
204806_x_at NM_018950 major histocompatibility complex, class I, F
205369_x_at J03208 dihydrolipoamide branched chain transacylase E2
1556165_at AK057525 CDNA FLJ32963 fis, clone TESTI2008405 215047_at
AL080170 tripartite motif-containing 58 225454_at AW248770
coiled-coil domain containing 124 1552480_s_at NM_080923 protein
tyrosine phosphatase, receptor type, C 205388_at NM_003279 troponin
C type 2 (fast) 218510_x_at AI816291 family with sequence
similarity 134, member B 1553685_s_at NM_138473 Sp1 transcription
factor 228672_at AI971618 inhibitor of growth family, member 5
205377_s_at AI190022 acetylcholinesterase (Yt blood group)
230633_at AI285730 transmembrane protein 102 207704_s_at NM_003644
growth arrest-specific 7 215668_s_at AJ011414 plexin B1 212107_s_at
BE561014 DEAH (Asp-Glu-Ala-His) box polypeptide 9 237282_s_at
AW137676 A kinase (PRKA) anchor protein 14
220285_at NM_016014 family with sequence similarity 108, member B1
207979_s_at NM_004931 CD8b molecule 226937_at BF110844 Cardiolipin
synthase 1 226051_at BF973568 selenoprotein M 212272_at AA813260
lipin 1 229881_at R41200 Kruppel-like factor 12 217524_x_at
AA018923 Transcribed locus 1559409_a_at BE893129 KIAA1345 protein
238480_at AI871745 Chromosome 18 open reading frame 50 1553042_a_at
NM_032721 T-cell activation NFKB-like protein 221418_s_at NM_005481
mediator complex subunit 16 202465_at NM_002593 procollagen
C-endopeptidase enhancer 231004_s_at BE219961 H1 histone family,
member X 242552_x_at AW274047 zinc finger, BED-type containing 5
238699_s_at AI659225 calcium/calmodulin-dependent serine protein
kinase (MAGUK family) 242162_at AA904430 WD repeat domain 69
207379_at NM_005711 EGF-like repeats and discoidin I-like domains 3
211513_s_at AF172449 opioid growth factor receptor 216981_x_at
X60502 sialophorin (leukosialin, CD43) 243938_x_at AI872645 dynein,
axonemal, heavy chain 5 211027_s_at BC006231 inhibitor of kappa
light polypeptide gene enhancer in B-cells, kinase beta 231354_at
AW510748 hypothetical LOC780529 232984_at AL137259 hydrocephalus
inducing homolog (mouse) 1554464_a_at BC008745 cartilage associated
protein 223661_at AF130080 -- 224282_s_at AB040138
1-acylglycerol-3-phosphate O-acyltransferase 3 214520_at NM_005251
forkhead box C2 (MFH-1, mesenchyme forkhead 1) 1569076_a_at
BE791720 FLJ16287 protein 210585_s_at AF007748 transportin 2
(importin 3, karyopherin beta 2b) 211599_x_at U19348 met
proto-oncogene (hepatocyte growth factor receptor) 221051_s_at
NM_014446 integrin beta 1 binding protein 3 217246_s_at L22650
diaphanous homolog 2 (Drosophila) 221623_at AF229053 brevican
238420_at AV721958 CDNA clone IMAGE: 5263531 1558643_s_at AA297258
EGF-like repeats and discoidin I-like domains 3 211266_s_at U35399
G protein-coupled receptor 4 208851_s_at AL161958 Thy-1 cell
surface antigen 220102_at NM_023067 forkhead box L2 214878_at
AU118165 zinc finger protein 37A /// zinc finger protein 37B
204480_s_at NM_024112 chromosome 9 open reading frame 16
1558247_s_at BC021210 hypothetical protein BC018697 206696_at
NM_000273 G protein-coupled receptor 143 1560316_s_at N32168
glucocorticoid induced transcript 1 203990_s_at AI140752
ubiquitously transcribed tetratricopeptide repeat, X chromosome
221638_s_at AF008937 syntaxin 16 230146_s_at BF111850 frequenin
homolog (Drosophila) 231151_at AL122010 discs, large (Drosophila)
homolog-associated protein 3 233767_at AU148706 CDNA FLJ12557 fis,
clone NT2RM4000783 211681_s_at AF116705 PDZ and LIM domain 5
225088_at BG546917 chromosome 16 open reading frame 63 203234_at
NM_003364 uridine phosphorylase 1 202028_s_at BC000603 ribosomal
protein L38 200954_at NM_001694 ATPase, H+ transporting, lysosomal
16 kDa, V0 subunit c 211317_s_at AF041461 CASP8 and FADD-like
apoptosis regulator 208729_x_at D83043 major histocompatibility
complex, class I, B 206486_at NM_002286 lymphocyte-activation gene
3 1558093_s_at BI832461 matrin 3 /// similar to Matrin-3 (Nuclear
scaffold protein P130/MAT3) 204149_s_at NM_000850 glutathione
S-transferase M4 1555942_a_at AK091113 NPC-A-5 1555202_a_at
BC010136 hypothetical protein FLJ10656 231721_at AF356518
junctional adhesion molecule 3 224127_at AF116660 -- 224241_s_at
BC002350 -- 216788_at AK025564 CDNA: FLJ21911 fis, clone HEP03855
228371_s_at BF196007 -- 221440_s_at NM_006606 retinoblastoma
binding protein 9 220585_at NM_025130 hexokinase domain containing
1 229439_s_at AI830823 RNA-binding protein 206026_s_at NM_007115
tumor necrosis factor, alpha-induced protein 6 209086_x_at BE964361
melanoma cell adhesion molecule 229440_at AI830823 RNA-binding
protein 221875_x_at AW514210 major histocompatibility complex,
class I, F 1557918_s_at AU131482 solute carrier family 16, member 1
(monocarboxylic acid transporter 1) 244735_at AI377758 coiled-coil
domain containing 54 227358_at Z39566 zinc finger and BTB domain
containing 46 224252_s_at AF177940 FXYD domain containing ion
transport regulator 5 206025_s_at AW188198 tumor necrosis factor,
alpha-induced protein 6 203953_s_at BE791251 claudin 3 231341_at
BE670584 solute carrier family 35, member D3 213211_s_at AI005317
TAF6-like RNA polymerase II, p300/CBP-associated factor
(PCAF)-associated factor, 65 kDa 226988_s_at AI709055 myosin, heavy
chain 14 208677_s_at AL550657 basigin (Ok blood group) 234625_at
AK025055 CDNA: FLJ21402 fis, clone COL03734 206769_at NM_004202
thymosin, beta 4, Y-linked 229432_at AV696264 N-acetylglutamate
synthase 242338_at BG535396 transmembrane protein 64 1554029_a_at
BC030966 KIAA0372 202793_at NM_005768 membrane bound
O-acyltransferase domain containing 5 210449_x_at AF100544
mitogen-activated protein kinase 14 244171_at AW505004 muskelin 1,
intracellular mediator containing kelch motifs 238848_at BF750565
OTU domain containing 4 221354_s_at NM_005297 melanin-concentrating
hormone receptor 1 204431_at NM_003260 transducin-like enhancer of
split 2 (E(sp1) homolog, Drosophila) 206491_s_at NM_003827
N-ethylmaleimide-sensitive factor attachment protein, alpha
217371_s_at Y09908 interleukin 15 204891_s_at NM_005356
lymphocyte-specific protein tyrosine kinase 200948_at NM_005439
myeloid leukemia factor 2 237806_s_at AI684717 Hypothetical protein
LOC729296 203849_s_at BG473130 kinesin family member 1A 211514_at
AF068286 receptor interacting protein kinase 5 234724_x_at AF152528
protocadherin beta 18 pseudogene 213665_at AI989477 SRY (sex
determining region Y)-box 4 1552736_a_at NM_138966 neuropilin (NRP)
and tolloid (TLL)-like 1 211088_s_at Z25433 polo-like kinase 4
(Drosophila) 1554576_a_at BC007242 ets variant gene 4 (E1A enhancer
binding protein, E1AF) 243323_s_at AI872979 AT-binding
transcription factor 1 220354_at NM_025266 hypothetical protein
MGC2780 223821_s_at BC004888 sushi domain containing 4 200824_at
NM_000852 glutathione S-transferase pi 227619_at BF195628 Werner
helicase interacting protein 1 201428_at NM_001305 claudin 4
215984_s_at AL121845 ADP-ribosylation factor related protein 1
206396_at NM_004170 solute carrier family 1 (neuronal/epithelial
high affinity glutamate transporter, system Xag), member 1
229406_at AI674243 hypothetical protein LOC146713 243936_x_at
T85061 -- 215495_s_at AL117523 sterile alpha motif domain
containing 4A 224003_at AF332243 testis-specific transcript,
Y-linked 14 230102_at AW206458 Ets variant gene 5 (ets-related
molecule) 203267_s_at BF223206 developmentally regulated GTP
binding protein 2 236940_at W60647 Transcribed locus, weakly
similar to NP_066953.1 isomerase A isoform 1 [Homo sapiens]
202002_at AW072302 acetyl-Coenzyme A acyltransferase 2
(mitochondrial 3-oxoacyl-Coenzyme A thiolase) 1560228_at BC041461
snail homolog 3 (Drosophila) 221317_x_at NM_018939 protocadherin
beta 6 217552_x_at AI432713 complement component (3b/4b) receptor 1
(Knops blood group) 214279_s_at W74452 NDRG family member 2
208629_s_at BG472176 hydroxyacyl-Coenzyme A
dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl- Coenzyme A
hydratase (trifunctional protein), alpha subunit
TABLE-US-00032 TABLE 14 Genes Expressed at a 2 fold or Greater
Level in hES Cell Lines versus iPS Cell Lines (p .ltoreq. 0.01)
Systematic Name Genbank Description 234626_at AF137396 olfactory
receptor, family 51, subfamily I, member 1 211006_s_at L02840
potassium voltage-gated channel, Shab-related subfamily, member 1
228239_at AA148789 chromosome 21 open reading frame 51 233583_at
AA608889 Transcribed locus 205911_at NM_000316 parathyroid hormone
receptor 1 217715_x_at BE045142 -- 1566477_at AL832530 MRNA; cDNA
DKFZp547F1316 (from clone DKFZp547F1316) 205693_at NM_006757
troponin T type 3 (skeletal, fast) 215406_at AK024860 CDNA:
FLJ21207 fis, clone COL00362 1564121_at AK026788 CDNA: FLJ23135
fis, clone LNG08666 220002_at NM_018012 kinesin family member 26B
233939_at AL117522 REX1, RNA exonuclease 1 homolog (S. cerevisiae)
210382_at U13989 secretin receptor 220596_at NM_015590 G patch
domain containing 4 208448_x_at NM_002173 interferon, alpha 16
231670_at AA057519 -- 223472_at AF071594 Wolf-Hirschhorn syndrome
candidate 1 1554542_at BC025747 similar to CG4995 gene product
1559623_at CA446227 Chromosome 11 open reading frame 54 1562036_at
BC043279 CDNA clone IMAGE: 5297259 229817_at AI452715 zinc finger
protein 608 234674_at AK027027 CDNA: FLJ23374 fis, clone HEP16126
242628_at AA194956 Transcribed locus 243081_at AA824282 CDNA clone
IMAGE: 5296106 1553721_at NM_173557 ring finger protein 152
239200_at BE503484 Transcribed locus 226286_at AI686411 RNA binding
motif and ELMO/CED-12 domain 1 1558570_at AK096657 hypothetical
protein LOC145783 1566204_at AL589610 CDNA FLJ35929 fis, clone
TESTI2010833 233608_at AU146417 CDNA FLJ11929 fis, clone
HEMBB1000434 217070_at AJ249275 5,10-methylenetetrahydrofolate
reductase (NADPH) 220577_at NM_025006 GTPase, very large interferon
inducible 1 220491_at NM_021175 hepcidin antimicrobial peptide
242398_x_at AA605121 Transcribed locus 237168_at AA708016
Transcribed locus 1556638_at AI250939 hypothetical protein
LOC284530 216928_at X51990 T-cell acute lymphocytic leukemia 1
209639_s_at AF030111 regulator of G-protein signaling 12 1561255_at
BC040329 CDNA clone IMAGE: 4827712 233164_x_at AK026955 rhomboid
domain containing 1 236038_at N50714 Transcribed locus 238126_at
AA886236 CDNA clone IMAGE: 4791585 243942_at AI400012 Transcribed
locus 1568978_s_at BM547346 chromosome 11 open reading frame 21
1566672_at AK093656 CDNA FLJ36337 fis, clone THYMU2006324 237663_at
AI681941 Transcribed locus 237151_s_at BF433885 similar to
hypothetical protein 212616_at BF668950 chromodomain helicase DNA
binding protein 9 231792_at AF325549 myosin light chain kinase 2,
skeletal muscle 1555554_at AY180924 breast cancer and salivary
gland expression gene 1553512_at NM_173860 homeobox C12 211483_x_at
AF081924 calcium/calmodulin-dependent protein kinase (CaM kinase)
II beta 1565588_at BG708117 SP140 nuclear body protein 1559240_at
AA811339 -- 230802_at AI761947 Rho GTPase activating protein 24
213369_at AI825832 protocadherin 21 235724_at AW513684 Acyl-CoA
synthetase short-chain family member 1 238279_x_at BF062155 --
1569167_at BC013250 Homo sapiens, clone IMAGE: 3867502, mRNA
208559_at NM_013311 pancreatic and duodenal homeobox 1 217122_s_at
AL031282 solute carrier family 35, member E2 /// similar to solute
carrier family 35, member E2 234108_at AF264628 taste receptor,
type 2, member 45 229480_at AI341053 MRNA; cDNA DKFZp686I18116
(from clone DKFZp686I18116) 240623_at BF589421 Transcribed locus
224519_at BC006438 CDNA clone MGC: 13162 IMAGE: 3010103 221456_at
NM_016943 taste receptor, type 2, member 3 236728_at AW070437
leucyl/cystinyl aminopeptidase 219839_x_at NM_012468 T-cell
leukemia/lymphoma 6 238894_at AW665144 Transcribed locus 231276_at
BF591245 Phosphodiesterase 3B, cGMP-inhibited 1552732_at AL832152
actin-binding Rho activating protein 210292_s_at AF332218
protocadherin 11 X-linked /// protocadherin 11 Y-linked 230354_at
BG236273 Transcribed locus 1557208_at AA609739 hypothetical protein
LOC219731 240305_at AI291536 CDNA clone IMAGE: 5285563 233075_at
AF071178 hect domain and RLD 2 pseudogene 7 226134_s_at AI978754
Transcribed locus 235796_at AI927957 Transcribed locus 1567375_at
AJ011596 Trapped 3' terminal exon, clone B2E8 232140_at BF056548
CDNA FLJ13474 fis, clone PLACE1003593 216707_at AL162044 MRNA; cDNA
DKFZp761L0812 (from clone DKFZp761L0812); partial cds 1557395_at
AW243434 hypothetical LOC255130 1554629_at BC027940 EPH receptor A7
215488_at AF052095 Clone 23911 mRNA sequence 211004_s_at BC002553
aldehyde dehydrogenase 3 family, member B1 244847_at AA988223
Transcribed locus 222079_at BF739971 -- 237996_at AV650867 --
216644_at AK000185 CDNA FLJ20178 fis, clone COL09990 238588_at
AI623295 CDNA clone IMAGE: 5265193 222061_at AA700015 CD58 molecule
211315_s_at AB012043 calcium channel, voltage-dependent, T type,
alpha 1G subunit 210037_s_at L24553 nitric oxide synthase 2A
(inducible, hepatocytes) 209957_s_at M30262 natriuretic peptide
precursor A 206449_s_at NM_001879 mannan-binding lectin serine
peptidase 1 (C4/C2 activating component of Ra- reactive factor)
1569064_at BC027487 hypothetical LOC643338 209747_at J03241
transforming growth factor, beta 3 224220_x_at AF063824 transient
receptor potential cation channel, subfamily C, member 4 244711_at
BF512863 Transcribed locus 239452_at AI088640 Transcribed locus
243281_at AW188311 Transcribed locus 1560346_at AL080057 MRNA; cDNA
DKFZp564D032 (from clone DKFZp564D032) 1566623_at AL050263
DKFZP547J0410 protein 222381_at AI907083 Programmed cell death 6
/// CDNA FLJ37304 fis, clone BRAMY2016070 227504_s_at N64630 MRNA;
cDNA DKFZp686F09227 (from clone DKFZp686F09227) 235164_at BG433539
zinc finger protein 25 1559159_at AK094069 centrosomal protein 68
kDa 1570128_at BC025771 DEAD (Asp-Glu-Ala-As) box polypeptide 19A
231055_at BF432941 Transcribed locus 1557453_at BM662646 Full
length insert cDNA clone ZD77B03 1564996_at AK000024 CDNA FLJ20017
fis, clone ADSE00552 243107_at AI910590 -- 204914_s_at AW157202 SRY
(sex determining region Y)-box 11 1564855_at AK058056 hypothetical
protein LOC727924 1564559_at AL833395 hypothetical protein
LOC728073 204556_s_at AL568422 DAZ interacting protein 1 1562372_at
AK094917 synaptic vesicle glycoprotein 2C 205777_at NM_001395 dual
specificity phosphatase 9 231475_at BE671790 TBC1 domain family,
member 21 224239_at AF301470 defensin, beta 103B 238228_at AI732206
-- 230763_at AA905508 spermatogenesis associated 17 229508_at
BF434828 U2 small nuclear RNA auxiliary factor 2 236479_at BF513986
-- 205183_at NM_002138 heterogeneous nuclear ribonucleoprotein D
(AU-rich element RNA binding protein 1, 37 kDa) 216135_at AK000122
IQ motif containing K 1553207_at NM_173664 ADP-ribosylation
factor-like 10 217162_at M94893 testis specific protein, Y-linked 1
244328_x_at T86832 -- 1566003_x_at AK096064 CDNA FLJ38745 fis,
clone KIDNE2012291 236736_at AW274301 Transcribed locus 238532_at
AI125562 D4, zinc and double PHD fingers, family 3 223781_x_at
M15943 alcohol dehydrogenase 4 (class II), pi polypeptide 222940_at
U55764 sulfotransferase family 1E, estrogen-preferring, member 1
213953_at AI732381 keratin 20 241033_at AI821633 Transcribed locus
1569332_at BC022563 chromosome 3 open reading frame 66 214049_x_at
AI829961 CD7 molecule 233165_at AJ242655 NCK interacting protein
with SH3 domain 241555_at AI032090 Transcribed locus 1553405_a_at
NM_033225 CUB and Sushi multiple domains 1 238406_x_at AI734001
seizure related 6 homolog (mouse)-like 2 203084_at NM_000660
transforming growth factor, beta 1 232182_at AI142853 hypothetical
protein LOC286272 1559821_at BC025328 Homo sapiens, clone IMAGE:
3944699, mRNA 206660_at NM_020070 immunoglobulin lambda-like
polypeptide 1 1564658_at BC037583 Chromosome 7 open reading frame
52 220095_at NM_017738 chromosome 9 open reading frame 39 230694_at
AI340341 -- 202341_s_at AA149745 tripartite motif-containing 2
1566577_at AL831879 MRNA; cDNA DKFZp547I1410 (from clone
DKFZp547I1410) 237587_at AI733359 Transcribed locus, weakly similar
to NP_001041360.1 protein LOC317588 [Rattus norvegicus]
1553868_a_at NM_173665 chromosome 5 open reading frame 36 238731_at
AW977837 SET domain, bifurcated 2 235055_x_at BF913667 Mucin 4,
cell surface associated 230189_x_at BF434897 Transcribed locus
1562656_at BC043591 CDNA clone IMAGE: 5248626 219898_at NM_018970 G
protein-coupled receptor 85 217585_at BE502910 nebulette
1554147_s_at AB063297 chromosome 3 open reading frame 15 231047_at
R56808 Transcribed locus 213525_at AC002310 CDNA clone IMAGE:
4906981 1553872_at NM_152914 transcript expressed during
hematopoiesis 2 1557452_at AF088024 Full length insert cDNA clone
ZC19A03 211618_s_at M31008 alkaline phosphatase, intestinal
227121_at BF476076 MRNA; cDNA DKFZp586K1922 (from clone
DKFZp586K1922) 244364_at AA443280 myosin IIIA 243797_at AW070323
serine/threonine kinase 17b 1561396_at AK092565 EPH receptor A6
241071_at BF432757 -- 1554739_at BC032544 intracisternal A
particle-promoted polypeptide 237015_at AI097501 CDNA FLJ37017 fis,
clone BRACE2010642 243825_at T79768 B-cell CLL/lymphoma 6, member B
(zinc finger protein) 232934_at AA526468 CDNA FLJ13422 fis, clone
PLACE1002213 1561669_at BC018424 Homo sapiens, clone IMAGE:
4508536, mRNA 244545_at AI769647 CDNA clone IMAGE: 5296106
1561200_at BM981856 von Willebrand factor A domain containing 3B
244291_x_at BE348646 Transcribed locus 1564854_at AK058061 CDNA
FLJ25332 fis, clone TST00642 229962_at W68731 leucine rich repeat
containing 37, member A3 225491_at AL157452 solute carrier family 1
(glial high affinity glutamate transporter), member 2 205713_s_at
NM_000095 cartilage oligomeric matrix protein 240692_at AI809153
SPR pseudogene 1553894_at NM_144974 coiled-coil domain containing
122 217530_at AW295295 solute carrier family 34 (sodium phosphate),
member 1 228376_at AI972498 glycoprotein,
alpha-galactosyltransferase 1 /// similar to glycoprotein
galactosyltransferase alpha 1, 3 244204_at W87300 -- 206128_at
AI264306 adrenergic, alpha-2C-, receptor 221275_s_at NM_030896 --
233701_at AK024580 CDNA: FLJ20927 fis, clone ADSE01007 240588_at
AI821798 -- 217233_at Z97206 -- 236719_at AI042187 Transcribed
locus, moderately similar to XP_001086437.1 hypothetical protein
[Macaca mulatta] 1561205_at BC036409 CDNA clone IMAGE: 5266702
216129_at AL117659 ATPase, Class II, type 9A 214428_x_at K02403
complement component 4A (Rodgers blood group) /// complement
component 4B (Childo blood group) 211579_at U95204 integrin, beta 3
(platelet glycoprotein IIIa, antigen CD61) 209354_at BC002794 tumor
necrosis factor receptor superfamily, member 14 (herpesvirus entry
mediator) 207896_s_at NM_007337 deleted in lung and esophageal
cancer 1 1561319_at BC041486 CDNA clone IMAGE: 5492202 1569454_a_at
BG475827 hypothetical protein LOC283352 240568_at AW206555 --
1552872_at NM_025091 chromosome X and Y open reading frame 2
233734_s_at AW271225 oxysterol binding protein-like 5 214347_s_at
AW772056 dopa decarboxylase (aromatic L-amino acid decarboxylase)
1556803_at BC033542 polymerase (RNA) III (DNA directed) polypeptide
B 236154_at R41907 Quaking homolog, KH domain RNA binding (mouse)
205623_at NM_000691 aldehyde dehydrogenase 3 family, member A1
220818_s_at NM_016179 transient receptor potential cation channel,
subfamily C, member 4 1555043_at BC028630 lipoma HMGIC fusion
partner-like 5 1568977_at BC019871 ribonuclease T2 235600_at N63890
Transcribed locus 220150_s_at NM_024581 chromosome 6 open reading
frame 60 210381_s_at BC000740 cholecystokinin B receptor 1558397_at
BF976693 CDNA FLJ34100 fis, clone FCBBF3007597 216214_at AF070602
Clone 24504 mRNA sequence 221990_at AI948472 paired box 8
243817_at AI874267 -- 241380_at BF508325 FLJ41603 protein 237604_at
AA906413 BC038740 243708_at AI678145 transmembrane protein 132E
233876_at AK000677 -- 240858_at AA680403 Transcribed locus
1560806_at BC037249 hypothetical protein LOC150527 239480_at
AA608964 Transcribed locus 1559580_at AL832694 leucine rich repeat
containing 39 230610_at AW008915 Transcribed locus, moderately
similar to XP_001087523.1 similar to Mid-1-related chloride channel
1 isoform 4 [Macaca mulatta] 221022_s_at NM_031293 polyamine
modulated factor 1 binding protein 1 239178_at AL583692 fibroblast
growth factor 9 (glia-activating factor) 237365_at AI798981 CDNA
clone IMAGE: 5269899 1568870_at BC034805 CDNA clone IMAGE: 4818211
214411_x_at AW584011 chymotrypsinogen B2 244035_at BF003032 Full
length insert cDNA clone YZ11B11 237094_at AI953086 family with
sequence similarity 19 (chemokine (C-C motif)-like), member A5
239312_at AW419032 -- 207640_x_at NM_006181 netrin 2-like (chicken)
242171_at AA693730 -- 1553248_at NM_152675 coiled-coil domain
containing 57 234480_at AL137340 Hypothetical protein DKFZp761C1711
1555474_at BC009479 tubulin tyrosine ligase-like family, member 3
234261_at AL137313 MRNA; cDNA DKFZp761M10121 (from clone
DKFZp761M10121) 243459_x_at AW300077 -- 237676_at AW274369
Transcribed locus 206819_at NM_014549 POM121-like protein
1556125_at BM668595 G patch domain containing 2 1556065_at BG828817
Hypothetical protein LOC284926 232120_at AA678124 CDNA FLJ14259
fis, clone PLACE1001076 1553562_at NM_172100 CD8b molecule
217016_x_at AK026825 hypothetical LOC389177 232807_at AU158601
family with sequence similarity 131, member A 227389_x_at AA058858
-- 237528_at D80212 Transcribed locus 242714_at AW500340 --
205050_s_at NM_012324 mitogen-activated protein kinase 8
interacting protein 2 240159_at AA836116 solute carrier family 15
(H+/peptide transporter), member 2 240887_at AI017957 Transcribed
locus 1562577_at BC025331 Homo sapiens, clone IMAGE: 4546564, mRNA
244715_at R39803 Transcribed locus 1561500_at AW575915 Hypothetical
protein LOC348180 239627_at BG034114 Transmembrane emp24 protein
transport domain containing 9 222901_s_at AF153815 potassium
inwardly-rectifying channel, subfamily J, member 16 233351_at
AF339776 Clone IMAGE: 1542282, mRNA sequence 1566898_at X53943
succinate dehydrogenase flavoprotein subunit 228136_s_at AI280446
Chromosome 17 open reading frame 70 233387_s_at AK024009
pericentrin (kendrin) 231911_at AA736604 KIAA1189 240402_at H05918
kin of IRRE like 3 (Drosophila) 244840_x_at AW452588 dedicator of
cytokinesis 4 1556172_at AL832916 MRNA; cDNA DKFZp762I0915 (from
clone DKFZp762I0915) 232833_at AF070565 Clone 24425 mRNA sequence
1558797_at BC017743 Homo sapiens, clone IMAGE: 4391558, mRNA
243542_at BF445273 prolyl endopeptidase-like 223717_s_at AB051833
acrosin binding protein 231324_at AW452134 Transcribed locus
1556713_at AK022031 CDNA FLJ11969 fis, clone HEMBB1001142 232186_at
AK027041 chromosome 20 open reading frame 142 231158_x_at AI380289
Polypyrimidine tract binding protein 1 228816_at AK022625
hypothetical protein LOC92270 1567390_at AJ011600 Trapped 3'
terminal exon, clone C2B5 1565732_at BI254450 MRNA; cDNA
DKFZp761B0218 (from clone DKFZp761B0218) 230228_at W94546
hypothetical LOC284297 217462_at AC004770 chromosome 11 open
reading frame 9 1561759_at AF085995 Similar to septin 7 211225_at
U27329 fucosyltransferase 5 (alpha (1,3) fucosyltransferase)
210565_at U03469 glucagon receptor 237523_at AI939584 Transcribed
locus 221921_s_at AI951798 cell adhesion molecule 3 234764_x_at
U96394 Immunoglobulin lambda variable 1-44 /// Immunoglobulin
anti-HBsAg lambda light chain (LM25) /// Immunoglobulin lambda
locus
TABLE-US-00033 TABLE 15 Genes Expressed at a 5 fold or Greater
Level in iPS Cell Lines versus both hES Cell Lines and Parental
Fibroblasts (p .ltoreq. 0.01) Systematic Name Genbank Description
AFFX-r2-Ec-bioD- BF057809 Transcribed locus 5_at 239206_at AF268617
POU class 5 homeobox 1 pseudogene 3 239205_s_at AW003929 claudin 6
215101_s_at NM_004360 cadherin 1, type 1, E-cadherin (epithelial)
210697_at NM_017697 RNA binding motif protein 35A 223551_at
NM_003212 teratocarcinoma-derived growth factor 1 ///
teratocarcinoma-derived growth factor 3, pseudogene 214974_x_at
AK022821 developmental pluripotency associated 4 237552_at AF268615
POU class 5 homeobox 1 /// POU class 5 homeobox 1 pseudogene 1 ///
POU class 5 homeobox 1 pseudogene 3 /// POU class 5 homeobox 1
pseudogene 4 231120_x_at AI554075 Transcribed locus 235075_at
NM_024674 lin-28 homolog (C. elegans) 211906_s_at AY072911
coxsackie virus and adenovirus receptor 217230_at NM_005356
lymphocyte-specific protein tyrosine kinase 225908_at BF001941 RNA
binding motif protein 35A 232881_at BC028721 solute carrier family
1 (high affinity aspartate/glutamate transporter), member 6
239951_at L08599 cadherin 1, type 1, E-cadherin (epithelial)
1553276_at BG166705 chemokine (C--X--C motif) ligand 5 219837_s_at
NM_001100 actin, alpha 1, skeletal muscle 208542_x_at NM_014474
sphingomyelin phosphodiesterase, acid-like 3B 239319_at BI092935
zinc finger protein 42 homolog (mouse) 235779_at AL117612 mal,
T-cell differentiation protein 2 220638_s_at M83248 secreted
phosphoprotein 1 (osteopontin, bone sialoprotein I, early
T-lymphocyte activation 1) 214336_s_at AU148706 CDNA FLJ12557 fis,
clone NT2RM4000783 219807_x_at NM_003413 Zic family member 3
heterotaxy 1 (odd-paired homolog, Drosophila) 1559503_a_at AL515381
coronin, actin binding protein, 2A 209040_s_at AF450454 zinc finger
protein 42 homolog (mouse) 214090_at BG327863 CD24 molecule
223629_at NM_020436 sal-like 4 (Drosophila) 1559051_s_at NM_014446
integrin beta 1 binding protein 3 212105_s_at AI674565 family with
sequence similarity 110, member C 203872_at BE974098 tumor protein
D52 222935_x_at AL136825 ubiquitin specific peptidase 44
243195_s_at W92748 sema domain, transmembrane domain (TM), and
cytoplasmic domain, (semaphorin) 6A 220179_at AL556409 galanin
222898_s_at AL533416 kinesin family member 1A 229332_at AU143918
hypothetical gene supported by AJ002784 1555731_a_at X69397 CD24
molecule 1553873_at NM_024939 RNA binding motif protein 35B
235942_at NM_005755 Epstein-Barr virus induced gene 3 244178_at
NM_173553 hypothetical protein FLJ25801 224463_s_at AF493872
guanine nucleotide binding protein (G protein), gamma 4 206797_at
NM_002196 insulinoma-associated 1 212278_x_at NM_021195 claudin 6
211107_s_at AA594937 cordon-bleu homolog (mouse) 214519_s_at
AK000168 CD24 molecule 216469_at BE552138 complement component
(3b/4b) receptor 1-like 221123_x_at AI963203 solute carrier family
7 (cationic amino acid transporter, y+ system), member 3
1568574_x_at NM_006892 DNA (cytosine-5-)-methyltransferase 3 beta
1554777_at AB020630 protein phosphatase 1, regulatory (inhibitor)
subunit 16B 211214_s_at AF154005 F11 receptor 205920_at BE542563
Hypothetical protein LOC728342 232771_at NM_001943 desmoglein 2
1555765_a_at AB019562 Secreted phosphoprotein 1 (osteopontin, bone
sialoprotein I, early T-lymphocyte activation 1) 206220_s_at
AF027205 serine peptidase inhibitor, Kunitz type, 2 201130_s_at
AF225513 protein kinase (cAMP-dependent, catalytic) inhibitor beta
219911_s_at NM_024749 vasohibin 2 226654_at NM_003991 endothelin
receptor type B 1559361_at NM_000273 G protein-coupled receptor 143
209260_at AL359055 MRNA full length insert cDNA clone EUROIMAGE
2344436 1552399_a_at NM_001038 sodium channel, nonvoltage-gated 1
alpha 205910_s_at BE552138 complement component (3b/4b) receptor 1
(Knops blood group) /// complement component (3b/4b) receptor
1-like /// similar to complement component (3b/4b) receptor 1
isoform F precursor 206232_s_at AK057525 CDNA FLJ32963 fis, clone
TESTI2008405 212009_s_at AB020630 protein phosphatase 1, regulatory
(inhibitor) subunit 16B 204815_s_at AI935915 SH3-binding domain
kinase 1 1554776_at BG389015 tumor protein D52 242070_at NM_005397
podocalyxin-like 1554508_at AK026546 chemokine (C--X--C motif)
ligand 5 236741_at AA761181 CD24 molecule 206604_at NM_003182
tachykinin, precursor 1 (substance K, substance P, neurokinin 1,
neurokinin 2, neuromedin L, neurokinin alpha, neuropeptide K,
neuropeptide gamma) 1555829_at NM_014392 DNA segment on chromosome
4 (unique) 234 expressed sequence 1555434_a_at AF070651 zinc finger
protein 257 1564706_s_at BF056473 CDNA clone IMAGE: 4667929
242519_at AF225425 sema domain, transmembrane domain (TM), and
cytoplasmic domain, (semaphorin) 6A 205344_at AI653107 Nik related
kinase 201123_s_at AA074145 proline dehydrogenase (oxidase) 1
1564339_a_at AL569326 protein kinase (cAMP-dependent, catalytic)
inhibitor beta 216031_x_at NM_004929 calbindin 1, 28 kDa
223285_s_at AI824954 SRY (sex determining region Y)-box 3
1555800_at AF110329 glutaminase 2 (liver, mitochondrial) 1557910_at
AW014927 calbindin 1, 28 kDa 204823_at BC038422 zinc finger protein
533 1553852_at BC028721 solute carrier family 1 (high affinity
aspartate/glutamate transporter), member 6 1557924_s_at NM_006984
claudin 10 1552995_at AI492376 killer cell lectin-like receptor
subfamily G, member 2 216360_x_at AI830823 RNA-binding protein
232751_at L19659 glucosaminyl (N-acetyl) transferase 2, I-branching
enzyme (I blood group) 231452_at NM_031272 testis expressed 14
213171_s_at N23258 Transcribed locus 209756_s_at NM_013267
glutaminase 2 (liver, mitochondrial) 1556670_at AI014470
hypothetical protein LOC728485 227759_at NM_003007 semenogelin I
208621_s_at NM_012116 Cas-Br-M (murine) ecotropic retroviral
transforming sequence c 229289_at NM_004775 UDP-Gal:betaGlcNAc beta
1,4-galactosyltransferase, polypeptide 6 1553698_a_at R61322
coiled-coil domain containing 64 207532_at NM_004485 guanine
nucleotide binding protein (G protein), gamma 4 219424_at AW193600
hypothetical gene supported by AY007155 214154_s_at AW007161 SRY
(sex determining region Y)-box 2 221213_s_at AI056483 zinc finger
protein 488 1556834_at M74921 endothelin receptor type B 227757_at
NM_005498 adaptor-related protein complex 1, mu 2 subunit
208504_x_at Z83838 Rho GTPase activating protein 8 /// PRR5-ARHGAP8
fusion 214008_at AB037776 immunoglobulin superfamily, member 9
209875_s_at AI989477 SRY (sex determining region Y)-box 4
1555821_a_at NM_000224 keratin 18 216915_s_at W58601 Transcribed
locus 239239_at NM_152332 tandem C2 domains, nuclear 221408_x_at
U07236 lymphocyte-specific protein tyrosine kinase 212016_s_at
NM_153270 kelch-like 34 (Drosophila) 214828_s_at AI193252 leucine
rich repeat and Ig domain containing 1 233305_at AF335278
cytochrome P450, family 2, subfamily S, polypeptide 1 216985_s_at
BF527050 SRY (sex determining region Y)-box 8 231789_at AA205873
chromosome 9 open reading frame 58 211363_s_at H93038 Insulin-like
growth factor 2 mRNA binding protein 1 217294_s_at AA573775
chromosome 1 open reading frame 172 211922_s_at AL566906
Transcribed locus 204018_x_at AI669212 protein phosphatase 2
(formerly 2A), regulatory subunit B, gamma isoform 243347_at
AIF191495 F11 receptor 206595_at BF791631 kelch domain containing
8A 238125_at NM_003822 nuclear receptor subfamily 5, group A,
member 2 209958_s_at NM_007267 transmembrane channel-like 6
238692_at BC007230 coagulation factor C homolog, cochlin (Limulus
polyphemus) 206390_x_at NM_024794 abhydrolase domain containing 9
210572_at BG479856 family with sequence similarity 60, member A ///
similar to teratocarcinoma expressed, serine rich /// similar to
Protein FAM60A (Tera protein) 1555034_at NM_003385 visinin-like 1
210587_at AL137763 grainyhead-like 3 (Drosophila) 231013_at
AI420156 MARVEL domain containing 3 206665_s_at AW139759 solute
carrier family 39 (zinc transporter), member 8 206882_at BC041633
chromosome 1 open reading frame 210 1555716_a_at AB046400 serpin
peptidase inhibitor, clade B (ovalbumin), member 4 217051_s_at
NM_022449 RAB17, member RAS oncogene family 222508_s_at AF193756
EF-hand calcium binding protein 1 211529_x_at BC039098 desmoglein 4
220108_at BC015108 Homo sapiens, Similar to otoconin 90, clone
IMAGE: 4044247, mRNA 1561367_a_at AW299463 WD repeat domain 72
211022_s_at AL537457 neurofilament, light polypeptide 68 kDa
218931_at BE791251 claudin 3 213363_at AF039555 visinin-like 1
230112_at AV706971 polycystic kidney and hepatic disease 1
(autosomal recessive)-like 1 209136_s_at AA888057 plakophilin 2
212125_at AI268404 protocadherin alpha 9 /// protocadherin alpha
subfamily C, 2 /// protocadherin alpha subfamily C, 1 ///
protocadherin alpha 13 /// protocadherin alpha 12 /// protocadherin
alpha 11 /// protocadherin alpha 10 /// protocadherin alpha 8 ///
protocadherin alpha 7 /// protocadherin alpha 6 /// protocadherin
alpha 5 /// protocadherin alpha 4 /// protocadherin alpha 3 ///
protocadherin alpha 2 /// protocadherin alpha 1 217370_x_at
BG473130 kinesin family member 1A 211016_x_at BC001745 DNA segment
on chromosome 4 (unique) 234 expressed sequence 241661_at NM_000814
gamma-aminobutyric acid (GABA) A receptor, beta 3 222611_s_at
AI792670 Full-length cDNA clone CS0DC002YA18 of Neuroblastoma Cot
25-normalized of Homo sapiens (human) 213722_at U46745
dystrobrevin, alpha 212574_x_at NM_014289 calpain 6 219928_s_at
AF152474 protocadherin alpha subfamily C, 2 204895_x_at BC029917
phosphoinositide-3-kinase adaptor protein 1 208275_x_at NM_001877
complement component (3d/Epstein Barr virus) receptor 2 232001_at
BC000181 G protein-coupled receptor 160 223828_s_at AI871354 v-myc
myelocytomatosis viral related oncogene, neuroblastoma derived
(avian) 210654_at NM_006465 AT rich interactive domain 3B
(BRIGHT-like) 206208_at BF905445 Proline rich Gla
(G-carboxyglutamic acid) 4 (transmembrane) 1553535_a_at BC000329
stratifin 222936_s_at BC014155 Ras homolog enriched in brain like 1
1566764_at NM_016354 solute carrier organic anion transporter
family, member 4A1 226913_s_at NM_001307 claudin 7 208478_s_at
AB032179 erythrocyte membrane protein band 4.1 like 4B 202662_s_at
AF152528 protocadherin beta 18 pseudogene 228851_s_at U53823
occludin /// occludin pseudogene 206552_s_at NM_003389 coronin,
actin binding protein, 2A 213943_at AA565499 NLR family, pyrin
domain containing 7 209198_s_at AF232238 hairy/enhancer-of-split
related with YRPW motif 2 211699_x_at AF213678 chromosome 19 open
reading frame 33 207402_at NM_004297 guanine nucleotide binding
protein (G protein), alpha 14 224539_s_at BF732462 PRKC, apoptosis,
WT1, regulator 229566_at AV681807 v-erb-b2 erythroblastic leukemia
viral oncogene homolog 3 (avian) 238742_x_at BC007242 ets variant
gene 4 (E1A enhancer binding protein, E1AF) 1555639_a_at AI768894
cingulin 211899_s_at NM_004968 islet cell autoantigen 1, 69 kDa
1553694_a_at AA565509 Transcribed locus, strongly similar to
XP_531332.1 hypothetical protein XP_531332 [Pantroglodytes]
213926_s_at AW961205 hypothetical protein LOC728485 214000_s_at
NM_005562 laminin, gamma 2 203729_at BC001186 protocadherin beta 5
203085_s_at BE350882 delta-like 3 (Drosophila) 207118_s_at
NM_000015 N-acetyltransferase 2 (arylamine N-acetyltransferase)
232591_s_at BE080109 similar to embigin homolog 236158_at AL359055
MRNA full length insert cDNA clone EUROIMAGE 2344436 229901_at
BF057784 G protein-coupled receptor 114
211051_s_at U58994 ladinin 1 222458_s_at NM_024306 fatty acid
2-hydroxylase 230809_at NM_007153 zinc finger protein 208 221279_at
BC000568 transmembrane protein 108 224169_at AB018009 solute
carrier family 7 (cationic amino acid transporter, y+ system),
member 5 233297_s_at U53470 inositol polyphosphate-5-phosphatase,
145 kDa 221665_s_at NM_002773 protease, serine, 8 205391_x_at
AA702685 organic solute transporter alpha 215728_s_at BC004907
EPS8-like 1 208474_at NM_021209 NLR family, CARD domain containing
4 223567_at AA910946 adaptor-related protein complex 1, mu 2
subunit 1558662_s_at BC011672 G protein regulated inducer of
neurite outgrowth 2 210620_s_at U73844 E74-like factor 3 (ets
domain transcription factor, epithelial-specific) 211020_at
AI740544 ADAM metallopeptidase with thrombospondin type 1 motif, 16
231698_at AI434443 Zinc finger protein 81 227316_at R99562 forkhead
box A3 1555814_a_at AI694320 zinc finger protein 533 235728_at
NM_003121 Spi-B transcription factor (Spi-1/PU.1 related)
213713_s_at NM_025266 hypothetical protein MGC2780 237206_at
BC035960 protein tyrosine phosphatase, receptor type, O 210413_x_at
NM_006467 polymerase (RNA) III (DNA directed) polypeptide G (32 kD)
242660_at NM_003577 undifferentiated embryonic cell transcription
factor 1 225369_at AV709406 transmembrane protein 125 235358_at
AI653169 adenylate kinase 3-like 2 1554628_at BC035104 CDNA clone
IMAGE: 5262438 212154_at NM_004659 matrix metallopeptidase 23B ///
matrix metallopeptidase 23A (pseudogene) 218260_at AI928513 --
207664_at NM_005477 hyperpolarization activated cyclic
nucleotide-gated potassium channel 4 201171_at NM_004973 jumonji,
AT rich interactive domain 2 203892_at BF739767 homolog of rat
pragma of Rnd2 241574_s_at AF059274 chondroitin sulfate
proteoglycan 5 (neuroglycan C) 210457_x_at NM_018593 solute carrier
family 16, member 10 (aromatic amino acid transporter) 223631_s_at
AA531023 family with sequence similarity 46, member B 1555733_s_at
AI566130 adenylate kinase 3-like 2 206917_at NM_002045 growth
associated protein 43 236058_at AW173071 UDP glycosyltransferase 3
family, polypeptide A1 1558015_s_at AI885670 selenophosphate
synthetase 1 227971_at AF257210 neuropeptide FF receptor 2
220892_s_at AI653050 4-hydroxyphenylpyruvate dioxygenase-like
230926_s_at AK026966 adenylate kinase 3-like 2 37549_g_at NM_003364
uridine phosphorylase 1 210828_s_at H23979 CD200 molecule
222406_s_at R45446 Transcribed locus 1553191_at NM_022357
dipeptidase 3 1554327_a_at AF147790 mucin 12, cell surface
associated 240983_s_at NM_024645 zinc finger, matrin type 4
212797_at L40378 serpin peptidase inhibitor, clade B (ovalbumin),
member 9 209719_x_at AL139377 hypothetical protein LOC728591
1552641_s_at NM_001464 ADAM metallopeptidase domain 2 (fertilin
beta) 222501_s_at NM_002119 major histocompatibility complex, class
II, DO alpha 1552477_a_at AB055704 LIM homeobox 4 226876_at
AI936724 Transcribed locus, weakly similar to XP_001114804.1
spectrin, beta, non- erythrocytic 1 isoform 4 [Macaca mulatta]
210869_s_at NM_002286 lymphocyte-activation gene 3 237911_at U19557
serpin peptidase inhibitor, clade B (ovalbumin), member 4
215037_s_at BC000740 cholecystokinin B receptor 206024_at AL137145
protein kinase C, theta 224279_s_at AL080170 tripartite
motif-containing 58 1553105_s_at NM_003177 spleen tyrosine kinase
210022_at BC005368 zinc finger protein 649 223616_at AC006539 zinc
finger protein 682 209629_s_at NM_005712 HERV-H LTR-associating 1
224037_at NM_001944 desmoglein 3 (pemphigus vulgaris antigen)
91826_at AL832535 hypothetical protein LOC157627 216641_s_at
AI807681 SH3 domain containing ring finger 2 218922_s_at NM_006574
chondroitin sulfate proteoglycan 5 (neuroglycan C) 237872_at R38389
olfactomedin 1 203065_s_at AF279779 cholinergic receptor,
muscarinic 3 /// similar to cholinergic receptor, muscarinic 3
228634_s_at AW242668 hypothetical LOC645321 234920_at AK057525 CDNA
FLJ32963 fis, clone TESTI2008405 1553697_at NM_022307 islet cell
autoantigen 1, 69 kDa 217010_s_at AV682679 selenophosphate
synthetase 1 202790_at AB045118 frequently rearranged in advanced
T-cell lymphomas 2 211772_x_at AW302207 Transcribed locus 219270_at
AW510925 HRAS-like suppressor family, member 5 207087_x_at BC013944
spermatogenesis and oogenesis specific basic helix-loop-helix 2
213714_at NM_005242 coagulation factor II (thrombin) receptor-like
1 215649_s_at NM_004615 tetraspanin 7 214903_at AF052167 MRS2-like,
magnesium homeostasis factor (S. cerevisiae) 210455_at NM_152476
zinc finger protein 560 233827_s_at AW268880 Solute carrier family
25, member 13 (citrin) 37547_at NM_018931 protocadherin beta 11
233638_s_at AW166283 protein phosphatase 2 (formerly 2A),
regulatory subunit B, gamma isoform 221035_s_at Z39566 zinc finger
and BTB domain containing 46 1555609_a_at R83905 IBR domain
containing 2 202779_s_at NM_004532 mucin 4, cell surface associated
206336_at AW139719 Transcribed locus 1554339_a_at BF059512
delta/notch-like EGF repeat containing 217711_at AK023446
aminoadipate-semialdehyde synthase 231011_at NM_003027 SH3-domain
GRB2-like 3 206209_s_at NM_013410 adenylate kinase 3-like 1 ///
adenylate kinase 3-like 2 /// similar to Adenylate kinase isoenzyme
4, mitochondrial (ATP-AMP transphosphorylase) 209722_s_at AK093656
CDNA FLJ36337 fis, clone THYMU2006324 214369_s_at NM_020662
MRS2-like, magnesium homeostasis factor (S. cerevisiae) 1552389_at
AF086401 Full length insert cDNA clone ZD75H06 215913_s_at L01087
protein kinase C, theta 201559_s_at AA868267 tripartite
motif-containing 54 217234_s_at W25881 CDNA: FLJ21041 fis, clone
CAE10652 209372_x_at AI807356 -- 218261_at BF063271
UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-
acetylgalactosaminyltransferase 3 (GalNAc-T3) 217445_s_at AW006735
CD8a molecule 205595_at NM_023940 RAS-like, family 11, member B
233669_s_at AF222694 lectin, galactoside-binding, soluble, 12
(galectin 12) 1561330_at U92817 -- 234976_x_at AW440392
Hypothetical protein LOC342892 234085_at AA824282 CDNA clone IMAGE:
5296106 207540_s_at NM_014901 ring finger protein 44 208608_s_at
AF061785 gamma-aminobutyric acid (GABA) A receptor, alpha 5 ///
similar to gamma- aminobutyric acid (GABA) A receptor, alpha 5
207950_s_at AF229180 aminoadipate-semialdehyde synthase 221981_s_at
AV723167 synaptotagmin I 206042_x_at NM_000366 tropomyosin 1
(alpha) 210334_x_at BI825302 transmembrane protein 37 210206_s_at
AI554106 polyhomeotic homolog 1 (Drosophila) 226786_at M61870 zinc
finger protein 90 211796_s_at BC027940 EPH receptor A7 216493_s_at
AY026481 galactose-3-O-sulfotransferase 3 204806_x_at BF438028
Transcribed locus 1556165_at AI830823 RNA-binding protein 215047_at
AF115765 artemin 1552480_s_at NM_000363 troponin I type 3 (cardiac)
205388_at AB019490 RAB GTPase activating protein 1-like 228672_at
BF195936 hypothetical LOC342979 205377_s_at BC005161 inhibin, beta
E 230633_at BC014852 interferon regulatory factor 6 207704_s_at
BF060667 gap junction protein, beta 3, 31 kDa 215668_s_at U26744
dystrobrevin, alpha 212107_s_at NM_021978 suppression of
tumorigenicity 14 (colon carcinoma) 237282_s_at NM_006103 WAP
four-disulfide core domain 2 220285_at NM_002993 chemokine (C--X--C
motif) ligand 6 (granulocyte chemotactic protein 2) 207979_s_at
AI208292 chromosome 5 open reading frame 35 229881_at BC003574
T-cell leukemia/lymphoma 1A 242162_at NM_005490 SH2 domain
containing 3A 207379_at NM_004202 thymosin, beta 4, Y-linked
216981_x_at AI452798 myocardin 224282_s_at AY116207 NLR family,
pyrin domain containing 12 221051_s_at NM_003260 transducin-like
enhancer of split 2 (E(sp1) homolog, Drosophila) 221623_at
NM_000810 gamma-aminobutyric acid (GABA) A receptor, alpha 5
206696_at T15991 -- 203990_s_at AV731490 synaptotagmin I 233767_at
NM_001902 cystathionase (cystathionine gamma-lyase) 211681_s_at
Z83850 Nik related kinase 203234_at AF243527 kallikrein-related
peptidase 5 208729_x_at U63824 TEA domain family member 4 206486_at
AF070580 synaptotagmin II 1558093_s_at BC001606 neutrophil
cytosolic factor 2 (65 kDa, chronic granulomatous disease,
autosomal 2) 1555942_a_at AI857639
phorbol-12-myristate-13-acetate-induced protein 1 1555202_a_at
AB022433 sema domain, transmembrane domain (TM), and cytoplasmic
domain, (semaphorin) 6B 229439_s_at AI862542 CDNA clone IMAGE:
4837650 209086_x_at AL517395 hypothetical protein BC004941
229440_at BC002693 spermatid perinuclear RNA binding protein
1557918_s_at U19556 serpin peptidase inhibitor, clade B
(ovalbumin), member 3 227358_at NM_052836 cadherin-like 23
203953_s_at NM_003054 solute carrier family 18 (vesicular
monoamine), member 2 206769_at H58488 Transcribed locus 242338_at
AA174083 Clone IMAGE: 609847, mRNA sequence 1554029_a_at NM_003963
transmembrane 4 L six family member 5 244171_at AK000794 --
204431_at AK025747 fidgetin 204891_s_at NM_057162 kelch-like 4
(Drosophila) 203849_s_at BG289314 cadherin-like 26 234724_x_at
AF060924 mitochondrial protein 18 kDa 213665_at AA608964
Transcribed locus 1552736_a_at AI733281 Transcribed locus
211088_s_at AK022644 dysbindin (dystrobrevin binding protein 1)
domain containing 1 1554576_a_at BC001387 HRAS-like suppressor 3
220354_at NM_004426 polyhomeotic homolog 1 (Drosophila) /// similar
to polyhomeotic 1-like 223821_s_at NM_016323 hect domain and RLD 5
227619_at AL121753 matrix metallopeptidase 24 (membrane-inserted)
215984_s_at AA401492 GNAS complex locus 1560228_at NM_004432 ELAV
(embryonic lethal, abnormal vision, Drosophila)-like 2 (Hu antigen
B) 217552_x_at NM_005071 solute carrier family 1 (high affinity
aspartate/glutamate transporter), member 6 214279_s_at NM_018283
nudix (nucleoside diphosphate linked moiety X)-type motif 15
1554952_s_at NM_002235 potassium voltage-gated channel,
shaker-related subfamily, member 6 215313_x_at NM_002090 chemokine
(C--X--C motif) ligand 3 237145_at AF043179 T cell receptor beta
variable 19 /// T cell receptor beta variable 7-2 /// T cell
receptor beta variable 5-4 /// T cell receptor beta variable 3-1
/// T cell receptor beta constant 1 1556348_at AI613010 F-box and
leucine-rich repeat protein 16 201140_s_at AA350425 Similar to zinc
finger protein 91 1556128_a_at W48843 sprouty homolog 4
(Drosophila) 213810_s_at NM_001149 ankyrin 3, node of Ranvier
(ankyrin G) 226857_at NM_002583 PRKC, apoptosis, WT1, regulator
1553257_at BC009701 peptidyl arginine deiminase, type II 1559880_at
NM_001275 chromogranin A (parathyroid secretory protein 1)
1552849_at NM_014289 calpain 6 1552804_a_at AF279774 growth
associated protein 43 1554689_a_at NM_016510 selenocysteine lyase
1552580_at AF482697 clarin 1 237461_at NM_002744 protein kinase C,
zeta 1559954_s_at NM_173549 chromosome 8 open reading frame 47
219367_s_at AW003107 -- 207419_s_at AK023059 CDNA FLJ12997 fis,
clone NT2RP3000247 201750_s_at AU132789 zinc finger protein 273
206907_at AL139377 spermatogenesis and oogenesis specific basic
helix-loop-helix 2 /// hypothetical protein LOC728591 220756_s_at
AF097159 UDP-Gal: betaGlcNAc beta 1,4-galactosyltransferase,
polypeptide 6 223510_at NM_022552 DNA
(cytosine-5-)-methyltransferase 3 alpha 214671_s_at AU131482 solute
carrier family 16, member 1 (monocarboxylic acid transporter 1)
208750_s_at AI738919 ligand of numb-protein X 1 1554052_at
NM_012282 KCNE1-like 222234_s_at NM_024037 chromosome 1 open
reading frame 135 221423_s_at AF277724 cell division cycle 25
homolog C (S. pombe) 205528_s_at NM_002450 metallothionein 1X
205531_s_at BC037211 hypothetical protein LOC283432 221162_at
NM_022154 solute carrier family 39 (zinc transporter), member 8
203381_s_at AF307451 cat eye syndrome chromosome region, candidate
6 210001_s_at AJ011414 plexin B1 215509_s_at AA522514 KIAA0746
protein 205174_s_at NM_003740 potassium channel, subfamily K,
member 5 41037_at NM_015894 stathmin-like 3 206701_x_at AA527080
KIAA1727 protein 205121_at U87408 Bardet-Biedl syndrome 9
1555106_a_at AV722990 protocadherin beta 15 214414_x_at AK091113
NPC-A-5 214390_s_at AA894574 FK506 binding protein 4, 59 kDa
237810_at NM_016365 nebulette 217441_at BF971587 tubulin, beta 2A
/// tubulin, beta 2B 1562022_s_at NM_000573 complement component
(3b/4b) receptor 1 (Knops blood group) 207279_s_at AF096296
chemokine (C-C motif) ligand 26 202400_s_at AA825563 Transcribed
locus 203798_s_at BC006117 L-2-hydroxyglutarate dehydrogenase
230641_at AI979334 chromosome 12 open reading frame 35 221539_at
NM_017894 zinc finger and SCAN domain containing 2 238716_at
NM_005059 relaxin 2 223402_at BC023610 CDNA clone IMAGE: 4638753
209619_at NM_003914 cyclin A1 209949_at AA329676 CDNA FLJ45742 fis,
clone KIDNE2016327 243354_at NM_004720 endothelial differentiation,
lysophosphatidic acid G-protein-coupled receptor, 4 212953_x_at
AW450586 family with sequence similarity 124A 208949_s_at NM_005110
glutamine-fructose-6-phosphate transaminase 2 212647_at AF136972
protein phosphatase 1B (formerly 2C), magnesium-dependent, beta
isoform 231195_at NM_006334 olfactomedin 1 209995_s_at AF393369
adaptor-related protein complex 1, sigma 3 subunit 242422_at
AI758697 zinc finger protein 493 209569_x_at AA524029 chromosome 9
open reading frame 61 235235_s_at NM_012099 CD3e molecule, epsilon
associated protein 207043_s_at AL043927 tubulin tyrosine
ligase-like family, member 4 228530_at AI272059 LOC401629 ///
LOC401630 205184_at NM_005314 gastrin-releasing peptide receptor
222871_at NM_016089 zinc finger protein 589 209772_s_at R48779
hypothetical protein BC008326 228570_at AF007143 Clone 23738 mRNA
sequence 1554751_at AK098715 CDNA FLJ25849 fis, clone TST08968
211392_s_at D53659 myotubularin related protein 7 213869_x_at
NM_000717 carbonic anhydrase IV 1555659_a_at N33009 apolipoprotein
E 1553156_at AW451792 COMM domain containing 7 227429_at BC010432
CDNA clone IMAGE: 3528357 212720_at NM_001392 dystrobrevin, alpha
206442_at BG328998 glutamic pyruvate transaminase (alanine
aminotransferase) 2 238959_at AL040935 BTB (POZ) domain containing
11 226281_at AW292273 cysteinyl-tRNA synthetase 223385_at AF393369
adaptor-related protein complex 1, sigma 3 subunit 217996_at
NM_018932 protocadherin beta 12 220010_at AI683694 EF-hand calcium
binding domain 4A 237217_at NM_002915 replication factor C
(activator 1) 3, 38 kDa 1556854_at AW139618 synapsin II 239012_at
NM_003213 TEA domain family member 4 1555618_s_at NM_145019 family
with sequence similarity 124A 218707_at AI971618 inhibitor of
growth family, member 5 1564494_s_at NM_005958 melatonin receptor
1A 205262_at AF095784 gamma-aminobutyric acid (GABA) B receptor, 2
208352_x_at AW268880 solute carrier family 25, member 13 (citrin)
204326_x_at AB040903 regulator of chromosome condensation 2
201201_at H90656 nicotinamide nucleotide adenylyltransferase 2
219885_at NM_004561 ovo-like 1 (Drosophila) 236070_at BF663141
villin 2 (ezrin) 212142_at AW966474 sushi domain containing 3
204452_s_at NM_024595 chromosome 1 open reading frame 108
1553328_a_at NM_022804 small nuclear ribonucleoprotein polypeptide
N /// SNRPN upstream reading frame 205899_at NM_004346 caspase 3,
apoptosis-related cysteine peptidase 234842_at NM_003236
transforming growth factor, alpha 1570253_a_at NM_012168 F-box
protein 2 1559057_at NM_016941 delta-like 3 (Drosophila) 207850_at
AI219073 EPS8-like 1 205204_at NM_001254 cell division cycle 6
homolog (S. cerevisiae) 218075_at BE896137 DCP2 decapping enzyme
homolog (S. cerevisiae) 213022_s_at AA928939 transmembrane protein
63C 210039_s_at NM_004931 CD8b molecule 215758_x_at AL136179 SRY
(sex determining region Y)-box 4 1554397_s_at NM_000148
fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H
blood group) 219165_at AB012043 calcium channel, voltage-dependent,
T type, alpha 1G subunit 217110_s_at AA588400 ovo-like 1
(Drosophila) 203879_at BF438407 zinc finger protein 551 221098_x_at
AL163202 similar to zinc finger protein 43 (HTF6) 218533_s_at
M98528 DNA segment on chromosome 4 (unique) 234 expressed sequence
218178_s_at NM_012261 chromosome 20 open reading frame 103
208980_s_at M28880 ankyrin 1, erythrocytic 206961_s_at AF199015
villin 2 (ezrin) 202307_s_at NM_032785 ATP/GTP binding protein-like
4 219735_s_at NM_022006 FXYD domain containing ion transport
regulator 7 228800_x_at U77949 cell division cycle 6 homolog (S.
cerevisiae) 225103_at NM_173549 chromosome 8 open reading frame 47
223074_s_at AF277724 cell division cycle 25 homolog C (S. pombe)
233348_at AC003682 zinc finger protein interacting with K protein 1
homolog (mouse) 220158_at AF498927 Rho GDP dissociation inhibitor
(GDI) beta 1559701_s_at BF594294 TEK tyrosine kinase, endothelial
(venous malformations, multiple cutaneous and mucosal) 223392_s_at
NM_013447 egf-like module containing, mucin-like, hormone
receptor-like 2 203331_s_at AE000659 T-cell receptor alpha-chain
pseudogene mRNA, clone HAP60 (V-alpha-1.1 family) 1569022_a_at
NM_018093 WD repeat domain 74 1555467_a_at AF255647 transmembrane
protein 163 225868_at AA906413 BC038740 240982_at NM_003097 small
nuclear ribonucleoprotein polypeptide N /// SNRPN upstream reading
frame 238315_s_at NM_005738 ADP-ribosylation factor-like 4A
215708_s_at AF231021 NLR family, pyrin domain containing 12
205007_s_at BF446578 RasGEF domain family, member 1A 201742_x_at
NM_017965 solute carrier family 7, (neutral amino acid transporter,
y+ system) member 10 1554374_at BC004940 naked cuticle homolog 2
(Drosophila) 1560303_at AI813438 desmoglein 3 (pemphigus vulgaris
antigen) 219468_s_at AA496034 BAI1-associated protein 2-like 1
219875_s_at NM_000558 hemoglobin, alpha 1 /// hemoglobin, alpha 2
225608_at NM_006426 dihydropyrimidinase-like 4 200806_s_at AB017332
aurora kinase C 201309_x_at AK094809 Ras protein-specific guanine
nucleotide-releasing factor 2 241013_at BG291649 OCIA domain
containing 2 1554586_a_at AF332218 protocadherin 11 X-linked ///
protocadherin 11 Y-linked 1553430_a_at AF279900 minichromosome
maintenance complex component 7 205019_s_at NM_025243 solute
carrier family 19, member 3 226955_at AB011446 aurora kinase B
216458_at AF136381 sorbin and SH3 domain containing 1 204347_at
AF229053 brevican 214240_at AF336127 solute carrier family 4,
sodium borate transporter, member 11 211656_x_at BC006114
cholinergic receptor, nicotinic, alpha 3 204395_s_at AI205764
chromosome 1 open reading frame 108 1554593_s_at W92036 proprotein
convertase subtilisin/kexin type 9 224097_s_at AF199015 villin 2
(ezrin) 204890_s_at NM_006891 crystallin, gamma D 219121_s_at
S76738 alkaline phosphatase, liver/bone/kidney 225063_at BC038538
Homo sapiens, clone IMAGE: 5172739, mRNA 202874_s_at NM_004994
matrix metallopeptidase 9 (gelatinase B, 92 kDa gelatinase, 92 kDa
type IV collagenase) 1554199_at AC007204 zinc finger protein 93
208206_s_at BF509686 chromosome 8 open reading frame 42 1554261_at
AI939470 glutamate receptor, ionotropic, AMPA 2 1554752_a_at
BE671925 Transcribed locus 208868_s_at NM_004252 solute carrier
family 9 (sodium/hydrogen exchanger), member 3 regulator 1
234238_at D88357 cell division cycle 2, G1 to S and G2 to M
235149_at AC005587 similar to CTAGE family, member 5 215362_at
NM_018944 chromosome 21 open reading frame 45 212529_at AI333651
frizzled homolog 7 (Drosophila) 1570266_x_at AI830073 chromosome 1
open reading frame 88 202660_at AI692696 Transcribed locus
202284_s_at AL080057 MRNA; cDNA DKFZp564D032 (from clone
DKFZp564D032) 209197_at M29277 melanoma cell adhesion molecule
219463_at NM_018891 laminin, gamma 2 219513_s_at AF114817 zinc
finger protein 589 202129_s_at AL573851 endothelial cell adhesion
molecule 223038_s_at NM_002150 4-hydroxyphenylpyruvate dioxygenase
229230_at N64686 chromosome 1 open reading frame 96 204281_at
NM_080923 protein tyrosine phosphatase, receptor type, C
219869_s_at AW138134 PHD finger protein 17 210357_s_at BG255416
KIAA0114 206119_at AA921835 hypothetical protein LOC283501
206445_s_at NM_004595 spermine synthase 201812_s_at NM_000041
apolipoprotein E 206946_at BC042986 CDNA clone IMAGE: 5296106
209774_x_at NM_018139 chromosome 14 open reading frame 104
1554384_at NM_000238 potassium voltage-gated channel, subfamily H
(eag-related), member 2 209346_s_at NM_024081 proline rich Gla
(G-carboxyglutamic acid) 4 (transmembrane) 227641_at NM_016629
tumor necrosis factor receptor superfamily, member 21 205748_s_at
AB020676 WW and C2 domain containing 1 208646_at BF510581 BTB (POZ)
domain containing 11 205861_at BG164358 DEAD (Asp-Glu-Ala-Asp) box
polypeptide 21 1557067_s_at BC000729 A kinase (PRKA) anchor protein
1 227171_at NM_018087 transmembrane protein 48 1558212_at NM_018182
chromosome 17 open reading frame 63 227733_at AV753544
phosphoglucomutase 2-like 1 231420_at U85995 Bardet-Biedl syndrome
9 201538_s_at NM_001444 fatty acid binding protein 5
(psoriasis-associated) /// similar to Fatty acid-binding protein,
epidermal (E-FABP) (Psoriasis-associated fatty acid-binding protein
homolog) (PA-FABP) 212457_at AF095771 Bardet-Biedl syndrome 9
203163_at NM_001786 cell division cycle 2, G1 to S and G2 to M
224334_s_at AB055703 LIM homeobox 4 201946_s_at AI829603 chromosome
13 open reading frame 3 205845_at NM_018351 FYVE, RhoGEF and PH
domain containing 6 210038_at NM_025151 RAB11 family interacting
protein 1 (class I) 213932_x_at NM_025047 ADP-ribosylation
factor-like 14 1562378_s_at AI140752 ubiquitously transcribed
tetratricopeptide repeat, X chromosome 214532_x_at NM_017791 feline
leukemia virus subgroup C cellular receptor family, member 2
1555788_a_at NM_007196 kallikrein-related peptidase 8 242329_at
BE542381 methionyl-tRNA synthetase 2, mitochondrial 242387_at
NM_024785 family with sequence similarity 124B 222283_at NM_021154
phosphoserine aminotransferase 1 226094_at BE645821 cell adhesion
molecule 4 239303_at AI026919 Transcribed locus 227248_at AI343600
Transcribed locus 206116_s_at AK024583 keratin, hair, basic, 5
209464_at AF289220 BCL2-like 12 (proline rich) 222701_s_at BF513674
MRNA; cDNA DKFZp779C0742 (from clone DKFZp779C0742) 210091_s_at
BC002652 crumbs homolog 3 (Drosophila) 231715_s_at NM_004741
nucleolar and coiled-body phosphoprotein 1 241172_at NM_006086
tubulin, beta 3 210008_s_at NM_002394 solute carrier family 3
(activators of dibasic and neutral amino acid transport), member 2
217644_s_at AF426267 chromosome 21 open reading frame 88 230675_at
U49396 purinergic receptor P2X, ligand-gated ion channel, 5
65517_at NM_005504 branched chain aminotransferase 1, cytosolic
222841_s_at BC000258 tubulin, delta 1 210291_s_at NM_014285 exosome
component 2 239492_at AI476267 zinc finger protein 195 200894_s_at
AI761824 zinc finger protein 398
TABLE-US-00034 TABLE 16 Table 16: Genes Expressed at a 5 fold or
Greater Level in iPS Cell Lines versus hES Cell Lines (p .ltoreq.
0.01), but not Significantly Different from Parental Fibroblasts (p
.gtoreq. 0.05) Systematic Name Genbank Description 217211_at D50604
similar to cytoplasmic beta-actin 231723_at NM_013346 sorting nexin
12 228371_s_at BF196007 -- 215172_at AL050040 protein tyrosine
phosphatase, non-receptor type 20B /// protein tyrosine
phosphatase, non-receptor type 20A 225088_at BG546917 chromosome 16
open reading frame 63 223994_s_at BC000154 solute carrier family 12
(potassium/chloride transporters), member 9 1554660_a_at BC036200
chromosome 1 open reading frame 71 1554334_a_at BC031044 DnaJ
(Hsp40) homolog, subfamily A, member 4 1555197_a_at AY039243
chromosome 21 open reading frame 58 220472_at NM_014150 zinc
finger, CCHC domain containing 4 213014_at BG222394
mitogen-activated protein kinase 8 interacting protein 1
1554795_a_at BC019895 filamin binding LIM protein 1 232132_at
AB043635 par-6 partitioning defective 6 homolog gamma (C. elegans)
206749_at NM_001764 CD1b molecule 213426_s_at AA150110 Caveolin 2
223318_s_at BC004393 alkB, alkylation repair homolog 7 (E. coli)
221310_at NM_004115 fibroblast growth factor 14 211513_s_at
AF172449 opioid growth factor receptor 211527_x_at M27281 vascular
endothelial growth factor A 1560154_a_at AK026500 CDNA: FLJ22847
fis, clone KAIA686 205196_s_at NM_001283 adaptor-related protein
complex 1, sigma 1 subunit 200954_at NM_001694 ATPase, H+
transporting, lysosomal 16 kDa, V0 subunit c 208067_x_at NM_007125
ubiquitously transcribed tetratricopeptide repeat gene, Y-linked
224241_s_at BC002350 -- 200621_at NM_004078 cysteine and
glycine-rich protein 1 205095_s_at NM_005177 ATPase, H+
transporting, lysosomal V0 subunit a1 222546_s_at AW204755
EPS8-like 2 206832_s_at NM_004186 sema domain, immunoglobulin
domain (Ig), short basic domain, secreted, (semaphorin) 3F
1552470_a_at NM_148914 abhydrolase domain containing 11 220259_at
NM_024927 pleckstrin homology domain containing, family H (with
MyTH4 domain) member 3 220426_at NM_024059 chromosome 20 open
reading frame 195 213597_s_at BF002474 CTD (carboxy-terminal
domain, RNA polymerase II, polypeptide A) small phosphatase-like
1555220_a_at AB040820 aldo-keto reductase family 1, member C-like 2
219430_at NM_020155 G protein-coupled receptor 137 233492_s_at
AC005587 olfactory receptor, family 2, subfamily A, member 4 ///
olfactory receptor, family 2, subfamily A, member 7 /// similar to
rho guanine nucleotide exchange factor 5 231146_at AI300541 family
with sequence similarity 24, member B 243936_x_at T85061 --
232498_at AK023386 hypothetical protein KIAA1833 211823_s_at D86862
paxillin 231243_s_at R93946 basic helix-loop-helix domain
containing, class B, 3 235854_x_at AA167669 Rho-associated,
coiled-coil containing protein kinase 1 215634_at AF007137 Clone
23618 mRNA sequence 226983_at AA626717 zinc finger protein 777
1569076_a_at BE791720 FLJ16287 protein 208894_at M60334 major
histocompatibility complex, class II, DR alpha 208430_s_at
NM_001390 dystrobrevin, alpha 210171_s_at S68134 cAMP responsive
element modulator 1552528_at NM_058189 chromosome 21 open reading
frame 69 1568905_at BC030750 CDNA clone IMAGE: 4795773 214520_at
NM_005251 forkhead box C2 (MFH-1, mesenchyme forkhead 1)
217248_s_at AL365343 solute carrier family 7 (cationic amino acid
transporter, y+ system), member 8 1558214_s_at BG330076 catenin
(cadherin-associated protein), alpha 1, 102 kDa 213160_at D86964
dedicator of cytokinesis 2 210978_s_at BC002616 transgelin 2
214878_at AU118165 zinc finger protein 37A /// zinc finger protein
37B 240703_s_at AW591969 hect (homologous to the E6-AP (UBE3A)
carboxyl terminus) domain and RCC1 (CHC1)-like domain (RLD) 1
204698_at NM_002201 interferon stimulated exonuclease gene 20 kDa
205822_s_at NM_002130 3-hydroxy-3-methylglutaryl-Coenzyme A
synthase 1 (soluble) 1558809_s_at AK094324 hypothetical protein
LOC284408 1569486_at BC035176 CDNA clone IMAGE: 5266012 241168_at
AV651242 Transcribed locus 216205_s_at AK021947 mitofusin 2
205810_s_at NM_003941 Wiskott-Aldrich syndrome-like 206396_at
NM_004170 solute carrier family 1 (neuronal/epithelial high
affinity glutamate transporter, system Xag), member 1 216710_x_at
AL359578 zinc finger protein 287 243323_s_at AI872979 AT-binding
transcription factor 1 229284_at R60683 Methionine
adenosyltransferase II, beta 238699_s_at AI659225
calcium/calmodulin-dependent serine protein kinase (MAGUK family)
217767_at NM_000064 similar to Complement C3 precursor 205924_at
BC005035 RAB3B, member RAS oncogene family 224301_x_at BC003602 H2A
histone family, member J 206932_at NM_003956 cholesterol
25-hydroxylase 222419_x_at AW205983 ubiquitin-conjugating enzyme
E2H (UBC8 homolog, yeast) 216501_at U25801 Vac14 homolog (S.
cerevisiae) 233421_s_at AU146738 nucleoporin 133 kDa 202627_s_at
AL574210 serpin peptidase inhibitor, clade E (nexin, plasminogen
activator inhibitor type 1), member 1 205867_at NM_002834 protein
tyrosine phosphatase, non-receptor type 11 (Noonan syndrome 1)
204480_s_at NM_024112 chromosome 9 open reading frame 16
206026_s_at NM_007115 tumor necrosis factor, alpha-induced protein
6 222678_s_at BF057821 DCN1, defective in cullin neddylation 1,
domain containing 1 (S. cerevisiae) 220246_at NM_020397
calcium/calmodulin-dependent protein kinase ID 208677_s_at AL550657
basigin (Ok blood group) 206997_s_at NM_004807 heparan sulfate
6-O-sulfotransferase 1 /// similar to Heparan-sulfate 6-O-
sulfotransferase 1 (HS6ST-1) 213807_x_at BE870509 met
proto-oncogene (hepatocyte growth factor receptor) 211187_at
AF118079 -- 236940_at W60647 Transcribed locus, weakly similar to
NP_066953.1 isomerase A isoform 1 [Homo sapiens] 224505_s_at
BC006355 phospholipase C, delta 4 205210_at NM_004257 transforming
growth factor, beta receptor associated protein 1 206025_s_at
AW188198 tumor necrosis factor, alpha-induced protein 6 238461_at
AA228031 eukaryotic translation initiation factor 4E family member
3 224003_at AF332243 testis-specific transcript, Y-linked 14
1553685_s_at NM_138473 Sp1 transcription factor 1561039_a_at
BC039609 zinc finger protein 81 235136_at BF337528 ORM1-like 3 (S.
cerevisiae) 205117_at X59065 fibroblast growth factor 1 (acidic)
213643_s_at AK022846 inositol polyphosphate-5-phosphatase, 75 kDa
225322_s_at AL514147 chromosome 17 open reading frame 70
232506_s_at AK026504 chromosome 15 open reading frame 41
AFFX-r2-P1-cre-3_at AFFX-TrpnX-5 -- 221220_s_at NM_017988 SCY1-like
2 (S. cerevisiae) 224127_at AF116660 -- 215876_at AK022254 CDNA
FLJ12192 fis, clone MAMMA1000851 205195_at NM_001283
adaptor-related protein complex 1, sigma 1 subunit 1563809_a_at
AK094768 MCF.2 cell line derived transforming sequence-like
238480_at AI871745 Chromosome 18 open reading frame 50 206673_at
NM_007223 G protein-coupled receptor 176 206100_at NM_001874
carboxypeptidase M 231299_at AI494590 centaurin, gamma 3 202793_at
NM_005768 membrane bound O-acyltransferase domain containing 5
205925_s_at NM_002867 RAB3B, member RAS oncogene family 204522_at
NM_005510 dom-3 homolog Z (C. elegans) 233543_s_at AK021582
coiled-coil domain containing 98 233573_s_at AK001080 WD repeat
domain 6 242552_x_at AW274047 zinc finger, BED-type containing 5
232566_at AK026258 nucleolar protein family 6 (RNA-associated)
202859_x_at NM_000584 interleukin 8 231396_s_at AA776721 family
with sequence similarity 126, member A 1557637_at BC038734 CDNA
clone IMAGE: 5267718 232343_at AK022200 CDNA FLJ12138 fis, clone
MAMMA1000331 238025_at AA706818 mixed lineage kinase domain-like
210256_s_at U78576 phosphatidylinositol-4-phosphate 5-kinase, type
I, alpha 239959_x_at AI147520 -- 227175_at AI806486 Myeloid cell
leukemia sequence 1 (BCL2-related) 223708_at AF329838 C1q and tumor
necrosis factor related protein 4 1554417_s_at AY113699 anterior
pharynx defective 1 homolog A (C. elegans) 217300_at U80771 --
234688_x_at AF141344 centrobin, centrosomal BRCA2 interacting
protein 210935_s_at AF274954 WD repeat domain 1 201048_x_at
NM_002869 RAB6A, member RAS oncogene family 209208_at AF059752
mannose-P-dolichol utilization defect 1 219168_s_at NM_017701
proline rich 5 (renal) 201045_s_at BF513857 RAB6A, member RAS
oncogene family /// RAB6C-like 219878_s_at NM_015995 Kruppel-like
factor 13 223143_s_at AI742378 chromosome 6 open reading frame 166
212575_at BF966155 chromosome 19 open reading frame 6 210930_s_at
AF177761 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2,
neuro/glioblastoma derived oncogene homolog (avian) 217270_s_at
AC005393 dual-specificity tyrosine-(Y)-phosphorylation regulated
kinase 1B AFFX-r2-Ec-bioD- AFFX-ThrX-M -- 3_at 210994_x_at AF230398
tripartite motif-containing 23 222511_x_at AW140098 Fas (TNFRSF6)
associated factor 1 208262_x_at NM_000243 Mediterranean fever AFFX-
AFFX- actin, beta HSAC07/X00351_5_at HSAC07/X00351_5
AFFX-hum_alu_at AFFX-r2-Bs-lys-M -- 237806_s_at AI684717
Hypothetical protein LOC729296 211599_x_at U19348 met
proto-oncogene (hepatocyte growth factor receptor) 1554544_a_at
L18865 myelin basic protein 235913_at AI285722 zinc finger-like
231957_s_at AC005594 dipeptidyl-peptidase 9 210421_s_at AB014602
solute carrier family 24 (sodium/potassium/calcium exchanger),
member 1 243319_at AI274981 Transcribed locus 220825_s_at NM_018240
kin of IRRE like (Drosophila) 1563719_a_at AK024924 CDNA: FLJ21271
fis, clone COL01751 234155_at AK024928 CDNA: FLJ21275 fis, clone
COL01827 213210_at AI005317 TAF6-like RNA polymerase II,
p300/CBP-associated factor (PCAF)-associated factor, 65 kDa
230257_s_at AI264325 chromosome 1 open reading frame 19 236657_at
AW014647 Full length insert cDNA YI37C01 236771_at AW511485
chromosome 6 open reading frame 159 1552649_a_at NM_057178 ring
finger and FYVE-like domain containing 1 225245_x_at BG386566 H2A
histone family, member J 228261_at BE045549 mindbomb homolog 2
(Drosophila) 1566666_at AK074225 CDNA FLJ23645 fis, clone COL02691
207686_s_at NM_001228 caspase 8, apoptosis-related cysteine
peptidase 224321_at AB004064 transmembrane protein with EGF-like
and two follistatin-like domains 2 201169_s_at BG326045 basic
helix-loop-helix domain containing, class B, 2 207678_s_at
NM_007017 SRY (sex determining region Y)-box 30 1555724_s_at
BC010946 transgelin 228901_at AI040910 Cyclin-dependent kinase 9
(CDC2-related kinase) 223083_s_at AW057545 egl nine homolog 2 (C.
elegans) 1562080_at AK057351 CDNA FLJ32789 fis, clone TESTI2002326
AFFX-r2-P1-cre-5_at AFFX-TrpnX-M -- 210971_s_at AB000815 aryl
hydrocarbon receptor nuclear translocator-like 219298_at NM_024693
enoyl Coenzyme A hydratase domain containing 3 222814_s_at AI916361
zinc finger, HIT type 2 217246_s_at L22650 diaphanous homolog 2
(Drosophila) 1560224_at BF327463 AT hook containing transcription
factor 1 217448_s_at AL117508 TOX high mobility group box family
member 4 /// similar to Epidermal Langerhans cell protein LCP1
200841_s_at AI142677 glutamyl-prolyl-tRNA synthetase 211087_x_at
Z25432 mitogen-activated protein kinase 14 1552717_s_at NM_153243
centrosomal protein 170 kDa /// centrosomal protein 170 kDa-like
241084_x_at BF062339 dynein, cytoplasmic 1, heavy chain 1
1555559_s_at AF419247 ubiquitin specific peptidase 25 203890_s_at
BF686824 death-associated protein kinase 3 223393_s_at AL136805
teashirt zinc finger homeobox 3 224805_s_at BF508824 chromosome 15
open reading frame 17 AFFX-LysX-M_at AFFX-LysX-5 -- 227071_at
AI762558 zinc finger protein 414 216788_at AK025564 CDNA: FLJ21911
fis, clone HEP03855 205081_at NM_001311 cysteine-rich protein 1
(intestinal) 203626_s_at NM_005983 S-phase kinase-associated
protein 2 (p45) 211613_s_at U79250 glycerol-3-phosphate
dehydrogenase 2 (mitochondrial) 219703_at NM_018365
meiosis-specific nuclear structural 1 238420_at AV721958 CDNA clone
IMAGE: 5263531 205186_at NM_003462 dynein, axonemal, light
intermediate chain 1 214975_s_at AK001816 myotubularin related
protein 1
215585_at AK024081 KIAA0174 204994_at NM_002463 myxovirus
(influenza virus) resistance 2 (mouse) 202017_at NM_000120 epoxide
hydrolase 1, microsomal (xenobiotic) 222509_s_at BG490634 zinc
finger protein 672 228683_s_at AI925361 potassium channel
tetramerisation domain containing 15 208978_at U36190 cysteine-rich
protein 2 243952_at BF000009 TPTE pseudogene 235940_at AW983691
chromosome 9 open reading frame 64 222085_at AW452357 Hypothetical
gene supported by AK075564; BC060873 229746_x_at BF439451 Homo
sapiens, clone IMAGE: 3885733, mRNA 1553219_a_at NM_015365 Alport
syndrome, mental retardation, midface hypoplasia and elliptocytosis
chromosomal region, gene 1 1559028_at BC037172 chromosome 21 open
reading frame 15 205390_s_at NM_000037 ankyrin 1, erythrocytic
1554988_at BC042592 solute carrier family 9, member 11 205065_at
AU130282 -- 1555569_a_at BC042482 potassium channel tetramerisation
domain containing 7 226632_at AL513673 cytoglobin 210732_s_at
AF342816 lectin, galactoside-binding, soluble, 8 (galectin 8)
AFFX-r2-Bs-dap-3_at AFFX-r2-Bs-phe-3 -- 213087_s_at BF690020 CDNA
clone IMAGE: 4838699 221638_s_at AF008937 syntaxin 16 213211_s_at
AI005317 TAF6-like RNA polymerase II, p300/CBP-associated factor
(PCAF)-associated factor, 65 kDa 238848_at BF750565 OTU domain
containing 4 229328_at T90358 Zinc finger protein 540 1553962_s_at
BI668074 ras homolog gene family, member B 238013_at BF347859
pleckstrin homology domain containing, family A (phosphoinositide
binding specific) member 2 205382_s_at NM_001928 complement factor
D (adipsin) 222711_s_at AI761828 rhomboid 5 homolog 1 (Drosophila)
1567274_at Z36814 -- 224346_at AF116671 -- 219058_x_at NM_022164
tubulointerstitial nephritis antigen-like 1 234939_s_at AL161953
PHD finger protein 12 217524_x_at AA018923 Transcribed locus
214190_x_at AI799984 golgi associated, gamma adaptin ear
containing, ARF binding protein 2 228208_x_at AL134573 Hypothetical
LOC645944 239664_at H18857 Transcribed locus 237211_x_at AA860341
MORN repeat containing 3 203402_at AL520102 potassium voltage-gated
channel, shaker-related subfamily, beta member 2 1555766_a_at
AF493870 guanine nucleotide binding protein (G protein), gamma 2
202873_at BF034973 ATPase, H+ transporting, lysosomal 42 kDa, V1
subunit C1 205577_at NM_005609 phosphorylase, glycogen; muscle
(McArdle syndrome, glycogen storage disease type V) 213928_s_at
AI742626 HIV-1 Rev binding protein 200601_at U48734 actinin, alpha
4 216549_s_at AL096712 TBC1 domain family, member 22B 211564_s_at
BC003096 PDZ and LIM domain 4 221418_s_at NM_005481 mediator
complex subunit 16 210933_s_at BC004908 fascin homolog 1,
actin-bundling protein (Strongylocentrotus purpuratus) 210585_s_at
AF007748 transportin 2 (importin 3, karyopherin beta 2b)
203726_s_at NM_000227 laminin, alpha 3 224795_x_at AW575927
immunoglobulin kappa constant /// immunoglobulin kappa variable 1-5
/// immunoglobulin kappa variable 2-24 231354_at AW510748
hypothetical LOC780529 AFFX-r2-Ec-bioC- AFFX-ThrX-5 -- 5_at
1552367_a_at AF276507 scinderin 201796_s_at BE790854 valyl-tRNA
synthetase 206847_s_at AF026397 homeobox A7 225333_at AI218383 zinc
finger protein 496 211514_at AF068286 receptor interacting protein
kinase 5 1560316_s_at N32168 glucocorticoid induced transcript 1
232315_at AU149712 Zinc finger-like 221628_s_at AF326966
cytokine-like nuclear factor n-pac 239623_at N93197 hypothetical
gene supported by AK126569 AFFX-DapX-5_at AFFX-DapX-5 -- 238542_at
AA831769 UL16 binding protein 2 200628_s_at M61715
tryptophanyl-tRNA synthetase 231881_at AU145225 caldesmon 1
233754_x_at AC007228 zinc finger protein 71 61734_at AI797684
reticulocalbin 3, EF-hand calcium binding domain 215955_x_at Y10388
Rho GTPase activating protein 26 201979_s_at NM_006247 protein
phosphatase 5, catalytic subunit 213767_at U43586 kinase suppressor
of ras 1 87100_at AI832249 abhydrolase domain containing 2
1562234_a_at AF397731 neuron navigator 3 /// similar to neuron
navigator 3 230309_at BE876610 Transcribed locus 1558247_s_at
BC021210 hypothetical protein BC018697 205462_s_at NM_002149
hippocalcin-like 1 221440_s_at NM_006606 retinoblastoma binding
protein 9 206488_s_at NM_000072 CD36 molecule (thrombospondin
receptor) 223661_at AF130080 -- 211019_s_at D63807 lanosterol
synthase (2,3-oxidosqualene-lanosterol cyclase) 211811_s_at
AF152484 protocadherin alpha 6 1562527_at AF519622 hypothetical
protein LOC283027 1569895_at BC016994 Homo sapiens, clone IMAGE:
4401848, mRNA 231402_at AI830201 Transcribed locus, strongly
similar to XP_531081.2 hypothetical protein [Pantroglodytes]
1567105_at AF362887 -- 209555_s_at M98399 CD36 molecule
(thrombospondin receptor) 227137_at N25937 Chromosome 10 open
reading frame 46 212937_s_at M20776 collagen, type VI, alpha 1
1560020_at BC043583 DnaJ (Hsp40) homolog, subfamily C, member 13
214040_s_at BE675337 gelsolin (amyloidosis, Finnish type)
201465_s_at BC002646 jun oncogene 234625_at AK025055 CDNA: FLJ21402
fis, clone COL03734 1554466_a_at BC007207 chromosome 16 open
reading frame 13 208721_s_at BF967271 anaphase promoting complex
subunit 5 213667_at AB002307 Snf2-related CBP activator protein
231151_at AL122010 discs, large (Drosophila) homolog-associated
protein 3 1552610_a_at NM_002227 Janus kinase 1 (a protein tyrosine
kinase) 1565347_s_at AY034078 transcription factor binding to IGHM
enhancer 3 209261_s_at BF000629 nuclear receptor subfamily 2, group
F, member 6 AFFX-r2-Bs-dap- AFFX-r2-Bs-phe-M -- M_at 242948_x_at
T97602 Transcribed locus 214300_s_at AI676092 topoisomerase (DNA)
III alpha 1556748_x_at AI476341 CDNA FLJ39784 fis, clone
SPLEN2002314 1562244_at AL833487 MRNA; cDNA DKFZp686H1629 (from
clone DKFZp686H1629) 244735_at AI377758 coiled-coil domain
containing 54 215581_s_at AK022303 minichromosome maintenance
complex component 3 associated protein 1555240_s_at AF493879
guanine nucleotide binding protein (G protein), gamma 12
216971_s_at Z54367 plectin 1, intermediate filament binding protein
500 kDa 234971_x_at AI521584 phospholipase C, delta 3 212938_at
M20776 collagen, type VI, alpha 1 230404_at AI418538 -- 210298_x_at
AF098518 four and a half LIM domains 1 204952_at NM_014400
LY6/PLAUR domain containing 3 232915_at AW571715 DEAD
(Asp-Glu-Ala-Asp) box polypeptide 49 243358_at BF347362
insulin-like growth factor 1 receptor 225061_at N45231 DnaJ (Hsp40)
homolog, subfamily A, member 4 218154_at NM_024736 gasdermin domain
containing 1 203324_s_at NM_001233 caveolin 2 1554757_a_at AF273055
inositol polyphosphate-5-phosphatase, 40 kDa 242676_at AA401733
Transcribed locus 1569039_s_at BC029855 zinc finger protein 677
221048_x_at NM_017941 chromosome 17 open reading frame 80
1553042_a_at NM_032721 T-cell activation NFKB-like protein
218944_at NM_023078 pyrroline-5-carboxylate reductase-like
204638_at NM_001611 acid phosphatase 5, tartrate resistant
241611_s_at BE675600 fibronectin type III domain containing 3A
222363_at AW979018 Transcribed locus 201008_s_at AA812232
thioredoxin interacting protein 224252_s_at AF177940 FXYD domain
containing ion transport regulator 5 225800_at AI990891 JAZF zinc
finger 1 240407_at AW450035 Homo sapiens, clone IMAGE: 5171705,
mRNA 200796_s_at BF594446 myeloid cell leukemia sequence 1
(BCL2-related) 214992_s_at AD000092 deoxyribonuclease II, lysosomal
209373_at BC003179 mal, T-cell differentiation protein-like
212272_at AA813260 lipin 1 242571_at AW962020 RALBP1 associated Eps
domain containing 2 215019_x_at AW474158 zinc finger protein 528
211668_s_at K03226 plasminogen activator, urokinase 204876_at
NM_014699 zinc finger protein 646 201167_x_at D13989 Rho GDP
dissociation inhibitor (GDI) alpha 211672_s_at AF019888 actin
related protein 2/3 complex, subunit 4, 20 kDa 212003_at BG171020
chromosome 1 open reading frame 144 217465_at AK001291
NCK-associated protein 1 236340_at AI769947 Transcribed locus,
strongly similar to XP_001146557.1 hypothetical protein
[Pantroglodytes] 226504_at AA522720 family with sequence similarity
109, member B 219899_x_at NM_014434 NADPH dependent diflavin
oxidoreductase 1 1567013_at AF323119 nuclear factor
(erythroid-derived 2)-like 2 203348_s_at BF060791 ets variant gene
5 (ets-related molecule) 215315_at AC003682 zinc finger protein 549
209062_x_at AF010227 nuclear receptor coactivator 3 1555229_a_at
BC007010 complement component 1, s subcomponent 203508_at NM_001066
tumor necrosis factor receptor superfamily, member 1B 217494_s_at
AF023139 phosphatase and tensin homolog (mutated in multiple
advanced cancers 1), pseudogene 1 210362_x_at AF230409
promyelocytic leukemia 201060_x_at AI537887 stomatin 204560_at
NM_004117 FK506 binding protein 5 236574_at AI304870 Hypothetical
protein LOC284373 222542_x_at BF724826 chaperone, ABC1 activity of
bc1 complex homolog (S. pombe) 211162_x_at AF116616 stearoyl-CoA
desaturase (delta-9-desaturase) 203771_s_at AA740186 biliverdin
reductase A 217569_x_at AA017093 -- 240397_x_at AI801626
Transcribed locus 207080_s_at NM_004160 peptide YY 213695_at L48516
paraoxonase 3 216591_s_at AF080579 succinate dehydrogenase complex,
subunit C, integral membrane protein, 15 kDa /// hCG1776980
1554464_a_at BC008745 cartilage associated protein 201971_s_at
NM_001690 ATPase, H+ transporting, lysosomal 70 kDa, V1 subunit A
AFFX-r2-Bs-dap-5_at AFFX-r2-Bs-phe-5 -- 215337_at AK022508 mediator
complex subunit 24 227806_at BG285710 chromosome 16 open reading
frame 74 216271_x_at AC004794 synapse defective 1, Rho GTPase,
homolog 1 (C. elegans) 212113_at AI927479 hypothetical LOC552889
230517_at AI416964 similar to GLI-Kruppel family member HKR1
214123_s_at AI126492 chromosome 4 open reading frame 10 219360_s_at
NM_017636 transient receptor potential cation channel, subfamily M,
member 4 205715_at NM_004334 bone marrow stromal cell antigen 1
1558775_s_at AU142380 neutral sphingomyelinase (N-SMase) activation
associated factor 1558423_at BE715671 hypothetical LOC349114
218510_x_at AI816291 family with sequence similarity 134, member B
205457_at NM_024294 chromosome 6 open reading frame 106 214446_at
NM_012081 elongation factor, RNA polymerase II, 2 210449_x_at
AF100544 mitogen-activated protein kinase 14 1552667_a_at NM_005489
SH2 domain containing 3C 205827_at NM_000729 cholecystokinin
231004_s_at BE219961 H1 histone family, member X 220102_at
NM_023067 forkhead box L2 222387_s_at BG476669 vacuolar protein
sorting 35 homolog (S. cerevisiae) 211708_s_at BC005807
stearoyl-CoA desaturase (delta-9-desaturase) 207453_s_at NM_012266
DnaJ (Hsp40) homolog, subfamily B, member 5 1568646_x_at BC038199
zinc finger protein 208 210932_s_at AF293342 ring finger protein
(C3H2C3 type) 6 1559528_at BC040652 Polycomb group ring finger 3
225454_at AW248770 coiled-coil domain containing 124 230747_s_at
AA406435 Chromosome 18 open reading frame 17 202226_s_at NM_016823
v-crk sarcoma virus CT10 oncogene homolog (avian) 228881_at N30347
presenilin associated, rhomboid-like 238969_at BF512162 chromosome
3 open reading frame 55 235234_at AA359612 FLJ36874 protein
243409_at AI005407 forkhead box L1 202465_at NM_002593 procollagen
C-endopeptidase enhancer 211124_s_at AF119835 KIT ligand 200948_at
NM_005439 myeloid leukemia factor 2 204149_s_at NM_000850
glutathione S-transferase M4 217371_s_at Y09908 interleukin 15
218000_s_at NM_007350 pleckstrin homology-like domain, family A,
member 1 211272_s_at AF064771 diacylglycerol kinase, alpha 80 kDa
211266_s_at U35399 G protein-coupled receptor 4 205384_at NM_005031
FXYD domain containing ion transport regulator 1 (phospholemman)
1553970_s_at BC042510 carboxyl ester lipase (bile salt-stimulated
lipase) 230146_s_at BF111850 frequenin homolog (Drosophila)
1559409_a_at BE893129 KIAA1345 protein 211561_x_at L35253
mitogen-activated protein kinase 14 220585_at NM_025130 hexokinase
domain containing 1 234237_s_at AL137611 hypothetical protein
FLJ20294 243110_x_at AI868441 neuropeptide W
214014_at W81196 CDC42 effector protein (Rho GTPase binding) 2
215774_s_at AV650470 -- 203994_s_at U84569 chromosome 21 open
reading frame 2 227419_x_at AW964972 placenta-specific 9 206531_at
NM_004647 D4, zinc and double PHD fingers family 1 208851_s_at
AL161958 Thy-1 cell surface antigen 201621_at NM_005380
neuroblastoma, suppression of tumorigenicity 1 231341_at BE670584
solute carrier family 35, member D3 214505_s_at AF220153 four and a
half LIM domains 1 211027_s_at BC006231 inhibitor of kappa light
polypeptide gene enhancer in B-cells, kinase beta 201428_at
NM_001305 claudin 4 211317_s_at AF041461 CASP8 and FADD-like
apoptosis regulator 216926_s_at AC003030 KIAA0892 221875_x_at
AW514210 major histocompatibility complex, class I, F 209213_at
BC002511 carbonyl reductase 1 1552914_a_at NM_025240 CD276 molecule
211530_x_at M90686 HLA-G histocompatibility antigen, class I, G
1558697_a_at BI600341 KIAA0430 244852_at AU119545 dermatan sulfate
epimerase-like 226306_at BF984592 chromosome 6 open reading frame 1
221943_x_at AW303136 Ribosomal protein L38 204470_at NM_001511
chemokine (C--X--C) motif) ligand 1 (melanoma growth stimulating
activity, alpha) 1552611_a_at AL555086 Janus kinase 1 (a protein
tyrosine kinase) 208879_x_at BG469030 PRP6 pre-mRNA processing
factor 6 homolog (S. cerevisiae) 209427_at AF064238 smoothelin
1565162_s_at D16947 microsomal glutathione S-transferase 1
227841_at BG260181 Cementum protein 1 234773_x_at AL442080 MRNA;
cDNA DKFZp434A0226 (from clone DKFZp434A0226) 238750_at AW083576
chemokine (C-C motif) ligand 28 228251_at BE467577 UBX domain
containing 1 206943_at NM_004612 transforming growth factor, beta
receptor I (activin A receptor type II-like kinase, 53 kDa)
226051_at BF973568 selenoprotein M 202639_s_at AI689052 RAN binding
protein 3 200756_x_at U67280 calumenin 217399_s_at AF032887
forkhead box O3 1555730_a_at D00682 cofilin 1 (non-muscle)
216831_s_at AF018283 runt-related transcription factor 1;
translocated to, 1 (cyclin D-related) 215719_x_at X83493 Fas (TNF
receptor superfamily, member 6) 233298_at AL139377 spermatogenesis
and oogenesis specific basic helix-loop-helix 2 /// hypothetical
protein LOC728591 215495_s_at AL117523 sterile alpha motif domain
containing 4A 218537_at NM_017885 host cell factor C1 regulator 1
(XPO1 dependent) 201367_s_at AI356398 zinc finger protein 36, C3H
type-like 2 223321_s_at AF312678 fibroblast growth factor
receptor-like 1 203676_at NM_002076 glucosamine
(N-acetyl)-6-sulfatase (Sanfilippo disease IIID) AFFX- AFFX- signal
transducer and activator of transcription 1, 91 kDa
HUMISGF3A/M97935_5_at HUMISGF3A/M97935_5 232984_at AL137259
hydrocephalus inducing homolog (mouse) 217601_at AL523184
nucleoporin 188 kDa 238795_at AA424537 chromosome 10 open reading
frame 18 222385_x_at AF346602 Sec61 alpha 1 subunit (S. cerevisiae)
214971_s_at AV695711 ST6 beta-galactosamide
alpha-2,6-sialyltranferase 1 202002_at AW072302 acetyl-Coenzyme A
acyltransferase 2 (mitochondrial 3-oxoacyl-Coenzyme A thiolase)
236491_at AI813346 BCL2-like 10 (apoptosis facilitator) 231721_at
AF356518 junctional adhesion molecule 3 220234_at NM_004056
carbonic anhydrase VIII 213548_s_at BG257762 CDV3 homolog (mouse)
1554321_a_at BC018471 NFS1 nitrogen fixation 1 homolog 231805_at
AL563031 prolactin releasing hormone receptor 1555006_at BC036233
WD repeat domain 66 221889_at AW026481 potassium channel
tetramerisation domain containing 13 201156_s_at AF141304 RAB5C,
member RAS oncogene family 1554383_a_at BC028121 translocation
associated membrane protein 2 210079_x_at U16953 potassium
voltage-gated channel, shaker-related subfamily, beta member 1
219558_at NM_024524 ATPase type 13A3 220889_s_at NM_020178 carbonic
anhydrase X 227488_at AV728999 hypothetical protein MGC16121
221762_s_at AL162458 chromosome 20 open reading frame 67 209727_at
M76477 GM2 ganglioside activator 76897_s_at AA628140 FK506 binding
protein 15, 133 kDa
TABLE-US-00035 TABLE 17 Human Oct3/4 Amino Acid Substitution Matrix
(Predictions Based on PMUT Analysis) Number of Number of Predicted
Predicted Deleterious Neutral WT Position Mutations Mutations M 1 M
G A P V I L F S C T N Q H Y W D E K R 4 16 A 2 M G A P V I L F S C
T N Q H Y W D E K R 9 11 G 3 M G A P V I L F S C T N Q H Y W D E K
R 7 13 H 4 M G A P V I L F S C T N Q H Y W D E K R 5 15 L 5 M G A P
V I L F S C T N Q H Y W D E K R 6 14 A 6 M G A P V I L F S C T N Q
H Y W D E K R 15 5 S 7 M G A P V I L F S C T N Q H Y W D E K R 4 16
D 8 M G A P V I L F S C T N Q H Y W D E K R 5 15 F 9 M G A P V I L
F S C T N Q H Y W D E K R 15 5 A 10 M G A P V I L F S C T N Q H Y W
D E K R 11 9 F 11 M G A P V I L F S C T N Q H Y W D E K R 5 15 S 12
M G A P V I L F S C T N Q H Y W D E K R 7 13 P 13 M G A P V I L F S
C T N Q H Y W D E K R 5 15 P 14 M G A P V I L F S C T N Q H Y W D E
K R 6 14 P 15 M G A P V I L F S C T N Q H Y W D E K R 2 18 G 16 M G
A P V I L F S C T N Q H Y W D E K R 10 10 G 17 M G A P V I L F S C
T N Q H Y W D E K R 6 14 G 18 M G A P V I L F S C T N Q H Y W D E K
R 15 5 G 19 M G A P V I L F S C T N Q H Y W D E K R 6 14 D 20 M G A
P V I L F S C T N Q H Y W D E K R 6 14 G 21 M G A P V I L F S C T N
Q H Y W D E K R 14 6 P 22 M G A P V I L F S C T N Q H Y W D E K R 5
15 G 23 M G A P V I L F S C T N Q H Y W D E K R 4 16 G 24 M G A P V
I L F S C T N Q H Y W D E K R 13 7 P 25 M G A P V I L F S C T N Q H
Y W D E K R 5 15 E 26 M G A P V I L F S C T N Q H Y W D E K R 8 12
P 27 M G A P V I L F S C T N Q H Y W D E K R 6 14 G 28 M G A P V I
L F S C T N Q H Y W D E K R 7 13 W 29 M G A P V I L F S C T N Q H Y
W D E K R 14 6 V 30 M G A P V I L F S C T N Q H Y W D E K R 6 14 D
31 M G A P V I L F S C T N Q H Y W D E K R 13 7 P 32 M G A P V I L
F S C T N Q H Y W D E K R 2 18 R 33 M G A P V I L F S C T N Q H Y W
D E K R 15 5 T 34 M G A P V I L F S C T N Q H Y W D E K R 7 13 W 35
M G A P V I L F S C T N Q H Y W D E K R 15 5 L 36 M G A P V I L F S
C T N Q H Y W D E K R 5 15 S 37 M G A P V I L F S C T N Q H Y W D E
K R 11 9 F 38 M G A P V I L F S C T N Q H Y W D E K R 3 17 Q 39 M G
A P V I L F S C T N Q H Y W D E K R 11 9 G 40 M G A P V I L F S C T
N Q H Y W D E K R 12 8 P 41 M G A P V I L F S C T N Q H Y W D E K R
10 10 P 42 M G A P V I L F S C T N Q H Y W D E K R 10 10 G 43 M G A
P V I L F S C T N Q H Y W D E K R 10 10 G 44 M G A P V I L F S C T
N Q H Y W D E K R 5 15 P 45 M G A P V I L F S C T N Q H Y W D E K R
11 9 G 46 M G A P V I L F S C T N Q H Y W D E K R 8 12 I 47 M G A P
V I L F S C T N Q H Y W D E K R 5 15 G 48 M G A P V I L F S C T N Q
H Y W D E K R 4 16 P 49 M G A P V I L F S C T N Q H Y W D E K R 4
16 G 50 M G A P V I L F S C T N Q H Y W D E K R 10 10 V 51 M G A P
V I L F S C T N Q H Y W D E K R 2 18 G 52 M G A P V I L F S C T N Q
H Y W D E K R 2 18 P 53 M G A P V I L F S C T N Q H Y W D E K R 5
15 G 54 M G A P V I L F S C T N Q H Y W D E K R 7 13 S 55 M G A P V
I L F S C T N Q H Y W D E K R 8 12 E 56 M G A P V I L F S C T N Q H
Y W D E K R 8 12 V 57 M G A P V I L F S C T N Q H Y W D E K R 5 15
W 58 M G A P V I L F S C T N Q H Y W D E K R 14 6 G 59 M G A P V I
L F S C T N Q H Y W D E K R 14 6 I 60 M G A P V I L F S C T N Q H Y
W D E K R 3 17 P 61 M G A P V I L F S C T N Q H Y W D E K R 5 15 P
62 M G A P V I L F S C T N Q H Y W D E K R 3 17 C 63 M G A P V I L
F S C T N Q H Y W D E K R 5 15 P 64 M G A P V I L F S C T N Q H Y W
D E K R 6 14 P 65 M G A P V I L F S C T N Q H Y W D E K R 4 16 P 66
M G A P V I L F S C T N Q H Y W D E K R 6 14 Y 67 M G A P V I L F S
C T N Q H Y W D E K R 5 15 E 68 M G A P V I L F S C T N Q H Y W D E
K R 7 13 F 69 M G A P V I L F S C T N Q H Y W D E K R 4 16 C 70 M G
A P V I L F S C T N Q H Y W D E K R 6 14 G 71 M G A P V I L F S C T
N Q H Y W D E K R 2 18 G 72 M G A P V I L F S C T N Q H Y W D E K R
15 5 M 73 M G A P V I L F S C T N Q H Y W D E K R 8 12 A 74 M G A P
V I L F S C T N Q H Y W D E K R 13 7 Y 75 M G A P V I L F S C T N Q
H Y W D E K R 0 20 C 76 M G A P V I L F S C T N Q H Y W D E K R 6
14 G 77 M G A P V I L F S C T N Q H Y W D E K R 8 12 P 78 M G A P V
I L F S C T N Q H Y W D E K R 3 17 Q 79 M G A P V I L F S C T N Q H
Y W D E K R 1 19 V 80 M G A P V I L F S C T N Q H Y W D E K R 6 14
G 81 M G A P V I L F S C T N Q H Y W D E K R 5 15 V 82 M G A P V I
L F S C T N Q H Y W D E K R 4 16 G 83 M G A P V I L F S C T N Q H Y
W D E K R 15 5 L 84 M G A P V I L F S C T N Q H Y W D E K R 1 19 V
85 M G A P V I L F S C T N Q H Y W D E K R 4 16 P 86 M G A P V I L
F S C T N Q H Y W D E K R 6 14 Q 87 M G A P V I L F S C T N Q H Y W
D E K R 2 18 G 88 M G A P V I L F S C T N Q H Y W D E K R 11 9 G 89
M G A P V I L F S C T N Q H Y W D E K R 7 13 L 90 M G A P V I L F S
C T N Q H Y W D E K R 0 20 E 91 M G A P V I L F S C T N Q H Y W D E
K R 5 15 T 92 M G A P V I L F S C T N Q H Y W D E K R 10 10 S 93 M
G A P V I L F S C T N Q H Y W D E K R 12 8 Q 94 M G A P V I L F S C
T N Q H Y W D E K R 5 15 P 95 M G A P V I L F S C T N Q H Y W D E K
R 5 15 E 96 M G A P V I L F S C T N Q H Y W D E K R 8 12 G 97 M G A
P V I L F S C T N Q H Y W D E K R 8 12 E 98 M G A P V I L F S C T N
Q H Y W D E K R 10 10 A 99 M G A P V I L F S C T N Q H Y W D E K R
11 9 G 100 M G A P V I L F S C T N Q H Y W D E K R 7 13 V 101 M G A
P V I L F S C T N Q H Y W D E K R 0 20 G 102 M G A P V I L F S C T
N Q H Y W D E K R 8 12 V 103 M G A P V I L F S C T N Q H Y W D E K
R 6 14 E 104 M G A P V I L F S C T N Q H Y W D E K R 8 12 S 105 M G
A P V I L F S C T N Q H Y W D E K R 10 10 N 106 M G A P V I L F S C
T N Q H Y W D E K R 6 14 S 107 M G A P V I L F S C T N Q H Y W D E
K R 15 5 D 108 M G A P V I L F S C T N Q H Y W D E K R 4 16 G 109 M
G A P V I L F S C T N Q H Y W D E K R 1 19 A 110 M G A P V I L F S
C T N Q H Y W D E K R 11 9 S 111 M G A P V I L F S C T N Q H Y W D
E K R 5 15 P 112 M G A P V I L F S C T N Q H Y W D E K R 2 18 E 113
M G A P V I L F S C T N Q H Y W D E K R 6 14 P 114 M G A P V I L F
S C T N Q H Y W D E K R 6 14 C 115 M G A P V I L F S C T N Q H Y W
D E K R 9 11 T 116 M G A P V I L F S C T N Q H Y W D E K R 6 14 V
117 M G A P V I L F S C T N Q H Y W D E K R 4 16 T 118 M G A P V I
L F S C T N Q H Y W D E K R 7 13 P 119 M G A P V I L F S C T N Q H
Y W D E K R 4 16 G 120 M G A P V I L F S C T N Q H Y W D E K R 12 8
A 121 M G A P V I L F S C T N Q H Y W D E K R 14 6
V 122 M G A P V I L F S C T N Q H Y W D E K R 5 15 K 123 M G A P V
I L F S C T N Q H Y W D E K R 13 7 L 124 M G A P V I L F S C T N Q
H Y W D E K R 8 12 E 125 M G A P V I L F S C T N Q H Y W D E K R 4
16 K 126 M G A P V I L F S C T N Q H Y W D E K R 10 10 E 127 M G A
P V I L F S C T N Q H Y W D E K R 8 12 K 128 M G A P V I L F S C T
N Q H Y W D E K R 12 8 L 129 M G A P V I L F S C T N Q H Y W D E K
R 3 17 E 130 M G A P V I L F S C T N Q H Y W D E K R 8 12 Q 131 M G
A P V I L F S C T N Q H Y W D E K R 10 10 N 132 M G A P V I L F S C
T N Q H Y W D E K R 5 15 P 133 M G A P V I L F S C T N Q H Y W D E
K R 7 13 E 134 M G A P V I L F S C T N Q H Y W D E K R 9 11 E 135 M
G A P V I L F S C T N Q H Y W D E K R 10 10 S 136 M G A P V I L F S
C T N Q H Y W D E K R 11 9 Q 137 M G A P V I L F S C T N Q H Y W D
E K R 7 13 D 138 M G A P V I L F S C T N Q H Y W D E K R 4 16 I 139
M G A P V I L F S C T N Q H Y W D E K R 4 16 K 140 M G A P V I L F
S C T N Q H Y W D E K R 13 7 A 141 M G A P V I L F S C T N Q H Y W
D E K R 9 11 L 142 M G A P V I L F S C T N Q H Y W D E K R 2 18 Q
143 M G A P V I L F S C T N Q H Y W D E K R 9 11 K 144 M G A P V I
L F S C T N Q H Y W D E K R 12 8 E 145 M G A P V I L F S C T N Q H
Y W D E K R 9 11 L 146 M G A P V I L F S C T N Q H Y W D E K R 2 18
E 147 M G A P V I L F S C T N Q H Y W D E K R 9 11 Q 148 M G A P V
I L F S C T N Q H Y W D E K R 12 8 F 149 M G A P V I L F S C T N Q
H Y W D E K R 8 12 A 150 M G A P V I L F S C T N Q H Y W D E K R 13
7 K 151 M G A P V I L F S C T N Q H Y W D E K R 16 4 L 152 M G A P
V I L F S C T N Q H Y W D E K R 5 15 L 153 M G A P V I L F S C T N
Q H Y W D E K R 5 15 K 154 M G A P V I L F S C T N Q H Y W D E K R
17 3 Q 155 M G A P V I L F S C T N Q H Y W D E K R 9 11 K 156 M G A
P V I L F S C T N Q H Y W D E K R 16 4 R 157 M G A P V I L F S C T
N Q H Y W D E K R 16 4 I 158 M G A P V I L F S C T N Q H Y W D E K
R 7 13 T 159 M G A P V I L F S C T N Q H Y W D E K R 8 12 L 160 M G
A P V I L F S C T N Q H Y W D E K R 3 17 G 161 M G A P V I L F S C
T N Q H Y W D E K R 3 17 Y 162 M G A P V I L F S C T N Q H Y W D E
K R 9 11 T 163 M G A P V I L F S C T N Q H Y W D E K R 11 9 Q 164 M
G A P V I L F S C T N Q H Y W D E K R 13 7 A 165 M G A P V I L F S
C T N Q H Y W D E K R 6 14 D 166 M G A P V I L F S C T N Q H Y W D
E K R 6 14 V 167 M G A P V I L F S C T N Q H Y W D E K R 13 7 G 168
M G A P V I L F S C T N Q H Y W D E K R 17 3 L 169 M G A P V I L F
S C T N Q H Y W D E K R 1 19 T 170 M G A P V I L F S C T N Q H Y W
D E K R 11 9 L 171 M G A P V I L F S C T N Q H Y W D E K R 1 19 G
172 M G A P V I L F S C T N Q H Y W D E K R 8 12 V 173 M G A P V I
L F S C T N Q H Y W D E K R 4 16 L 174 M G A P V I L F S C T N Q H
Y W D E K R 2 18 F 175 M G A P V I L F S C T N Q H Y W D E K R 5 15
G 176 M G A P V I L F S C T N Q H Y W D E K R 13 7 K 177 M G A P V
I L F S C T N Q H Y W D E K R 15 5 V 178 M G A P V I L F S C T N Q
H Y W D E K R 7 13 F 179 M G A P V I L F S C T N Q H Y W D E K R 8
12 S 180 M G A P V I L F S C T N Q H Y W D E K R 12 8 Q 181 M G A P
V I L F S C T N Q H Y W D E K R 14 6 T 182 M G A P V I L F S C T N
Q H Y W D E K R 11 9 T 183 M G A P V I L F S C T N Q H Y W D E K R
9 11 I 184 M G A P V I L F S C T N Q H Y W D E K R 9 11 C 185 M G A
P V I L F S C T N Q H Y W D E K R 17 3 R 186 M G A P V I L F S C T
N Q H Y W D E K R 17 3 F 187 M G A P V I L F S C T N Q H Y W D E K
R 13 7 E 188 M G A P V I L F S C T N Q H Y W D E K R 13 7 A 189 M G
A P V I L F S C T N Q H Y W D E K R 11 9 L 190 M G A P V I L F S C
T N Q H Y W D E K R 2 18 Q 191 M G A P V I L F S C T N Q H Y W D E
K R 13 7 L 192 M G A P V I L F S C T N Q H Y W D E K R 4 16 S 193 M
G A P V I L F S C T N Q H Y W D E K R 10 10 F 194 M G A P V I L F S
C T N Q H Y W D E K R 7 13 K 195 M G A P V I L F S C T N Q H Y W D
E K R 15 5 N 196 M G A P V I L F S C T N Q H Y W D E K R 16 4 M 197
M G A P V I L F S C T N Q H Y W D E K R 12 8 C 198 M G A P V I L F
S C T N Q H Y W D E K R 14 6 K 199 M G A P V I L F S C T N Q H Y W
D E K R 9 11 L 200 M G A P V I L F S C T N Q H Y W D E K R 12 8 R
201 M G A P V I L F S C T N Q H Y W D E K R 18 2 P 202 M G A P V I
L F S C T N Q H Y W D E K R 16 4 L 203 M G A P V I L F S C T N Q H
Y W D E K R 8 12 L 204 M G A P V I L F S C T N Q H Y W D E K R 9 11
Q 205 M G A P V I L F S C T N Q H Y W D E K R 6 14 K 206 M G A P V
I L F S C T N Q H Y W D E K R 15 5 W 207 M G A P V I L F S C T N Q
H Y W D E K R 18 2 V 208 M G A P V I L F S C T N Q H Y W D E K R 13
7 E 209 M G A P V I L F S C T N Q H Y W D E K R 12 8 E 210 M G A P
V I L F S C T N Q H Y W D E K R 16 4 A 211 M G A P V I L F S C T N
Q H Y W D E K R 17 3 D 212 M G A P V I L F S C T N Q H Y W D E K R
12 8 N 213 M G A P V I L F S C T N Q H Y W D E K R 15 5 N 214 M G A
P V I L F S C T N Q H Y W D E K R 8 12 E 215 M G A P V I L F S C T
N Q H Y W D E K R 5 15 N 216 M G A P V I L F S C T N Q H Y W D E K
R 18 2 L 217 M G A P V I L F S C T N Q H Y W D E K R 10 10 Q 218 M
G A P V I L F S C T N Q H Y W D E K R 12 8 E 219 M G A P V I L F S
C T N Q H Y W D E K R 5 15 I 220 M G A P V I L F S C T N Q H Y W D
E K R 12 8 C 221 M G A P V I L F S C T N Q H Y W D E K R 17 3 K 222
M G A P V I L F S C T N Q H Y W D E K R 13 7 A 223 M G A P V I L F
S C T N Q H Y W D E K R 6 14 E 224 M G A P V I L F S C T N Q H Y W
D E K R 13 7 T 225 M G A P V I L F S C T N Q H Y W D E K R 11 9 L
226 M G A P V I L F S C T N Q H Y W D E K R 7 13 V 227 M G A P V I
L F S C T N Q H Y W D E K R 6 14 Q 228 M G A P V I L F S C T N Q H
Y W D E K R 18 2 A 229 M G A P V I L F S C T N Q H Y W D E K R 15 5
R 230 M G A P V I L F S C T N Q H Y W D E K R 18 2 K 231 M G A P V
I L F S C T N Q H Y W D E K R 14 6 R 232 M G A P V I L F S C T N Q
H Y W D E K R 18 2 K 233 M G A P V I L F S C T N Q H Y W D E K R 8
12 R 234 M G A P V I L F S C T N Q H Y W D E K R 18 2 T 235 M G A P
V I L F S C T N Q H Y W D E K R 11 9 S 236 M G A P V I L F S C T N
Q H Y W D E K R 15 5 I 237 M G A P V I L F S C T N Q H Y W D E K R
13 7 E 238 M G A P V I L F S C T N Q H Y W D E K R 9 11 N 239 M G A
P V I L F S C T N Q H Y W D E K R 14 6 R 240 M G A P V I L F S C T
N Q H Y W D E K R 18 2 V 241 M G A P V I L F S C T N Q H Y W D E K
R 11 9 R 242 M G A P V I L F S C T N Q H Y W D E K R 18 2 G 243 M G
A P V I L F S C T N Q H Y W D E K R 15 5 N 244 M G A P V I L F S C
T N Q H Y W D E K R 19 1 L 245 M G A P V I L F S C T N Q H Y W D E
K R 10 10 E 246 M G A P V I L F S C T N Q H Y W D E K R 13 7
N 247 M G A P V I L F S C T N Q H Y W D E K R 16 4 L 248 M G A P V
I L F S C T N Q H Y W D E K R 9 11 F 249 M G A P V I L F S C T N Q
H Y W D E K R 16 4 L 250 M G A P V I L F S C T N Q H Y W D E K R 16
4 Q 251 M G A P V I L F S C T N Q H Y W D E K R 18 2 C 252 M G A P
V I L F S C T N Q H Y W D E K R 16 4 P 253 M G A P V I L F S C T N
Q H Y W D E K R 17 3 K 254 M G A P V I L F S C T N Q H Y W D E K R
11 9 P 255 M G A P V I L F S C T N Q H Y W D E K R 16 4 T 256 M G A
P V I L F S C T N Q H Y W D E K R 15 5 L 257 M G A P V I L F S C T
N Q H Y W D E K R 9 11 Q 258 M G A P V I L F S C T N Q H Y W D E K
R 18 2 Q 259 M G A P V I L F S C T N Q H Y W D E K R 15 5 I 260 M G
A P V I L F S C T N Q H Y W D E K R 14 6 S 261 M G A P V I L F S C
T N Q H Y W D E K R 15 5 H 262 M G A P V I L F S C T N Q H Y W D E
K R 18 2 I 263 M G A P V I L F S C T N Q H Y W D E K R 13 7 A 264 M
G A P V I L F S C T N Q H Y W D E K R 15 5 Q 265 M G A P V I L F S
C T N Q H Y W D E K R 9 11 Q 266 M G A P V I L F S C T N Q H Y W D
E K R 18 2 L 267 M G A P V I L F S C T N Q H Y W D E K R 14 6 G 268
M G A P V I L F S C T N Q H Y W D E K R 17 3 L 269 M G A P V I L F
S C T N Q H Y W D E K R 11 9 E 270 M G A P V I L F S C T N Q H Y W
D E K R 16 4 K 271 M G A P V I L F S C T N Q H Y W D E K R 14 6 D
272 M G A P V I L F S C T N Q H Y W D E K R 15 5 V 273 M G A P V I
L F S C T N Q H Y W D E K R 15 5 V 274 M G A P V I L F S C T N Q H
Y W D E K R 16 4 R 275 M G A P V I L F S C T N Q H Y W D E K R 18 2
V 276 M G A P V I L F S C T N Q H Y W D E K R 17 3 W 277 M G A P V
I L F S C T N Q H Y W D E K R 19 1 F 278 M G A P V I L F S C T N Q
H Y W D E K R 18 2 C 279 M G A P V I L F S C T N Q H Y W D E K R 19
1 N 280 M G A P V I L F S C T N Q H Y W D E K R 18 2 R 281 M G A P
V I L F S C T N Q H Y W D E K R 18 2 R 282 M G A P V I L F S C T N
Q H Y W D E K R 13 7 Q 283 M G A P V I L F S C T N Q H Y W D E K R
18 2 K 284 M G A P V I L F S C T N Q H Y W D E K R 11 9 G 285 M G A
P V I L F S C T N Q H Y W D E K R 18 2 K 286 M G A P V I L F S C T
N Q H Y W D E K R 12 8 R 287 M G A P V I L F S C T N Q H Y W D E K
R 18 2 S 288 M G A P V I L F S C T N Q H Y W D E K R 15 5 S 289 M G
A P V I L F S C T N Q H Y W D E K R 13 7 S 290 M G A P V I L F S C
T N Q H Y W D E K R 15 5 D 291 M G A P V I L F S C T N Q H Y W D E
K R 13 7 Y 292 M G A P V I L F S C T N Q H Y W D E K R 17 3 A 293 M
G A P V I L F S C T N Q H Y W D E K R 16 4 Q 294 M G A P V I L F S
C T N Q H Y W D E K R 18 2 R 295 M G A P V I L F S C T N Q H Y W D
E K R 18 2 E 296 M G A P V I L F S C T N Q H Y W D E K R 17 3 D 297
M G A P V I L F S C T N Q H Y W D E K R 15 5 F 298 M G A P V I L F
S C T N Q H Y W D E K R 14 6 E 299 M G A P V I L F S C T N Q H Y W
D E K R 7 13 A 300 M G A P V I L F S C T N Q H Y W D E K R 16 4 A
301 M G A P V I L F S C T N Q H Y W D E K R 15 5 G 302 M G A P V I
L F S C T N Q H Y W D E K R 19 1 S 303 M G A P V I L F S C T N Q H
Y W D E K R 15 5 P 304 M G A P V I L F S C T N Q H Y W D E K R 14 6
F 305 M G A P V I L F S C T N Q H Y W D E K R 16 4 S 306 M G A P V
I L F S C T N Q H Y W D E K R 7 13 G 307 M G A P V I L F S C T N Q
H Y W D E K R 18 2 G 308 M G A P V I L F S C T N Q H Y W D E K R 19
1 P 309 M G A P V I L F S C T N Q H Y W D E K R 17 3 V 310 M G A P
V I L F S C T N Q H Y W D E K R 16 4 S 311 M G A P V I L F S C T N
Q H Y W D E K R 14 6 F 312 M G A P V I L F S C T N Q H Y W D E K R
18 2 P 313 M G A P V I L F S C T N Q H Y W D E K R 18 2 L 314 M G A
P V I L F S C T N Q H Y W D E K R 12 8 A 315 M G A P V I L F S C T
N Q H Y W D E K R 17 3 P 316 M G A P V I L F S C T N Q H Y W D E K
R 18 2 G 317 M G A P V I L F S C T N Q H Y W D E K R 19 1 P 318 M G
A P V I L F S C T N Q H Y W D E K R 18 2 H 319 M G A P V I L F S C
T N Q H Y W D E K R 18 2 F 320 M G A P V I L F S C T N Q H Y W D E
K R 18 2 G 321 M G A P V I L F S C T N Q H Y W D E K R 18 2 T 322 M
G A P V I L F S C T N Q H Y W D E K R 14 6 P 323 M G A P V I L F S
C T N Q H Y W D E K R 18 2 G 324 M G A P V I L F S C T N Q H Y W D
E K R 17 3 Y 325 M G A P V I L F S C T N Q H Y W D E K R 16 4 G 326
M G A P V I L F S C T N Q H Y W D E K R 19 1 S 327 M G A P V I L F
S C T N Q H Y W D E K R 15 5 P 328 M G A P V I L F S C T N Q H Y W
D E K R 18 2 H 329 M G A P V I L F S C T N Q H Y W D E K R 18 2 F
330 M G A P V I L F S C T N Q H Y W D E K R 16 4 T 331 M G A P V I
L F S C T N Q H Y W D E K R 17 3 A 332 M G A P V I L F S C T N Q H
Y W D E K R 14 6 L 333 M G A P V I L F S C T N Q H Y W D E K R 14 6
Y 334 M G A P V I L F S C T N Q H Y W D E K R 16 4 S 335 M G A P V
I L F S C T N Q H Y W D E K R 16 4 S 336 M G A P V I L F S C T N Q
H Y W D E K R 16 4 V 337 M G A P V I L F S C T N Q H Y W D E K R 15
5 P 338 M G A P V I L F S C T N Q H Y W D E K R 18 2 F 339 M G A P
V I L F S C T N Q H Y W D E K R 18 2 P 340 M G A P V I L F S C T N
Q H Y W D E K R 18 2 E 341 M G A P V I L F S C T N Q H Y W D E K R
15 5 G 342 M G A P V I L F S C T N Q H Y W D E K R 19 1 E 343 M G A
P V I L F S C T N Q H Y W D E K R 7 13 A 344 M G A P V I L F S C T
N Q H Y W D E K R 17 3 F 345 M G A P V I L F S C T N Q H Y W D E K
R 17 3 P 346 M G A P V I L F S C T N Q H Y W D E K R 17 3 P 347 M G
A P V I L F S C T N Q H Y W D E K R 10 10 V 348 M G A P V I L F S C
T N Q H Y W D E K R 15 5 S 349 M G A P V I L F S C T N Q H Y W D E
K R 13 3 V 350 M G A P V I L F S C T N Q H Y W D E K R 16 4 T 351 M
G A P V I L F S C T N Q H Y W D E K R 15 5 T 352 M G A P V I L F S
C T N Q H Y W D E K R 15 5 L 353 M G A P V I L F S C T N Q H Y W D
E K R 14 6 G 354 M G A P V I L F S C T N Q H Y W D E K R 19 1 S 355
M G A P V I L F S C T N Q H Y W D E K R 14 6 P 356 M G A P V I L F
S C T N Q H Y W D E K R 18 2 H 357 M G A P V I L F S C T N Q H Y W
D E K R 18 2 H 358 M G A P V I L F S C T N Q H Y W D E K R 18 2 S
359 M G A P V I L F S C T N Q H Y W D E K R 15 5 N 360 M G A P V I
L F S C T N Q H Y W D E K R 13 3
TABLE-US-00036 TABLE 18 Human Sox2 Amino Acid Substitution Matrix
(Predictions Based on PMUT Analysis) Number of Number of Predicted
Predicted Deleterious Neutral WT Position Mutations Mutations M 1 M
G A P V I L F S C T N Q H Y W D E K R 12 8 Y 2 M G A P V I L F S C
T N Q H Y W D E K R 8 12 N 3 M G A P V I L F S C T N Q H Y W D E K
R 15 5 M 4 M G A P V I L F S C T N Q H Y W D E K R 14 6 M 5 M G A P
V I L F S C T N Q H Y W D E K R 8 12 E 6 M G A P V I L F S C T N Q
H Y W D E K R 13 7 T 7 M G A P V I L F S C T N Q H Y W D E K R 10
10 E 8 M G A P V I L F S C T N Q H Y W D E K R 10 10 L 9 M G A P V
I L F S C T N Q H Y W D E K R 0 20 K 10 M G A P V I L F S C T N Q H
Y W D E K R 9 11 P 11 M G A P V I L F S C T N Q H Y W D E K R 11 9
P 12 M G A P V I L F S C T N Q H Y W D E K R 11 9 G 13 M G A P V I
L F S C T N Q H Y W D E K R 19 1 P 14 M G A P V I L F S C T N Q H Y
W D E K R 9 11 Q 15 M G A P V I L F S C T N Q H Y W D E K R 7 13 Q
16 M G A P V I L F S C T N Q H Y W D E K R 5 15 T 17 M G A P V I L
F S C T N Q H Y W D E K R 7 13 S 18 M G A P V I L F S C T N Q H Y W
D E K R 1 19 G 19 M G A P V I L F S C T N Q H Y W D E K R 11 9 G 20
M G A P V I L F S C T N Q H Y W D E K R 17 3 G 21 M G A P V I L F S
C T N Q H Y W D E K R 7 13 G 22 M G A P V I L F S C T N Q H Y W D E
K R 13 7 G 23 M G A P V I L F S C T N Q H Y W D E K R 15 5 N 24 M G
A P V I L F S C T N Q H Y W D E K R 5 15 S 25 M G A P V I L F S C T
N Q H Y W D E K R 6 14 T 26 M G A P V I L F S C T N Q H Y W D E K R
5 15 A 27 M G A P V I L F S C T N Q H Y W D E K R 14 6 A 28 M G A P
V I L F S C T N Q H Y W D E K R 3 17 A 29 M G A P V I L F S C T N Q
H Y W D E K R 10 10 A 30 M G A P V I L F S C T N Q H Y W D E K R 14
6 G 31 M G A P V I L F S C T N Q H Y W D E K R 4 16 G 32 M G A P V
I L F S C T N Q H Y W D E K R 6 14 N 33 M G A P V I L F S C T N Q H
Y W D E K R 13 7 Q 34 M G A P V I L F S C T N Q H Y W D E K R 5 15
K 35 M G A P V I L F S C T N Q H Y W D E K R 12 8 N 36 M G A P V I
L F S C T N Q H Y W D E K R 11 9 S 37 M G A P V I L F S C T N Q H Y
W D E K R 5 15 P 38 M G A P V I L F S C T N Q H Y W D E K R 1 19 D
39 M G A P V I L F S C T N Q H Y W D E K R 12 8 R 40 M G A P V I L
F S C T N Q H Y W D E K R 18 2 V 41 M G A P V I L F S C T N Q H Y W
D E K R 10 10 K 42 M G A P V I L F S C T N Q H Y W D E K R 18 2 R
43 M G A P V I L F S C T N Q H Y W D E K R 18 2 P 44 M G A P V I L
F S C T N Q H Y W D E K R 18 2 M 45 M G A P V I L F S C T N Q H Y W
D E K R 15 5 N 46 M G A P V I L F S C T N Q H Y W D E K R 17 3 A 47
M G A P V I L F S C T N Q H Y W D E K R 17 3 F 48 M G A P V I L F S
C T N Q H Y W D E K R 16 4 M 49 M G A P V I L F S C T N Q H Y W D E
K R 13 7 V 50 M G A P V I L F S C T N Q H Y W D E K R 18 2 W 51 M G
A P V I L F S C T N Q H Y W D E K R 19 1 S 52 M G A P V I L F S C T
N Q H Y W D E K R 16 4 R 53 M G A P V I L F S C T N Q H Y W D E K R
18 2 G 54 M G A P V I L F S C T N Q H Y W D E K R 14 6 Q 55 M G A P
V I L F S C T N Q H Y W D E K R 18 2 R 56 M G A P V I L F S C T N Q
H Y W D E K R 17 3 R 57 M G A P V I L F S C T N Q H Y W D E K R 18
2 K 58 M G A P V I L F S C T N Q H Y W D E K R 18 2 M 59 M G A P V
I L F S C T N Q H Y W D E K R 15 5 A 60 M G A P V I L F S C T N Q H
Y W D E K R 17 3 Q 61 M G A P V I L F S C T N Q H Y W D E K R 18 2
E 62 M G A P V I L F S C T N Q H Y W D E K R 16 4 N 63 M G A P V I
L F S C T N Q H Y W D E K R 17 3 P 64 M G A P V I L F S C T N Q H Y
W D E K R 16 4 K 65 M G A P V I L F S C T N Q H Y W D E K R 16 4 M
66 M G A P V I L F S C T N Q H Y W D E K R 13 7 H 67 M G A P V I L
F S C T N Q H Y W D E K R 18 2 N 68 M G A P V I L F S C T N Q H Y W
D E K R 18 2 S 69 M G A P V I L F S C T N Q H Y W D E K R 13 7 E 70
M G A P V I L F S C T N Q H Y W D E K R 12 8 I 71 M G A P V I L F S
C T N Q H Y W D E K R 15 5 S 72 M G A P V I L F S C T N Q H Y W D E
K R 16 4 K 73 M G A P V I L F S C T N Q H Y W D E K R 16 4 R 74 M G
A P V I L F S C T N Q H Y W D E K R 16 4 L 75 M G A P V I L F S C T
N Q H Y W D E K R 12 8 G 76 M G A P V I L F S C T N Q H Y W D E K R
17 3 A 77 M G A P V I L F S C T N Q H Y W D E K R 18 2 E 78 M G A P
V I L F S C T N Q H Y W D E K R 9 11 W 79 M G A P V I L F S C T N Q
H Y W D E K R 19 1 K 80 M G A P V I L F S C T N Q H Y W D E K R 16
4 L 81 M G A P V I L F S C T N Q H Y W D E K R 12 8 L 82 M G A P V
I L F S C T N Q H Y W D E K R 10 10 S 83 M G A P V I L F S C T N Q
H Y W D E K R 2 18 E 84 M G A P V I L F S C T N Q H Y W D E K R 10
10 T 85 M G A P V I L F S C T N Q H Y W D E K R 0 20 E 86 M G A P V
I L F S C T N Q H Y W D E K R 11 9 K 87 M G A P V I L F S C T N Q H
Y W D E K R 15 5 R 88 M G A P V I L F S C T N Q H Y W D E K R 17 3
P 89 M G A P V I L F S C T N Q H Y W D E K R 17 3 F 90 M G A P V I
L F S C T N Q H Y W D E K R 18 2 I 91 M G A P V I L F S C T N Q H Y
W D E K R 10 10 D 92 M G A P V I L F S C T N Q H Y W D E K R 11 9 E
93 M G A P V I L F S C T N Q H Y W D E K R 12 8 A 94 M G A P V I L
F S C T N Q H Y W D E K R 17 3 K 95 M G A P V I L F S C T N Q H Y W
D E K R 15 5 R 96 M G A P V I L F S C T N Q H Y W D E K R 18 2 L 97
M G A P V I L F S C T N Q H Y W D E K R 14 6 R 98 M G A P V I L F S
C T N Q H Y W D E K R 18 2 A 99 M G A P V I L F S C T N Q H Y W D E
K R 16 4 L 100 M G A P V I L F S C T N Q H Y W D E K R 5 15 H 101 M
G A P V I L F S C T N Q H Y W D E K R 18 2 M 102 M G A P V I L F S
C T N Q H Y W D E K R 13 7 K 103 M G A P V I L F S C T N Q H Y W D
E K R 14 6 E 104 M G A P V I L F S C T N Q H Y W D E K R 11 9 H 105
M G A P V I L F S C T N Q H Y W D E K R 14 6 P 106 M G A P V I L F
S C T N Q H Y W D E K R 15 5 D 107 M G A P V I L F S C T N Q H Y W
D E K R 12 8 Y 108 M G A P V I L F S C T N Q H Y W D E K R 17 3 K
109 M G A P V I L F S C T N Q H Y W D E K R 14 6 Y 110 M G A P V I
L F S C T N Q H Y W D E K R 16 4 R 111 M G A P V I L F S C T N Q H
Y W D E K R 18 2 P 112 M G A P V I L F S C T N Q H Y W D E K R 17 3
R 113 M G A P V I L F S C T N Q H Y W D E K R 17 3 R 114 M G A P V
I L F S C T N Q H Y W D E K R 18 2 K 115 M G A P V I L F S C T N Q
H Y W D E K R 14 6 T 116 M G A P V I L F S C T N Q H Y W D E K R 15
5 K 117 M G A P V I L F S C T N Q H Y W D E K R 16 4 T 118 M G A P
V I L F S C T N Q H Y W D E K R 11 9 L 119 M G A P V I L F S C T N
Q H Y W D E K R 12 8 M 120 M G A P V I L F S C T N Q H Y W D E K R
10 10 K 121 M G A P V I L F S C T N Q H Y W D E K R 14 6
K 122 M G A P V I L F S C T N Q H Y W D E K R 17 3 D 123 M G A P V
I L F S C T N Q H Y W D E K R 13 7 K 124 M G A P V I L F S C T N Q
H Y W D E K R 16 4 Y 125 M G A P V I L F S C T N Q H Y W D E K R 14
6 T 126 M G A P V I L F S C T N Q H Y W D E K R 9 11 L 127 M G A P
V I L F S C T N Q H Y W D E K R 9 11 P 128 M G A P V I L F S C T N
Q H Y W D E K R 15 5 G 129 M G A P V I L F S C T N Q H Y W D E K R
18 2 G 130 M G A P V I L F S C T N Q H Y W D E K R 19 1 L 131 M G A
P V I L F S C T N Q H Y W D E K R 8 12 L 132 M G A P V I L F S C T
N Q H Y W D E K R 6 14 A 133 M G A P V I L F S C T N Q H Y W D E K
R 13 7 P 134 M G A P V I L F S C T N Q H Y W D E K R 10 10 G 135 M
G A P V I L F S C T N Q H Y W D E K R 12 8 G 136 M G A P V I L F S
C T N Q H Y W D E K R 6 14 N 137 M G A P V I L F S C T N Q H Y W D
E K R 12 8 S 138 M G A P V I L F S C T N Q H Y W D E K R 7 13 M 139
M G A P V I L F S C T N Q H Y W D E K R 9 11 A 140 M G A P V I L F
S C T N Q H Y W D E K R 9 11 S 141 M G A P V I L F S C T N Q H Y W
D E K R 8 12 G 142 M G A P V I L F S C T N Q H Y W D E K R 14 6 V
143 M G A P V I L F S C T N Q H Y W D E K R 7 13 G 144 M G A P V I
L F S C T N Q H Y W D E K R 10 10 V 145 M G A P V I L F S C T N Q H
Y W D E K R 6 14 G 146 M G A P V I L F S C T N Q H Y W D E K R 7 13
A 147 M G A P V I L F S C T N Q H Y W D E K R 14 6 G 148 M G A P V
I L F S C T N Q H Y W D E K R 10 10 L 149 M G A P V I L F S C T N Q
H Y W D E K R 3 17 G 150 M G A P V I L F S C T N Q H Y W D E K R 15
5 A 151 M G A P V I L F S C T N Q H Y W D E K R 1 19 G 152 M G A P
V I L F S C T N Q H Y W D E K R 17 3 V 153 M G A P V I L F S C T N
Q H Y W D E K R 7 13 N 154 M G A P V I L F S C T N Q H Y W D E K R
10 10 Q 155 M G A P V I L F S C T N Q H Y W D E K R 15 5 R 156 M G
A P V I L F S C T N Q H Y W D E K R 18 2 M 157 M G A P V I L F S C
T N Q H Y W D E K R 13 7 D 158 M G A P V I L F S C T N Q H Y W D E
K R 16 4 S 159 M G A P V I L F S C T N Q H Y W D E K R 14 6 Y 160 M
G A P V I L F S C T N Q H Y W D E K R 13 7 A 161 M G A P V I L F S
C T N Q H Y W D E K R 12 8 H 162 M G A P V I L F S C T N Q H Y W D
E K R 14 6 M 163 M G A P V I L F S C T N Q H Y W D E K R 11 9 N 164
M G A P V I L F S C T N Q H Y W D E K R 16 4 G 165 M G A P V I L F
S C T N Q H Y W D E K R 12 8 W 166 M G A P V I L F S C T N Q H Y W
D E K R 16 4 S 167 M G A P V I L F S C T N Q H Y W D E K R 6 14 N
168 M G A P V I L F S C T N Q H Y W D E K R 11 9 G 169 M G A P V I
L F S C T N Q H Y W D E K R 15 5 S 170 M G A P V I L F S C T N Q H
Y W D E K R 7 13 Y 171 M G A P V I L F S C T N Q H Y W D E K R 11 9
S 172 M G A P V I L F S C T N Q H Y W D E K R 13 7 M 173 M G A P V
I L F S C T N Q H Y W D E K R 11 9 M 174 M G A P V I L F S C T N Q
H Y W D E K R 13 7 Q 175 M G A P V I L F S C T N Q H Y W D E K R 15
5 D 176 M G A P V I L F S C T N Q H Y W D E K R 13 7 Q 177 M G A P
V I L F S C T N Q H Y W D E K R 14 6 L 178 M G A P V I L F S C T N
Q H Y W D E K R 7 13 G 179 M G A P V I L F S C T N Q H Y W D E K R
16 4 Y 180 M G A P V I L F S C T N Q H Y W D E K R 17 3 P 181 M G A
P V I L F S C T N Q H Y W D E K R 13 7 Q 182 M G A P V I L F S C T
N Q H Y W D E K R 16 4 H 183 M G A P V I L F S C T N Q H Y W D E K
R 14 6 P 184 M G A P V I L F S C T N Q H Y W D E K R 15 5 G 185 M G
A P V I L F S C T N Q H Y W D E K R 10 10 L 186 M G A P V I L F S C
T N Q H Y W D E K R 4 16 N 187 M G A P V I L F S C T N Q H Y W D E
K R 17 3 A 188 M G A P V I L F S C T N Q H Y W D E K R 5 15 H 189 M
G A P V I L F S C T N Q H Y W D E K R 11 9 G 190 M G A P V I L F S
C T N Q H Y W D E K R 10 10 A 191 M G A P V I L F S C T N Q H Y W D
E K R 8 12 A 192 M G A P V I L F S C T N Q H Y W D E K R 9 11 Q 193
M G A P V I L F S C T N Q H Y W D E K R 9 11 M 194 M G A P V I L F
S C T N Q H Y W D E K R 10 10 Q 195 M G A P V I L F S C T N Q H Y W
D E K R 12 8 P 196 M G A P V I L F S C T N Q H Y W D E K R 9 11 M
197 M G A P V I L F S C T N Q H Y W D E K R 14 6 H 198 M G A P V I
L F S C T N Q H Y W D E K R 16 4 R 199 M G A P V I L F S C T N Q H
Y W D E K R 18 2 Y 200 M G A P V I L F S C T N Q H Y W D E K R 14 6
D 201 M G A P V I L F S C T N Q H Y W D E K R 15 5 V 202 M G A P V
I L F S C T N Q H Y W D E K R 3 17 S 203 M G A P V I L F S C T N Q
H Y W D E K R 11 9 A 204 M G A P V I L F S C T N Q H Y W D E K R 13
7 L 205 M G A P V I L F S C T N Q H Y W D E K R 12 8 Q 206 M G A P
V I L F S C T N Q H Y W D E K R 18 2 Y 207 M G A P V I L F S C T N
Q H Y W D E K R 16 4 N 208 M G A P V I L F S C T N Q H Y W D E K R
10 10 S 209 M G A P V I L F S C T N Q H Y W D E K R 13 7 M 210 M G
A P V I L F S C T N Q H Y W D E K R 13 7 T 211 M G A P V I L F S C
T N Q H Y W D E K R 8 12 S 212 M G A P V I L F S C T N Q H Y W D E
K R 13 7 S 213 M G A P V I L F S C T N Q H Y W D E K R 13 7 Q 214 M
G A P V I L F S C T N Q H Y W D E K R 16 4 T 215 M G A P V I L F S
C T N Q H Y W D E K R 14 6 Y 216 M G A P V I L F S C T N Q H Y W D
E K R 17 3 M 217 M G A P V I L F S C T N Q H Y W D E K R 14 6 N 218
M G A P V I L F S C T N Q H Y W D E K R 13 7 G 219 M G A P V I L F
S C T N Q H Y W D E K R 18 2 S 220 M G A P V I L F S C T N Q H Y W
D E K R 12 8 P 221 M G A P V I L F S C T N Q H Y W D E K R 13 7 T
222 M G A P V I L F S C T N Q H Y W D E K R 10 10 Y 223 M G A P V I
L F S C T N Q H Y W D E K R 14 6 S 224 M G A P V I L F S C T N Q H
Y W D E K R 13 7 M 225 M G A P V I L F S C T N Q H Y W D E K R 12 8
S 226 M G A P V I L F S C T N Q H Y W D E K R 11 9 Y 227 M G A P V
I L F S C T N Q H Y W D E K R 15 5 S 228 M G A P V I L F S C T N Q
H Y W D E K R 13 7 Q 229 M G A P V I L F S C T N Q H Y W D E K R 13
7 Q 230 M G A P V I L F S C T N Q H Y W D E K R 12 8 G 231 M G A P
V I L F S C T N Q H Y W D E K R 14 6 T 232 M G A P V I L F S C T N
Q H Y W D E K R 3 17 P 233 M G A P V I L F S C T N Q H Y W D E K R
15 5 G 234 M G A P V I L F S C T N Q H Y W D E K R 14 6 M 235 M G A
P V I L F S C T N Q H Y W D E K R 14 6 A 236 M G A P V I L F S C T
N Q H Y W D E K R 12 8 L 237 M G A P V I L F S C T N Q H Y W D E K
R 12 8 G 238 M G A P V I L F S C T N Q H Y W D E K R 19 1 S 239 M G
A P V I L F S C T N Q H Y W D E K R 15 5 M 240 M G A P V I L F S C
T N Q H Y W D E K R 14 6 G 241 M G A P V I L F S C T N Q H Y W D E
K R 19 1 S 242 M G A P V I L F S C T N Q H Y W D E K R 15 5 V 243 M
G A P V I L F S C T N Q H Y W D E K R 13 7 V 244 M G A P V I L F S
C T N Q H Y W D E K R 13 7 K 245 M G A P V I L F S C T N Q H Y W D
E K R 14 6 S 246 M G A P V I L F S C T N Q H Y W D E K R 15 5
E 247 M G A P V I L F S C T N Q H Y W D E K R 12 8 A 248 M G A P V
I L F S C T N Q H Y W D E K R 3 17 S 249 M G A P V I L F S C T N Q
H Y W D E K R 10 10 S 250 M G A P V I L F S C T N Q H Y W D E K R
10 10 S 251 M G A P V I L F S C T N Q H Y W D E K R 14 6 P 252 M G
A P V I L F S C T N Q H Y W D E K R 16 4 P 253 M G A P V I L F S C
T N Q H Y W D E K R 18 2 V 254 M G A P V I L F S C T N Q H Y W D E
K R 12 8 V 255 M G A P V I L F S C T N Q H Y W D E K R 7 13 T 256 M
G A P V I L F S C T N Q H Y W D E K R 13 7 S 257 M G A P V I L F S
C T N Q H Y W D E K R 10 10 S 258 M G A P V I L F S C T N Q H Y W D
E K R 14 6 S 259 M G A P V I L F S C T N Q H Y W D E K R 12 8 H 260
M G A P V I L F S C T N Q H Y W D E K R 18 2 S 261 M G A P V I L F
S C T N Q H Y W D E K R 14 6 R 262 M G A P V I L F S C T N Q H Y W
D E K R 18 2 A 263 M G A P V I L F S C T N Q H Y W D E K R 16 4 P
264 M G A P V I L F S C T N Q H Y W D E K R 17 3 C 265 M G A P V I
L F S C T N Q H Y W D E K R 17 3 Q 266 M G A P V I L F S C T N Q H
Y W D E K R 18 2 A 267 M G A P V I L F S C T N Q H Y W D E K R 10
10 G 268 M G A P V I L F S C T N Q H Y W D E K R 19 1 D 269 M G A P
V I L F S C T N Q H Y W D E K R 17 3 L 270 M G A P V I L F S C T N
Q H Y W D E K R 14 6 R 271 M G A P V I L F S C T N Q H Y W D E K R
18 2 D 272 M G A P V I L F S C T N Q H Y W D E K R 16 4 M 273 M G A
P V I L F S C T N Q H Y W D E K R 17 3 I 274 M G A P V I L F S C T
N Q H Y W D E K R 16 4 S 275 M G A P V I L F S C T N Q H Y W D E K
R 16 4 M 276 M G A P V I L F S C T N Q H Y W D E K R 16 4 Y 277 M G
A P V I L F S C T N Q H Y W D E K R 18 2 L 278 M G A P V I L F S C
T N Q H Y W D E K R 11 9 P 279 M G A P V I L F S C T N Q H Y W D E
K R 18 2 G 280 M G A P V I L F S C T N Q H Y W D E K R 19 1 A 281 M
G A P V I L F S C T N Q H Y W D E K R 15 5 E 282 M G A P V I L F S
C T N Q H Y W D E K R 16 4 V 283 M G A P V I L F S C T N Q H Y W D
E K R 10 10 P 284 M G A P V I L F S C T N Q H Y W D E K R 10 10 E
285 M G A P V I L F S C T N Q H Y W D E K R 10 10 P 286 M G A P V I
L F S C T N Q H Y W D E K R 14 6 A 287 M G A P V I L F S C T N Q H
Y W D E K R 15 5 A 288 M G A P V I L F S C T N Q H Y W D E K R 16 4
P 289 M G A P V I L F S C T N Q H Y W D E K R 3 17 S 290 M G A P V
I L F S C T N Q H Y W D E K R 15 5 R 291 M G A P V I L F S C T N Q
H Y W D E K R 18 2 L 292 M G A P V I L F S C T N Q H Y W D E K R 13
7 H 293 M G A P V I L F S C T N Q H Y W D E K R 19 1 M 294 M G A P
V I L F S C T N Q H Y W D E K R 13 7 S 295 M G A P V I L F S C T N
Q H Y W D E K R 12 8 Q 296 M G A P V I L F S C T N Q H Y W D E K R
18 2 H 297 M G A P V I L F S C T N Q H Y W D E K R 18 2 Y 298 M G A
P V I L F S C T N Q H Y W D E K R 17 3 Q 299 M G A P V I L F S C T
N Q H Y W D E K R 17 3 S 300 M G A P V I L F S C T N Q H Y W D E K
R 16 4 G 301 M G A P V I L F S C T N Q H Y W D E K R 17 3 P 302 M G
A P V I L F S C T N Q H Y W D E K R 8 12 V 303 M G A P V I L F S C
T N Q H Y W D E K R 16 4 P 304 M G A P V I L F S C T N Q H Y W D E
K R 18 2 G 305 M G A P V I L F S C T N Q H Y W D E K R 19 1 T 306 M
G A P V I L F S C T N Q H Y W D E K R 15 5 A 307 M G A P V I L F S
C T N Q H Y W D E K R 15 5 I 308 M G A P V I L F S C T N Q H Y W D
E K R 14 6 N 309 M G A P V I L F S C T N Q H Y W D E K R 18 2 G 310
M G A P V I L F S C T N Q H Y W D E K R 19 1 T 311 M G A P V I L F
S C T N Q H Y W D E K R 17 3 L 312 M G A P V I L F S C T N Q H Y W
D E K R 11 9 P 313 M G A P V I L F S C T N Q H Y W D E K R 18 2 L
314 M G A P V I L F S C T N Q H Y W D E K R 15 5 S 315 M G A P V I
L F S C T N Q H Y W D E K R 12 8 H 316 M G A P V I L F S C T N Q H
Y W D E K R 18 2 M 317 M G A P V I L F S C T N Q H Y W D E K R 16
4
TABLE-US-00037 TABLE 19 Human Klf4 Amino Acid Substitution Matrix
(Predictions Based on PMUT Analysis) Number of Number of Predicted
Predicted Deleterious Neutral WT Position Mutations Mutations M 1 M
G A P V I L F S C T N Q H Y W D E K R 3 17 A 2 M G A P V I L F S C
T N Q H Y W D E K R 4 16 V 3 M G A P V I L F S C T N Q H Y W D E K
R 0 20 S 4 M G A P V I L F S C T N Q H Y W D E K R 3 17 D 5 M G A P
V I L F S C T N Q H Y W D E K R 3 17 A 6 M G A P V I L F S C T N Q
H Y W D E K R 1 19 L 7 M G A P V I L F S C T N Q H Y W D E K R 0 20
L 8 M G A P V I L F S C T N Q H Y W D E K R 0 20 P 9 M G A P V I L
F S C T N Q H Y W D E K R 0 20 S 10 M G A P V I L F S C T N Q H Y W
D E K R 1 19 F 11 M G A P V I L F S C T N Q H Y W D E K R 13 7 S 12
M G A P V I L F S C T N Q H Y W D E K R 2 18 T 13 M G A P V I L F S
C T N Q H Y W D E K R 3 17 F 14 M G A P V I L F S C T N Q H Y W D E
K R 0 20 A 15 M G A P V I L F S C T N Q H Y W D E K R 0 20 S 16 M G
A P V I L F S C T N Q H Y W D E K R 1 19 G 17 M G A P V I L F S C T
N Q H Y W D E K R 5 15 P 18 M G A P V I L F S C T N Q H Y W D E K R
1 19 A 19 M G A P V I L F S C T N Q H Y W D E K R 3 17 G 20 M G A P
V I L F S C T N Q H Y W D E K R 10 10 R 21 M G A P V I L F S C T N
Q H Y W D E K R 4 16 E 22 M G A P V I L F S C T N Q H Y W D E K R 1
19 K 23 M G A P V I L F S C T N Q H Y W D E K R 1 19 T 24 M G A P V
I L F S C T N Q H Y W D E K R 0 20 L 25 M G A P V I L F S C T N Q H
Y W D E K R 0 20 R 26 M G A P V I L F S C T N Q H Y W D E K R 5 15
Q 27 M G A P V I L F S C T N Q H Y W D E K R 5 15 A 28 M G A P V I
L F S C T N Q H Y W D E K R 5 15 G 29 M G A P V I L F S C T N Q H Y
W D E K R 1 19 A 30 M G A P V I L F S C T N Q H Y W D E K R 4 16 P
31 M G A P V I L F S C T N Q H Y W D E K R 0 20 N 32 M G A P V I L
F S C T N Q H Y W D E K R 2 18 N 33 M G A P V I L F S C T N Q H Y W
D E K R 1 19 R 34 M G A P V I L F S C T N Q H Y W D E K R 7 13 W 35
M G A P V I L F S C T N Q H Y W D E K R 3 17 R 36 M G A P V I L F S
C T N Q H Y W D E K R 6 14 E 37 M G A P V I L F S C T N Q H Y W D E
K R 7 13 E 38 M G A P V I L F S C T N Q H Y W D E K R 0 20 L 39 M G
A P V I L F S C T N Q H Y W D E K R 0 20 S 40 M G A P V I L F S C T
N Q H Y W D E K R 5 15 H 41 M G A P V I L F S C T N Q H Y W D E K R
10 10 M 42 M G A P V I L F S C T N Q H Y W D E K R 1 19 K 43 M G A
P V I L F S C T N Q H Y W D E K R 12 8 R 44 M G A P V I L F S C T N
Q H Y W D E K R 12 8 L 45 M G A P V I L F S C T N Q H Y W D E K R 3
17 P 46 M G A P V I L F S C T N Q H Y W D E K R 5 15 P 47 M G A P V
I L F S C T N Q H Y W D E K R 0 20 V 48 M G A P V I L F S C T N Q H
Y W D E K R 0 20 L 49 M G A P V I L F S C T N Q H Y W D E K R 0 20
P 50 M G A P V I L F S C T N Q H Y W D E K R 4 16 G 51 M G A P V I
L F S C T N Q H Y W D E K R 0 20 R 52 M G A P V I L F S C T N Q H Y
W D E K R 11 9 P 53 M G A P V I L F S C T N Q H Y W D E K R 2 18 Y
54 M G A P V I L F S C T N Q H Y W D E K R 1 19 D 55 M G A P V I L
F S C T N Q H Y W D E K R 4 16 L 56 M G A P V I L F S C T N Q H Y W
D E K R 0 20 A 57 M G A P V I L F S C T N Q H Y W D E K R 1 19 A 58
M G A P V I L F S C T N Q H Y W D E K R 2 18 A 59 M G A P V I L F S
C T N Q H Y W D E K R 0 20 T 60 M G A P V I L F S C T N Q H Y W D E
K R 5 15 V 61 M G A P V I L F S C T N Q H Y W D E K R 0 20 A 62 M G
A P V I L F S C T N Q H Y W D E K R 0 20 T 63 M G A P V I L F S C T
N Q H Y W D E K R 7 13 D 64 M G A P V I L F S C T N Q H Y W D E K R
3 17 L 65 M G A P V I L F S C T N Q H Y W D E K R 0 20 E 66 M G A P
V I L F S C T N Q H Y W D E K R 2 18 S 67 M G A P V I L F S C T N Q
H Y W D E K R 6 14 G 68 M G A P V I L F S C T N Q H Y W D E K R 6
14 G 69 M G A P V I L F S C T N Q H Y W D E K R 6 14 A 70 M G A P V
I L F S C T N Q H Y W D E K R 5 15 G 71 M G A P V I L F S C T N Q H
Y W D E K R 14 6 A 72 M G A P V I L F S C T N Q H Y W D E K R 1 19
A 73 M G A P V I L F S C T N Q H Y W D E K R 7 13 C 74 M G A P V I
L F S C T N Q H Y W D E K R 6 14 G 75 M G A P V I L F S C T N Q H Y
W D E K R 7 13 G 76 M G A P V I L F S C T N Q H Y W D E K R 9 I I S
77 M G A P V I L F S C T N Q H Y W D E K R 4 16 N 78 M G A P V I L
F S C T N Q H Y W D E K R 7 13 L 79 M G A P V I L F S C T N Q H Y W
D E K R 0 20 A 80 M G A P V I L F S C T N Q H Y W D E K R 8 12 P 81
M G A P V I L F S C T N Q H Y W D E K R 0 20 L 82 M G A P V I L F S
C T N Q H Y W D E K R 0 20 P 83 M G A P V I L F S C T N Q H Y W D E
K R 0 20 R 84 M G A P V I L F S C T N Q H Y W D E K R 11 9 R 85 M G
A P V I L F S C T N Q H Y W D E K R 17 3 E 86 M G A P V I L F S C T
N Q H Y W D E K R 3 17 T 87 M G A P V I L F S C T N Q H Y W D E K R
0 20 E 88 M G A P V I L F S C T N Q H Y W D E K R 9 11 E 89 M G A P
V I L F S C T N Q H Y W D E K R 1 19 F 90 M G A P V I L F S C T N Q
H Y W D E K R 0 20 N 91 M G A P V I L F S C T N Q H Y W D E K R 2
18 D 92 M G A P V I L F S C T N Q H Y W D E K R 3 17 L 93 M G A P V
I L F S C T N Q H Y W D E K R 0 20 L 94 M G A P V I L F S C T N Q H
Y W D E K R 0 20 D 95 M G A P V I L F S C T N Q H Y W D E K R 6 14
L 96 M G A P V I L F S C T N Q H Y W D E K R 0 20 D 97 M G A P V I
L F S C T N Q H Y W D E K R 2 18 F 98 M G A P V I L F S C T N Q H Y
W D E K R 0 20 I 99 M G A P V I L F S C T N Q H Y W D E K R 3 17 L
100 M G A P V I L F S C T N Q H Y W D E K R 0 20 S 101 M G A P V I
L F S C T N Q H Y W D E K R 13 7 N 102 M G A P V I L F S C T N Q H
Y W D E K R 7 13 S 103 M G A P V I L F S C T N Q H Y W D E K R 1 19
L 104 M G A P V I L F S C T N Q H Y W D E K R 1 19 T 105 M G A P V
I L F S C T N Q H Y W D E K R 9 11 H 106 M G A P V I L F S C T N Q
H Y W D E K R 15 5 P 107 M G A P V I L F S C T N Q H Y W D E K R 2
18 P 108 M G A P V I L F S C T N Q H Y W D E K R 3 17 E 109 M G A P
V I L F S C T N Q H Y W D E K R 4 16 S 110 M G A P V I L F S C T N
Q H Y W D E K R 1 19 V 111 M G A P V I L F S C T N Q H Y W D E K R
1 19 A 112 M G A P V I L F S C T N Q H Y W D E K R 9 11 A 113 M G A
P V I L F S C T N Q H Y W D E K R 6 14 T 114 M G A P V I L F S C T
N Q H Y W D E K R 9 11 V 115 M G A P V I L F S C T N Q H Y W D E K
R 2 18 S 116 M G A P V I L F S C T N Q H Y W D E K R 11 9 S 117 M G
A P V I L F S C T N Q H Y W D E K R 4 16 S 118 M G A P V I L F S C
T N Q H Y W D E K R 6 14 A 119 M G A P V I L F S C T N Q H Y W D E
K R 8 12 S 120 M G A P V I L F S C T N Q H Y W D E K R 13 7 A 121 M
G A P V I L F S C T N Q H Y W D E K R 5 15
S 122 M G A P V I L F S C T N Q H Y W D E K R 10 10 S 123 M G A P V
I L F S C T N Q H Y W D E K R 10 10 S 124 M G A P V I L F S C T N Q
H Y W D E K R 2 18 S 125 M G A P V I L F S C T N Q H Y W D E K R 12
8 S 126 M G A P V I L F S C T N Q H Y W D E K R 5 15 P 127 M G A P
V I L F S C T N Q H Y W D E K R 6 14 S 128 M G A P V I L F S C T N
Q H Y W D E K R 3 17 S 129 M G A P V I L F S C T N Q H Y W D E K R
9 11 S 130 M G A P V I L F S C T N Q H Y W D E K R 11 9 G 131 M G A
P V I L F S C T N Q H Y W D E K R 16 4 P 132 M G A P V I L F S C T
N Q H Y W D E K R 11 9 A 133 M G A P V I L F S C T N Q H Y W D E K
R 4 16 S 134 M G A P V I L F S C T N Q H Y W D E K R 11 9 A 135 M G
A P V I L F S C T N Q H Y W D E K R 12 8 P 136 M G A P V I L F S C
T N Q H Y W D E K R 14 6 S 137 M G A P V I L F S C T N Q H Y W D E
K R 9 11 T 138 M G A P V I L F S C T N Q H Y W D E K R 7 13 A 139 M
G A P V I L F S C T N Q H Y W D E K R 14 6 S 140 M G A P V I L F S
C T N Q H Y W D E K R 8 12 F 141 M G A P V I L F S C T N Q H Y W D
E K R 11 9 T 142 M G A P V I L F S C T N Q H Y W D E K R 1 19 Y 143
M G A P V I L F S C T N Q H Y W D E K R 13 7 P 144 M G A P V I L F
S C T N Q H Y W D E K R 6 14 I 145 M G A P V I L F S C T N Q H Y W
D E K R 7 13 R 146 M G A P V I L F S C T N Q H Y W D E K R 7 13 A
147 M G A P V I L F S C T N Q H Y W D E K R 10 10 G 148 M G A P V I
L F S C T N Q H Y W D E K R 6 14 N 149 M G A P V I L F S C T N Q H
Y W D E K R 3 17 D 150 M G A P V I L F S C T N Q H Y W D E K R 12 8
P 151 M G A P V I L F S C T N Q H Y W D E K R 16 4 G 152 M G A P V
I L F S C T N Q H Y W D E K R 5 15 V 153 M G A P V I L F S C T N Q
H Y W D E K R 6 14 A 154 M G A P V I L F S C T N Q H Y W D E K R 10
10 P 155 M G A P V I L F S C T N Q H Y W D E K R 11 9 G 156 M G A P
V I L F S C T N Q H Y W D E K R 5 15 G 157 M G A P V I L F S C T N
Q H Y W D E K R 18 2 T 158 M G A P V I L F S C T N Q H Y W D E K R
4 16 G 159 M G A P V I L F S C T N Q H Y W D E K R 12 8 G 160 M G A
P V I L F S C T N Q H Y W D E K R 12 8 G 161 M G A P V I L F S C T
N Q H Y W D E K R 8 12 L 162 M G A P V I L F S C T N Q H Y W D E K
R 5 15 L 163 M G A P V I L F S C T N Q H Y W D E K R 2 18 Y 164 M G
A P V I L F S C T N Q H Y W D E K R 7 13 G 165 M G A P V I L F S C
T N Q H Y W D E K R 17 3 R 166 M G A P V I L F S C T N Q H Y W D E
K R 7 13 E 167 M G A P V I L F S C T N Q H Y W D E K R 6 14 S 168 M
G A P V I L F S C T N Q H Y W D E K R 8 12 A 169 M G A P V I L F S
C T N Q H Y W D E K R 14 6 P 170 M G A P V I L F S C T N Q H Y W D
E K R 13 7 P 171 M G A P V I L F S C T N Q H Y W D E K R 5 15 P 172
M G A P V I L F S C T N Q H Y W D E K R 5 15 T 173 M G A P V I L F
S C T N Q H Y W D E K R 3 17 A 174 M G A P V I L F S C T N Q H Y W
D E K R 14 6 P 175 M G A P V I L F S C T N Q H Y W D E K R 11 9 F
176 M G A P V I L F S C T N Q H Y W D E K R 15 5 N 177 M G A P V I
L F S C T N Q H Y W D E K R 11 9 L 178 M G A P V I L F S C T N Q H
Y W D E K R 5 15 A 179 M G A P V I L F S C T N Q H Y W D E K R 5 15
D 180 M G A P V I L F S C T N Q H Y W D E K R 13 7 I 181 M G A P V
I L F S C T N Q H Y W D E K R 8 12 N 182 M G A P V I L F S C T N Q
H Y W D E K R 7 13 D 183 M G A P V I L F S C T N Q H Y W D E K R 8
12 V 184 M G A P V I L F S C T N Q H Y W D E K R 9 11 S 185 M G A P
V I L F S C T N Q H Y W D E K R 7 13 P 186 M G A P V I L F S C T N
Q H Y W D E K R 8 12 S 187 M G A P V I L F S C T N Q H Y W D E K R
6 14 G 188 M G A P V I L F S C T N Q H Y W D E K R 13 7 G 189 M G A
P V I L F S C T N Q H Y W D E K R 14 6 F 190 M G A P V I L F S C T
N Q H Y W D E K R 12 8 V 191 M G A P V I L F S C T N Q H Y W D E K
R 8 12 A 192 M G A P V I L F S C T N Q H Y W D E K R 13 7 E 193 M G
A P V I L F S C T N Q H Y W D E K R 6 14 L 194 M G A P V I L F S C
T N Q H Y W D E K R 5 15 L 195 M G A P V I L F S C T N Q H Y W D E
K R 6 14 R 196 M G A P V I L F S C T N Q H Y W D E K R 11 9 P 197 M
G A P V I L F S C T N Q H Y W D E K R 7 13 E 198 M G A P V I L F S
C T N Q H Y W D E K R 4 16 L 199 M G A P V I L F S C T N Q H Y W D
E K R 8 12 D 200 M G A P V I L F S C T N Q H Y W D E K R 12 8 P 201
M G A P V I L F S C T N Q H Y W D E K R 5 15 V 202 M G A P V I L F
S C T N Q H Y W D E K R 4 16 Y 203 M G A P V I L F S C T N Q H Y W
D E K R 13 7 I 204 M G A P V I L F S C T N Q H Y W D E K R 12 8 P
205 M G A P V I L F S C T N Q H Y W D E K R 13 7 P 206 M G A P V I
L F S C T N Q H Y W D E K R 4 16 Q 207 M G A P V I L F S C T N Q H
Y W D E K R 7 13 Q 208 M G A P V I L F S C T N Q H Y W D E K R 12 8
P 209 M G A P V I L F S C T N Q H Y W D E K R 4 16 Q 210 M G A P V
I L F S C T N Q H Y W D E K R 4 16 P 211 M G A P V I L F S C T N Q
H Y W D E K R 6 14 P 212 M G A P V I L F S C T N Q H Y W D E K R 10
10 G 213 M G A P V I L F S C T N Q H Y W D E K R 16 4 G 214 M G A P
V I L F S C T N Q H Y W D E K R 11 9 G 215 M G A P V I L F S C T N
Q H Y W D E K R 14 6 L 216 M G A P V I L F S C T N Q H Y W D E K R
3 17 M 217 M G A P V I L F S C T N Q H Y W D E K R 8 12 G 218 M G A
P V I L F S C T N Q H Y W D E K R 11 9 K 219 M G A P V I L F S C T
N Q H Y W D E K R 13 7 F 220 M G A P V I L F S C T N Q H Y W D E K
R 13 7 V 221 M G A P V I L F S C T N Q H Y W D E K R 10 10 L 222 M
G A P V I L F S C T N Q H Y W D E K R 8 12 K 223 M G A P V I L F S
C T N Q H Y W D E K R 12 8 A 224 M G A P V I L F S C T N Q H Y W D
E K R 12 8 S 225 M G A P V I L F S C T N Q H Y W D E K R 3 17 L 226
M G A P V I L F S C T N Q H Y W D E K R 6 14 S 227 M G A P V I L F
S C T N Q H Y W D E K R 3 17 A 228 M G A P V I L F S C T N Q H Y W
D E K R 11 9 P 229 M G A P V I L F S C T N Q H Y W D E K R 14 6 G
230 M G A P V I L F S C T N Q H Y W D E K R 17 3 S 231 M G A P V I
L F S C T N Q H Y W D E K R 13 7 E 232 M G A P V I L F S C T N Q H
Y W D E K R 4 16 Y 233 M G A P V I L F S C T N Q H Y W D E K R 12 8
G 234 M G A P V I L F S C T N Q H Y W D E K R 14 6 S 235 M G A P V
I L F S C T N Q H Y W D E K R 6 14 P 236 M G A P V I L F S C T N Q
H Y W D E K R 6 14 S 237 M G A P V I L F S C T N Q H Y W D E K R 4
16 V 238 M G A P V I L F S C T N Q H Y W D E K R 6 14 I 239 M G A P
V I L F S C T N Q H Y W D E K R 11 9 S 240 M G A P V I L F S C T N
Q H Y W D E K R 4 16 V 241 M G A P V I L F S C T N Q H Y W D E K R
10 10 S 242 M G A P V I L F S C T N Q H Y W D E K R 13 7 K 243 M G
A P V I L F S C T N Q H Y W D E K R 4 16 G 244 M G A P V I L F S C
T N Q H Y W D E K R 13 7 S 245 M G A P V I L F S C T N Q H Y W D E
K R 12 8 P 246 M G A P V I L F S C T N Q H Y W D E K R 6 14
D 247 M G A P V I L F S C T N Q H Y W D E K R 10 10 G 248 M G A P V
I L F S C T N Q H Y W D E K R 13 7 S 249 M G A P V I L F S C T N Q
H Y W D E K R 4 16 H 250 M G A P V I L F S C T N Q H Y W D E K R 17
3 P 251 M G A P V I L F S C T N Q H Y W D E K R 11 9 V 252 M G A P
V I L F S C T N Q H Y W D E K R 11 9 V 253 M G A P V I L F S C T N
Q H Y W D E K R 7 13 V 254 M G A P V I L F S C T N Q H Y W D E K R
12 8 A 255 M G A P V I L F S C T N Q H Y W D E K R 12 8 P 256 M G A
P V I L F S C T N Q H Y W D E K R 11 9 Y 257 M G A P V I L F S C T
N Q H Y W D E K R 11 9 N 258 M G A P V I L F S C T N Q H Y W D E K
R 2 18 G 259 M G A P V I L F S C T N Q H Y W D E K R 13 7 G 260 M G
A P V I L F S C T N Q H Y W D E K R 16 4 P 261 M G A P V I L F S C
T N Q H Y W D E K R 13 7 P 262 M G A P V I L F S C T N Q H Y W D E
K R 7 13 R 263 M G A P V I L F S C T N Q H Y W D E K R 15 5 T 264 M
G A P V I L F S C T N Q H Y W D E K R 5 15 C 265 M G A P V I L F S
C T N Q H Y W D E K R 16 4 P 266 M G A P V I L F S C T N Q H Y W D
E K R 7 13 K 267 M G A P V I L F S C T N Q H Y W D E K R 5 15 I 268
M G A P V I L F S C T N Q H Y W D E K R 12 8 K 269 M G A P V I L F
S C T N Q H Y W D E K R 4 16 Q 270 M G A P V I L F S C T N Q H Y W
D E K R 8 12 E 271 M G A P V I L F S C T N Q H Y W D E K R 10 10 A
272 M G A P V I L F S C T N Q H Y W D E K R 11 9 V 273 M G A P V I
L F S C T N Q H Y W D E K R 6 14 S 274 M G A P V I L F S C T N Q H
Y W D E K R 4 16 S 275 M G A P V I L F S C T N Q H Y W D E K R 4 16
D 276 M G A P V I L F S C T N Q H Y W D E K R 13 7 T 277 M G A P V
I L F S C T N Q H Y W D E K R 14 6 H 278 M G A P V I L F S C T N Q
H Y W D E K R 15 5 L 279 M G A P V I L F S C T N Q H Y W D E K R 1
19 G 280 M G A P V I L F S C T N Q H Y W D E K R 15 5 A 281 M G A P
V I L F S C T N Q H Y W D E K R 7 13 G 282 M G A P V I L F S C T N
Q H Y W D E K R 13 7 P 283 M G A P V I L F S C T N Q H Y W D E K R
16 4 P 284 M G A P V I L F S C T N Q H Y W D E K R 9 11 L 285 M G A
P V I L F S C T N Q H Y W D E K R 3 17 S 286 M G A P V I L F S C T
N Q H Y W D E K R 4 16 N 287 M G A P V I L F S C T N Q H Y W D E K
R 8 12 G 288 M G A P V I L F S C T N Q H Y W D E K R 12 8 H 289 M G
A P V I L F S C T N Q H Y W D E K R 12 8 R 290 M G A P V I L F S C
T N Q H Y W D E K R 12 8 P 291 M G A P V I L F S C T N Q H Y W D E
K R 11 9 A 292 M G A P V I L F S C T N Q H Y W D E K R 6 14 A 293 M
G A P V I L F S C T N Q H Y W D E K R 11 9 H 294 M G A P V I L F S
C T N Q H Y W D E K R 15 5 D 295 M G A P V I L F S C T N Q H Y W D
E K R 10 10 F 296 M G A P V I L F S C T N Q H Y W D E K R 12 8 P
297 M G A P V I L F S C T N Q H Y W D E K R 7 13 L 298 M G A P V I
L F S C T N Q H Y W D E K R 7 13 G 299 M G A P V I L F S C T N Q H
Y W D E K R 15 5 R 300 M G A P V I L F S C T N Q H Y W D E K R 19 1
Q 301 M G A P V I L F S C T N Q H Y W D E K R 5 15 L 302 M G A P V
I L F S C T N Q H Y W D E K R 5 15 P 303 M G A P V I L F S C T N Q
H Y W D E K R 11 9 S 304 M G A P V I L F S C T N Q H Y W D E K R 8
12 R 305 M G A P V I L F S C T N Q H Y W D E K R 14 6 T 306 M G A P
V I L F S C T N Q H Y W D E K R 8 12 T 307 M G A P V I L F S C T N
Q H Y W D E K R 6 14 P 308 M G A P V I L F S C T N Q H Y W D E K R
13 7 T 309 M G A P V I L F S C T N Q H Y W D E K R 5 15 L 310 M G A
P V I L F S C T N Q H Y W D E K R 2 18 G 311 M G A P V I L F S C T
N Q H Y W D E K R 17 3 L 312 M G A P V I L F S C T N Q H Y W D E K
R 1 19 E 313 M G A P V I L F S C T N Q H Y W D E K R 4 16 E 314 M G
A P V I L F S C T N Q H Y W D E K R 4 16 V 315 M G A P V I L F S C
T N Q H Y W D E K R 8 12 L 316 M G A P V I L F S C T N Q H Y W D E
K R 6 14 S 317 M G A P V I L F S C T N Q H Y W D E K R 10 10 S 318
M G A P V I L F S C T N Q H Y W D E K R 13 7 R 319 M G A P V I L F
S C T N Q H Y W D E K R 15 5 D 320 M G A P V I L F S C T N Q H Y W
D E K R 9 11 D 321 M G A P V I L F S C T N Q H Y W D E K R 14 6 H
322 M G A P V I L F S C T N Q H Y W D E K R 15 5 P 323 M G A P V I
L F S C T N Q H Y W D E K R 10 10 A 324 M G A P V I L F S C T N Q H
Y W D E K R 10 10 L 325 M G A P V I L F S C T N Q H Y W D E K R 6
14 P 326 M G A P V I L F S C T N Q H Y W D E K R 15 5 L 327 M G A P
V I L F S C T N Q H Y W D E K R 6 14 P 328 M G A P V I L F S C T N
Q H Y W D E K R 14 6 P 329 M G A P V I L F S C T N Q H Y W D E K R
9 11 G 330 M G A P V I L F S C T N Q H Y W D E K R 17 3 F 331 M G A
P V I L F S C T N Q H Y W D E K R 6 14 H 332 M G A P V I L F S C T
N Q H Y W D E K R 16 4 P 333 M G A P V I L F S C T N Q H Y W D E K
R 18 2 H 334 M G A P V I L F S C T N Q H Y W D E K R 16 4 P 335 M G
A P V I L F S C T N Q H Y W D E K R 6 14 G 336 M G A P V I L F S C
T N Q H Y W D E K R 16 4 P 337 M G A P V I L F S C T N Q H Y W D E
K R 6 14 N 338 M G A P V I L F S C T N Q H Y W D E K R 8 12 Y 339 M
G A P V I L F S C T N Q H Y W D E K R 12 8 P 340 M G A P V I L F S
C T N Q H Y W D E K R 8 12 S 341 M G A P V I L F S C T N Q H Y W D
E K R 7 13 F 342 M G A P V I L F S C T N Q H Y W D E K R 12 8 L 343
M G A P V I L F S C T N Q H Y W D E K R 5 15 P 344 M G A P V I L F
S C T N Q H Y W D E K R 7 13 D 345 M G A P V I L F S C T N Q H Y W
D E K R 12 8 Q 346 M G A P V I L F S C T N Q H Y W D E K R 7 13 M
347 M G A P V I L F S C T N Q H Y W D E K R 12 8 Q 348 M G A P V I
L F S C T N Q H Y W D E K R 12 8 P 349 M G A P V I L F S C T N Q H
Y W D E K R 5 15 Q 350 M G A P V I L F S C T N Q H Y W D E K R 4 16
V 351 M G A P V I L F S C T N Q H Y W D E K R 7 13 P 352 M G A P V
I L F S C T N Q H Y W D E K R 11 9 P 353 M G A P V I L F S C T N Q
H Y W D E K R 8 12 L 354 M G A P V I L F S C T N Q H Y W D E K R 8
12 H 355 M G A P V I L F S C T N Q H Y W D E K R 13 7 Y 356 M G A P
V I L F S C T N Q H Y W D E K R 14 6 Q 357 M G A P V I L F S C T N
Q H Y W D E K R 5 15 E 358 M G A P V I L F S C T N Q H Y W D E K R
7 13 L 359 M G A P V I L F S C T N Q H Y W D E K R 6 14 M 360 M G A
P V I L F S C T N Q H Y W D E K R 7 13 P 361 M G A P V I L F S C T
N Q H Y W D E K R 16 4 P 362 M G A P V I L F S C T N Q H Y W D E K
R 17 3 G 363 M G A P V I L F S C T N Q H Y W D E K R 12 8 S 364 M G
A P V I L F S C T N Q H Y W D E K R 9 11 C 365 M G A P V I L F S C
T N Q H Y W D E K R 15 5 M 366 M G A P V I L F S C T N Q H Y W D E
K R 10 10 P 367 M G A P V I L F S C T N Q H Y W D E K R 14 6 E 368
M G A P V I L F S C T N Q H Y W D E K R 5 15 E 369 M G A P V I L F
S C T N Q H Y W D E K R 9 11 P 370 M G A P V I L F S C T N Q H Y W
D E K R 6 14 K 371 M G A P V I L F S C T N Q H Y W D E K R 14 6 P
372 M G A P V I L F S C T N Q H Y W D E K R 10 10
K 373 M G A P V I L F S C T N Q H Y W D E K R 6 14 R 374 M G A P V
I L F S C T N Q H Y W D E K R 10 10 G 375 M G A P V I L F S C T N Q
H Y W D E K R 17 3 R 376 M G A P V I L F S C T N Q H Y W D E K R 11
9 R 377 M G A P V I L F S C T N Q H Y W D E K R 17 3 S 378 M G A P
V I L F S C T N Q H Y W D E K R 9 11 W 379 M G A P V I L F S C T N
Q H Y W D E K R 2 18 P 380 M G A P V I L F S C T N Q H Y W D E K R
13 7 R 381 M G A P V I L F S C T N Q H Y W D E K R 18 2 K 382 M G A
P V I L F S C T N Q H Y W D E K R 6 14 R 383 M G A P V I L F S C T
N Q H Y W D E K R 18 2 T 384 M G A P V I L F S C T N Q H Y W D E K
R 5 15 A 385 M G A P V I L F S C T N Q H Y W D E K R 14 6 T 386 M G
A P V I L F S C T N Q H Y W D E K R 11 9 H 387 M G A P V I L F S C
T N Q H Y W D E K R 14 6 T 388 M G A P V I L F S C T N Q H Y W D E
K R 10 10 C 389 M G A P V I L F S C T N Q H Y W D E K R 17 3 D 390
M G A P V I L F S C T N Q H Y W D E K R 14 6 Y 391 M G A P V I L F
S C T N Q H Y W D E K R 11 9 A 392 M G A P V I L F S C T N Q H Y W
D E K R 14 6 G 393 M G A P V I L F S C T N Q H Y W D E K R 16 4 D
394 M G A P V I L F S C T N Q H Y W D E K R 18 2 G 395 M G A P V I
L F S C T N Q H Y W D E K R 16 4 K 396 M G A P V I L F S C T N Q H
Y W D E K R 15 5 T 397 M G A P V I L F S C T N Q H Y W D E K R 12 8
Y 398 M G A P V I L F S C T N Q H Y W D E K R 13 7 T 399 M G A P V
I L F S C T N Q H Y W D E K R 12 8 K 400 M G A P V I L F S C T N Q
H Y W D E K R 14 6 S 401 M G A P V I L F S C T N Q H Y W D E K R 14
6 S 402 M G A P V I L F S C T N Q H Y W D E K R 14 6 H 403 M G A P
V I L F S C T N Q H Y W D E K R 18 2 L 404 M G A P V I L F S C T N
Q H Y W D E K R 10 10 K 405 M G A P V I L F S C T N Q H Y W D E K R
14 6 A 406 M G A P V I L F S C T N Q H Y W D E K R 15 5 H 407 M G A
P V I L F S C T N Q H Y W D E K R 18 2 L 408 M G A P V I L F S C T
N Q H Y W D E K R 7 13 R 409 M G A P V I L F S C T N Q H Y W D E K
R 18 2 T 410 M G A P V I L F S C T N Q H Y W D E K R 14 6 H 411 M G
A P V I L F S C T N Q H Y W D E K R 15 5 T 412 M G A P V I L F S C
T N Q H Y W D E K R 12 8 G 413 M G A P V I L F S C T N Q H Y W D E
K R 16 4 E 414 M G A P V I L F S C T N Q H Y W D E K R 13 7 K 415 M
G A P V I L F S C T N Q H Y W D E K R 14 6 P 416 M G A P V I L F S
C T N Q H Y W D E K R 15 5 Y 417 M G A P V I L F S C T N Q H Y W D
E K R 13 7 H 418 M G A P V I L F S C T N Q H Y W D E K R 15 5 D 419
M G A P V I L F S C T N Q H Y W D E K R 18 2 D 420 M G A P V I L F
S C T N Q H Y W D E K R 13 7 W 421 M G A P V I L F S C T N Q H Y W
D E K R 18 2 D 422 M G A P V I L F S C T N Q H Y W D E K R 10 10 G
423 M G A P V I L F S C T N Q H Y W D E K R 16 4 D 424 M G A P V I
L F S C T N Q H Y W D E K R 18 2 G 425 M G A P V I L F S C T N Q H
Y W D E K R 16 4 W 426 M G A P V I L F S C T N Q H Y W D E K R 18 2
K 427 M G A P V I L F S C T N Q H Y W D E K R 14 6 F 428 M G A P V
I L F S C T N Q H Y W D E K R 15 5 A 429 M G A P V I L F S C T N Q
H Y W D E K R 14 6 R 430 M G A P V I L F S C T N Q H Y W D E K R 18
2 S 431 M G A P V I L F S C T N Q H Y W D E K R 12 8 D 432 M G A P
V I L F S C T N Q H Y W D E K R 17 3 E 433 M G A P V I L F S C T N
Q H Y W D E K R 16 4 L 434 M G A P V I L F S C T N Q H Y W D E K R
10 10 T 435 M G A P V I L F S C T N Q H Y W D E K R 14 6 R 436 M G
A P V I L F S C T N Q H Y W D E K R 18 2 H 437 M G A P V I L F S C
T N Q H Y W D E K R 18 2 Y 438 M G A P V I L F S C T N Q H Y W D E
K R 13 7 R 439 M G A P V I L F S C T N Q H Y W D E K R 18 2 K 440 M
G A P V I L F S C T N Q H Y W D E K R 16 4 H 441 M G A P V I L F S
C T N Q H Y W D E K R 18 2 T 442 M G A P V I L F S C T N Q H Y W D
E K R 12 8 G 443 M G A P V I L F S C T N Q H Y W D E K R 16 4 H 444
M G A P V I L F S C T N Q H Y W D E K R 15 5 R 445 M G A P V I L F
S C T N Q H Y W D E K R 16 4 P 446 M G A P V I L F S C T N Q H Y W
D E K R 16 4 F 447 M G A P V I L F S C T N Q H Y W D E K R 14 6 Q
448 M G A P V I L F S C T N Q H Y W D E K R 11 9 C 449 M G A P V I
L F S C T N Q H Y W D E K R 17 3 Q 450 M G A P V I L F S C T N Q H
Y W D E K R 12 8 K 451 M G A P V I L F S C T N Q H Y W D E K R 12 8
C 452 M G A P V I L F S C T N Q H Y W D E K R 17 3 D 453 M G A P V
I L F S C T N Q H Y W D E K R 15 5 R 454 M G A P V I L F S C T N Q
H Y W D E K R 18 2 A 455 M G A P V I L F S C T N Q H Y W D E K R 14
6 F 456 M G A P V I L F S C T N Q H Y W D E K R 13 7 S 457 M G A P
V I L F S C T N Q H Y W D E K R 12 8 R 458 M G A P V I L F S C T N
Q H Y W D E K R 18 2 S 459 M G A P V I L F S C T N Q H Y W D E K R
14 6 D 460 M G A P V I L F S C T N Q H Y W D E K R 15 5 H 461 M G A
P V I L F S C T N Q H Y W D E K R 18 2 L 462 M G A P V I L F S C T
N Q H Y W D E K R 10 10 A 463 M G A P V I L F S C T N Q H Y W D E K
R 15 5 L 464 M G A P V I L F S C T N Q H Y W D E K R 10 10 H 465 M
G A P V I L F S C T N Q H Y W D E K R 18 2 M 466 M G A P V I L F S
C T N Q H Y W D E K R 17 3 K 467 M G A P V I L F S C T N Q H Y W D
E K R 16 4 R 468 M G A P V I L F S C T N Q H Y W D E K R 18 2 H 469
M G A P V I L F S C T N Q H Y W D E K R 15 5 F 470 M G A P V I L F
S C T N Q H Y W D E K R 11 9
TABLE-US-00038 TABLE 20 Human Klf4 Amino Acid Substitution Matrix
(Predictions Based on PMUT Analysis) Number of Number of Predicted
Predicted Deleterious Neutral WT Position Mutations Mutations M 1 M
G A P V I L F S C T N Q H Y W D E K R 13 7 P 2 M G A P V I L F S C
T N Q H Y W D E K R 14 6 L 3 M G A P V I L F S C T N Q H Y W D E K
R 12 8 N 4 M G A P V I L F S C T N Q H Y W D E K R 11 9 V 5 M G A P
V I L F S C T N Q H Y W D E K R 7 13 S 6 M G A P V I L F S C T N Q
H Y W D E K R 10 10 F 7 M G A P V I L F S C T N Q H Y W D E K R 13
7 T 8 M G A P V I L F S C T N Q H Y W D E K R 0 20 N 9 M G A P V I
L F S C T N Q H Y W D E K R 8 12 R 10 M G A P V I L F S C T N Q H Y
W D E K R 9 11 N 11 M G A P V I L F S C T N Q H Y W D E K R 13 7 Y
12 M G A P V I L F S C T N Q H Y W D E K R 10 10 D 13 M G A P V I L
F S C T N Q H Y W D E K R 16 4 L 14 M G A P V I L F S C T N Q H Y W
D E K R 6 14 D 15 M G A P V I L F S C T N Q H Y W D E K R 11 9 Y 16
M G A P V I L F S C T N Q H Y W D E K R 14 6 D 17 M G A P V I L F S
C T N Q H Y W D E K R 15 5 S 18 M G A P V I L F S C T N Q H Y W D E
K R 16 4 V 19 M G A P V I L F S C T N Q H Y W D E K R 5 15 Q 20 M G
A P V I L F S C T N Q H Y W D E K R 18 2 P 21 M G A P V I L F S C T
N Q H Y W D E K R 17 3 Y 22 M G A P V I L F S C T N Q H Y W D E K R
14 6 F 23 M G A P V I L F S C T N Q H Y W D E K R 18 2 Y 24 M G A P
V I L F S C T N Q H Y W D E K R 10 10 D 25 M G A P V I L F S C T N
Q H Y W D E K R 7 13 D 26 M G A P V I L F S C T N Q H Y W D E K R
12 8 E 27 M G A P V I L F S C T N Q H Y W D E K R 11 9 E 28 M G A P
V I L F S C T N Q H Y W D E K R 8 12 E 29 M G A P V I L F S C T N Q
H Y W D E K R 10 10 N 30 M G A P V I L F S C T N Q H Y W D E K R 10
10 F 31 M G A P V I L F S C T N Q H Y W D E K R 6 14 Y 32 M G A P V
I L F S C T N Q H Y W D E K R 14 6 Q 33 M G A P V I L F S C T N Q H
Y W D E K R 4 16 Q 34 M G A P V I L F S C T N Q H Y W D E K R 15 5
Q 35 M G A P V I L F S C T N Q H Y W D E K R 12 8 Q 36 M G A P V I
L F S C T N Q H Y W D E K R 5 15 Q 37 M G A P V I L F S C T N Q H Y
W D E K R 11 9 S 38 M G A P V I L F S C T N Q H Y W D E K R 9 11 E
39 M G A P V I L F S C T N Q H Y W D E K R 13 7 L 40 M G A P V I L
F S C T N Q H Y W D E K R 10 10 Q 41 M G A P V I L F S C T N Q H Y
W D E K R 16 4 P 42 M G A P V I L F S C T N Q H Y W D E K R 11 9 P
43 M G A P V I L F S C T N Q H Y W D E K R 12 8 A 44 M G A P V I L
F S C T N Q H Y W D E K R 16 4 P 45 M G A P V I L F S C T N Q H Y W
D E K R 18 2 S 46 M G A P V I L F S C T N Q H Y W D E K R 9 11 E 47
M G A P V I L F S C T N Q H Y W D E K R 11 9 D 48 M G A P V I L F S
C T N Q H Y W D E K R 14 6 I 49 M G A P V I L F S C T N Q H Y W D E
K R 12 8 W 50 M G A P V I L F S C T N Q H Y W D E K R 18 2 K 51 M G
A P V I L F S C T N Q H Y W D E K R 16 4 K 52 M G A P V I L F S C T
N Q H Y W D E K R 16 4 F 53 M G A P V I L F S C T N Q H Y W D E K R
18 2 E 54 M G A P V I L F S C T N Q H Y W D E K R 11 9 L 55 M G A P
V I L F S C T N Q H Y W D E K R 7 13 L 56 M G A P V I L F S C T N Q
H Y W D E K R 11 9 P 57 M G A P V I L F S C T N Q H Y W D E K R 14
6 T 58 M G A P V I L F S C T N Q H Y W D E K R 15 5 P 59 M G A P V
I L F S C T N Q H Y W D E K R 16 4 P 60 M G A P V I L F S C T N Q H
Y W D E K R 15 5 L 61 M G A P V I L F S C T N Q H Y W D E K R 7 13
S 62 M G A P V I L F S C T N Q H Y W D E K R 17 3 P 63 M G A P V I
L F S C T N Q H Y W D E K R 14 6 S 64 M G A P V I L F S C T N Q H Y
W D E K R 15 5 R 65 M G A P V I L F S C T N Q H Y W D E K R 17 3 R
66 M G A P V I L F S C T N Q H Y W D E K R 15 5 S 67 M G A P V I L
F S C T N Q H Y W D E K R 14 6 G 68 M G A P V I L F S C T N Q H Y W
D E K R 13 7 L 69 M G A P V I L F S C T N Q H Y W D E K R 3 17 C 70
M G A P V I L F S C T N Q H Y W D E K R 14 6 S 71 M G A P V I L F S
C T N Q H Y W D E K R 13 7 P 72 M G A P V I L F S C T N Q H Y W D E
K R 15 5 S 73 M G A P V I L F S C T N Q H Y W D E K R 7 13 Y 74 M G
A P V I L F S C T N Q H Y W D E K R 8 12 V 75 M G A P V I L F S C T
N Q H Y W D E K R 9 11 A 76 M G A P V I L F S C T N Q H Y W D E K R
9 11 V 77 M G A P V I L F S C T N Q H Y W D E K R 2 18 T 78 M G A P
V I L F S C T N Q H Y W D E K R 19 1 P 79 M G A P V I L F S C T N Q
H Y W D E K R 3 17 F 80 M G A P V I L F S C T N Q H Y W D E K R 8
12 S 81 M G A P V I L F S C T N Q H Y W D E K R 14 6 L 82 M G A P V
I L F S C T N Q H Y W D E K R 1 19 R 83 M G A P V I L F S C T N Q H
Y W D E K R 12 8 G 84 M G A P V I L F S C T N Q H Y W D E K R 11 9
D 85 M G A P V I L F S C T N Q H Y W D E K R 9 11 N 86 M G A P V I
L F S C T N Q H Y W D E K R 3 17 D 87 M G A P V I L F S C T N Q H Y
W D E K R 13 7 G 88 M G A P V I L F S C T N Q H Y W D E K R 10 10 G
89 M G A P V I L F S C T N Q H Y W D E K R 8 12 G 90 M G A P V I L
F S C T N Q H Y W D E K R 11 9 G 91 M G A P V I L F S C T N Q H Y W
D E K R 8 12 S 92 M G A P V I L F S C T N Q H Y W D E K R 13 7 F 93
M G A P V I L F S C T N Q H Y W D E K R 4 16 S 94 M G A P V I L F S
C T N Q H Y W D E K R 12 8 T 95 M G A P V I L F S C T N Q H Y W D E
K R 16 4 A 96 M G A P V I L F S C T N Q H Y W D E K R 16 4 D 97 M G
A P V I L F S C T N Q H Y W D E K R 12 8 Q 98 M G A P V I L F S C T
N Q H Y W D E K R 16 4 L 99 M G A P V I L F S C T N Q H Y W D E K R
12 8 E 100 M G A P V I L F S C T N Q H Y W D E K R 14 6 M 101 M G A
P V I L F S C T N Q H Y W D E K R 14 6 V 102 M G A P V I L F S C T
N Q H Y W D E K R 15 5 T 103 M G A P V I L F S C T N Q H Y W D E K
R 10 10 E 104 M G A P V I L F S C T N Q H Y W D E K R 15 5 L 105 M
G A P V I L F S C T N Q H Y W D E K R 9 11 L 106 M G A P V I L F S
C T N Q H Y W D E K R 10 10 G 107 M G A P V I L F S C T N Q H Y W D
E K R 17 3 G 108 M G A P V I L F S C T N Q H Y W D E K R 10 10 D
109 M G A P V I L F S C T N Q H Y W D E K R 17 3 M 110 M G A P V I
L F S C T N Q H Y W D E K R 13 7 V 111 M G A P V I L F S C T N Q H
Y W D E K R 14 6 N 112 M G A P V I L F S C T N Q H Y W D E K R 16 4
Q 113 M G A P V I L F S C T N Q H Y W D E K R 15 5 S 114 M G A P V
I L F S C T N Q H Y W D E K R 15 5 F 115 M G A P V I L F S C T N Q
H Y W D E K R 13 7 I 116 M G A P V I L F S C T N Q H Y W D E K R 14
6 D 117 M G A P V I L F S C T N Q H Y W D E K R 16 4 D 118 M G A P
V I L F S C T N Q H Y W D E K R 14 6 P 119 M G A P V I L F S C T N
Q H Y W D E K R 13 7 D 120 M G A P V I L F S C T N Q H Y W D E K R
14 6 D 121 M G A P V I L F S C T N Q H Y W D E K R 10 10
E 122 M G A P V I L F S C T N Q H Y W D E K R 12 8 T 123 M G A P V
I L F S C T N Q H Y W D E K R 9 11 F 124 M G A P V I L F S C T N Q
H Y W D E K R 16 4 I 125 M G A P V I L F S C T N Q H Y W D E K R 9
11 K 126 M G A P V I L F S C T N Q H Y W D E K R 17 3 N 127 M G A P
V I L F S C T N Q H Y W D E K R 6 14 I 128 M G A P V I L F S C T N
Q H Y W D E K R 14 6 I 129 M G A P V I L F S C T N Q H Y W D E K R
13 7 I 130 M G A P V I L F S C T N Q H Y W D E K R 12 8 Q 131 M G A
P V I L F S C T N Q H Y W D E K R 16 4 D 132 M G A P V I L F S C T
N Q H Y W D E K R 17 3 D 133 M G A P V I L F S C T N Q H Y W D E K
R 17 3 M 134 M G A P V I L F S C T N Q H Y W D E K R 14 6 W 135 M G
A P V I L F S C T N Q H Y W D E K R 19 1 S 136 M G A P V I L F S C
T N Q H Y W D E K R 15 5 G 137 M G A P V I L F S C T N Q H Y W D E
K R 18 2 F 138 M G A P V I L F S C T N Q H Y W D E K R 17 3 S 139 M
G A P V I L F S C T N Q H Y W D E K R 16 4 A 140 M G A P V I L F S
C T N Q H Y W D E K R 17 3 A 141 M G A P V I L F S C T N Q H Y W D
E K R 16 4 A 142 M G A P V I L F S C T N Q H Y W D E K R 17 3 K 143
M G A P V I L F S C T N Q H Y W D E K R 18 2 L 144 M G A P V I L F
S C T N Q H Y W D E K R 12 8 V 145 M G A P V I L F S C T N Q H Y W
D E K R 15 5 S 146 M G A P V I L F S C T N Q H Y W D E K R 14 6 E
147 M G A P V I L F S C T N Q H Y W D E K R 14 6 K 148 M G A P V I
L F S C T N Q H Y W D E K R 17 3 L 149 M G A P V I L F S C T N Q H
Y W D E K R 14 6 A 150 M G A P V I L F S C T N Q H Y W D E K R 16 4
S 151 M G A P V I L F S C T N Q H Y W D E K R 11 9 Y 152 M G A P V
I L F S C T N Q H Y W D E K R 15 5 Q 153 M G A P V I L F S C T N Q
H Y W D E K R 17 3 A 154 M G A P V I L F S C T N Q H Y W D E K R 17
3 A 155 M G A P V I L F S C T N Q H Y W D E K R 12 8 R 156 M G A P
V I L F S C T N Q H Y W D E K R 17 3 K 157 M G A P V I L F S C T N
Q H Y W D E K R 11 9 D 158 M G A P V I L F S C T N Q H Y W D E K R
8 12 S 159 M G A P V I L F S C T N Q H Y W D E K R 9 11 G 160 M G A
P V I L F S C T N Q H Y W D E K R 10 10 S 161 M G A P V I L F S C T
N Q H Y W D E K R 7 13 P 162 M G A P V I L F S C T N Q H Y W D E K
R 13 7 N 163 M G A P V I L F S C T N Q H Y W D E K R 2 18 P 164 M G
A P V I L F S C T N Q H Y W D E K R 8 12 A 165 M G A P V I L F S C
T N Q H Y W D E K R 8 12 R 166 M G A P V I L F S C T N Q H Y W D E
K R 16 4 G 167 M G A P V I L F S C T N Q H Y W D E K R 11 9 H 168 M
G A P V I L F S C T N Q H Y W D E K R 14 6 S 169 M G A P V I L F S
C T N Q H Y W D E K R 4 16 V 170 M G A P V I L F S C T N Q H Y W D
E K R 10 10 C 171 M G A P V I L F S C T N Q H Y W D E K R 10 10 S
172 M G A P V I L F S C T N Q H Y W D E K R 10 10 T 173 M G A P V I
L F S C T N Q H Y W D E K R 10 10 S 174 M G A P V I L F S C T N Q H
Y W D E K R 13 7 S 175 M G A P V I L F S C T N Q H Y W D E K R 10
10 L 176 M G A P V I L F S C T N Q H Y W D E K R 6 14 Y 177 M G A P
V I L F S C T N Q H Y W D E K R 11 9 L 178 M G A P V I L F S C T N
Q H Y W D E K R 9 11 Q 179 M G A P V I L F S C T N Q H Y W D E K R
13 7 D 180 M G A P V I L F S C T N Q H Y W D E K R 15 5 L 181 M G A
P V I L F S C T N Q H Y W D E K R 10 10 S 182 M G A P V I L F S C T
N Q H Y W D E K R 9 11 A 183 M G A P V I L F S C T N Q H Y W D E K
R 11 9 A 184 M G A P V I L F S C T N Q H Y W D E K R 14 6 A 185 M G
A P V I L F S C T N Q H Y W D E K R 15 5 S 186 M G A P V I L F S C
T N Q H Y W D E K R 15 5 E 187 M G A P V I L F S C T N Q H Y W D E
K R 9 11 C 188 M G A P V I L F S C T N Q H Y W D E K R 18 2 I 189 M
G A P V I L F S C T N Q H Y W D E K R 14 6 D 190 M G A P V I L F S
C T N Q H Y W D E K R 16 4 P 191 M G A P V I L F S C T N Q H Y W D
E K R 16 4 S 192 M G A P V I L F S C T N Q H Y W D E K R 15 5 V 193
M G A P V I L F S C T N Q H Y W D E K R 17 3 V 194 M G A P V I L F
S C T N Q H Y W D E K R 15 5 F 195 M G A P V I L F S C T N Q H Y W
D E K R 17 3 P 196 M G A P V I L F S C T N Q H Y W D E K R 18 2 Y
197 M G A P V I L F S C T N Q H Y W D E K R 17 3 P 198 M G A P V I
L F S C T N Q H Y W D E K R 18 2 L 199 M G A P V I L F S C T N Q H
Y W D E K R 14 6 N 200 M G A P V I L F S C T N Q H Y W D E K R 11 9
D 201 M G A P V I L F S C T N Q H Y W D E K R 12 8 S 202 M G A P V
I L F S C T N Q H Y W D E K R 11 9 S 203 M G A P V I L F S C T N Q
H Y W D E K R 9 11 S 204 M G A P V I L F S C T N Q H Y W D E K R 13
7 P 205 M G A P V I L F S C T N Q H Y W D E K R 13 7 K 206 M G A P
V I L F S C T N Q H Y W D E K R 10 10 S 207 M G A P V I L F S C T N
Q H Y W D E K R 6 14 D 208 M G A P V I L F S C T N Q H Y W D E K R
12 8 A 209 M G A P V I L F S C T N Q H Y W D E K R 11 9 S 210 M G A
P V I L F S C T N Q H Y W D E K R 11 9 Q 211 M G A P V I L F S C T
N Q H Y W D E K R 1 19 D 212 M G A P V I L F S C T N Q H Y W D E K
R 14 6 S 213 M G A P V I L F S C T N Q H Y W D E K R 13 7 S 214 M G
A P V I L F S C T N Q H Y W D E K R 7 13 A 215 M G A P V I L F S C
T N Q H Y W D E K R 16 4 F 216 M G A P V I L F S C T N Q H Y W D E
K R 6 14 S 217 M G A P V I L F S C T N Q H Y W D E K R 16 4 P 218 M
G A P V I L F S C T N Q H Y W D E K R 15 5 S 219 M G A P V I L F S
C T N Q H Y W D E K R 11 9 S 220 M G A P V I L F S C T N Q H Y W D
E K R 10 10 D 221 M G A P V I L F S C T N Q H Y W D E K R 9 11 S
222 M G A P V I L F S C T N Q H Y W D E K R 14 6 L 223 M G A P V I
L F S C T N Q H Y W D E K R 6 14 L 224 M G A P V I L F S C T N Q H
Y W D E K R 9 11 S 225 M G A P V I L F S C T N Q H Y W D E K R 10
10 S 226 M G A P V I L F S C T N Q H Y W D E K R 10 10 T 227 M G A
P V I L F S C T N Q H Y W D E K R 8 12 E 228 M G A P V I L F S C T
N Q H Y W D E K R 10 10 S 229 M G A P V I L F S C T N Q H Y W D E K
R 8 12 S 230 M G A P V I L F S C T N Q H Y W D E K R 11 9 P 231 M G
A P V I L F S C T N Q H Y W D E K R 14 6 Q 232 M G A P V I L F S C
T N Q H Y W D E K R 2 18 G 233 M G A P V I L F S C T N Q H Y W D E
K R 11 9 S 234 M G A P V I L F S C T N Q H Y W D E K R 13 7 P 235 M
G A P V I L F S C T N Q H Y W D E K R 15 5 E 236 M G A P V I L F S
C T N Q H Y W D E K R 10 10 P 237 M G A P V I L F S C T N Q H Y W D
E K R 14 6 L 238 M G A P V I L F S C T N Q H Y W D E K R 5 15 V 239
M G A P V I L F S C T N Q H Y W D E K R 10 10 L 240 M G A P V I L F
S C T N Q H Y W D E K R 8 12 H 241 M G A P V I L F S C T N Q H Y W
D E K R 14 6 E 242 M G A P V I L F S C T N Q H Y W D E K R 11 9 E
243 M G A P V I L F S C T N Q H Y W D E K R 14 6 T 244 M G A P V I
L F S C T N Q H Y W D E K R 12 8 P 245 M G A P V I L F S C T N Q H
Y W D E K R 14 6 P 246 M G A P V I L F S C T N Q H Y W D E K R 15
5
T 247 M G A P V I L F S C T N Q H Y W D E K R 11 9 Y 248 M G A P V
I L F S C T N Q H Y W D E K R 11 9 S 249 M G A P V I L F S C T N Q
H Y W D E K R 10 10 S 250 M G A P V I L F S C T N Q H Y W D E K R
11 9 D 251 M G A P V I L F S C T N Q H Y W D E K R 16 4 S 252 M G A
P V I L F S C T N Q H Y W D E K R 10 10 E 253 M G A P V I L F S C T
N Q H Y W D E K R 14 6 E 254 M G A P V I L F S C T N Q H Y W D E K
R 15 5 E 255 M G A P V I L F S C T N Q H Y W D E K R 15 5 Q 256 M G
A P V I L F S C T N Q H Y W D E K R 15 5 E 257 M G A P V I L F S C
T N Q H Y W D E K R 13 7 D 258 M G A P V I L F S C T N Q H Y W D E
K R 13 7 E 259 M G A P V I L F S C T N Q H Y W D E K R 13 7 E 260 M
G A P V I L F S C T N Q H Y W D E K R 14 6 E 261 M G A P V I L F S
C T N Q H Y W D E K R 16 4 I 262 M G A P V I L F S C T N Q H Y W D
E K R 16 4 D 263 M G A P V I L F S C T N Q H Y W D E K R 17 3 V 264
M G A P V I L F S C T N Q H Y W D E K R 17 3 V 265 M G A P V I L F
S C T N Q H Y W D E K R 17 3 S 266 M G A P V I L F S C T N Q H Y W
D E K R 12 8 V 267 M G A P V I L F S C T N Q H Y W D E K R 16 4 E
268 M G A P V I L F S C T N Q H Y W D E K R 16 4 K 269 M G A P V I
L F S C T N Q H Y W D E K R 15 5 R 270 M G A P V I L F S C T N Q H
Y W D E K R 18 2 Q 271 M G A P V I L F S C T N Q H Y W D E K R 18 2
A 272 M G A P V I L F S C T N Q H Y W D E K R 8 12 P 273 M G A P V
I L F S C T N Q H Y W D E K R 13 7 G 274 M G A P V I L F S C T N Q
H Y W D E K R 7 13 K 275 M G A P V I L F S C T N Q H Y W D E K R 15
5 R 276 M G A P V I L F S C T N Q H Y W D E K R 18 2 S 277 M G A P
V I L F S C T N Q H Y W D E K R 12 8 E 278 M G A P V I L F S C T N
Q H Y W D E K R 12 8 S 279 M G A P V I L F S C T N Q H Y W D E K R
13 7 G 280 M G A P V I L F S C T N Q H Y W D E K R 15 5 S 281 M G A
P V I L F S C T N Q H Y W D E K R 11 9 P 282 M G A P V I L F S C T
N Q H Y W D E K R 9 11 S 283 M G A P V I L F S C T N Q H Y W D E K
R 14 6 A 284 M G A P V I L F S C T N Q H Y W D E K R 13 7 G 285 M G
A P V I L F S C T N Q H Y W D E K R 9 11 G 286 M G A P V I L F S C
T N Q H Y W D E K R 15 5 H 287 M G A P V I L F S C T N Q H Y W D E
K R 15 5 S 288 M G A P V I L F S C T N Q H Y W D E K R 12 8 K 289 M
G A P V I L F S C T N Q H Y W D E K R 17 3 P 290 M G A P V I L F S
C T N Q H Y W D E K R 14 6 P 291 M G A P V I L F S C T N Q H Y W D
E K R 11 9 H 292 M G A P V I L F S C T N Q H Y W D E K R 15 5 S 293
M G A P V I L F S C T N Q H Y W D E K R 16 4 P 294 M G A P V I L F
S C T N Q H Y W D E K R 17 3 L 295 M G A P V I L F S C T N Q H Y W
D E K R 15 5 V 296 M G A P V I L F S C T N Q H Y W D E K R 15 5 L
297 M G A P V I L F S C T N Q H Y W D E K R 16 4 K 298 M G A P V I
L F S C T N Q H Y W D E K R 18 2 R 299 M G A P V I L F S C T N Q H
Y W D E K R 19 1 C 300 M G A P V I L F S C T N Q H Y W D E K R 18 2
H 301 M G A P V I L F S C T N Q H Y W D E K R 17 3 V 302 M G A P V
I L F S C T N Q H Y W D E K R 16 4 S 303 M G A P V I L F S C T N Q
H Y W D E K R 12 8 T 304 M G A P V I L F S C T N Q H Y W D E K R 11
9 H 305 M G A P V I L F S C T N Q H Y W D E K R 15 5 Q 306 M G A P
V I L F S C T N Q H Y W D E K R 18 2 H 307 M G A P V I L F S C T N
Q H Y W D E K R 18 2 N 308 M G A P V I L F S C T N Q H Y W D E K R
18 2 Y 309 M G A P V I L F S C T N Q H Y W D E K R 18 2 A 310 M G A
P V I L F S C T N Q H Y W D E K R 17 3 A 311 M G A P V I L F S C T
N Q H Y W D E K R 18 2 P 312 M G A P V I L F S C T N Q H Y W D E K
R 19 1 P 313 M G A P V I L F S C T N Q H Y W D E K R 17 3 S 314 M G
A P V I L F S C T N Q H Y W D E K R 15 5 T 315 M G A P V I L F S C
T N Q H Y W D E K R 12 8 R 316 M G A P V I L F S C T N Q H Y W D E
K R 17 3 K 317 M G A P V I L F S C T N Q H Y W D E K R 12 8 D 318 M
G A P V I L F S C T N Q H Y W D E K R 15 5 Y 319 M G A P V I L F S
C T N Q H Y W D E K R 16 4 P 320 M G A P V I L F S C T N Q H Y W D
E K R 17 3 A 321 M G A P V I L F S C T N Q H Y W D E K R 15 5 A 322
M G A P V I L F S C T N Q H Y W D E K R 11 9 K 323 M G A P V I L F
S C T N Q H Y W D E K R 17 3 P 324 M G A P V I L F S C T N Q H Y W
D E K R 18 2 V 325 M G A P V I L F S C T N Q H Y W D E K R 4 16 K
326 M G A P V I L F S C T N Q H Y W D E K R 16 4 L 327 M G A P V I
L F S C T N Q H Y W D E K R 14 6 D 328 M G A P V I L F S C T N Q H
Y W D E K R 14 6 S 329 M G A P V I L F S C T N Q H Y W D E K R 15 5
V 330 M G A P V I L F S C T N Q H Y W D E K R 5 15 R 331 M G A P V
I L F S C T N Q H Y W D E K R 18 2 V 332 M G A P V I L F S C T N Q
H Y W D E K R 16 4 L 333 M G A P V I L F S C T N Q H Y W D E K R 11
9 R 334 M G A P V I L F S C T N Q H Y W D E K R 15 5 Q 335 M G A P
V I L F S C T N Q H Y W D E K R 14 6 I 336 M G A P V I L F S C T N
Q H Y W D E K R 14 6 S 337 M G A P V I L F S C T N Q H Y W D E K R
16 4 N 338 M G A P V I L F S C T N Q H Y W D E K R 13 7 N 339 M G A
P V I L F S C T N Q H Y W D E K R 12 8 R 340 M G A P V I L F S C T
N Q H Y W D E K R 18 2 K 341 M G A P V I L F S C T N Q H Y W D E K
R 18 2 C 342 M G A P V I L F S C T N Q H Y W D E K R 18 2 T 343 M G
A P V I L F S C T N Q H Y W D E K R 5 15 S 344 M G A P V I L F S C
T N Q H Y W D E K R 14 6 P 345 M G A P V I L F S C T N Q H Y W D E
K R 17 3 R 346 M G A P V I L F S C T N Q H Y W D E K R 19 1 S 347 M
G A P V I L F S C T N Q H Y W D E K R 16 4 S 348 M G A P V I L F S
C T N Q H Y W D E K R 17 3 D 349 M G A P V I L F S C T N Q H Y W D
E K R 16 4 T 350 M G A P V I L F S C T N Q H Y W D E K R 11 9 E 351
M G A P V I L F S C T N Q H Y W D E K R 15 5 E 352 M G A P V I L F
S C T N Q H Y W D E K R 15 5 N 353 M G A P V I L F S C T N Q H Y W
D E K R 17 3 V 354 M G A P V I L F S C T N Q H Y W D E K R 1 19 K
355 M G A P V I L F S C T N Q H Y W D E K R 16 4 R 356 M G A P V I
L F S C T N Q H Y W D E K R 18 2 R 357 M G A P V I L F S C T N Q H
Y W D E K R 18 2 T 358 M G A P V I L F S C T N Q H Y W D E K R 16 4
H 359 M G A P V I L F S C T N Q H Y W D E K R 18 2 N 360 M G A P V
I L F S C T N Q H Y W D E K R 18 2 V 361 M G A P V I L F S C T N Q
H Y W D E K R 16 4 L 362 M G A P V I L F S C T N Q H Y W D E K R 16
4 E 363 M G A P V I L F S C T N Q H Y W D E K R 17 3 R 364 M G A P
V I L F S C T N Q H Y W D E K R 18 2 Q 365 M G A P V I L F S C T N
Q H Y W D E K R 18 2 R 366 M G A P V I L F S C T N Q H Y W D E K R
18 2 R 367 M G A P V I L F S C T N Q H Y W D E K R 18 2 N 368 M G A
P V I L F S C T N Q H Y W D E K R 15 5 E 369 M G A P V I L F S C T
N Q H Y W D E K R 15 5 L 370 M G A P V I L F S C T N Q H Y W D E K
R 16 4 K 371 M G A P V I L F S C T N Q H Y W D E K R 18 2 R 372 M G
A P V I L F S C T N Q H Y W D E K R 18 2
S 373 M G A P V I L F S C T N Q H Y W D E K R 17 3 F 374 M G A P V
I L F S C T N Q H Y W D E K R 18 2 F 375 M G A P V I L F S C T N Q
H Y W D E K R 18 2 A 376 M G A P V I L F S C T N Q H Y W D E K R 17
3 L 377 M G A P V I L F S C T N Q H Y W D E K R 16 4 R 378 M G A P
V I L F S C T N Q H Y W D E K R 19 1 D 379 M G A P V I L F S C T N
Q H Y W D E K R 15 5 Q 380 M G A P V I L F S C T N Q H Y W D E K R
18 2 I 381 M G A P V I L F S C T N Q H Y W D E K R 15 5 P 382 M G A
P V I L F S C T N Q H Y W D E K R 18 2 E 383 M G A P V I L F S C T
N Q H Y W D E K R 15 5 L 384 M G A P V I L F S C T N Q H Y W D E K
R 13 7 E 385 M G A P V I L F S C T N Q H Y W D E K R 13 7 N 386 M G
A P V I L F S C T N Q H Y W D E K R 15 5 N 387 M G A P V I L F S C
T N Q H Y W D E K R 15 5 E 388 M G A P V I L F S C T N Q H Y W D E
K R 14 6 K 389 M G A P V I L F S C T N Q H Y W D E K R 18 2 A 390 M
G A P V I L F S C T N Q H Y W D E K R 17 3 P 391 M G A P V I L F S
C T N Q H Y W D E K R 17 3 K 392 M G A P V I L F S C T N Q H Y W D
E K R 18 2 V 393 M G A P V I L F S C T N Q H Y W D E K R 18 2 V 394
M G A P V I L F S C T N Q H Y W D E K R 18 2 I 395 M G A P V I L F
S C T N Q H Y W D E K R 16 4 L 396 M G A P V I L F S C T N Q H Y W
D E K R 16 4 K 397 M G A P V I L F S C T N Q H Y W D E K R 18 2 K
398 M G A P V I L F S C T N Q H Y W D E K R 18 2 A 399 M G A P V I
L F S C T N Q H Y W D E K R 17 3 T 400 M G A P V I L F S C T N Q H
Y W D E K R 16 4 A 401 M G A P V I L F S C T N Q H Y W D E K R 13 7
Y 402 M G A P V I L F S C T N Q H Y W D E K R 16 4 I 403 M G A P V
I L F S C T N Q H Y W D E K R 15 5 L 404 M G A P V I L F S C T N Q
H Y W D E K R 14 6 S 405 M G A P V I L F S C T N Q H Y W D E K R 16
4 V 406 M G A P V I L F S C T N Q H Y W D E K R 12 8 Q 407 M G A P
V I L F S C T N Q H Y W D E K R 18 2 A 408 M G A P V I L F S C T N
Q H Y W D E K R 16 4 E 409 M G A P V I L F S C T N Q H Y W D E K R
10 10 E 410 M G A P V I L F S C T N Q H Y W D E K R 17 3 Q 411 M G
A P V I L F S C T N Q H Y W D E K R 16 4 K 412 M G A P V I L F S C
T N Q H Y W D E K R 18 2 L 413 M G A P V I L F S C T N Q H Y W D E
K R 16 4 I 414 M G A P V I L F S C T N Q H Y W D E K R 16 4 S 415 M
G A P V I L F S C T N Q H Y W D E K R 15 5 E 416 M G A P V I L F S
C T N Q H Y W D E K R 17 3 E 417 M G A P V I L F S C T N Q H Y W D
E K R 10 10 D 418 M G A P V I L F S C T N Q H Y W D E K R 17 3 L
419 M G A P V I L F S C T N Q H Y W D E K R 13 7 L 420 M G A P V I
L F S C T N Q H Y W D E K R 16 4 R 421 M G A P V I L F S C T N Q H
Y W D E K R 18 2 K 422 M G A P V I L F S C T N Q H Y W D E K R 15 5
R 423 M G A P V I L F S C T N Q H Y W D E K R 18 2 R 424 M G A P V
I L F S C T N Q H Y W D E K R 18 2 E 425 M G A P V I L F S C T N Q
H Y W D E K R 16 4 Q 426 M G A P V I L F S C T N Q H Y W D E K R 18
2 L 427 M G A P V I L F S C T N Q H Y W D E K R 17 3 K 428 M G A P
V I L F S C T N Q H Y W D E K R 18 2 H 429 M G A P V I L F S C T N
Q H Y W D E K R 18 2 K 430 M G A P V I L F S C T N Q H Y W D E K R
18 2 L 431 M G A P V I L F S C T N Q H Y W D E K R 17 3 E 432 M G A
P V I L F S C T N Q H Y W D E K R 17 3 Q 433 M G A P V I L F S C T
N Q H Y W D E K R 18 2 L 434 M G A P V I L F S C T N Q H Y W D E K
R 17 3 R 435 M G A P V I L F S C T N Q H Y W D E K R 19 1 N 436 M G
A P V I L F S C T N Q H Y W D E K R 18 2 S 437 M G A P V I L F S C
T N Q H Y W D E K R 16 4 C 438 M G A P V I L F S C T N Q H Y W D E
K R 19 1 A 439 M G A P V I L F S C T N Q H Y W D E K R 18 2
TABLE-US-00039 TABLE 21 Probe Sets ID, Gene Name, and Gene
Description for Hierarchical Clustering Analysis (The International
Stem Cell Initiative) Probe Set ID Gene Name Gene Description AFFX-
GAPDH glyceraldehyde-3-phosphate dehydrogenase HUMGAPDH/M33197_M_at
AFFX- GAPDH glyceraldehyde-3-phosphate dehydrogenase
HUMGAPDH/M33197_5_at AFFX- GAPDH glyceraldehyde-3-phosphate
dehydrogenase HUMGAPDH/M33197_3_at 40284_at FOXA2 forkhead box A2
244849_at SEMA3A sema domain, immunoglobulin domain (Ig), short
basicdomain, secreted, (semaphorin) 3A 244163_at SEMA3A sema
domain, immunoglobulin domain (Ig), short basicdomain, secreted,
(semaphorin) 3A 243712_at XIST X (inactive)-specific transcript
243692_at GATA4 GATA binding protein 4 243161_x_at ZFP42 zinc
finger protein 42 homolog (mouse) 242622_x_at PTEN Phosphatase and
tensin homolog (mutated in multipleadvanced cancers 1) 241861_at
SYCP3 Synaptonemal complex protein 3 241609_at FOXD3 Forkhead box
D3 237896_at NODAL nodal homolog (mouse) 236930_at NUMB Numb
homolog (Drosophila) 236859_at RUNX2 runt-related transcription
factor 2 235795_at PAX6 paired box gene 6 (aniridia, keratitis)
234967_at IL6ST interleukin 6 signal transducer (gp130, oncostatin
Mreceptor) 234474_x_at IL6ST interleukin 6 signal transducer
(gp130, oncostatin Mreceptor) 233322_at CD9 CD9 molecule 233317_at
CD9 CD9 molecule 233314_at PTEN phosphatase and tensin homolog
(mutated in multipleadvanced cancers 1) 233254_x_at PTEN
phosphatase and tensin homolog (mutated in multipleadvanced cancers
1) 232809_s_at FLT1 Fms-related tyrosine kinase 1 (vascular
endothelialgrowth factor/vascular permeability factor receptor)
232231_at RUNX2 runt-related transcription factor 2 231798_at NOG
Noggin 231776_at EOMES eomesodermin homolog (Xenopus laevis)
231592_at XIST X (inactive)-specific transcript 230916_at NODAL
nodal homolog (mouse) 230855_at GATA4 GATA binding protein 4
230462_at NUMB numb homolog (Drosophila) 230318_at SERPINA1 Serpin
peptidase inhibitor, clade A (alpha-1antiproteinase, antitrypsin),
member 1 229724_at GABRB3 gamma-aminobutyric acid (GABA) A
receptor, beta 3 229346_at NES nestin 229341_at TFCP2L1
Transcription factor CP2-like 1 229282_at GATA6 GATA binding
protein 6 229259_at GFAP glial fibrillary acidic protein 228038_at
SOX2 SRY (sex determining region Y)-box 2 227830_at GABRB3
gamma-aminobutyric acid (GABA) A receptor, beta 3 227771_at LIFR
leukemia inhibitory factor receptor alpha 227690_at GABRB3
gamma-aminobutyric acid (GABA) A receptor, beta 3 227671_at XIST X
(inactive)-specific transcript 227642_at TFCP2L1 Transcription
factor CP2-like 1 227469_at PTEN Phosphatase and tensin homolog
(mutated in multipleadvanced cancers 1) 227048_at LAMA1 laminin,
alpha 1 225575_at LIFR leukemia inhibitory factor receptor alpha
225571_at LIFR leukemia inhibitory factor receptor alpha 225363_at
PTEN phosphatase and tensin homolog (mutated in multipleadvanced
cancers 1) 224590_at XIST X (inactive)-specific transcript
224589_at XIST X (inactive)-specific transcript 224588_at XIST X
(inactive)-specific transcript 223963_s_at IGF2BP2 insulin-like
growth factor 2 mRNA binding protein 2 223679_at CTNNB1 catenin
(cadherin-associated protein), beta 1, 88 kDa 223122_s_at SFRP2
secreted frizzled-related protein 2 223121_s_at SFRP2 secreted
frizzled-related protein 2 222346_at LAMA1 laminin, alpha 1
222176_at PTEN phosphatase and tensin homolog (mutated in
multipleadvanced cancers 1) 222033_s_at FLT1 Fms-related tyrosine
kinase 1 (vascular endothelialgrowth factor/vascular permeability
factor receptor) 221728_x_at XIST X (inactive)-specific transcript
221630_s_at DDX4 DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 221283_at
RUNX2 runt-related transcription factor 2 221282_x_at RUNX2
runt-related transcription factor 2 220668_s_at DNMT3B DNA
(cytosine-5-)-methyltransferase 3 beta 220184_at NANOG Nanog
homeobox 220053_at GDF3 growth differentiation factor 3 219993_at
SOX17 SRY (sex determining region Y)-box 17 219823_at LIN28 lin-28
homolog (C. elegans) 219735_s_at TFCP2L1 transcription factor
CP2-like 1 219177_at BXDC2 brix domain containing 2 218847_at
IGF2BP2 insulin-like growth factor 2 mRNA binding protein 2
218678_at NES nestin 218048_at COMMD3 COMM domain containing 3
217430_x_at COL1A1 collagen, type I, alpha 1 217404_s_at COL2A1
collagen, type II, alpha 1 (primary osteoarthritis,
spondyloepiphyseal dysplasia, congenital) 217398_x_at GAPDH
glyceraldehyde-3-phosphate dehydrogenase 217246_s_at DIAPH2
diaphanous homolog 2 (Drosophila) 217232_x_at HBB hemoglobin, beta
216994_s_at RUNX2 runt-related transcription factor 2 216953_s_at
WT1 Wilms tumor 1 216947_at DES desmin 216442_x_at FN1 fibronectin
1 214702_at FN1 fibronectin 1 214701_s_at FN1 fibronectin 1
214614_at HLXB9 homeobox HB9 214532_x_at LOC642559///LOC645682///
POU domain, class 5, transcription factor 1 /// POUdomain, class 5,
POU5F1 /// transcription factor 1 pseudogene 1/// POU domain, class
5, transcription factor 1 pseudogene 214413_at TAT Tyrosine
aminotransferase 214312_at FOXA2 forkhead box A2 214240_at GAL
galanin 214218_s_at XIST X (inactive)-specific transcript
214178_s_at SOX2 SRY (sex determining region Y)-box 2 214022_s_at
IFITM1 interferon induced transmembrane protein 1 (9-27) 213921_at
SST somatostatin 213825_at OLIG2 oligodendrocyte lineage
transcription factor 2 213824_at OLIG2 oligodendrocyte lineage
transcription factor 2 213722_at SOX2 SRY (sex determining region
Y)-box 2 213721_at SOX2 SRY (sex determining region Y)-box 2
213492_at COL2A1 collagen, type II, alpha 1 (primary
osteoarthritis, spondyloepiphyseal dysplasia, congenital)
213453_x_at GAPDH glyceraldehyde-3-phosphate dehydrogenase
213200_at SYP synaptophysin 212581_x_at GAPDH
glyceraldehyde-3-phosphate dehydrogenase 212464_s_at FN1
fibronectin 1 212196_at IL6ST Interleukin 6 signal transducer
(gp130, oncostatin Mreceptor) 212195_at IL6ST Interleukin 6 signal
transducer (gp130, oncostatin Mreceptor) 211719_x_at FN1
fibronectin 1 211711_s_at PTEN phosphatase and tensin homolog
(mutated in multipleadvanced cancers 1) 211696_x_at HBB hemoglobin,
beta 211651_s_at LAMB1 laminin, beta 1 211429_s_at SERPINA1 serpin
peptidase inhibitor, clade A (alpha-1antiproteinase, antitrypsin),
member 1 211428_at SERPINA1 serpin peptidase inhibitor, clade A
(alpha-1antiproteinase, antitrypsin), member 1 211402_x_at NR6A1
nuclear receptor subfamily 6, group A, member 1 211176_s_at PAX4
paired box gene 4 211000_s_at IL6ST interleukin 6 signal transducer
(gp130, oncostatin Mreceptor) 210938_at PDX1 pancreatic and
duodenal homeobox 1 210937_s_at PDX1 pancreatic and duodenal
homeobox 1 210761_s_at GRB7 growth factor receptor-bound protein 7
210560_at GBX2 gastrulation brain homeobox 2 210495_x_at FN1
fibronectin 1 210392_x_at NR6A1 nuclear receptor subfamily 6, group
A, member 1 210391_at NR6A1 nuclear receptor subfamily 6, group A,
member 1 210311_at FGF5 fibroblast growth factor 5 210310_s_at FGF5
fibroblast growth factor 5 210287_s_at FLT1 fms-related tyrosine
kinase 1 (vascular endothelialgrowth factor/vascular permeability
factor receptor) 210174_at NR5A2 nuclear receptor subfamily 5,
group A, member 2 210103_s_at FOXA2 forkhead box A2 210002_at GATA6
GATA binding protein 6 209957_s_at NPPA natriuretic peptide
precursor A 209543_s_at CD34 CD34 molecule 209116_x_at HBB
hemoglobin, beta 209073_s_at NUMB numb homolog (Drosophila)
208983_s_at PECAM1 platelet/endothelial cell adhesion molecule
(CD31 208982_at PECAM1 platelet/endothelial cell adhesion molecule
(CD31 208981_at PECAM1 platelet/endothelial cell adhesion molecule
(CD31 208559_at PDX1 pancreatic and duodenal homeobox 1 208500_x_at
FOXD3 forkhead box D3 208378_x_at FGF5 fibroblast growth factor 5
208343_s_at NR5A2 nuclear receptor subfamily 5, group A, member 2
208337_s_at NR5A2 nuclear receptor subfamily 5, group A, member 2
208291_s_at TH tyrosine hydroxylase 208286_x_at
LOC642559///LOC645682/// POU domain, class 5, transcription factor
1 /// POUdomain, class 5, POU5F1 /// transcription factor 1
pseudogene 1/// POU domain, class 5, transcription factor 1
pseudogene 208275_x_at UTF1 undifferentiated embryonic cell
transcription factor 1 207867_at PAX4 paired box gene 4 207742_s_at
NR6A1 nuclear receptor subfamily 6, group A, member 1 207545_s_at
NUMB numb homolog (Drosophila) 207466_at GAL galanin 207424_at MYF5
myogenic factor 5 207199_at TERT telomerase reverse transcriptase
207062_at IAPP islet amyloid polypeptide 206916_x_at TAT tyrosine
aminotransferase 206805_at SEMA3A sema domain, immunoglobulin
domain (Ig), short basicdomain, secreted, (semaphorin) 3A 206783_at
FGF4 fibroblast growth factor 4 (heparin secretory transforming
protein 1, Kaposi sarcoma oncogene) 206701_x_at EDNRB endothelin
receptor type B 206657_s_at MYOD1 myogenic differentiation 1
206647_at HBZ hemoglobin, zeta 206598_at INS insulin 206524_at T T,
brachyury homolog (mouse) 206422_at GCG glucagon 206387_at CDX2
caudal type homeobox transcription factor 2 206286_s_at TDGF1
///TDGF3 teratocarcinoma-derived growth factor 1
///teratocarcinoma-derived growth factor 3, pseudogene 206282_at
NEUROD1 neurogenic differentiation 1 206269_at GCM1 glial cells
missing homolog 1 (Drosophila) 206268_at LEFTY1 left-right
determination factor 1 206104_at ISL1 ISL1 transcription factor,
LIM/homeodomain, (islet-1) 206067_s_at WT1 Wilms tumor 1 206012_at
LEFTY2 left-right determination factor 2 205900_at KRT1 keratin 1
(epidermolytic hyperkeratosis) 205876_at LIFR leukemia inhibitory
factor receptor alpha 205850_s_at GABRB3 gamma-aminobutyric acid
(GABA) A receptor, beta 3 205726_at DIAPH2 diaphanous homolog 2
(Drosophila) 205646_s_at PAX6 paired box gene 6 (aniridia,
keratitis) 205603_s_at DIAPH2 diaphanous homolog 2 (Drosophila)
205517_at GATA4 GATA binding protein 4 205387_s_at CGB ///CGB5
///CGB7 chorionic gonadotropin, beta polypeptide ///
chorionicgonadotropin, beta polypeptide 5 ///
chorionicgonadotropin, beta polypeptide 7 205132_at ACTC1 actin,
alpha, cardiac muscle 1 205051_s_at KIT v-kit Hardy-Zuckerman 4
feline sarcoma viral oncogene homolog 204864_s_at IL6ST interleukin
6 signal transducer (gp130, oncostatin Mreceptor) 204863_s_at IL6ST
interleukin 6 signal transducer (gp130, oncostatin Mreceptor)
204694_at AFP alpha-fetoprotein 204677_at CDH5 cadherin 5, type 2,
VE-cadherin (vascular epithelium) 204535_s_at REST RE1-silencing
transcription factor 204406_at FLT1 fms-related tyrosine kinase 1
(vascular endothelial growth factor/vascular permeability factor
receptor) 204273_at EDNRB endothelin receptor type B 204271_s_at
EDNRB endothelin receptor type B 204054_at PTEN phosphatase and
tensin homolog (mutated in multiple advanced cancers 1)
204053_x_at PTEN phosphatase and tensin homolog (mutated in
multiple advanced cancers 1) 203540_at GFAP glial fibrillary acidic
protein 202833_s_at SERPINA1 serpin peptidase inhibitor, clade A
(alpha-1 antiproteinase, antitrypsin), member 1 202575_at CRABP2
cellular retinoic acid binding protein 2 202312_s_at COL1A1
collagen, type I, alpha 1 202311_s_at COL1A1 collagen, type I,
alpha 1 202310_s_at COL1A1 collagen, type I, alpha 1 202222_s_at
DES desmin 201601_x_at IFITM1 interferon induced transmembrane
protein 1 (9-27) 201578_at PODXL podocalyxin-like 201533_at CTNNB1
catenin (cadherin-associated protein), beta 1, 88 kDa 201505_at
LAMB1 laminin, beta 1 201315_x_at IFITM2 interferon induced
transmembrane protein 2 (1-8D) 201005_at CD9 CD9 molecule 200771_at
LAMC1 laminin, gamma 1 (formerly LAMB2) 200770_s_at LAMC1 laminin,
gamma 1 (formerly LAMB2) 1570276_a_at GATA4 GATA binding protein 4
1562981_at HBB Hemoglobin, beta 1561316_at GABRB3
Gamma-aminobutyric acid (GABA) A receptor, beta 3 1560469_at NR5A2
nuclear receptor subfamily 5, group A, member 2 1559921_at PECAM1
platelet/endothelial cell adhesion molecule (CD31 1558199_at FN1
fibronectin 1 1556499_s_at COL1A1 collagen, type I, alpha 1
1556057_s_at NEUROD1 neurogenic differentiation 1 1555271_a_at TERT
telomerase reverse transcriptase 1554777_at ZFP42 zinc finger
protein 42 homolog (mouse) 1554776_at ZFP42 zinc finger protein 42
homolog (mouse) 1554411_at CTNNB1 catenin (cadherin-associated
protein), beta 1, 88 kDa 1553599_a_at SYCP3 synaptonemal complex
protein 3 1553131_a_at GATA4 GATA binding protein 4 1552982_a_at
FGF4 fibroblast growth factor 4 (heparin secretory transforming
protein 1, Kaposi sarcoma oncogene)
[0554] While preferred embodiments have been described herein, such
embodiments are provided by way of example only. Numerous
variations, changes, and substitutions are feasible. It should be
understood that various alternatives to the embodiments of the
methods and compositions described herein may be employed in
practicing the invention. It is intended that the following claims
define the scope of the invention and that methods and compositions
within the scope of these claims and their equivalents be covered
thereby.
Sequence CWU 1
1
67111PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 1Tyr Gly Arg Lys Lys Arg Arg Gln Arg Arg Arg1 5
1028PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 2Arg Lys Lys Arg Arg Gln Arg Arg1
5311PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 3Tyr Ala Arg Ala Ala Ala Arg Gln Ala Arg Ala1 5
10411PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 4Thr His Arg Leu Pro Arg Arg Arg Arg Arg Arg1 5
10511PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 5Gly Gly Arg Arg Ala Arg Arg Arg Arg Arg Arg1 5
106360PRTHomo sapiens 6Met Ala Gly His Leu Ala Ser Asp Phe Ala Phe
Ser Pro Pro Pro Gly1 5 10 15Gly Gly Gly Asp Gly Pro Gly Gly Pro Glu
Pro Gly Trp Val Asp Pro 20 25 30Arg Thr Trp Leu Ser Phe Gln Gly Pro
Pro Gly Gly Pro Gly Ile Gly 35 40 45Pro Gly Val Gly Pro Gly Ser Glu
Val Trp Gly Ile Pro Pro Cys Pro 50 55 60Pro Pro Tyr Glu Phe Cys Gly
Gly Met Ala Tyr Cys Gly Pro Gln Val65 70 75 80Gly Val Gly Leu Val
Pro Gln Gly Gly Leu Glu Thr Ser Gln Pro Glu 85 90 95Gly Glu Ala Gly
Val Gly Val Glu Ser Asn Ser Asp Gly Ala Ser Pro 100 105 110Glu Pro
Cys Thr Val Thr Pro Gly Ala Val Lys Leu Glu Lys Glu Lys 115 120
125Leu Glu Gln Asn Pro Glu Glu Ser Gln Asp Ile Lys Ala Leu Gln Lys
130 135 140Glu Leu Glu Gln Phe Ala Lys Leu Leu Lys Gln Lys Arg Ile
Thr Leu145 150 155 160Gly Tyr Thr Gln Ala Asp Val Gly Leu Thr Leu
Gly Val Leu Phe Gly 165 170 175Lys Val Phe Ser Gln Thr Thr Ile Cys
Arg Phe Glu Ala Leu Gln Leu 180 185 190Ser Phe Lys Asn Met Cys Lys
Leu Arg Pro Leu Leu Gln Lys Trp Val 195 200 205Glu Glu Ala Asp Asn
Asn Glu Asn Leu Gln Glu Ile Cys Lys Ala Glu 210 215 220Thr Leu Val
Gln Ala Arg Lys Arg Lys Arg Thr Ser Ile Glu Asn Arg225 230 235
240Val Arg Gly Asn Leu Glu Asn Leu Phe Leu Gln Cys Pro Lys Pro Thr
245 250 255Leu Gln Gln Ile Ser His Ile Ala Gln Gln Leu Gly Leu Glu
Lys Asp 260 265 270Val Val Arg Val Trp Phe Cys Asn Arg Arg Gln Lys
Gly Lys Arg Ser 275 280 285Ser Ser Asp Tyr Ala Gln Arg Glu Asp Phe
Glu Ala Ala Gly Ser Pro 290 295 300Phe Ser Gly Gly Pro Val Ser Phe
Pro Leu Ala Pro Gly Pro His Phe305 310 315 320Gly Thr Pro Gly Tyr
Gly Ser Pro His Phe Thr Ala Leu Tyr Ser Ser 325 330 335Val Pro Phe
Pro Glu Gly Glu Ala Phe Pro Pro Val Ser Val Thr Thr 340 345 350Leu
Gly Ser Pro Met His Ser Asn 355 3607153PRTHomo sapiens 7Asp Ile Lys
Ala Leu Gln Lys Glu Leu Glu Gln Phe Ala Lys Leu Leu1 5 10 15Lys Gln
Lys Arg Ile Thr Leu Gly Tyr Thr Gln Ala Asp Val Gly Leu 20 25 30Thr
Leu Gly Val Leu Phe Gly Lys Val Phe Ser Gln Thr Thr Ile Cys 35 40
45Arg Phe Glu Ala Leu Gln Leu Ser Phe Lys Asn Met Cys Lys Leu Arg
50 55 60Pro Leu Leu Gln Lys Trp Val Glu Glu Ala Asp Asn Asn Glu Asn
Leu65 70 75 80Gln Glu Ile Cys Lys Ala Glu Thr Leu Val Gln Ala Arg
Lys Arg Lys 85 90 95Arg Thr Ser Ile Glu Asn Arg Val Arg Gly Asn Leu
Glu Asn Leu Phe 100 105 110Leu Gln Cys Pro Lys Pro Thr Leu Gln Gln
Ile Ser His Ile Ala Gln 115 120 125Gln Leu Gly Leu Glu Lys Asp Val
Val Arg Val Trp Phe Cys Asn Arg 130 135 140Arg Gln Lys Gly Lys Arg
Ser Ser Ser145 1508317PRTHomo sapiens 8Met Tyr Asn Met Met Glu Thr
Glu Leu Lys Pro Pro Gly Pro Gln Gln1 5 10 15Thr Ser Gly Gly Gly Gly
Gly Asn Ser Thr Ala Ala Ala Ala Gly Gly 20 25 30Asn Gln Lys Asn Ser
Pro Asp Arg Val Lys Arg Pro Met Asn Ala Phe 35 40 45Met Val Trp Ser
Arg Gly Gln Arg Arg Lys Met Ala Gln Glu Asn Pro 50 55 60Lys Met His
Asn Ser Glu Ile Ser Lys Arg Leu Gly Ala Glu Trp Lys65 70 75 80Leu
Leu Ser Glu Thr Glu Lys Arg Pro Phe Ile Asp Glu Ala Lys Arg 85 90
95Leu Arg Ala Leu His Met Lys Glu His Pro Asp Tyr Lys Tyr Arg Pro
100 105 110Arg Arg Lys Thr Lys Thr Leu Met Lys Lys Asp Lys Tyr Thr
Leu Pro 115 120 125Gly Gly Leu Leu Ala Pro Gly Gly Asn Ser Met Ala
Ser Gly Val Gly 130 135 140Val Gly Ala Gly Leu Gly Ala Gly Val Asn
Gln Arg Met Asp Ser Tyr145 150 155 160Ala His Met Asn Gly Trp Ser
Asn Gly Ser Tyr Ser Met Met Gln Asp 165 170 175Gln Leu Gly Tyr Pro
Gln His Pro Gly Leu Asn Ala His Gly Ala Ala 180 185 190Gln Met Gln
Pro Met His Arg Tyr Asp Val Ser Ala Leu Gln Tyr Asn 195 200 205Ser
Met Thr Ser Ser Gln Thr Tyr Met Asn Gly Ser Pro Thr Tyr Ser 210 215
220Met Ser Tyr Ser Gln Gln Gly Thr Pro Gly Met Ala Leu Gly Ser
Met225 230 235 240Gly Ser Val Val Lys Ser Glu Ala Ser Ser Ser Pro
Pro Val Val Thr 245 250 255Ser Ser Ser His Ser Arg Ala Pro Cys Gln
Ala Gly Asp Leu Arg Asp 260 265 270Met Ile Ser Met Tyr Leu Pro Gly
Ala Glu Val Pro Glu Pro Ala Ala 275 280 285Pro Ser Arg Leu His Met
Ser Gln His Tyr Gln Ser Gly Pro Val Pro 290 295 300Gly Thr Ala Ile
Asn Gly Thr Leu Pro Leu Ser His Met305 310 315976PRTHomo sapiens
9Arg Val Lys Arg Pro Met Asn Ala Phe Met Val Trp Ser Arg Gly Gln1 5
10 15Arg Arg Lys Met Ala Gln Glu Asn Pro Lys Met His Asn Ser Glu
Ile 20 25 30Ser Lys Arg Leu Gly Ala Glu Trp Lys Leu Leu Ser Glu Thr
Glu Lys 35 40 45Arg Pro Phe Ile Asp Glu Ala Lys Arg Leu Arg Ala Leu
His Met Lys 50 55 60Glu His Pro Asp Tyr Lys Tyr Arg Pro Arg Arg
Lys65 70 7510470PRTHomo sapiens 10Met Ala Val Ser Asp Ala Leu Leu
Pro Ser Phe Ser Thr Phe Ala Ser1 5 10 15Gly Pro Ala Gly Arg Glu Lys
Thr Leu Arg Gln Ala Gly Ala Pro Asn 20 25 30Asn Arg Trp Arg Glu Glu
Leu Ser His Met Lys Arg Leu Pro Pro Val 35 40 45Leu Pro Gly Arg Pro
Tyr Asp Leu Ala Ala Ala Thr Val Ala Thr Asp 50 55 60Leu Glu Ser Gly
Gly Ala Gly Ala Ala Cys Gly Gly Ser Asn Leu Ala65 70 75 80Pro Leu
Pro Arg Arg Glu Thr Glu Glu Phe Asn Asp Leu Leu Asp Leu 85 90 95Asp
Phe Ile Leu Ser Asn Ser Leu Thr His Pro Pro Glu Ser Val Ala 100 105
110Ala Thr Val Ser Ser Ser Ala Ser Ala Ser Ser Ser Ser Ser Pro Ser
115 120 125Ser Ser Gly Pro Ala Ser Ala Pro Ser Thr Cys Ser Phe Thr
Tyr Pro 130 135 140Ile Arg Ala Gly Asn Asp Pro Gly Val Ala Pro Gly
Gly Thr Gly Gly145 150 155 160Gly Leu Leu Tyr Gly Arg Glu Ser Ala
Pro Pro Pro Thr Ala Pro Phe 165 170 175Asn Leu Ala Asp Ile Asn Asp
Val Ser Pro Ser Gly Gly Phe Val Ala 180 185 190Glu Leu Leu Arg Pro
Glu Leu Asp Pro Val Tyr Ile Pro Pro Gln Gln 195 200 205Pro Gln Pro
Pro Gly Gly Gly Leu Met Gly Lys Phe Val Leu Lys Ala 210 215 220Ser
Leu Ser Ala Pro Gly Ser Glu Tyr Gly Ser Pro Ser Val Ile Ser225 230
235 240Val Ser Lys Gly Ser Pro Asp Gly Ser His Pro Val Val Val Ala
Pro 245 250 255Tyr Asn Gly Gly Pro Pro Arg Thr Cys Pro Lys Ile Lys
Gln Glu Ala 260 265 270Val Ser Ser Cys Thr His Leu Gly Ala Gly Pro
Pro Leu Ser Asn Gly 275 280 285His Arg Pro Ala Ala His Asp Phe Pro
Leu Gly Arg Gln Leu Pro Ser 290 295 300Arg Thr Thr Pro Thr Leu Gly
Leu Glu Glu Val Leu Ser Ser Arg Asp305 310 315 320Cys His Pro Ala
Leu Pro Leu Pro Pro Gly Phe His Pro His Pro Gly 325 330 335Pro Asn
Tyr Pro Ser Phe Leu Pro Asp Gln Met Gln Pro Gln Val Pro 340 345
350Pro Leu His Tyr Gln Glu Leu Met Pro Pro Gly Ser Cys Met Pro Glu
355 360 365Glu Pro Lys Pro Lys Arg Gly Arg Arg Ser Trp Pro Arg Lys
Arg Thr 370 375 380Ala Thr His Thr Cys Asp Tyr Ala Gly Cys Gly Lys
Thr Tyr Thr Lys385 390 395 400Ser Ser His Leu Lys Ala His Leu Arg
Thr His Thr Gly Glu Lys Pro 405 410 415Tyr His Cys Asp Trp Asp Gly
Cys Gly Trp Lys Phe Ala Arg Ser Asp 420 425 430Glu Leu Thr Arg His
Tyr Arg Lys His Thr Gly His Arg Pro Phe Gln 435 440 445Cys Gln Lys
Cys Asp Arg Ala Phe Ser Arg Ser Asp His Leu Ala Leu 450 455 460His
Met Lys Arg His Phe465 4701188PRTHomo sapiens 11Lys Arg Thr Ala Thr
His Thr Cys Asp Tyr Ala Gly Cys Gly Lys Thr1 5 10 15Tyr Thr Lys Ser
Ser His Leu Lys Ala His Leu Arg Thr His Thr Gly 20 25 30Glu Lys Pro
Tyr His Cys Asp Trp Asp Gly Cys Gly Trp Lys Phe Ala 35 40 45Arg Ser
Asp Glu Leu Thr Arg His Tyr Arg Lys His Thr Gly His Arg 50 55 60Pro
Phe Gln Cys Gln Lys Cys Asp Arg Ala Phe Ser Arg Ser Asp His65 70 75
80Leu Ala Leu His Met Lys Arg His 8512454PRTHomo sapiens 12Met Asp
Phe Phe Arg Val Val Glu Asn Gln Gln Pro Pro Ala Thr Met1 5 10 15Pro
Leu Asn Val Ser Phe Thr Asn Arg Asn Tyr Asp Leu Asp Tyr Asp 20 25
30Ser Val Gln Pro Tyr Phe Tyr Cys Asp Glu Glu Glu Asn Phe Tyr Gln
35 40 45Gln Gln Gln Gln Ser Glu Leu Gln Pro Pro Ala Pro Ser Glu Asp
Ile 50 55 60Trp Lys Lys Phe Glu Leu Leu Pro Thr Pro Pro Leu Ser Pro
Ser Arg65 70 75 80Arg Ser Gly Leu Cys Ser Pro Ser Tyr Val Ala Val
Thr Pro Phe Ser 85 90 95Leu Arg Gly Asp Asn Asp Gly Gly Gly Gly Ser
Phe Ser Thr Ala Asp 100 105 110Gln Leu Glu Met Val Thr Glu Leu Leu
Gly Gly Asp Met Val Asn Gln 115 120 125Ser Phe Ile Cys Asp Pro Asp
Asp Glu Thr Phe Ile Lys Asn Ile Ile 130 135 140Ile Gln Asp Cys Met
Trp Ser Gly Phe Ser Ala Ala Ala Lys Leu Val145 150 155 160Ser Glu
Lys Leu Ala Ser Tyr Gln Ala Ala Arg Lys Asp Ser Gly Ser 165 170
175Pro Asn Pro Ala Arg Gly His Ser Val Cys Ser Thr Ser Ser Leu Tyr
180 185 190Leu Gln Asp Leu Ser Ala Ala Ala Ser Glu Cys Ile Asp Pro
Ser Val 195 200 205Val Phe Pro Tyr Pro Leu Asn Asp Ser Ser Ser Pro
Lys Ser Cys Ala 210 215 220Ser Gln Asp Ser Ser Ala Phe Ser Pro Ser
Ser Asp Ser Leu Leu Ser225 230 235 240Ser Thr Glu Ser Ser Pro Gln
Gly Ser Pro Glu Pro Leu Val Leu His 245 250 255Glu Glu Thr Pro Pro
Thr Thr Ser Ser Asp Ser Glu Glu Glu Gln Glu 260 265 270Asp Glu Glu
Glu Ile Asp Val Val Ser Val Glu Lys Arg Gln Ala Pro 275 280 285Gly
Lys Arg Ser Glu Ser Gly Ser Pro Ser Ala Gly Gly His Ser Lys 290 295
300Pro Pro His Ser Pro Leu Val Leu Lys Arg Cys His Val Ser Thr
His305 310 315 320Gln His Asn Tyr Ala Ala Pro Pro Ser Thr Arg Lys
Asp Tyr Pro Ala 325 330 335Ala Lys Arg Val Lys Leu Asp Ser Val Arg
Val Leu Arg Gln Ile Ser 340 345 350Asn Asn Arg Lys Cys Thr Ser Pro
Arg Ser Ser Asp Thr Glu Glu Asn 355 360 365Val Lys Arg Arg Thr His
Asn Val Leu Glu Arg Gln Arg Arg Asn Glu 370 375 380Leu Lys Arg Ser
Phe Phe Ala Leu Arg Asp Gln Ile Pro Glu Leu Glu385 390 395 400Asn
Asn Glu Lys Ala Pro Lys Val Val Ile Leu Lys Lys Ala Thr Ala 405 410
415Tyr Ile Leu Ser Val Gln Ala Glu Glu Gln Lys Leu Ile Ser Glu Glu
420 425 430Asp Leu Leu Arg Lys Arg Arg Glu Gln Leu Lys His Lys Leu
Glu Gln 435 440 445Leu Arg Asn Ser Cys Ala 4501385PRTHomo sapiens
13Lys Arg Arg Thr His Asn Val Leu Glu Arg Gln Arg Arg Asn Glu Leu1
5 10 15Lys Arg Ser Phe Phe Ala Leu Arg Asp Gln Ile Pro Glu Leu Glu
Asn 20 25 30Asn Glu Lys Ala Pro Lys Val Val Ile Leu Lys Lys Ala Thr
Ala Tyr 35 40 45Ile Leu Ser Val Gln Ala Glu Glu Gln Lys Leu Ile Ser
Glu Glu Asp 50 55 60Leu Leu Arg Lys Arg Arg Glu Gln Leu Lys His Lys
Leu Glu Gln Leu65 70 75 80Arg Asn Ser Cys Ala 851429DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
14gcagccctgg gtctccagat ctggccagc 291529DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
15ggtggccggg gccagggcta gccacgtgc 2916263PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
16Met Tyr Asn Met Met Glu Thr Glu Leu Lys Pro Pro Gly Pro Gln Gln1
5 10 15Thr Ser Gly Gly Gly Gly Gly Asn Ser Thr Ala Ala Ala Ala Gly
Gly 20 25 30Asn Gln Lys Asn Ser Pro Asp Arg Val Lys Arg Pro Met Asn
Ala Phe 35 40 45Met Val Trp Ser Arg Gly Gln Arg Arg Lys Met Ala Gln
Glu Asn Pro 50 55 60Lys Met His Asn Ser Glu Ile Ser Lys Arg Leu Gly
Ala Glu Trp Lys65 70 75 80Leu Leu Ser Glu Thr Glu Lys Arg Pro Phe
Ile Asp Glu Ala Lys Arg 85 90 95Leu Arg Ala Leu His Met Lys Glu His
Pro Asp Tyr Lys Tyr Arg Pro 100 105 110Arg Arg Lys Thr Lys Thr Leu
Met Lys Lys Asp Lys Tyr Thr Leu Pro 115 120 125Gly Gly Leu Leu Ala
Pro Gly Gly Asn Ser Met Ala Ser Gly Val Gly 130 135 140Val Gly Ala
Gly Leu Gly Ala Gly Val Asn Gln Arg Met Asp Ser Tyr145 150 155
160Ala His Met Asn Gly Trp Ser Asn Gly Ser Tyr Ser Met Met Gln Asp
165 170 175Gln Leu Gly Tyr Pro Gln His Ser Thr Thr Ala Pro Ile Thr
Asp Val 180 185 190Ser Leu Gly Asp Glu Leu Arg Leu Asp Gly Glu Glu
Val Asp Met Thr 195 200 205Pro Ala Asp Ala Leu Asp Asp Phe Asp Leu
Glu Met Leu Gly Asp Val 210 215 220Glu Ser Pro Ser Pro Gly Met Thr
His Asp Pro Val Ser Tyr Gly Ala225 230 235 240Leu Asp Val Asp Asp
Phe Glu Phe Glu Gln Met Phe Thr Asp Ala Leu 245 250 255Gly Ile Asp
Asp Phe Gly Gly 260178PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 17Lys Lys Lys Lys Lys Lys Lys
Lys1 51812DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 18saccacgtgg ts
1219148PRTHuman herpesvirus 2 19Thr Lys Thr Leu Met Lys Lys Asp Lys
Tyr Thr Leu Pro Gly Gly Leu1 5 10 15Leu Ala Pro Gly Gly Asn Ser Met
Ala Ser Gly Val Gly Val Gly Ala 20 25 30Gly Leu Gly Ala Gly Val Asn
Gln Arg Met Asp Ser Tyr Ala His Met 35 40 45Asn Gly Trp Ser Asn Gly
Ser Tyr Ser Met Met Gln Asp Gln Leu Gly 50 55 60Tyr Pro Gln His Ser
Thr Thr Ala Pro Ile Thr Asp Val Ser Leu Gly65 70 75 80Asp Glu Leu
Arg Leu Asp Gly Glu Glu Val Asp Met Thr Pro Ala Asp 85 90 95Ala Leu
Asp Asp Phe Asp Leu Glu Met Leu Gly Asp Val Glu Ser Pro 100 105
110Ser Pro Gly Met Thr His Asp Pro Val Ser Tyr Gly Ala Leu Asp Val
115 120 125Asp Asp Phe Glu Phe Glu Gln Met Phe Thr Asp Ala Leu Gly
Ile Asp 130 135 140Asp Phe Gly Gly1452025DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
20agtctggctt atatccaaca cttcg 252122DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
21gactttgctt tccttggtca gg 222220DNAArtificial SequenceDescription
of Artificial Sequence Synthetic primer 22tacctcagcc tccagcagat
202320DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 23tgcgtcacac cattgctatt 202422DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
24agccagtctc accttcaacc gc 222520DNAArtificial SequenceDescription
of Artificial Sequence Synthetic primer 25ggagtagcag agggaggccg
202620DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 26aaaccccagc acatcaactc 202719DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
27gtcattccct gggtggttc 192820DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 28ttggagtgca atggtgtgat
202920DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 29tctgttcaca caggctccag 203022DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
30ggcgtccgcg ggaatgtact tc 223121DNAArtificial SequenceDescription
of Artificial Sequence Synthetic primer 31tggcttaggg gtggtctggc c
213221DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 32gcagcgacca gtcctccgac t 213320DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
33aacgtgggga aggcctgtgc 203420DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 34acagaacctg ctgcctgaat
203520DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 35agaaatgcct gaggaaagca 203620DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
36cttgacaatc gagtggctga 203720DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 37tcatccgtgg tgtagccata
203822DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 38aacctgcacg actcctcgca ca 223920DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
39aggatgcgca tggcgattcg 204020DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 40gagaaggaga agctggagca
204120DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 41aatagaaccc ccagggtgag 204222DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
42agtagacggc atcgcagctt gg 224322DNAArtificial SequenceDescription
of Artificial Sequence Synthetic primer 43ggaagcttag ccaggtccga gg
224419DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 44caggagaacc ccaagatgc 194517DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
45gcagccgctt agcctcg 174620DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 46acactgcccc tctcacacat
204720DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 47cgggactatg gttgctgact 204820DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
48accctgggtc ttgaggaagt 204920DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 49acgatcgtct tcccctcttt
205021DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 50ctcaccctta ccgagtcggc g 215120DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
51gcagctgggg cacctgaacc 205225DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 52tccagcttgt acctgcagga tctga
255325DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 53cctccagcag aaggtgatcc agact 255422DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
54agtagacggc atcgcagctt gg 225525DNAArtificial SequenceDescription
of Artificial Sequence Synthetic primer 55cctccagcag aaggtgatcc
agact 255640DNAArtificial SequenceDescription of Artificial
Sequence Synthetic primer 56aggaagagag ggaatttaag gtgtatgtat
tttttatttt 405756DNAArtificial SequenceDescription of Artificial
Sequence Synthetic primer 57cagtaatacg actcactata gggagaaggc
tataacccac ccctataatc ccaata 565835DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
58aggaagagag gttaggttgg ttttaaattt ttgat 355961DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
59cagtaatacg actcactata gggagaaggc ttttataata aaaactctat caccttaaac
60c 616035DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 60aggaagagag tagtagggat tttttggatt ggttt
356158DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 61cagtaatacg actcactata gggagaaggc taaaactttt
cccccactct tatattac 586239DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 62aggaagagag ggtaataaag
tgagattttg ttttaaaaa 396355DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 63cagtaatacg actcactata
gggagaaggc tccacccact aaccttaacc tctaa 55644PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 64Asp
Glu Ala His1654PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 65Asp Glu Ala Asp16620PRTHomo sapiens
66Met Gly Ala Pro Val Ile Leu Phe Ser Cys Thr Asn Gln His Tyr Trp1
5 10 15Asp Glu Lys Arg 206716DNAHomo sapiens 67cttttgcatt acaatg
16
* * * * *