U.S. patent application number 12/577662 was filed with the patent office on 2010-04-01 for stress-related polynucleotides and polypeptides in plants.
This patent application is currently assigned to Mendel Biotechnology, Inc.. Invention is credited to Luc Adam, Neal I. Gutterson, Jacqueline E. Heard, Frederick D. Hempel, Cai-Zhong Jiang, James S. Keddie, Roderick W. Kumimoto, Omaira Pineda, Oliver Ratcliffe, T. Lynne Reuber, Jose Luis Riechmann, Guo-Liang Yu.
Application Number | 20100083395 12/577662 |
Document ID | / |
Family ID | 46281007 |
Filed Date | 2010-04-01 |
United States Patent
Application |
20100083395 |
Kind Code |
A1 |
Reuber; T. Lynne ; et
al. |
April 1, 2010 |
STRESS-RELATED POLYNUCLEOTIDES AND POLYPEPTIDES IN PLANTS
Abstract
The invention relates to plant transcription factor
polypeptides, polynucleotides that encode them, homologs from a
variety of plant species, and methods of using the polynucleotides
and polypeptides to produce transgenic plants having advantageous
properties compared to a reference plant. Sequence information
related to these polynucleotides and polypeptides can also be used
in bioinformatic search methods and is also disclosed.
Inventors: |
Reuber; T. Lynne; (San
Mateo, CA) ; Riechmann; Jose Luis; (Barcelona,
ES) ; Heard; Jacqueline E.; (Webster Groves, MO)
; Jiang; Cai-Zhong; (Fremont, CA) ; Adam; Luc;
(Hayward, CA) ; Ratcliffe; Oliver; (Oakland,
CA) ; Pineda; Omaira; (Vero Beach, FL) ; Yu;
Guo-Liang; (Berkeley, CA) ; Gutterson; Neal I.;
(Oakland, CA) ; Hempel; Frederick D.; (Hayward,
CA) ; Kumimoto; Roderick W.; (Norman, OK) ;
Keddie; James S.; (San Mateo, CA) |
Correspondence
Address: |
Mendel Biotechnology, Inc.
3935 Point Eden Way
Hayward
CA
94545
US
|
Assignee: |
Mendel Biotechnology, Inc.
Hayward
CA
|
Family ID: |
46281007 |
Appl. No.: |
12/577662 |
Filed: |
October 12, 2009 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
11725235 |
Mar 16, 2007 |
7601893 |
|
|
12577662 |
|
|
|
|
10225068 |
Aug 9, 2002 |
7193129 |
|
|
11725235 |
|
|
|
|
09837944 |
Apr 18, 2001 |
|
|
|
10225068 |
|
|
|
|
10171468 |
Jun 14, 2002 |
|
|
|
09837944 |
|
|
|
|
11986992 |
Nov 26, 2007 |
|
|
|
10171468 |
|
|
|
|
10412699 |
Apr 10, 2003 |
7345217 |
|
|
11986992 |
|
|
|
|
11435388 |
May 15, 2006 |
7663025 |
|
|
10412699 |
|
|
|
|
PCT/US04/37584 |
Nov 12, 2004 |
|
|
|
11435388 |
|
|
|
|
10714887 |
Nov 13, 2003 |
|
|
|
PCT/US04/37584 |
|
|
|
|
12338024 |
Dec 18, 2008 |
|
|
|
10714887 |
|
|
|
|
10374780 |
Feb 25, 2003 |
7511190 |
|
|
12338024 |
|
|
|
|
09713994 |
Nov 16, 2000 |
|
|
|
10374780 |
|
|
|
|
09934455 |
Aug 22, 2001 |
|
|
|
12338024 |
|
|
|
|
09713994 |
Nov 16, 2000 |
|
|
|
09934455 |
|
|
|
|
09837944 |
Apr 18, 2001 |
|
|
|
09713994 |
|
|
|
|
10225068 |
Aug 9, 2002 |
7193129 |
|
|
12338024 |
|
|
|
|
09837944 |
Apr 18, 2001 |
|
|
|
10225068 |
|
|
|
|
10171468 |
Jun 14, 2002 |
|
|
|
09837944 |
|
|
|
|
12077535 |
Mar 17, 2008 |
|
|
|
10171468 |
|
|
|
|
12077535 |
Mar 17, 2008 |
|
|
|
12077535 |
|
|
|
|
12064961 |
Dec 22, 2008 |
|
|
|
PCT/US06/34615 |
Aug 31, 2006 |
|
|
|
12077535 |
|
|
|
|
10225068 |
Aug 9, 2002 |
7193129 |
|
|
12077535 |
|
|
|
|
09837944 |
Apr 18, 2001 |
|
|
|
10225068 |
|
|
|
|
10171468 |
Jun 14, 2002 |
|
|
|
09837944 |
|
|
|
|
10870198 |
Jun 16, 2004 |
|
|
|
10171468 |
|
|
|
|
10669824 |
Sep 23, 2003 |
|
|
|
10870198 |
|
|
|
|
10225068 |
Aug 9, 2002 |
7193129 |
|
|
10669824 |
|
|
|
|
10714887 |
Nov 13, 2003 |
|
|
|
10225068 |
|
|
|
|
10225068 |
Aug 9, 2002 |
7193129 |
|
|
10714887 |
|
|
|
|
10669824 |
Sep 23, 2003 |
|
|
|
10225068 |
|
|
|
|
10374780 |
Feb 25, 2003 |
7511190 |
|
|
10669824 |
|
|
|
|
10374780 |
Feb 25, 2003 |
7511190 |
|
|
10870198 |
|
|
|
|
10412699 |
Apr 10, 2003 |
7345217 |
|
|
10374780 |
|
|
|
|
60310847 |
Aug 9, 2001 |
|
|
|
60336049 |
Nov 19, 2001 |
|
|
|
60338692 |
Dec 11, 2001 |
|
|
|
60542928 |
Feb 5, 2004 |
|
|
|
60527658 |
Dec 5, 2003 |
|
|
|
60166228 |
Nov 17, 1999 |
|
|
|
60197899 |
Apr 17, 2000 |
|
|
|
60227439 |
Aug 22, 2000 |
|
|
|
60227439 |
Aug 22, 2000 |
|
|
|
60310847 |
Aug 9, 2001 |
|
|
|
60336049 |
Nov 19, 2001 |
|
|
|
60338692 |
Dec 11, 2001 |
|
|
|
60961403 |
Jul 20, 2007 |
|
|
|
60961403 |
Jul 20, 2007 |
|
|
|
60713952 |
Aug 31, 2005 |
|
|
|
60336049 |
Nov 19, 2001 |
|
|
|
60338692 |
Dec 11, 2001 |
|
|
|
60527658 |
Dec 5, 2003 |
|
|
|
60542928 |
Feb 5, 2004 |
|
|
|
Current U.S.
Class: |
800/260 ;
435/419; 800/290; 800/298; 800/306; 800/307; 800/308; 800/309;
800/310; 800/312; 800/314; 800/317; 800/317.1; 800/317.2;
800/317.3; 800/320.1; 800/320.2; 800/320.3; 800/322 |
Current CPC
Class: |
C07K 14/415 20130101;
C12N 15/8275 20130101; C12N 15/8282 20130101; Y02A 40/146 20180101;
C12N 15/8261 20130101; C12N 15/8273 20130101; C12N 15/8271
20130101; C12N 15/8241 20130101 |
Class at
Publication: |
800/260 ;
800/298; 435/419; 800/306; 800/312; 800/320.3; 800/320.1;
800/317.2; 800/314; 800/320.2; 800/322; 800/309; 800/307; 800/317;
800/317.1; 800/310; 800/317.3; 800/308; 800/290 |
International
Class: |
A01H 5/00 20060101
A01H005/00; C12N 5/10 20060101 C12N005/10; C12N 15/82 20060101
C12N015/82; A01H 1/02 20060101 A01H001/02 |
Claims
1. A transgenic plant comprising a recombinant polynucleotide
encoding a polypeptide having a percentage identity with any of SEQ
ID NOs: 2n, where n=1 to 140, or to a conserved domain of SEQ ID
NOs: 2n, where n=1 to 140; (a) wherein the percentage identity is
selected from the group consisting of at least 50%, at least 51%,
at least 52%, at least 53%, at least 54%, at least 55%, at least
56%, at least 57%, at least 58%, at least 59%, at least 60%, at
least 61%, at least 62%, at least 63%, at least 64%, at least 65%,
at least 66%, at least 67%, at least 68%, at least 69%, at least
70%, at least 71%, at least 72%, at least 73%, at least 74%, at
least 75%, at least 76%, at least 77%, at least 78%, at least 79%,
at least 80%, at least 81%, at least 82%, at least 83%, at least
84%, at least 85%, at least 86%, at least 87%, at least 88%, at
least 89%, at least 90%, at least 91%, at least 92%, at least 93%,
at least 94%, at least 95%, at least 96%, at least 97%, at least
98%, at least 99%, and about 100%; wherein the conserved domain is
required for a function by the polypeptide of regulating
transcription, and the polypeptide confers to the transgenic plant
an altered trait as compared to a control plant.
2. The transgenic plant of claim 1, wherein the transgenic plant
comprises a recombinant polynucleotide encoding an At-hook
transcription factor polypeptide having a percentage identity with
SEQ ID NO: 4, or to a conserved domain of amino acids 162-206 of
SEQ ID NO: 84; (a) wherein the percentage identity is selected from
the group consisting of at least 50%, at least 51%, at least 52%,
at least 53%, at least 54%, at least 55%, at least 56%, at least
57%, at least 58%, at least 59%, at least 60%, at least 61%, at
least 62%, at least 63%, at least 64%, at least 65%, at least 66%,
at least 67%, at least 68%, at least 69%, at least 70%, at least
71%, at least 72%, at least 73%, at least 74%, at least 75%, at
least 76%, at least 77%, at least 78%, at least 79%, at least 80%,
at least 81%, at least 82%, at least 83%, at least 84%, at least
85%, at least 86%, at least 87%, at least 88%, at least 89%, at
least 90%, at least 91%, at least 92%, at least 93%, at least 94%,
at least 95%, at least 96%, at least 97%, at least 98%, at least
99%, and about 100%; wherein the conserved domain is required for a
function by the polypeptide of regulating transcription, and the
polypeptide confers to the transgenic plant the altered trait; and
the altered trait is selected from the group consisting of more
delayed flowering, enlarged lateral organs, greater biomass,
greater tolerance to hyperosmotic tolerance, greater tolerance to
sucrose, greater tolerance to water deficit, greater tolerance to
drought, greater tolerance to salt, decreased sensitivity to
abscisic acid, and greater tolerance to cold.
3. The transgenic plant of claim 2, wherein the transgenic plant is
more tolerant to 150 mM NaCl than the control plant.
4. The transgenic plant of claim 2, wherein the transgenic plant is
more tolerant to 9.4% sucrose than the control plant.
5. The transgenic plant of claim 2, wherein the transgenic plant is
more tolerant to 8.degree. C. than the control plant.
6. The transgenic plant of claim 2, wherein expression of the
polypeptide is regulated by a constitutive, inducible, or
tissue-specific promoter.
7. A host cell produced from the transgenic plant of claim 2,
wherein the host cell comprises the recombinant polynucleotide.
8. A transgenic seed produced from the transgenic plant of claim 2,
wherein the transgenic seed comprises the recombinant
polynucleotide.
9. The transgenic plant of claim 2, wherein the plant is selected
from the group consisting of: canola, soybean, wheat, corn, potato,
cotton, rice, oilseed rape, sunflower, alfalfa, sugarcane, turf,
banana, blackberry, blueberry, strawberry, raspberry, cantaloupe,
carrot, cauliflower, coffee, cucumber, eggplant, grapes, honeydew,
lettuce, mango, melon, onion, papaya, peas, peppers, pineapple,
pumpkin, spinach, squash, sweet corn, tobacco, tomato, watermelon,
mint and other labiates, rosaceous fruits, and vegetable
brassicas.
10. A method of altering a trait in a plant, the method steps
comprising: introducing into a target plant a recombinant
polynucleotide encoding an At-hook transcription factor polypeptide
having a percentage identity with SEQ ID NO: 4, or to a conserved
domain of amino acids 162-206 of SEQ ID NO: 84; (a) wherein the
percentage identity is selected from the group consisting of at
least 50%, at least 51%, at least 52%, at least 53%, at least 54%,
at least 55%, at least 56%, at least 57%, at least 58%, at least
59%, at least 60%, at least 61%, at least 62%, at least 63%, at
least 64%, at least 65%, at least 66%, at least 67%, at least 68%,
at least 69%, at least 70%, at least 71%, at least 72%, at least
73%, at least 74%, at least 75%, at least 76%, at least 77%, at
least 78%, at least 79%, at least 80%, at least 81%, at least 82%,
at least 83%, at least 84%, at least 85%, at least 86%, at least
87%, at least 88%, at least 89%, at least 90%, at least 91%, at
least 92%, at least 93%, at least 94%, at least 95%, at least 96%,
at least 97%, at least 98%, at least 99%, and about 100%; wherein
the conserved domain is required for a function by the polypeptide
of regulating transcription, and the polypeptide confers to the
transgenic plant the altered trait; and the altered trait is
selected from the group consisting of more delayed flowering,
enlarged lateral organs, greater biomass, greater tolerance to
hyperosmotic tolerance, greater tolerance to sucrose, greater
tolerance to water deficit, greater tolerance to drought, greater
tolerance to salt, decreased sensitivity to abscisic acid, and
greater tolerance to cold.
11. The method of claim 8, wherein the transgenic plant produces
transgenic seed, and a progeny plant grown from the transgenic seed
comprises the recombinant polynucleotide and has the altered trait
relative to the control plant.
12. The method of claim 8, wherein the transgenic plant is crossed
with another plant, transgenic seed is selected, and a progeny
plant grown from the transgenic seed comprises the recombinant
polynucleotide and has the altered trait relative to the control
plant.
13. A method of imparting an altered trait to a crop plant by
crossing a first transgenic crop plant with a second crop plant,
wherein said first transgenic crop plant contains recombinant DNA
which expresses a transcription factor having at least 50% identity
to SEQ ID NO: 84 or to a conserved domain of amino acids 162-206 of
SEQ ID NO: 84, wherein said method further comprises a screening
process for identification of the altered trait; wherein the
altered trait is selected from the group consisting of more delayed
flowering, enlarged lateral organs, greater biomass, greater
tolerance to hyperosmotic tolerance, greater tolerance to sucrose,
greater tolerance to water deficit, greater tolerance to drought,
greater tolerance to salt, decreased sensitivity to abscisic acid,
and greater tolerance to cold.
14. The method of claim 13, wherein said transcription factor has
at least 80% identity to SEQ ID NO: 84 or to a conserved domain of
amino acids 162-206 of SEQ ID NO: 84.
15. The method of claim 13, wherein said transcription factor has
at least 85% identity to SEQ ID NO: 84 or to a conserved domain of
amino acids 162-206 of SEQ ID NO: 84.
16. The method of claim 13, wherein said transcription factor has
at least 90% identity to SEQ ID NO: 84 or to a conserved domain of
amino acids 162-206 of SEQ ID NO: 84.
17. The method of claim 13, wherein said transcription factor has
at least 95% identity to SEQ ID NO: 84 or to a conserved domain of
amino acids 162-206 of SEQ ID NO: 84.
18. The method of claim 13, wherein said transcription factor has
100% identity to SEQ ID NO: 84 or to a conserved domain of amino
acids 162-206 of SEQ ID NO: 84.
Description
[0001] This application is a continuation-in-part of prior U.S.
patent application Ser. No. 11/725,235, filed Mar. 16, 2007
(pending), which is a divisional application of prior U.S. patent
application Ser. No. 10/225,068, filed Aug. 9, 2002 (issued as U.S.
Pat. No. 7,193,129). U.S. patent application Ser. No. 10/225,068
claims the benefit of U.S. provisional applications 60/310,847,
filed Aug. 9, 2001 (expired), 60/336,049, filed Nov. 19, 2001
(expired), and 60/338,692, filed Dec. 11, 2001 (expired). U.S.
patent application Ser. No. 10/225,068 is also a
continuation-in-part of prior U.S. patent application Ser. No.
09/837,944, filed Apr. 18, 2001 (abandoned), and U.S. patent
application Ser. No. 10/225,068 is a continuation-in-part of prior
U.S. patent application Ser. No. 10/171,468, filed Jun. 14, 2002
(abandoned). This application is a continuation-in-part of prior
U.S. patent application Ser. No. 11/986,992, filed Nov. 26, 2007
(pending), which is a divisional application of prior U.S. patent
application Ser. No. 10/412,699 (issued as U.S. Pat. No.
7,345,217), filed Apr. 10, 2003. This application is a
continuation-in-part of prior U.S. patent application Ser. No.
11/435,388, filed May 15, 2006 (pending), which is a
continuation-in-part of PCT application PCT/US04/37584, filed Nov.
12, 2004 (published). PCT/US04/37584 is a continuation-in-part of
prior U.S. patent application Ser. No. 10/714,887, filed Nov. 13,
2003 (pending). PCT/US04/37584 also claims the benefit of prior
U.S. provisional applications 60/527,658, filed Dec. 5, 2003
(expired), and 60/542,928, filed Feb. 5, 2004 (expired). This
application is a continuation-in-part of prior U.S. patent
application Ser. No. 12/338,024, filed Dec. 18, 2008 (pending),
which is a division of prior U.S. patent application Ser. No.
10/374,780, filed Feb. 25, 2003 (issued as U.S. Pat. No.
7,511,190). U.S. patent application Ser. No. 10/374,780 is a
continuation-in-part of prior U.S. patent application Ser. No.
10/225,068, filed Aug. 9, 2002 (issued as U.S. Pat. No. 7,193,129).
U.S. patent application Ser. No. 10/225,068 claims the benefit of
U.S. provisional applications 60/310,847, filed Aug. 9, 2001
(expired), 60/336,049, filed Nov. 19, 2001 (expired), and
60/338,692, filed Dec. 11, 2001 (expired). U.S. patent application
Ser. No. 10/225,068 is also a continuation-in-part of prior U.S.
patent application Ser. No. 09/837,944, filed Apr. 18, 2001
(abandoned), and U.S. patent application Ser. No. 10/225,068 is a
continuation-in-part of prior U.S. patent application Ser. No.
10/171,468, filed Jun. 14, 2002 (abandoned). This application is a
continuation-in-part of prior U.S. patent application Ser. No.
12/077,535, filed Mar. 17, 2008 (pending). U.S. patent application
Ser. No. 12/077,535 claims the benefit of U.S. provisional
applications 60/961,403, filed Jul. 20, 2007 (expired), 60/527,658,
filed Dec. 5, 2003 (expired), and 60/542,928, filed Feb. 5, 2004
(expired). U.S. patent application Ser. No. 12/077,535 is also a
continuation in part of prior U.S. patent application Ser. No.
12/064,961, filed Dec. 22, 2008 (pending). U.S. patent application
Ser. No. 12/064,961 is a national stage application of PCT
application PCT/US06/34615, filed Aug. 31, 2006 (published). PCT
application PCT/US06/34615 is a continuation of U.S. provisional
application 60/713,952, filed Aug. 31, 2005 (expired). U.S. patent
application Ser. No. 12/077,535 is also a continuation-in-part of
prior U.S. patent application Ser. No. 10/225,068, filed Aug. 9,
2002 (issued as U.S. Pat. No. 7,193,129). U.S. patent application
Ser. No. 10/225,068 claims the benefit of U.S. provisional
applications 60/310,847, filed Aug. 9, 2001 (expired), 60/336,049,
filed Nov. 19, 2001 (expired), and 60/338,692, filed Dec. 11, 2001
(expired). U.S. patent application Ser. No. 10/225,068 is also a
continuation-in-part of prior U.S. patent application Ser. No.
09/837,944, filed Apr. 18, 2001 (abandoned), and U.S. patent
application Ser. No. 10/225,068 is a continuation-in-part of prior
U.S. patent application Ser. No. 10/171,468, filed Jun. 14, 2002
(abandoned). This application is a continuation-in-part of prior
U.S. patent application Ser. No. 10/870,198, filed Jun. 16, 2004
(pending). U.S. patent application Ser. No. 10/870,198 claims the
benefit of U.S. provisional applications 60/527,658, filed Dec. 5,
2003 (expired), and 60/542,928 filed Feb. 5, 2004 (expired). U.S.
patent application Ser. No. 10/870,198 is a continuation-in-part of
prior U.S. patent application Ser. No. 10/669,824, filed Sep. 23,
2003 (pending). U.S. patent application Ser. No. 10/870,198 is also
a continuation-in-part of prior U.S. patent application Ser. No.
10/225,068, filed Aug. 9, 2002 (issued as U.S. Pat. No. 7,193,129).
U.S. patent application Ser. No. 10/870,198 is a
continuation-in-part of prior U.S. patent application Ser. No.
10/714,887, filed Nov. 13, 2003 (pending). This application is a
continuation-in-part of prior U.S. patent application Ser. No.
10/714,887, filed Nov. 13, 2003 (pending). U.S. patent application
Ser. No. 10/714,887 is a continuation-in-part of prior U.S. patent
application Ser. No. 10/225,068, filed Aug. 9, 2002 (issued as U.S.
Pat. No. 7,193,129). U.S. patent application Ser. No. 10/714,887 is
a continuation-in-part of prior U.S. patent application Ser. No.
10/669,824, filed Sep. 23, 2003 (pending). U.S. patent application
Ser. No. 10/714,887 is a continuation-in-part of prior U.S. patent
application Ser. No. 10/374,780, filed Feb. 25, 2003 (issued as
U.S. Pat. No. 7,511,190). U.S. patent application Ser. No.
10/714,887 is a continuation-in-part of prior U.S. patent
application Ser. No. 10/412,699, filed Apr. 10, 2003 (issued as
U.S. Pat. No. 7,345,217). Each of these patent applications is
herein incorporated by reference.
FIELD OF THE INVENTION
[0002] This invention relates to the field of plant biology. More
particularly, the present invention pertains to compositions and
methods for phenotypically modifying a plant.
INTRODUCTION
[0003] A plant's traits, such as its biochemical, developmental, or
phenotypic characteristics, may be controlled through a number of
cellular processes. One important way to manipulate that control is
through transcription factors--proteins that influence the
expression of a particular gene or sets of genes. Transformed and
transgenic plants that comprise cells having altered levels of at
least one selected transcription factor, for example, possess
advantageous or desirable traits. Strategies for manipulating
traits by altering a plant cell's transcription factor content can
therefore result in plants and crops with commercially valuable
properties. Applicants have identified polynucleotides encoding
transcription factors, developed numerous transgenic plants using
these polynucleotides, and have analyzed the plants for a variety
of important traits. In so doing, applicants have identified
important polynucleotide and polypeptide sequences for producing
commercially valuable plants and crops as well as the methods for
making them and using them. Other aspects and embodiments of the
invention are described below and can be derived from the teachings
of this disclosure as a whole.
BACKGROUND OF THE INVENTION
[0004] Transcription factors can modulate gene expression, either
increasing or decreasing (inducing or repressing) the rate of
transcription. This modulation results in differential levels of
gene expression at various developmental stages, in different
tissues and cell types, and in response to different exogenous
(e.g., environmental) and endogenous stimuli throughout the life
cycle of the organism.
[0005] Because transcription factors are key controlling elements
of biological pathways, altering the expression levels of one or
more transcription factors can change entire biological pathways in
an organism. For example, manipulation of the levels of selected
transcription factors may result in increased expression of
economically useful proteins or metabolic chemicals in plants or to
improve other agriculturally relevant characteristics. Conversely,
blocked or reduced expression of a transcription factor may reduce
biosynthesis of unwanted compounds or remove an undesirable trait.
Therefore, manipulating transcription factor levels in a plant
offers tremendous potential in agricultural biotechnology for
modifying a plant's traits.
[0006] The present invention provides novel transcription factors
useful for modifying a plant's phenotype in desirable ways.
SUMMARY OF THE INVENTION
[0007] In a first aspect, the invention relates to a recombinant
polynucleotide comprising a nucleotide sequence selected from the
group consisting of: (a) a nucleotide sequence encoding a
polypeptide comprising a polypeptide sequence selected from those
of the Sequence Listing, SEQ ID NOs: 2 to 2N, where N=2-123, or
those listed in Table 4, or a complementary nucleotide sequence
thereof; (b) a nucleotide sequence encoding a polypeptide
comprising a variant of a polypeptide of (a) having one or more, or
between 1 and about 5, or between 1 and about 10, or between 1 and
about 30, conservative amino acid substitutions; (c) a nucleotide
sequence comprising a sequence selected from those of SEQ ID NOs: 1
to (2N-1), where N=2-123, or those included in Table 4, or a
complementary nucleotide sequence thereof; (d) a nucleotide
sequence comprising silent substitutions in a nucleotide sequence
of (c); (e) a nucleotide sequence which hybridizes under stringent
conditions over substantially the entire length of a nucleotide
sequence of one or more of: (a), (b), (c), or (d); (f) a nucleotide
sequence comprising at least 10 or 15, or at least about 20, or at
least about 30 consecutive nucleotides of a sequence of any of
(a)-(e), or at least 10 or 15, or at least about 20, or at least
about 30 consecutive nucleotides outside of a region encoding a
conserved domain of any of (a)-(e); (g) a nucleotide sequence
comprising a subsequence or fragment of any of (a)-(f), which
subsequence or fragment encodes a polypeptide having a biological
activity that modifies a plant's characteristic, functions as a
transcription factor, or alters the level of transcription of a
gene or transgene in a cell; (h) a nucleotide sequence having at
least 31% sequence identity to a nucleotide sequence of any of
(a)-(g); (i) a nucleotide sequence having at least 60%, or at least
70%, or at least 80%, or at least 90%, or at least 95% sequence
identity to a nucleotide sequence of any of (a)-(g) or a 10 or 15
nucleotide, or at least about 20, or at least about 30 nucleotide
region of a sequence of (a)-(g) that is outside of a region
encoding a conserved domain; (j) a nucleotide sequence that encodes
a polypeptide having at least 31% sequence identity to a
polypeptide listed in Table 4, or the Sequence Listing; (k) a
nucleotide sequence which encodes a polypeptide having at least
60%, or at least 70%, or at least 80%, or at least 90%, or at least
95% sequence identity to a polypeptide listed in Table 4, or the
Sequence Listing; and (l) a nucleotide sequence that encodes a
conserved domain of a polypeptide having at least 85%, or at least
90%, or at least 95%, or at least 98% sequence identity to a
conserved domain of a polypeptide listed in Table 4, or the
Sequence Listing. The recombinant polynucleotide may further
comprise a constitutive, inducible, or tissue-specific promoter
operably linked to the nucleotide sequence. The invention also
relates to compositions comprising at least two of the
above-described polynucleotides.
[0008] In a second aspect, the invention comprises an isolated or
recombinant polypeptide comprising a subsequence of at least about
10, or at least about 15, or at least about 20, or at least about
30 contiguous amino acids encoded by the recombinant or isolated
polynucleotide described above, or comprising a subsequence of at
least about 8, or at least about 12, or at least about 15, or at
least about 20, or at least about 30 contiguous amino acids outside
a conserved domain.
[0009] In a third aspect, the invention comprises an isolated or
recombinant polynucleotide that encodes a polypeptide that is a
paralog of the isolated polypeptide described above. In one aspect,
the invention is a paralog which, when expressed in Arabidopsis,
modifies a trait of the Arabidopsis plant.
[0010] In a fourth aspect, the invention comprises an isolated or
recombinant polynucleotide that encodes a polypeptide that is an
ortholog of the isolated polypeptide described above. In one
aspect, the invention is an ortholog which, when expressed in
Arabidopsis, modifies a trait of the Arabidopsis plant.
[0011] In a fifth aspect, the invention comprises an isolated
polypeptide that is a paralog of the isolated polypeptide described
above. In one aspect, the invention is a paralog which, when
expressed in Arabidopsis, modifies a trait of the Arabidopsis
plant.
[0012] In a sixth aspect, the invention comprises an isolated
polypeptide that is an ortholog of the isolated polypeptide
described above. In one aspect, the invention is an ortholog which,
when expressed in Arabidopsis, modifies a trait of the Arabidopsis
plant.
[0013] The present invention also encompasses transcription factor
variants. At the polypeptide level, the sequences described herein
in the Sequence Listing and Tables 4 and 5, and the sequences of
the invention by virtue of a paralogous or homologous relationship
with the sequences described in the Sequence Listing or in Table 4
or Table 5, will typically share at least 50%, at least 51%, at
least 52%, at least 53%, at least 54%, at least 55%, at least 56%,
at least 57%, at least 58%, at least 59%, at least 60%, at least
61%, at least 62%, at least 63%, at least 64%, at least 65%, at
least 66%, at least 67%, at least 68%, at least 69%, at least 70%,
at least 71%, at least 72%, at least 73%, at least 74%, at least
75%, at least 76%, at least 77%, at least 78%, at least 79%, at
least 80%, at least 81%, at least 82%, at least 83%, at least 84%,
at least 85%, at least 86%, at least 87%, at least 88%, at least
89%, at least 90%, at least 91%, at least 92%, at least 93%, at
least 94%, at least 95%, at least 96%, at least 97%, at least 98%,
at least 99%, or about 100% amino acid sequence identity to one or
more of the listed full-length sequences, or to a conserved domain
of a sequence provided in the Sequence Listing or in Table 4 (and
identified by its amino acid coordinates in Table 4), to a listed
sequence but excluding or outside of the known consensus sequence
or consensus DNA-binding site. A preferred transcription factor
variant is one having at least 50% amino acid sequence identity to
the transcription factor amino acid sequences SEQ ID NOs: 2 to 2N,
where N=2-123, and which contains at least one functional or
structural characteristic of the transcription factor amino acid
sequences. Sequences having lesser degrees of identity but
comparable biological activity are considered to be
equivalents.
[0014] In another aspect, the invention is a transgenic plant
comprising one or more of the above-described isolated or
recombinant polynucleotides. In yet another aspect, the invention
is a plant with altered expression levels of a polynucleotide
described above or a plant with altered expression or activity
levels of an above-described polypeptide. Further, the invention is
a plant lacking a nucleotide sequence encoding a polypeptide
described above or substantially lacking a polypeptide described
above. The plant may be any plant, including, but not limited to,
Arabidopsis, mustard, soybean, wheat, corn, potato, cotton, rice,
oilseed rape, sunflower, alfalfa, sugarcane, turf, banana,
blackberry, blueberry, strawberry, raspberry, cantaloupe, carrot,
cauliflower, coffee, cucumber, eggplant, grapes, honeydew, lettuce,
mango, melon, onion, papaya, peas, peppers, pineapple, pumpkin,
spinach, squash, sweet corn, tobacco, tomato, watermelon, rosaceous
fruits, vegetable brassicas, and mint or other labiates. In yet
another aspect, the inventions is an isolated plant material of a
plant, including, but not limited to, plant tissue, fruit, seed,
plant cell, embryo, protoplast, pollen, and the like. In yet
another aspect, the invention is a transgenic plant tissue culture
of regenerable cells, including, but not limited to, embryos,
meristematic cells, microspores, protoplast, pollen, and the
like.
[0015] In yet another aspect the invention is a transgenic plant
comprising one or more of the above described polynucleotides
wherein the encoded polypeptide is expressed and regulates
transcription of a gene.
[0016] In a further aspect the invention provides a method of using
the polynucleotide composition to breed a progeny plant from a
transgenic plant including crossing plants, producing seeds from
transgenic plants, and methods of breeding using transgenic plants,
the method comprising transforming a plant with the polynucleotide
composition to create a transgenic plant, crossing the transgenic
plant with another plant, selecting seed, and growing the progeny
plant from the seed.
[0017] In a further aspect, the invention provides a progeny plant
derived from a parental plant wherein said progeny plant exhibits
at least three fold greater messenger RNA levels than said parental
plant, wherein the messenger RNA encodes a DNA-binding protein
which is capable of binding to a DNA regulatory sequence and
inducing expression of a plant trait gene, wherein the progeny
plant is characterized by a change in the plant trait compared to
said parental plant. In yet a further aspect, the progeny plant
exhibits at least ten fold greater messenger RNA levels compared to
said parental plant. In yet a further aspect, the progeny plant
exhibits at least fifty fold greater messenger RNA levels compared
to said parental plant.
[0018] In a further aspect, the invention relates to a cloning or
expression vector comprising the isolated or recombinant
polynucleotide described above or cells comprising the cloning or
expression vector.
[0019] In yet a further aspect, the invention relates to a
composition produced by incubating a polynucleotide of the
invention with a nuclease, a restriction enzyme, a polymerase; a
polymerase and a primer; a cloning vector, or with a cell.
[0020] Furthermore, the invention relates to a method for producing
a plant having a modified trait. The method comprises altering the
expression of an isolated or recombinant polynucleotide of the
invention or altering the expression or activity of a polypeptide
of the invention in a plant to produce a modified plant, and
selecting the modified plant for a modified trait. In one aspect,
the plant is a monocot plant. In another aspect, the plant is a
dicot plant. In another aspect the recombinant polynucleotide is
from a dicot plant and the plant is a monocot plant. In yet another
aspect the recombinant polynucleotide is from a monocot plant and
the plant is a dicot plant. In yet another aspect the recombinant
polynucleotide is from a monocot plant and the plant is a monocot
plant. In yet another aspect the recombinant polynucleotide is from
a dicot plant and the plant is a dicot plant.
[0021] In another aspect, the invention is a transgenic plant
comprising an isolated or recombinant polynucleotide encoding a
polypeptide wherein the polypeptide is selected from the group
consisting of SEQ ID NOs: 2-2N where N=2-123. In yet another
aspect, the invention is a plant with altered expression levels of
a polypeptide described above or a plant with altered expression or
activity levels of an above-described polypeptide. Further, the
invention is a plant lacking a polynucleotide sequence encoding a
polypeptide described above or substantially lacking a polypeptide
described above. The plant may be any plant, including, but not
limited to, Arabidopsis, mustard, soybean, wheat, corn, potato,
cotton, rice, oilseed rape, sunflower, alfalfa, sugarcane, turf,
banana, blackberry, blueberry, strawberry, raspberry, cantaloupe,
carrot, cauliflower, coffee, cucumber, eggplant, grapes, honeydew,
lettuce, mango, melon, onion, papaya, peas, peppers, pineapple,
pumpkin, spinach, squash, sweet corn, tobacco, tomato, watermelon,
rosaceous fruits, vegetable brassicas, and mint or other labiates.
In yet another aspect, the inventions is an isolated plant material
of a plant, including, but not limited to, plant tissue, fruit,
seed, plant cell, embryo, protoplast, pollen, and the like. In yet
another aspect, the invention is a transgenic plant tissue culture
of regenerable cells, including, but not limited to, embryos,
meristematic cells, microspores, protoplast, pollen, and the
like.
[0022] In another aspect, the invention relates to a method of
identifying a factor that is modulated by or interacts with a
polypeptide encoded by a polynucleotide of the invention. The
method comprises expressing a polypeptide encoded by the
polynucleotide in a plant; and identifying at least one factor that
is modulated by or interacts with the polypeptide. In one
embodiment the method for identifying modulating or interacting
factors is by detecting binding by the polypeptide to a promoter
sequence, or by detecting interactions between an additional
protein and the polypeptide in a yeast two hybrid system, or by
detecting expression of a factor by hybridization to a microarray,
subtractive hybridization, or differential display.
[0023] In yet another aspect, the invention is a method of
identifying a molecule that modulates activity or expression of a
polynucleotide or polypeptide of interest. The method comprises
placing the molecule in contact with a plant comprising the
polynucleotide or polypeptide encoded by the polynucleotide of the
invention and monitoring one or more of the expression level of the
polynucleotide in the plant, the expression level of the
polypeptide in the plant, and modulation of an activity of the
polypeptide in the plant.
[0024] In yet another aspect, the invention relates to an
integrated system, computer or computer readable medium comprising
one or more character strings corresponding to a polynucleotide of
the invention, or to a polypeptide encoded by the polynucleotide.
The integrated system, computer or computer readable medium may
comprise a link between one or more sequence strings to a modified
plant trait.
[0025] In yet another aspect, the invention is a method for
identifying a sequence similar or homologous to one or more
polynucleotides of the invention, or one or more polypeptides
encoded by the polynucleotides. The method comprises providing a
sequence database, and querying the sequence database with one or
more target sequences corresponding to the one or more
polynucleotides or to the one or more polypeptides to identify one
or more sequence members of the database that display sequence
similarity or homology to one or more of the one or more target
sequences.
[0026] The method may further comprise of linking the one or more
of the polynucleotides of the invention, or encoded polypeptides,
to a modified plant phenotype.
BRIEF DESCRIPTION OF THE SEQUENCE LISTING, TABLES, AND FIGURE
[0027] The Sequence Listing provides exemplary polynucleotide and
polypeptide sequences of the invention. The traits associated with
the use of the sequences are included in the description provided
below.
[0028] Incorporation of the Sequence Listing. The copy of the
Sequence Listing, being submitted electronically with this patent
application, provided under 37 CFR .sctn.1.821-1.825, is a
read-only memory computer-readable file in ASCII text format. The
Sequence Listing is named "SeqList.sub.--0036-1CIP1.txt", the
electronic file of the Sequence Listing was created on Oct. 12,
2009, and is 652,806 bytes in size (638 kilobytes as measured in
MS-WINDOWS). The Sequence Listing is herein incorporated by
reference in its entirety.
[0029] Table 4 shows the polynucleotides and polypeptides
identified by SEQ ID NO; Mendel Gene ID No.; conserved domain of
the polypeptide; and if the polynucleotide was tested in a
transgenic assay. The first column shows the polynucleotide SEQ ID
NO; the second column shows the Mendel Gene ID No., GID; the third
column shows the trait(s) resulting from the knock out or
overexpression of the polynucleotide in the transgenic plant; the
fourth column shows the category of the trait; the fifth column
shows the transcription factor family to which the polynucleotide
belongs; the sixth column ("Comment"), includes specific effects
and utilities, relative to control plants; conferred by the
polynucleotide of the first column; the seventh column shows the
SEQ ID NO of the polypeptide encoded by the polynucleotide; and the
eighth column shows the amino acid residue positions of the
conserved domain in amino acid (AA) co-ordinates.
[0030] Table 5 lists a summary of orthologous and homologous
sequences identified using BLAST (tblastx program). The first
column shows the polynucleotide sequence identifier (SEQ ID NO),
the second column shows the corresponding cDNA identifier (Gene
ID), the third column shows the orthologous or homologous
polynucleotide GenBank Accession Number (Test Sequence ID), the
fourth column shows the calculated probability value that the
sequence identity is due to chance (Smallest Sum Probability), the
fifth column shows the plant species from which the test sequence
was isolated (Test Sequence Species), and the sixth column shows
the orthologous or homologous test sequence GenBank annotation
(Test Sequence GenBank Annotation).
[0031] FIG. 1 shows a phylogenic tree of related plant families
adapted from Daly et al. (2001 Plant Physiology 127:1328-1333).
[0032] FIG. 2 is a phylogenetic tree of the G1073 clade member
sequences and include numerous sequences within the clade that have
similar functions of conferring, for example, greater biomass and
hyperosmotic stress tolerance. The clade is found within the
box.
DETAILED DESCRIPTION OF EXEMPLARY EMBODIMENTS
[0033] In an important aspect, the present invention relates to
polynucleotides and polypeptides, e.g. for modifying phenotypes of
plants. Throughout this disclosure, various information sources are
referred to and/or are specifically incorporated. The information
sources include scientific journal articles, patent documents,
textbooks, and World Wide Web browser-inactive page addresses, for
example. While the reference to these information sources clearly
indicates that they can be used by one of skill in the art,
applicants specifically incorporate each and every one of the
information sources cited herein, in their entirety, whether or not
a specific mention of "incorporation by reference" is noted. The
contents and teachings of each and every one of the information
sources can be relied on and used to make and use embodiments of
the invention.
[0034] It must be noted that as used herein and in the appended
claims, the singular forms "a," "an," and "the" include plural
reference unless the context clearly dictates otherwise. Thus, for
example, a reference to "a plant" includes a plurality of such
plants, and a reference to "a stress" is a reference to one or more
stresses and equivalents thereof known to those skilled in the art,
and so forth.
[0035] The polynucleotide sequences of the invention encode
polypeptides that are members of well-known transcription factor
families, including plant transcription factor families, as
disclosed in Table 4. Generally, the transcription factors encoded
by the present sequences are involved in cell differentiation and
proliferation and the regulation of growth. Accordingly, one
skilled in the art would recognize that by expressing the present
sequences in a plant, one may change the expression of autologous
genes or induce the expression of introduced genes. By affecting
the expression of similar autologous sequences in a plant that have
the biological activity of the present sequences, or by introducing
the present sequences into a plant, one may alter a plant's
phenotype to one with improved traits. The sequences of the
invention may also be used to transform a plant and introduce
desirable traits not found in the wild-type cultivar or strain.
Plants may then be selected for those that produce the most
desirable degree of over- or underexpression of target genes of
interest and coincident trait improvement.
[0036] The sequences of the present invention may be from any
species, particularly plant species, in a naturally occurring form
or from any source whether natural, synthetic, semi-synthetic or
recombinant. The sequences of the invention may also include
fragments of the present amino acid sequences. In this context, a
"fragment" refers to a fragment of a polypeptide sequence which is
at least 5 to about 15 amino acids in length, most preferably at
least 14 amino acids, and which retain some biological activity of
a transcription factor. Where "amino acid sequence" is recited to
refer to an amino acid sequence of a naturally occurring protein
molecule, "amino acid sequence" and like terms are not meant to
limit the amino acid sequence to the complete native amino acid
sequence associated with the recited protein molecule.
[0037] As one of ordinary skill in the art recognizes,
transcription factors can be identified by the presence of a region
or domain of structural similarity or identity to a specific
consensus sequence or the presence of a specific consensus
DNA-binding site or DNA-binding site motif (see, for example,
Riechmann et al., (2000) Science 290: 2105-2110). The plant
transcription factors may belong to one of the following
transcription factor families: the AP2 (APETALA2) domain
transcription factor family (Riechmann and Meyerowitz (1998) Biol.
Chem. 379:633-646); the MYB transcription factor family (Martin and
Paz-Ares, (1997) Trends Genet. 13:67-73); the MADS domain
transcription factor family (Riechmann and Meyerowitz (1997) Biol.
Chem. 378:1079-1101); the WRKY protein family (Ishiguro and
Nakamura (1994) Mol. Gen. Genet. 244:563-571); the ankyrin-repeat
protein family (Zhang et al. (1992) Plant Cell 4:1575-1588); the
zinc finger protein (Z) family (Klug and Schwabe (1995) FASEB J. 9:
597-604); the homeobox (HB) protein family (Buerglin in Guidebook
to the Homeobox Genes, Duboule (ed.) (1994) Oxford University
Press); the CAAT-element binding proteins (Forsburg and Guarente
(1989) Genes Dev. 3:1166-1178); the squamosa promoter binding
proteins (SPB) (Klein et al. (1996) Mol. Gen. Genet. 1996
250:7-16); the NAM protein family (Souer et al. (1996) Cell
85:159-170); the IAA/AUX proteins (Rouse et al. (1998) Science
279:1371-1373); the HLH/MYC protein family (Littlewood et al.
(1994) Prot. Profile 1:639-709); the DNA-binding protein (DBP)
family (Tucker et al. (1994) EMBO J. 13:2994-3002); the bZIP family
of transcription factors (Foster et al. (1994) FASEB J. 8:192-200);
the Box P-binding protein (the BPF-1) family (da Costa e Silva et
al. (1993) Plant J. 4:125-135); the high mobility group (HMG)
family (Bustin and Reeves (1996) Prog. Nucl. Acids Res. Mol. Biol.
54:35-100); the scarecrow (SCR) family (Di Laurenzio et al. (1996)
Cell 86:423-433); the GF14 family (Wu et al. (1997) Plant Physiol.
114:1421-1431); the polycomb (PCOMB) family (Kennison (1995) Annu.
Rev. Genet. 29:289-303); the teosinte branched (TEO) family (Luo et
al. (1996) Nature 383:794-799; the ABI3 family (Giraudat et al.
(1992) Plant Cell 4:1251-1261); the triple helix (TH) family
(Dehesh et al. (1990) Science 250:1397-1399); the EIL family (Chao
et al. (1997) Cell 89:1133-44); the AT-HOOK family (Reeves and
Nissen (1990) J. Biol. Chem. 265:8573-8582); the S1FA family (Zhou
et al. (1995) Nucleic Acids Res. 23:1165-1169); the bZIPT2 family
(Lu and Ferl (1995) Plant Physiol. 109:723); the YABBY family
(Bowman et al. (1999) Development 126:2387-96); the PAZ family
(Bohmert et al. (1998) EMBO J. 17:170-80); a family of
miscellaneous (MISC) transcription factors including the DPBF
family (Kim et al. (1997) Plant J. 11:1237-1251) and the SPF1
family (Ishiguro and Nakamura (1994) Mol. Gen. Genet. 244:563-571);
the golden (GLD) family (Hall et al. (1998) Plant Cell 10:925-936),
the TUBBY family (Boggin et al, (1999) Science 286:2119-2125), the
heat shock family (Wu C (1995) Annu Rev Cell Dev Biol 11:441-469),
the ENBP family (Christiansen et al (1996) Plant Mol Biol
32:809-821), the RING-zinc family (Jensen et al. (1998) FEBS
letters 436:283-287), the PDBP family (Janik et al Virology. (1989)
168:320-329), the PCF family (Cubas P, et al. Plant J. (1999)
18:215-22), the SRS(SHI-related) family (Fridborg et al Plant Cell
(1999) 11:1019-1032), the CPP (cysteine-rich polycomb-like) family
(Cvitanich et al Proc. Natl. Acad. Sci. USA. (2000) 97:8163-8168),
the ARF (auxin response factor) family (Ulmasov, et al. (1999)
Proc. Natl. Acad. Sci. USA 96: 5844-5849), the SWI/SNF family
(Collingwood et al J. Mol. End. 23:255-275), the ACBF family
(Seguin et al (1997) Plant Mal Biol. 35:281-291), PCGL (CG-1 like)
family (da Costa e Silva et al. (1994) Plant Mol. Biol. 25:921-924)
the ARID family (Vazquez et al. (1999) Development. 126: 733-42),
the Jumonji family, Balciunas et al (2000, Trends Biochem Sci. 25:
274-276), the bZIP-NIN family (Schauser et al (1999) Nature 402:
191-195), the E2F family Kaelin et al (1992) Cell 70: 351-364) and
the GRF-like family (Knaap et al (2000) Plant Physiol. 122:
695-704). As indicated by any part of the list above and as known
in the art, transcription factors have been sometimes categorized
by class, family, and sub-family according to their structural
content and consensus DNA-binding site motif, for example. Many of
the classes and many of the families and sub-families are listed
here. However, the inclusion of one sub-family and not another, or
the inclusion of one family and not another, does not mean that the
invention does not encompass polynucleotides or polypeptides of a
certain family or sub-family. The list provided here is merely an
example of the types of transcription factors and the knowledge
available concerning the consensus sequences and consensus
DNA-binding site motifs that help define them as known to those of
skill in the art (each of the references noted above are
specifically incorporated herein by reference). A transcription
factor may include, but is not limited to, any polypeptide that can
activate or repress transcription of a single gene or a number of
genes. This polypeptide group includes, but is not limited to,
DNA-binding proteins, DNA-binding protein binding proteins, protein
kinases, protein phosphatases, GTP-binding proteins, and receptors,
and the like.
[0038] In addition to methods for modifying a plant phenotype by
employing one or more polynucleotides and polypeptides of the
invention described herein, the polynucleotides and polypeptides of
the invention have a variety of additional uses. These uses include
their use in the recombinant production (i.e., expression) of
proteins; as regulators of plant gene expression, as diagnostic
probes for the presence of complementary or partially complementary
nucleic acids (including for detection of natural coding nucleic
acids); as substrates for further reactions, e.g., mutation
reactions, PCR reactions, or the like; as substrates for cloning
e.g., including digestion or ligation reactions; and for
identifying exogenous or endogenous modulators of the transcription
factors. A "polynucleotide" is a nucleic acid sequence comprising a
plurality of polymerized nucleotides, e.g., at least about 15
consecutive polymerized nucleotides, optionally at least about 30
consecutive nucleotides, at least about 50 consecutive nucleotides.
In many instances, a polynucleotide comprises a nucleotide sequence
encoding a polypeptide (or protein) or a domain or fragment
thereof. Additionally, the polynucleotide may comprise a promoter,
an intron, an enhancer region, a polyadenylation site, a
translation initiation site, 5' or 3' untranslated regions, a
reporter gene, a selectable marker, or the like. The polynucleotide
can be single stranded or double stranded DNA or RNA. The
polynucleotide optionally comprises modified bases or a modified
backbone. The polynucleotide can be, e.g., genomic DNA or RNA, a
transcript (such as an mRNA), a cDNA, a PCR product, a cloned DNA,
a synthetic DNA or RNA, or the like. The polynucleotide can
comprise a sequence in either sense or antisense orientations.
DEFINITIONS
[0039] A "recombinant polynucleotide" is a polynucleotide that is
not in its native state, e.g., the polynucleotide comprises a
nucleotide sequence not found in nature, or the polynucleotide is
in a context other than that in which it is naturally found, e.g.,
separated from nucleotide sequences with which it typically is in
proximity in nature, or adjacent (or contiguous with) nucleotide
sequences with which it typically is not in proximity. For example,
the sequence at issue can be cloned into a vector, or otherwise
recombined with one or more additional nucleic acid.
[0040] An "isolated polynucleotide" is a polynucleotide whether
naturally occurring or recombinant, that is present outside the
cell in which it is typically found in nature, whether purified or
not. Optionally, an isolated polynucleotide is subject to one or
more enrichment or purification procedures, e.g., cell lysis,
extraction, centrifugation, precipitation, or the like.
[0041] A "polypeptide" is an amino acid sequence comprising a
plurality of consecutive polymerized amino acid residues e.g., at
least about 15 consecutive polymerized amino acid residues,
optionally at least about 30 consecutive polymerized amino acid
residues, at least about 50 consecutive polymerized amino acid
residues. In many instances, a polypeptide comprises a polymerized
amino acid residue sequence that is a transcription factor or a
domain or portion or fragment thereof. Additionally, the
polypeptide may comprise a localization domain, 2) an activation
domain, 3) a repression domain, 4) an oligomerization domain or 5)
a DNA-binding domain, or the like. The polypeptide optionally
comprises modified amino acid residues, naturally occurring amino
acid residues not encoded by a codon, non-naturally occurring amino
acid residues.
[0042] A "recombinant polypeptide" is a polypeptide produced by
translation of a recombinant polynucleotide. A "synthetic
polypeptide" is a polypeptide created by consecutive polymerization
of isolated amino acid residues using methods well known in the
art. An "isolated polypeptide," whether a naturally occurring or a
recombinant polypeptide, is more enriched in (or out of) a cell
than the polypeptide in its natural state in a wild type cell,
e.g., more than about 5% enriched, more than about 10% enriched, or
more than about 20%, or more than about 50%, or more, enriched,
i.e., alternatively denoted: 105%, 110%, 120%, 150% or more,
enriched relative to wild type standardized at 100%. Such an
enrichment is not the result of a natural response of a wild type
plant. Alternatively, or additionally, the isolated polypeptide is
separated from other cellular components with which it is typically
associated, e.g., by any of the various protein purification
methods herein.
[0043] "Identity" or "similarity" refers to sequence similarity
between two polynucleotide sequences or between two polypeptide
sequences, with identity being a more strict comparison. The
phrases "percent identity" and "% identity" refer to the percentage
of sequence similarity found in a comparison of two or more
polynucleotide sequences or two or more polypeptide sequences.
Identity or similarity can be determined by comparing a position in
each sequence that may be aligned for purposes of comparison. When
a position in the compared sequence is occupied by the same
nucleotide base or amino acid, then the molecules are identical at
that position. A degree of similarity or identity between
polynucleotide sequences is a function of the number of identical
or matching nucleotides at positions shared by the polynucleotide
sequences. A degree of identity of polypeptide sequences is a
function of the number of identical amino acids at positions shared
by the polypeptide sequences. A degree of homology or similarity of
polypeptide sequences is a function of the number of amino acids,
i.e., structurally related, at positions shared by the polypeptide
sequences.
[0044] "Alignment" refers to a number of nucleotide bases or amino
acid residue sequences aligned by lengthwise comparison so that
components in common (i.e., nucleotide bases or amino acid residues
at corresponding positions) may be visually and readily identified.
The fraction or percentage of components in common is related to
the homology or identity between the sequences.
[0045] "Altered" nucleic acid sequences encoding polypeptide
include those sequences with deletions, insertions, or
substitutions of different nucleotides, resulting in a
polynucleotide encoding a polypeptide with at least one functional
characteristic of the polypeptide. Included within this definition
are polymorphisms that may or may not be readily detectable using a
particular oligonucleotide probe of the polynucleotide encoding
polypeptide, and improper or unexpected hybridization to allelic
variants, with a locus other than the normal chromosomal locus for
the polynucleotide sequence encoding polypeptide. The encoded
polypeptide protein may also be "altered", and may contain
deletions, insertions, or substitutions of amino acid residues that
produce a silent change and result in a functionally equivalent
polypeptide. Deliberate amino acid substitutions may be made on the
basis of similarity in residue side chain chemistry, including, but
not limited to, polarity, charge, solubility, hydrophobicity,
hydrophilicity, and/or the amphipathic nature of the residues, as
long as the biological activity of polypeptide is retained. For
example, negatively charged amino acids may include aspartic acid
and glutamic acid, positively charged amino acids may include
lysine and arginine, and amino acids with uncharged polar head
groups having similar hydrophilicity values may include leucine,
isoleucine, and valine; glycine and alanine; asparagine and
glutamine; serine and threonine; and phenylalanine and tyrosine.
Alignments between different polypeptide sequences may be used to
calculate "percentage sequence similarity".
[0046] The term "plant" includes whole plants, shoot vegetative
organs/structures (e.g., leaves, stems and tubers), roots, flowers
and floral organs/structures (e.g., bracts, sepals, petals,
stamens, carpels, anthers and ovules), seed (including embryo,
endosperm, and seed coat) and fruit (the mature ovary), plant
tissue (e.g., vascular tissue, ground tissue, and the like) and
cells (e.g., guard cells, egg cells, and the like), and progeny of
same. The class of plants that can be used in the method of the
invention is generally as broad as the class of higher and lower
plants amenable to transformation techniques, including angiosperms
(monocotyledonous and dicotyledonous plants), gymnosperms, ferns,
horsetails, psilophytes, lycophytes, bryophytes, and multicellular
algae. (See for example, FIG. 1, adapted from Daly et al. 2001
Plant Physiology 127:1328-1333; and see also Tudge, C., The Variety
of Life, Oxford University Press, New York, 2000, pp. 547-606.)
[0047] A "transgenic plant" refers to a plant that contains genetic
material not found in a wild type plant of the same species,
variety or cultivar. The genetic material may include a transgene,
an insertional mutagenesis event (such as by transposon or T-DNA
insertional mutagenesis), an activation tagging sequence, a mutated
sequence, a homologous recombination event or a sequence modified
by chimeraplasty. Typically, the foreign genetic material has been
introduced into the plant by human manipulation, but any method can
be used as one of skill in the art recognizes.
[0048] A transgenic plant may contain an expression vector or
cassette. The expression cassette typically comprises a
polypeptide-encoding sequence operably linked (i.e., under
regulatory control of) to appropriate inducible or constitutive
regulatory sequences that allow for the expression of polypeptide.
The expression cassette can be introduced into a plant by
transformation or by breeding after transformation of a parent
plant. A plant refers to a whole plant as well as to a plant part,
such as seed, fruit, leaf, or root, plant tissue, plant cells or
any other plant material, e.g., a plant explant, as well as to
progeny thereof, and to in vitro systems that mimic biochemical or
cellular components or processes in a cell.
[0049] A "control plant" as used in the present invention refers to
a plant cell, seed, plant component, plant tissue, plant organ or
whole plant used to compare against transformed, transgenic or
genetically modified plant for the purpose of identifying an
enhanced phenotype in the transformed, transgenic or genetically
modified plant. A control plant may in some cases be a transformed
or transgenic plant line that comprises an empty nucleic acid
construct or marker gene, but does not contain the recombinant
polynucleotide of the present invention that is expressed in the
transformed, transgenic or genetically modified plant being
evaluated. In general, a control plant is a plant of the same line
or variety as the transformed, transgenic or genetically modified
plant being tested. A suitable control plant would include a
genetically unaltered or non-transgenic plant of the parental line
used to generate a transformed or transgenic plant herein.
[0050] "Wild type" or "wild-type", as used herein, refers to a
plant cell, seed, plant component, plant tissue, plant organ or
whole plant that has not been genetically modified or treated in an
experimental sense. Wild-type cells, seed, components, tissue,
organs or whole plants may be used as controls to compare levels of
expression and the extent and nature of trait modification with
cells, tissue or plants of the same species in which a
polypeptide's expression is altered, for example, in that it has
been knocked out, overexpressed, or ectopically expressed.
[0051] "Ectopic expression or altered expression" in reference to a
polynucleotide indicates that the pattern of expression in, e.g., a
transgenic plant or plant tissue, is different from the expression
pattern in a wild type plant or a reference plant of the same
species. The pattern of expression may also be compared with a
reference expression pattern in a wild type plant of the same
species. For example, the polynucleotide or polypeptide is
expressed in a cell or tissue type other than a cell or tissue type
in which the sequence is expressed in the wild type plant, or by
expression at a time other than at the time the sequence is
expressed in the wild type plant, or by a response to different
inducible agents, such as hormones or environmental signals, or at
different expression levels (either higher or lower) compared with
those found in a wild type plant. The term also refers to altered
expression patterns that are produced by lowering the levels of
expression to below the detection level or completely abolishing
expression. The resulting expression pattern can be transient or
stable, constitutive or inducible. In reference to a polypeptide,
the term "ectopic expression or altered expression" further may
relate to altered activity levels resulting from the interactions
of the polypeptides with exogenous or endogenous modulators or from
interactions with factors or as a result of the chemical
modification of the polypeptides.
[0052] A "fragment" or "domain," with respect to a polypeptide,
refers to a subsequence of the polypeptide. In some cases, the
fragment or domain, is a subsequence of the polypeptide which
performs at least one biological function of the intact polypeptide
in substantially the same manner, or to a similar extent, as does
the intact polypeptide. For example, a polypeptide fragment can
comprise a recognizable structural motif or functional domain such
as a DNA-binding site or domain that binds to a DNA promoter
region, an activation domain, or a domain for protein-protein
interactions. Fragments can vary in size from as few as 6 amino
acids to the full length of the intact polypeptide, but are
preferably at least about 30 amino acids in length and more
preferably at least about 60 amino acids in length. In reference to
a polynucleotide sequence, "a fragment" refers to any subsequence
of a polynucleotide, typically, of at least about 15 consecutive
nucleotides, preferably at least about 30 nucleotides, more
preferably at least about 50 nucleotides, of any of the sequences
provided herein.
[0053] The invention also encompasses production of DNA sequences
that encode transcription factors and transcription factor
derivatives, or fragments thereof, entirely by synthetic chemistry.
After production, the synthetic sequence may be inserted into any
of the many available expression vectors and cell systems using
reagents well known in the art. Moreover, synthetic chemistry may
be used to introduce mutations into a sequence encoding
transcription factors or any fragment thereof.
[0054] A "conserved domain", with respect to a polypeptide, refers
to a domain within a transcription factor family which exhibits a
higher degree of sequence homology, such as at least 50%, at least
51%, at least 52%, at least 53%, at least 54%, at least 55%, at
least 56%, at least 57%, at least 58%, at least 59%, at least 60%,
at least 61%, at least 62%, at least 63%, at least 64%, at least
65%, at least 66%, at least 67%, at least 68%, at least 69%, at
least 70%, at least 71%, at least 72%, at least 73%, at least 74%,
at least 75%, at least 76%, at least 77%, at least 78%, at least
79%, at least 80%, at least 81%, at least 82%, at least 83%, at
least 84%, at least 85%, at least 86%, at least 87%, at least 88%,
at least 89%, at least 90%, at least 91%, at least 92%, at least
93%, at least 94%, at least 95%, at least 96%, at least 97%, at
least 98%, at least 99%, or about 100% amino acid residue sequence
identity of a polypeptide of consecutive amino acid residues. A
fragment or domain can be referred to as outside a consensus
sequence or outside a consensus DNA-binding site that is known to
exist or that exists for a particular transcription factor class,
family, or sub-family. In this case, the fragment or domain will
not include the exact amino acids of a consensus sequence or
consensus DNA-binding site of a transcription factor class, family
or sub-family, or the exact amino acids of a particular
transcription factor consensus sequence or consensus DNA-binding
site. Furthermore, a particular fragment, region, or domain of a
polypeptide, or a polynucleotide encoding a polypeptide, can be
"outside a conserved domain" if all the amino acids of the
fragment, region, or domain fall outside of a defined conserved
domain(s) for a polypeptide or protein. The conserved domains for
each of polypeptides of SEQ ID NOs:2-2N, where N=2-123, are listed
in Table 4 as described in Example VII. Also, many of the
polypeptides of Table 4 have conserved domains specifically
indicated by start and stop sites. A comparison of the regions of
the polypeptides in SEQ ID NOs:2-2N, where N=2-123, or of those in
Table 4, allows one of skill in the art to identify conserved
domain(s) for any of the polypeptides listed or referred to in this
disclosure, including those in Table 4 or Table 5.
[0055] A "trait" refers to a physiological, morphological,
biochemical, or physical characteristic of a plant or particular
plant material or cell. In some instances, this characteristic is
visible to the human eye, such as seed or plant size, or can be
measured by biochemical techniques, such as detecting the protein,
starch, or oil content of seed or leaves, or by observation of a
metabolic or physiological process, e.g. by measuring uptake of
carbon dioxide, or by the observation of the expression level of a
gene or genes, e.g., by employing Northern analysis, RT-PCR,
microarray gene expression assays, or reporter gene expression
systems, or by agricultural observations such as stress tolerance,
yield, or pathogen tolerance. Any technique can be used to measure
the amount of, comparative level of, or difference in any selected
chemical compound or macromolecule in the transgenic plants,
however.
[0056] "Trait modification" refers to a detectable difference in a
characteristic in a plant ectopically expressing a polynucleotide
or polypeptide of the present invention relative to a plant not
doing so, such as a wild type plant. In some cases, the trait
modification can be evaluated quantitatively. For example, the
trait modification can entail at least about a 2% increase or
decrease in an observed trait (difference), at least a 5%
difference, at least about a 10% difference, at least about a 20%
difference, at least about a 30%, at least about a 50%, at least
about a 70%, or at least about a 100%, or an even greater
difference compared with a wild type plant. It is known that there
can be a natural variation in the modified trait. Therefore, the
trait modification observed entails a change of the normal
distribution of the trait in the plants compared with the
distribution observed in wild type plant.
[0057] Traits Which May Be Modified. Trait modifications of
particular interest include those to seed (such as embryo or
endosperm), fruit, root, flower, leaf, stem, shoot, seedling or the
like, including: enhanced tolerance to environmental conditions
including freezing, chilling, heat, drought, water saturation,
radiation and ozone; improved tolerance to microbial, fungal or
viral diseases; improved tolerance to pest infestations, including
nematodes, mollicutes, parasitic higher plants or the like;
decreased herbicide sensitivity; improved tolerance of heavy metals
or enhanced ability to take up heavy metals; improved growth under
poor photoconditions (e.g., low light and/or short day length), or
changes in expression levels of genes of interest. Other phenotype
that can be modified relate to the production of plant metabolites,
such as variations in the production of taxol, tocopherol,
tocotrienol, sterols, phytosterols, vitamins, wax monomers,
anti-oxidants, amino acids, lignins, cellulose, tannins,
prenyllipids (such as chlorophylls and carotenoids),
glucosinolates, and terpenoids, enhanced or compositionally altered
protein or oil production (especially in seeds), or modified sugar
(insoluble or soluble) and/or starch composition. Physical plant
characteristics that can be modified include cell development (such
as the number of trichomes), fruit and seed size and number, yields
of plant parts such as stems, leaves, inflorescences, and roots,
the stability of the seeds during storage, characteristics of the
seed pod (e.g., susceptibility to shattering), root hair length and
quantity, internode distances, or the quality of seed coat. Plant
growth characteristics that can be modified include growth rate,
germination rate of seeds, vigor of plants and seedlings, leaf and
flower senescence, male sterility, apomixis, flowering time, flower
abscission, rate of nitrogen uptake, osmotic sensitivity to soluble
sugar concentrations, biomass or transpiration characteristics, as
well as plant architecture characteristics such as apical
dominance, branching patterns, number of organs, organ identity,
organ shape or size.
[0058] Transcription Factors Modify Expression Of Endogenous Genes.
Expression of genes which encode transcription factors that modify
expression of endogenous genes, polynucleotides, and proteins are
well known in the art. In addition, transgenic plants comprising
isolated polynucleotides encoding transcription factors may also
modify expression of endogenous genes, polynucleotides, and
proteins. Examples include Peng et al. (1997, Genes and Development
11:3194-3205) and Peng et al. (1999, Nature, 400:256-261). In
addition, many others have demonstrated that an Arabidopsis
transcription factor expressed in an exogenous plant species
elicits the same or very similar phenotypic response. See, for
example, Fu et al. (2001, Plant Cell 13:1791-1802); Nandi et al.
(2000, Curr. Biol. 10:215-218); Coupland (1995, Nature
377:482-483); and Weigel and Nilsson (1995, Nature
377:482-500).
[0059] In another example, Mandel et al. (1992, Cell 71-133-143)
and Suzuki et al. (2001, Plant J. 28:409-418) teach that a
transcription factor expressed in another plant species elicits the
same or very similar phenotypic response of the endogenous
sequence, as often predicted in earlier studies of Arabidopsis
transcription factors in Arabidopsis (see Mandel et al., 1992,
supra; Suzuki et al., 2001, supra).
[0060] Other examples include Miller et al. (2001, Plant J.
28:169-179); Kim et al. (2001, Plant J. 25:247-259); Kyozuka and
Shimamoto (2002, Plant Cell Physiol. 43:130-135); Boss and Thomas
(2002, Nature, 416:847-850); He et al. (2000, Transgenic Res.,
9:223-227); and Robson et al. (2001, Plant J. 28:619-631).
[0061] In yet another example, Gilmour et al. (1998, Plant J.
16:433-442) teach an Arabidopsis AP2 transcription factor, CBF1,
which, when overexpressed in transgenic plants, increases plant
freezing tolerance. Jaglo et al (2001, Plant Physiol. 127:910-017)
further identified sequences in Brassica napus which encode
CBF-like genes and that transcripts for these genes accumulated
rapidly in response to low temperature. Transcripts encoding
CBF-like proteins were also found to accumulate rapidly in response
to low temperature in wheat, as well as in tomato. An alignment of
the CBF proteins from Arabidopsis, B. napus, wheat, rye, and tomato
revealed the presence of conserved amino acid sequences,
PKK/RPAGRxKFxETRHP and DSAWR, that bracket the AP2/EREBP DNA
binding domains of the proteins and distinguish them from other
members of the AP2/EREBP protein family. (See Jaglo et al.,
supra.)
[0062] Polypeptides and Polynucleotides of the Invention. The
present invention provides, among other things, transcription
factors (TFs), and transcription factor homologue polypeptides, and
isolated or recombinant polynucleotides encoding the polypeptides,
or novel variant polypeptides or polynucleotides encoding novel
variants of transcription factors derived from the specific
sequences provided here. These polypeptides and polynucleotides may
be employed to modify a plant's characteristic.
[0063] Exemplary polynucleotides encoding the polypeptides of the
invention were identified in the Arabidopsis thaliana GenBank
database using publicly available sequence analysis programs and
parameters. Sequences initially identified were then further
characterized to identify sequences comprising specified sequence
strings corresponding to sequence motifs present in families of
known transcription factors. In addition, further exemplary
polynucleotides encoding the polypeptides of the invention were
identified in the plant GenBank database using publicly available
sequence analysis programs and parameters. Sequences initially
identified were then further characterized to identify sequences
comprising specified sequence strings corresponding to sequence
motifs present in families of known transcription factors.
Polynucleotide sequences meeting such criteria were confirmed as
transcription factors.
[0064] Additional polynucleotides of the invention were identified
by screening Arabidopsis thaliana and/or other plant cDNA libraries
with probes corresponding to known transcription factors under low
stringency hybridization conditions. Additional sequences,
including full length coding sequences were subsequently recovered
by the rapid amplification of cDNA ends (RACE) procedure, using a
commercially available kit according to the manufacturer's
instructions. Where necessary, multiple rounds of RACE are
performed to isolate 5' and 3' ends. The full length cDNA was then
recovered by a routine end-to-end polymerase chain reaction (PCR)
using primers specific to the isolated 5' and 3' ends. Exemplary
sequences are provided in the Sequence Listing.
[0065] The polynucleotides of the invention can be or were
ectopically expressed in overexpressor or knockout plants and the
changes in the characteristic(s) or trait(s) of the plants
observed. Therefore, the polynucleotides and polypeptides can be
employed to improve the characteristics of plants.
[0066] The polynucleotides of the invention can be or were
ectopically expressed in overexpressor plant cells and the changes
in the expression levels of a number of genes, polynucleotides,
and/or proteins of the plant cells observed. Therefore, the
polynucleotides and polypeptides can be employed to change
expression levels of a genes, polynucleotides, and/or proteins of
plants.
[0067] Producing Polypeptides. The polynucleotides of the invention
include sequences that encode transcription factors and
transcription factor homologue polypeptides and sequences
complementary thereto, as well as unique fragments of coding
sequence, or sequence complementary thereto. Such polynucleotides
can be, e.g., DNA or RNA, e.g., mRNA, cRNA, synthetic RNA, genomic
DNA, cDNA synthetic DNA, oligonucleotides, etc. The polynucleotides
are either double-stranded or single-stranded, and include either,
or both sense (i.e., coding) sequences and antisense (i.e.,
non-coding, complementary) sequences. The polynucleotides include
the coding sequence of a transcription factor, or transcription
factor homologue polypeptide, in isolation, in combination with
additional coding sequences (e.g., a purification tag, a
localization signal, as a fusion-protein, as a pre-protein, or the
like), in combination with non-coding sequences (e.g., introns or
inteins, regulatory elements such as promoters, enhancers,
terminators, and the like), and/or in a vector or host environment
in which the polynucleotide encoding a transcription factor or
transcription factor homologue polypeptide is an endogenous or
exogenous gene.
[0068] A variety of methods exist for producing the polynucleotides
of the invention. Procedures for identifying and isolating DNA
clones are well known to those of skill in the art, and are
described in, e.g., Berger and Kimmel, Guide to Molecular Cloning
Techniques, Methods in Enzymology volume 152 Academic Press, Inc.,
San Diego, Calif. ("Berger"); Sambrook et al., Molecular Cloning--A
Laboratory Manual (2nd Ed.), Vol. 1-3, Cold Spring Harbor
Laboratory, Cold Spring Harbor, N.Y., 1989 ("Sambrook") and Current
Protocols in Molecular Biology, F. M. Ausubel et al., eds., Current
Protocols, a joint venture between Greene Publishing Associates,
Inc. and John Wiley & Sons, Inc., (supplemented through 2000)
("Ausubel").
[0069] Alternatively, polynucleotides of the invention, can be
produced by a variety of in vitro amplification methods adapted to
the present invention by appropriate selection of specific or
degenerate primers. Examples of protocols sufficient to direct
persons of skill through in vitro amplification methods, including
the polymerase chain reaction (PCR) the ligase chain reaction
(LCR), Qbeta-replicase amplification and other RNA polymerase
mediated techniques (e.g., NASBA), e.g., for the production of the
homologous nucleic acids of the invention are found in Berger
(supra), Sambrook (supra), and Ausubel (supra), as well as Mullis
et al., (1987) PCR Protocols A Guide to Methods and Applications
(Innis et al. eds) Academic Press Inc. San Diego, Calif. (1990)
(Innis). Improved methods for cloning in vitro amplified nucleic
acids are described in Wallace et al., U.S. Pat. No. 5,426,039.
Improved methods for amplifying large nucleic acids by PCR are
summarized in Cheng et al. (1994) Nature 369: 684-685 and the
references cited therein, in which PCR amplicons of up to 40 kb are
generated. One of skill will appreciate that essentially any RNA
can be converted into a double stranded DNA suitable for
restriction digestion, PCR expansion and sequencing using reverse
transcriptase and a polymerase. See, e.g., Ausubel, Sambrook and
Berger, all supra.
[0070] Alternatively, polynucleotides and oligonucleotides of the
invention can be assembled from fragments produced by solid-phase
synthesis methods. Typically, fragments of up to approximately 100
bases are individually synthesized and then enzymatically or
chemically ligated to produce a desired sequence, e.g., a
polynucleotide encoding all or part of a transcription factor. For
example, chemical synthesis using the phosphoramidite method is
described, e.g., by Beaucage et al. (1981) Tetrahedron Letters
22:1859-1869; and Matthes et al. (1984) EMBO J. 3:801-805.
According to such methods, oligonucleotides are synthesized,
purified, annealed to their complementary strand, ligated and then
optionally cloned into suitable vectors. And if so desired, the
polynucleotides and polypeptides of the invention can be custom
ordered from any of a number of commercial suppliers.
[0071] Homologous Sequences. Sequences homologous, i.e., that share
significant sequence identity or similarity, to those provided in
the Sequence Listing, derived from Arabidopsis thaliana or from
other plants of choice are also an aspect of the invention.
Homologous sequences can be derived from any plant including
monocots and dicots and in particular agriculturally important
plant species, including but not limited to, crops such as soybean,
wheat, corn, potato, cotton, rice, rape, oilseed rape (including
canola), sunflower, alfalfa, sugarcane and turf; or fruits and
vegetables, such as banana, blackberry, blueberry, strawberry, and
raspberry, cantaloupe, carrot, cauliflower, coffee, cucumber,
eggplant, grapes, honeydew, lettuce, mango, melon, onion, papaya,
peas, peppers, pineapple, pumpkin, spinach, squash, sweet corn,
tobacco, tomato, watermelon, rosaceous fruits (such as apple,
peach, pear, cherry and plum) and vegetable brassicas (such as
broccoli, cabbage, cauliflower, Brussels sprouts, and kohlrabi).
Other crops, fruits and vegetables whose phenotype can be changed
include barley, rye, millet, sorghum, currant, avocado, citrus
fruits such as oranges, lemons, grapefruit and tangerines,
artichoke, cherries, nuts such as the walnut and peanut, endive,
leek, roots, such as arrowroot, beet, cassaya, turnip, radish, yam,
and sweet potato, and beans. The homologous sequences may also be
derived from woody species, such pine, poplar and eucalyptus, or
mint or other labiates.
Orthologs and Paralogs.
[0072] Homologous sequences as described above can comprise
orthologous or paralogous sequences. Several different methods are
known by those of skill in the art for identifying and defining
these functionally homologous sequences. General methods for
identifying orthologs and paralogs, including phylogenetic methods,
sequence similarity and hybridization methods, are described
herein; an ortholog or paralog, including equivalogs, may be
identified by one or more of the methods described below.
[0073] As described by Eisen (Eisen (1998) Genome Res. 8: 163-167),
evolutionary information may be used to predict gene function. It
is common for groups of genes that are homologous in sequence to
have diverse, although usually related, functions. However, in many
cases, the identification of homologs is not sufficient to make
specific predictions because not all homologs have the same
function. Thus, an initial analysis of functional relatedness based
on sequence similarity alone may not provide one with a means to
determine where similarity ends and functional relatedness begins.
Fortunately, it is well known in the art that protein function can
be classified using phylogenetic analysis of gene trees combined
with the corresponding species. Functional predictions can be
greatly improved by focusing on how the genes became similar in
sequence (i.e., by evolutionary processes) rather than on the
sequence similarity itself (Eisen, supra). In fact, many specific
examples exist in which gene function has been shown to correlate
well with gene phylogeny (Eisen, supra). Thus, "[t]he first step in
making functional predictions is the generation of a phylogenetic
tree representing the evolutionary history of the gene of interest
and its homologs. Such trees are distinct from clusters and other
means of characterizing sequence similarity because they are
inferred by techniques that help convert patterns of similarity
into evolutionary relationships . . . . After the gene tree is
inferred, biologically determined functions of the various homologs
are overlaid onto the tree. Finally, the structure of the tree and
the relative phylogenetic positions of genes of different functions
are used to trace the history of functional changes, which is then
used to predict functions of [as yet] uncharacterized genes"
(Eisen, supra).
[0074] Within a single plant species, gene duplication may cause
two copies of a particular gene, giving rise to two or more genes
with similar sequence and often similar function known as paralogs.
A paralog is therefore a similar gene formed by duplication within
the same species. Paralogs typically cluster together or in the
same clade (a group of similar genes) when a gene family phylogeny
is analyzed using programs such as CLUSTAL (Thompson et al. (1994)
Nucleic Acids Res. 22: 4673-4680; Higgins et al. (1996) Methods
Enzymol. 266: 383-402). Groups of similar genes can also be
identified with pair-wise BLAST analysis (Feng and Doolittle (1987)
J. Mol. Evol. 25: 351-360). For example, a clade of very similar
MADS domain transcription factors from Arabidopsis all share a
common function in flowering time (Ratcliffe et al. (2001) Plant
Physiol. 126: 122-132), and a group of very similar AP2 domain
transcription factors from Arabidopsis are involved in tolerance of
plants to freezing (Gilmour et al. (1998) Plant J. 16: 433-442).
Analysis of groups of similar genes with similar function that fall
within one clade can yield sub-sequences that are particular to the
clade. These sub-sequences, known as consensus sequences, can not
only be used to define the sequences within each clade, but define
the functions of these genes; genes within a clade may contain
paralogous sequences, or orthologous sequences that share the same
function (see also, for example, Mount (2001), in Bioinformatics:
Sequence and Genome Analysis, Cold Spring Harbor Laboratory Press,
Cold Spring Harbor, N.Y., p. 543).
[0075] Transcription factor gene sequences are conserved across
diverse eukaryotic species lines (Goodrich et al. (1993) Cell 75:
519-530; Lin et al. (1991) Nature 353: 569-571; Sadowski et al.
(1988) Nature 335: 563-564). Plants are no exception to this
observation; diverse plant species possess transcription factors
that have similar sequences and functions. Speciation, the
production of new species from a parental species, gives rise to
two or more genes with similar sequence and similar function. These
genes, termed orthologs, often have an identical function within
their host plants and are often interchangeable between species
without losing function. Because plants have common ancestors, many
genes in any plant species will have a corresponding orthologous
gene in another plant species. Once a phylogenic tree for a gene
family of one species has been constructed using a program such as
CLUSTAL (Thompson et al., supra); Higgins et al., supra) potential
orthologous sequences can be placed into the phylogenetic tree and
their relationship to genes from the species of interest can be
determined. Orthologous sequences can also be identified by a
reciprocal BLAST strategy. Once an orthologous sequence has been
identified, the function of the ortholog can be deduced from the
identified function of the reference sequence.
[0076] By using a phylogenetic analysis, one skilled in the art
would recognize that the ability to predict similar functions
conferred by closely-related polypeptides is predictable. This
predictability has been confirmed by our own many studies in which
we have found that a wide variety of polypeptides have orthologous
or closely-related homologous sequences that function as does the
first, closely-related reference sequence. For example, distinct
transcription factors, including:
[0077] (i) AP2 family Arabidopsis G47 (found in U.S. Pat. No.
7,135,616, issued 14 Nov. 2006), a phylogenetically-related
sequence from soybean, and two phylogenetically-related homologs
from rice all can confer greater tolerance to drought, hyperosmotic
stress, or delayed flowering as compared to control plants;
[0078] (ii) CAAT family Arabidopsis G481 (found in PCT patent
publication WO2004076638), and numerous phylogenetically-related
sequences from dicots and monocots can confer greater tolerance to
drought-related stress as compared to control plants;
[0079] (iii) Myb-related Arabidopsis G682 (found in U.S. Pat. No.
7,223,904, issued 29 May 2007) and numerous
phylogenetically-related sequences from dicots and monocots can
confer greater tolerance to heat, drought-related stress, cold, and
salt as compared to control plants;
[0080] (iv) WRKY family Arabidopsis G1274 (found in U.S. Pat. No.
7,196,245, issued 27 Mar. 2007) and numerous closely-related
sequences from dicots and monocots have been shown to confer
increased water deprivation tolerance, and
[0081] (v) AT-hook family soy sequence G3456 (found in US patent
publication US20040128712A1) and numerous phylogenetically-related
sequences from dicots and monocots, increased biomass compared to
control plants when these sequences are overexpressed in
plants.
[0082] The polypeptides sequences belong to distinct clades of
polypeptides that include members from diverse species. In each
case, most or all of the clade member sequences derived from both
dicots and monocots have been shown to confer increased tolerance
to one or more abiotic stresses when the sequences were
overexpressed, and hence will likely increase yield and or crop
quality. These studies each demonstrate that evolutionarily
conserved genes from diverse species are likely to function
similarly (i.e., by regulating similar target sequences and
controlling the same traits), and that polynucleotides from one
species may be transformed into closely-related or
distantly-related plant species to confer or improve traits.
[0083] At the nucleotide level, the sequences of the invention will
typically share at least about 30% or 40% nucleotide sequence
identity, preferably at least about 50%, about 60%, about 70% or
about 80% sequence identity, and more preferably about 85%, about
90%, about 95% or about 97% or more sequence identity to one or
more of the listed full-length sequences, or to a region of a
listed sequence excluding or outside of the region(s) encoding a
known consensus sequence or consensus DNA-binding site, or outside
of the region(s) encoding one or all conserved domains. The
degeneracy of the genetic code enables major variations in the
nucleotide sequence of a polynucleotide while maintaining the amino
acid sequence of the encoded protein.
[0084] At the polypeptide level, the sequences of the invention
will typically share at least about 50%, about 60%, about 70% or
about 80% sequence identity, and more preferably about 85%, about
90%, about 95% or about 97% or more sequence identity to one or
more of the listed full-length sequences, or to a listed sequence
but excluding or outside of the known consensus sequence or
consensus DNA-binding site.
[0085] Percent identity can be determined electronically, e.g., by
using the MEGALIGN program (DNASTAR, Inc. Madison, Wis.). The
MEGALIGN program can create alignments between two or more
sequences according to different methods, for example, the clustal
method (see, for example, Higgins and Sharp (1988) Gene 73:
237-244). The clustal algorithm groups sequences into clusters by
examining the distances between all pairs. The clusters are aligned
pairwise and then in groups. Other alignment algorithms or programs
may be used, including FASTA, BLAST, or ENTREZ, FASTA and BLAST,
and which may be used to calculate percent similarity. These are
available as a part of the GCG sequence analysis package
(University of Wisconsin, Madison, Wis.), and can be used with or
without default settings. ENTREZ is available through the National
Center for Biotechnology Information. In one embodiment, the
percent identity of two sequences can be determined by the GCG
program with a gap weight of 1, e.g., each amino acid gap is
weighted as if it were a single amino acid or nucleotide mismatch
between the two sequences (see U.S. Pat. No. 6,262,333).
[0086] Software for performing BLAST analyses is publicly
available, e.g., through the National Center for Biotechnology
Information (presently at www.ncbi.nlm.nih.gov). This algorithm
involves first identifying high scoring sequence pairs (HSPs) by
identifying short words of length W in the query sequence, which
either match or satisfy some positive-valued threshold score T when
aligned with a word of the same length in a database sequence. T is
referred to as the neighborhood word score threshold (Altschul
(1990) J. Mol. Biol. 215: 403-410; Altschul (1993) J. Mol. Evol.
36: 290-300). These initial neighborhood word hits act as seeds for
initiating searches to find longer HSPs containing them. The word
hits are then extended in both directions along each sequence for
as far as the cumulative alignment score can be increased.
Cumulative scores are calculated using, for nucleotide sequences,
the parameters M (reward score for a pair of matching residues;
always >0) and N (penalty score for mismatching residues; always
<0). For amino acid sequences, a scoring matrix is used to
calculate the cumulative score. Extension of the word hits in each
direction are halted when: the cumulative alignment score falls off
by the quantity X from its maximum achieved value; the cumulative
score goes to zero or below, due to the accumulation of one or more
negative-scoring residue alignments; or the end of either sequence
is reached. The BLAST algorithm parameters W, T, and X determine
the sensitivity and speed of the alignment. The BLASTN program (for
nucleotide sequences) uses as defaults a wordlength (W) of 11, an
expectation (E) of 10, a cutoff of 100, M=5, n=-4, and a comparison
of both strands. For amino acid sequences, the BLASTP program uses
as defaults a wordlength (W) of 3, an expectation (E) of 10, and
the BLOSUM62 scoring matrix (see Henikoff and Henikoff (1989) Proc.
Natl. Acad. Sci. USA 89:10915). Unless otherwise indicated for
comparisons of predicted polynucleotides, "sequence identity"
refers to the % sequence identity generated from a tblastx using
the NCBI version of the algorithm at the default settings using
gapped alignments with the filter "off" (see, for example,
www.ncbi.nlm.nih.gov/).
[0087] Other techniques for alignment are described by Doolittle,
(Doolittle, ed. (1996) Methods in Enzymology, vol. 266: "Computer
Methods for Macromolecular Sequence Analysis" Academic Press, Inc.,
San Diego, Calif., USA). Preferably, an alignment program that
permits gaps in the sequence is utilized to align the sequences.
The Smith-Waterman is one type of algorithm that permits gaps in
sequence alignments (see Shpaer (1997) Methods Mol. Biol. 70:
173-187). Also, the GAP program using the Needleman and Wunsch
alignment method can be utilized to align sequences. An alternative
search strategy uses MPSRCH software, which runs on a MASPAR
computer. MPSRCH uses a Smith-Waterman algorithm to score sequences
on a massively parallel computer. This approach improves ability to
pick up distantly related matches, and is especially tolerant of
small gaps and nucleotide sequence errors. Nucleic acid-encoded
amino acid sequences can be used to search both protein and DNA
databases.
[0088] The percentage similarity between two polypeptide sequences,
e.g., sequence A and sequence B, is calculated by dividing the
length of sequence A, minus the number of gap residues in sequence
A, minus the number of gap residues in sequence B, into the sum of
the residue matches between sequence A and sequence B, times one
hundred. Gaps of low or of no similarity between the two amino acid
sequences are not included in determining percentage similarity.
Percent identity between polynucleotide sequences can also be
counted or calculated by other methods known in the art, e.g., the
Jotun Hein method (see, for example, Hein (1990) Methods Enzymol.
183: 626-645). Identity between sequences can also be determined by
other methods known in the art, e.g., by varying hybridization
conditions (see US Patent Application No. 20010010913).
[0089] Thus, the invention provides methods for identifying a
sequence similar or paralogous or orthologous or homologous to one
or more polynucleotides as noted herein, or one or more target
polypeptides encoded by the polynucleotides, or otherwise noted
herein and may include linking or associating a given plant
phenotype or gene function with a sequence. In the methods, a
sequence database is provided (locally or across an internet or
intranet) and a query is made against the sequence database using
the relevant sequences herein and associated plant phenotypes or
gene functions.
[0090] In addition, one or more polynucleotide sequences or one or
more polypeptides encoded by the polynucleotide sequences may be
used to search against a BLOCKS (Bairoch et al. (1997) Nucleic
Acids Res. 25: 217-221), PFAM, and other databases which contain
previously identified and annotated motifs, sequences and gene
functions. Methods that search for primary sequence patterns with
secondary structure gap penalties (Smith et al. (1992) Protein
Engineering 5: 35-51) as well as algorithms such as Basic Local
Alignment Search Tool (BLAST; Altschul, 1990, supra; Altschul et
al., 1993, supra), BLOCKS (Henikoff and Henikoff (1991) Nucleic
Acids Res. 19: 6565-6572), Hidden Markov Models (HMM; Eddy (1996)
Curr. Opin. Str. Biol. 6: 361-365; Sonnhammer et al. (1997)
Proteins 28: 405-420), and the like, can be used to manipulate and
analyze polynucleotide and polypeptide sequences encoded by
polynucleotides. These databases, algorithms and other methods are
well known in the art and are described in Ausubel et al. (1997)
Short Protocols in Molecular Biology, John Wiley & Sons, New
York, N.Y., unit 7.7, and in Meyers (1995) Molecular Biology and
Biotechnology, Wiley VCH, New York, N.Y., p 856-853.
[0091] A further method for identifying or confirming that specific
homologous sequences control the same function is by comparison of
the transcript profile(s) obtained upon overexpression or knockout
of two or more related polypeptides. Since transcript profiles are
diagnostic for specific cellular states, one skilled in the art
will appreciate that genes that have a highly similar transcript
profile (e.g., with greater than 50% regulated transcripts in
common, or with greater than 70% regulated transcripts in common,
or with greater than 90% regulated transcripts in common) will have
highly similar functions. Fowler and Thomashow, 2002, have shown
that three paralogous AP2 family genes (CBF1, CBF2 and CBF3) are
induced upon cold treatment, and each of which can condition
improved freezing tolerance, and all have highly similar transcript
profiles. Once a polypeptide has been shown to provide a specific
function, its transcript profile becomes a diagnostic tool to
determine whether paralogs or orthologs have the same function.
[0092] Furthermore, methods using manual alignment of sequences
similar or homologous to one or more polynucleotide sequences or
one or more polypeptides encoded by the polynucleotide sequences
may be used to identify regions of similarity and conserved domains
characteristic of a particular transcription factor family. Such
manual methods are well-known of those of skill in the art and can
include, for example, comparisons of tertiary structure between a
polypeptide sequence encoded by a polynucleotide that comprises a
known function and a polypeptide sequence encoded by a
polynucleotide sequence that has a function not yet determined Such
examples of tertiary structure may comprise predicted alpha
helices, beta-sheets, amphipathic helices, leucine zipper motifs,
zinc finger motifs, proline-rich regions, cysteine repeat motifs,
and the like.
[0093] Orthologs and paralogs of presently disclosed polypeptides
may be cloned using compositions provided by the present invention
according to methods well known in the art. cDNAs can be cloned
using mRNA from a plant cell or tissue that expresses one of the
present sequences. Appropriate mRNA sources may be identified by
interrogating Northern blots with probes designed from the present
sequences, after which a library is prepared from the mRNA obtained
from a positive cell or tissue. Polypeptide-encoding cDNA is then
isolated using, for example, PCR, using primers designed from a
presently disclosed gene sequence, or by probing with a partial or
complete cDNA or with one or more sets of degenerate probes based
on the disclosed sequences. The cDNA library may be used to
transform plant cells. Expression of the cDNAs of interest is
detected using, for example, microarrays, Northern blots,
quantitative PCR, or any other technique for monitoring changes in
expression. Genomic clones may be isolated using similar techniques
to those.
[0094] Examples of orthologs of the Arabidopsis polypeptide
sequences and their functionally similar orthologs are listed in
Tables 4 and 5 and the Sequence Listing. In addition to the
sequences in Tables 4 and 5 and the Sequence Listing, the invention
encompasses isolated nucleotide sequences that are phylogenetically
and structurally similar to sequences listed in the Sequence
Listing and can function in a plant by increasing yield and/or and
abiotic stress tolerance when ectopically expressed in a plant.
[0095] Since a significant number of these sequences are
phylogenetically and sequentially related to each other and have
been shown to increase a plant's tolerance to one or more abiotic
stresses, one skilled in the art would predict that other similar,
phylogenetically related sequences falling within the present
clades of polypeptides would also perform similar functions when
ectopically expressed.
[0096] Identifying Polynucleotides or Nucleic Acids by
Hybridization. Polynucleotides homologous to the sequences
illustrated in the Sequence Listing and tables can be identified,
e.g., by hybridization to each other under stringent or under
highly stringent conditions. Single stranded polynucleotides
hybridize when they associate based on a variety of well
characterized physical-chemical forces, such as hydrogen bonding,
solvent exclusion, base stacking and the like. The stringency of a
hybridization reflects the degree of sequence identity of the
nucleic acids involved, such that the higher the stringency, the
more similar are the two polynucleotide strands. Stringency is
influenced by a variety of factors, including temperature, salt
concentration and composition, organic and non-organic additives,
solvents, etc. present in both the hybridization and wash solutions
and incubations (and number thereof), as described in more detail
in the references cited above. Encompassed by the invention are
polynucleotide sequences that are capable of hybridizing to the
claimed polynucleotide sequences, and, in particular, to those
shown in SEQ ID NOs: 26; 46; 176; 114; 142; 144; 82; 50; 72; 96;
18; 22; 24; and 240, and fragments thereof under various conditions
of stringency. (See, e.g., Wahl, G. M. and S. L. Berger (1987)
Methods Enzymol. 152:399-407; Kimmel, A. R. (1987) Methods Enzymol.
152:507-511.) Estimates of homology are provided by either DNA-DNA
or DNA-RNA hybridization under conditions of stringency as is well
understood by those skilled in the art (Hames and Higgins, Eds.
(1985) Nucleic Acid Hybridisation, IRL Press, Oxford, U.K.).
Stringency conditions can be adjusted to screen for moderately
similar fragments, such as homologous sequences from distantly
related organisms, to highly similar fragments, such as genes that
duplicate functional enzymes from closely related organisms.
Post-hybridization washes determine stringency conditions.
[0097] In addition to the nucleotide sequences listed in Tables 4
and 5, full length cDNA, orthologs, paralogs and homologs of the
present nucleotide sequences may be identified and isolated using
well known methods. The cDNA libraries orthologs, paralogs and
homologs of the present nucleotide sequences may be screened using
hybridization methods to determine their utility as hybridization
target or amplification probes.
[0098] An example of stringent hybridization conditions for
hybridization of complementary nucleic acids which have more than
100 complementary residues on a filter in a Southern or northern
blot is about 5.degree. C. to 20.degree. C. lower than the thermal
melting point (T.sub.m) for the specific sequence at a defined
ionic strength and pH. The T.sub.m is the temperature (under
defined ionic strength and pH) at which 50% of the target sequence
hybridizes to a perfectly matched probe. Nucleic acid molecules
that hybridize under stringent conditions will typically hybridize
to a probe based on either the entire cDNA or selected portions,
e.g., to a unique subsequence, of the cDNA under wash conditions of
0.2.times.SSC to 2.0.times.SSC, 0.1% SDS at 50-65.degree. C. For
example, high stringency is about 0.2.times.SSC, 0.1% SDS at
65.degree. C. Ultra-high stringency will be the same conditions
except the wash temperature is raised about 3 to about 5.degree.
C., and ultra-ultra-high stringency will be the same conditions
except the wash temperature is raised about 6 to about 9.degree. C.
For identification of less closely related homologues washes can be
performed at a lower temperature, e.g., 50.degree. C. In general,
stringency is increased by raising the wash temperature and/or
decreasing the concentration of SSC, as known in the art.
[0099] In another example, stringent salt concentration will
ordinarily be less than about 750 mM NaCl and 75 mM trisodium
citrate, preferably less than about 500 mM NaCl and 50 mM trisodium
citrate, and most preferably less than about 250 mM NaCl and 25 mM
trisodium citrate. Low stringency hybridization can be obtained in
the absence of organic solvent, e.g., formamide, while high
stringency hybridization can be obtained in the presence of at
least about 35% formamide, and most preferably at least about 50%
formamide. Stringent temperature conditions will ordinarily include
temperatures of at least about 30.degree. C., more preferably of at
least about 37.degree. C., and most preferably of at least about
42.degree. C. Varying additional parameters, such as hybridization
time, the concentration of detergent, e.g., sodium dodecyl sulfate
(SDS), and the inclusion or exclusion of carrier DNA, are well
known to those skilled in the art. Various levels of stringency are
accomplished by combining these various conditions as needed. In a
preferred embodiment, hybridization will occur at 30.degree. C. in
750 mM NaCl, 75 mM trisodium citrate, and 1% SDS. In a more
preferred embodiment, hybridization will occur at 37.degree. C. in
500 mM NaCl, 50 mM trisodium citrate, 1% SDS, 35% formamide, and
100 .mu.g/ml denatured salmon sperm DNA (ssDNA). In a most
preferred embodiment, hybridization will occur at 42.degree. C. in
250 mM NaCl, 25 mM trisodium citrate, 1% SDS, 50% formamide, and
200 .mu.g/ml ssDNA. Useful variations on these conditions will be
readily apparent to those skilled in the art.
[0100] The washing steps that follow hybridization can also vary in
stringency. Wash stringency conditions can be defined by salt
concentration and by temperature. As above, wash stringency can be
increased by decreasing salt concentration or by increasing
temperature. For example, stringent salt concentration for the wash
steps will preferably be less than about 30 mM NaCl and 3 mM
trisodium citrate, and most preferably less than about 15 mM NaCl
and 1.5 mM trisodium citrate. Stringent temperature conditions for
the wash steps will ordinarily include temperature of at least
about 25.degree. C., more preferably of at least about 42.degree.
C. Another preferred set of highly stringent conditions uses two
final washes in 0.1.times.SSC, 0.1% SDS at 65.degree. C. The most
preferred high stringency washes are of at least about 68.degree.
C. For example, in a preferred embodiment, wash steps will occur at
25.degree. C. in 30 mM NaCl, 3 mM trisodium citrate, and 0.1% SDS.
In a more preferred embodiment, wash steps will occur at 42.degree.
C. in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. In a most
preferred embodiment, the wash steps will occur at 68.degree. C. in
15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. Additional
variations on these conditions will be readily apparent to those
skilled in the art (see U.S. Patent Application No.
20010010913).
[0101] As another example, stringent conditions can be selected
such that an oligonucleotide that is perfectly complementary to the
coding oligonucleotide hybridizes to the coding oligonucleotide
with at least about a 5-10.times. higher signal to noise ratio than
the ratio for hybridization of the perfectly complementary
oligonucleotide to a nucleic acid encoding a transcription factor
known as of the filing date of the application. Conditions can be
selected such that a higher signal to noise ratio is observed in
the particular assay which is used, e.g., about 15.times.,
25.times., 35.times., 50.times. or more. Accordingly, the subject
nucleic acid hybridizes to the unique coding oligonucleotide with
at least a 2.times. higher signal to noise ratio as compared to
hybridization of the coding oligonucleotide to a nucleic acid
encoding known polypeptide. Again, higher signal to noise ratios
can be selected, e.g., about 5.times., 10.times., 25.times.,
35.times., 50.times. or more. The particular signal will depend on
the label used in the relevant assay, e.g., a fluorescent label, a
colorimetric label, a radioactive label, or the like.
[0102] Alternatively, transcription factor homolog polypeptides can
be obtained by screening an expression library using antibodies
specific for one or more transcription factors. With the provision
herein of the disclosed transcription factor, and transcription
factor homologue nucleic acid sequences, the encoded polypeptide(s)
can be expressed and purified in a heterologous expression system
(e.g., E. coli) and used to raise antibodies (monoclonal or
polyclonal) specific for the polypeptide(s) in question. Antibodies
can also be raised against synthetic peptides derived from
transcription factor, or transcription factor homologue, amino acid
sequences. Methods of raising antibodies are well known in the art
and are described in Harlow and Lane (1988) Antibodies: A
Laboratory Manual, Cold Spring Harbor Laboratory, New York. Such
antibodies can then be used to screen an expression library
produced from the plant from which it is desired to clone
additional transcription factor homologues, using the methods
described above. The selected cDNAs can be confirmed by sequencing
and enzymatic activity.
[0103] Sequence Variations. It will readily be appreciated by those
of skill in the art, that any of a variety of polynucleotide
sequences are capable of encoding the transcription factors and
transcription factor homologue polypeptides of the invention. Due
to the degeneracy of the genetic code, many different
polynucleotides can encode identical and/or substantially similar
polypeptides in addition to those sequences illustrated in the
Sequence Listing. Nucleic acids having a sequence that differs from
the sequences shown in the Sequence Listing, or complementary
sequences, that encode functionally equivalent peptides (i.e.,
peptides having some degree of equivalent or similar biological
activity) but differ in sequence from the sequence shown in the
sequence listing due to degeneracy in the genetic code, are also
within the scope of the invention.
[0104] Altered polynucleotide sequences encoding polypeptides
include those sequences with deletions, insertions, or
substitutions of different nucleotides, resulting in a
polynucleotide encoding a polypeptide with at least one functional
characteristic of the instant polypeptides. Included within this
definition are polymorphisms which may or may not be readily
detectable using a particular oligonucleotide probe of the
polynucleotide encoding the instant polypeptides, and improper or
unexpected hybridization to allelic variants, with a locus other
than the normal chromosomal locus for the polynucleotide sequence
encoding the instant polypeptides.
[0105] Allelic variant refers to any of two or more alternative
forms of a gene occupying the same chromosomal locus. Allelic
variation arises naturally through mutation, and may result in
phenotypic polymorphism within populations. Gene mutations can be
silent (i.e., no change in the encoded polypeptide) or may encode
polypeptides having altered amino acid sequence. The term allelic
variant is also used herein to denote a protein encoded by an
allelic variant of a gene. Splice variant refers to alternative
forms of RNA transcribed from a gene. Splice variation arises
naturally through use of alternative splicing sites within a
transcribed RNA molecule, or less commonly between separately
transcribed RNA molecules, and may result in several mRNAs
transcribed from the same gene. Splice variants may encode
polypeptides having altered amino acid sequence. The term splice
variant is also used herein to denote a protein encoded by a splice
variant of an mRNA transcribed from a gene.
[0106] Those skilled in the art would recognize that G481, SEQ ID
NO: 114, represents a single transcription factor; allelic
variation and alternative splicing may be expected to occur.
Allelic variants of SEQ ID NO: 113 can be cloned by probing cDNA or
genomic libraries from different individual organisms according to
standard procedures. Allelic variants of the DNA sequence shown in
SEQ ID NO:113, including those containing silent mutations and
those in which mutations result in amino acid sequence changes, are
within the scope of the present invention, as are proteins which
are allelic variants of SEQ ID NO: 114. cDNAs generated from
alternatively spliced mRNAs, which retain the properties of the
transcription factor are included within the scope of the present
invention, as are polypeptides encoded by such cDNAs and mRNAs.
Allelic variants and splice variants of these sequences can be
cloned by probing cDNA or genomic libraries from different
individual organisms or tissues according to standard procedures
known in the art (see U.S. Pat. No. 6,388,064).
[0107] For example, Table 1 illustrates, e.g., that the codons AGC,
AGT, TCA, TCC, TCG, and TCT all encode the same amino acid: serine.
Accordingly, at each position in the sequence where there is a
codon encoding serine, any of the above trinucleotide sequences can
be used without altering the encoded polypeptide.
TABLE-US-00001 TABLE 1 Amino acid Possible Codons Alanine Ala A GCA
GCC GCG GCU Cysteine Cys C TGC TGT Aspartic acid Asp D GAC GAT
Glutamic acid Glu E GAA GAG Phenylalanine Phe F TTC TTT Glycine Gly
G GGA GGC GGG GGT Histidine His H CAC CAT Isoleucine Ile I ATA ATC
ATT Lysine Lys K AAA AAG Leucine Leu L TTA TTG CTA CTC CTG CTT
Methionine Met M ATG Asparagine Asn N AAC AAT Proline Pro P CCA CCC
CCG CCT Glutamine Gln Q CAA CAG Arginine Arg R AGA AGG CGA CGC CGG
CGT Serine Ser S AGC AGT TCA TCC TCG TCT Threonine Thr T ACA ACC
ACG ACT Valine Val V GTA GTC GTG GTT Tryptophan Trp W TGG Tyrosine
Tyr Y TAC TAT
[0108] Sequence alterations that do not change the amino acid
sequence encoded by the polynucleotide are termed "silent"
variations. With the exception of the codons ATG and TGG, encoding
methionine and tryptophan, respectively, any of the possible codons
for the same amino acid can be substituted by a variety of
techniques, e.g., site-directed mutagenesis, available in the art.
Accordingly, any and all such variations of a sequence selected
from the above table are a feature of the invention.
[0109] In addition to silent variations, other conservative
variations that alter one, or a few amino acids in the encoded
polypeptide, can be made without altering the function of the
polypeptide, these conservative variants are, likewise, a feature
of the invention.
[0110] For example, substitutions, deletions and insertions
introduced into the sequences provided in the Sequence Listing are
also envisioned by the invention. Such sequence modifications can
be engineered into a sequence by site-directed mutagenesis (Wu
(ed.) Meth. Enzymol. (1993) vol. 217, Academic Press) or the other
methods noted below. Amino acid substitutions are typically of
single residues; insertions usually will be on the order of about
from 1 to 10 amino acid residues; and deletions will range about
from 1 to 30 residues. In preferred embodiments, deletions or
insertions are made in adjacent pairs, e.g., a deletion of two
residues or insertion of two residues. Substitutions, deletions,
insertions or any combination thereof can be combined to arrive at
a sequence. The mutations that are made in the polynucleotide
encoding the transcription factor should not place the sequence out
of reading frame and should not create complementary regions that
could produce secondary mRNA structure. Preferably, the polypeptide
encoded by the DNA performs the desired function.
[0111] Conservative substitutions are those in which at least one
residue in the amino acid sequence has been removed and a different
residue inserted in its place. Such substitutions generally are
made in accordance with the Table 2 when it is desired to maintain
the activity of the protein. Table 2 shows amino acids which can be
substituted for an amino acid in a protein and which are typically
regarded as conservative substitutions.
TABLE-US-00002 TABLE 2 Conservative Residue Substitutions Ala Ser
Arg Lys Asn Gln; His Asp Glu Gln Asn Cys Ser Glu Asp Gly Pro His
Asn; Gln Ile Leu, Val Leu Ile; Val Lys Arg; Gln Met Leu; Ile Phe
Met; Leu; Tyr Ser Thr; Gly Thr Ser; Val Trp Tyr Tyr Trp; Phe Val
Ile; Leu
[0112] The polypeptides provided in the Sequence Listing have a
novel activity, such as, for example, regulatory activity. Although
all conservative amino acid substitutions (for example, one basic
amino acid substituted for another basic amino acid) in a
polypeptide will not necessarily result in the polypeptide
retaining its activity, it is expected that many of these
conservative mutations would result in the polypeptide retaining
its activity. Most mutations, conservative or non-conservative,
made to a protein but outside of a conserved domain required for
function and protein activity will not affect the activity of the
protein to any great extent.
[0113] Similar substitutions are those in which at least one
residue in the amino acid sequence has been removed and a different
residue inserted in its place. Such substitutions generally are
made in accordance with the Table 3 when it is desired to maintain
the activity of the protein. Table 3 shows amino acids which can be
substituted for an amino acid in a protein and which are typically
regarded as structural and functional substitutions. For example, a
residue in column 1 of Table 3 may be substituted with residue in
column 2; in addition, a residue in column 2 of Table 3 may be
substituted with the residue of column 1.
TABLE-US-00003 TABLE 3 Residue Similar Substitutions Ala Ser; Thr;
Gly; Val; Leu; Ile Arg Lys; His; Gly Asn Gln; His; Gly; Ser; Thr
Asp Glu, Ser; Thr Gln Asn; Ala Cys Ser; Gly Glu Asp Gly Pro; Arg
His Asn; Gln; Tyr; Phe; Lys; Arg Ile Ala; Leu; Val; Gly; Met Leu
Ala; Ile; Val; Gly; Met Lys Arg; His; Gln; Gly; Pro Met Leu; Ile;
Phe Phe Met; Leu; Tyr; Trp; His; Val; Ala Ser Thr; Gly; Asp; Ala;
Val; Ile; His Thr Ser; Val; Ala; Gly Trp Tyr; Phe; His Tyr Trp;
Phe; His Val Ala; Ile; Leu; Gly; Thr; Ser; Glu
[0114] Substitutions that are less conservative than those in Table
2 can be selected by picking residues that differ more
significantly in their effect on maintaining (a) the structure of
the polypeptide backbone in the area of the substitution, for
example, as a sheet or helical conformation, (b) the charge or
hydrophobicity of the molecule at the target site, or (c) the bulk
of the side chain. The substitutions which in general are expected
to produce the greatest changes in protein properties will be those
in which (a) a hydrophilic residue, e.g., seryl or threonyl, is
substituted for (or by) a hydrophobic residue, e.g., leucyl,
isoleucyl, phenylalanyl, valyl or alanyl; (b) a cysteine or proline
is substituted for (or by) any other residue; (c) a residue having
an electropositive side chain, e.g., lysyl, arginyl, or histidyl,
is substituted for (or by) an electronegative residue, e.g.,
glutamyl or aspartyl; or (d) a residue having a bulky side chain,
e.g., phenylalanine, is substituted for (or by) one not having a
side chain, e.g., glycine.
[0115] Further Modifying Sequences of the
Invention--Mutation/Forced Evolution. In addition to generating
silent or conservative substitutions as noted, above, the present
invention optionally includes methods of modifying the sequences of
the Sequence Listing. In the methods, nucleic acid or protein
modification methods are used to alter the given sequences to
produce new sequences and/or to chemically or enzymatically modify
given sequences to change the properties of the nucleic acids or
proteins.
[0116] Thus, in one embodiment, given nucleic acid sequences are
modified, e.g., according to standard mutagenesis or artificial
evolution methods to produce modified sequences. The modified
sequences may be created using purified natural polynucleotides
isolated from any organism or may be synthesized from purified
compositions and chemicals using chemical means well know to those
of skill in the art. For example, Ausubel, supra, provides
additional details on mutagenesis methods. Artificial forced
evolution methods are described, for example, by Stemmer (1994)
Nature 370:389-391, Stemmer (1994) Proc. Natl. Acad. Sci. USA
91:10747-10751, and U.S. Pat. Nos. 5,811,238, 5,837,500, and
6,242,568. Methods for engineering synthetic transcription factors
and other polypeptides are described, for example, by Zhang et al.
(2000) J. Biol. Chem. 275:33850-33860, Liu et al. (2001) J. Biol.
Chem. 276:11323-11334, and Isalan et al. (2001) Nature Biotechnol.
19:656-660. Many other mutation and evolution methods are also
available and expected to be within the skill of the
practitioner.
[0117] Similarly, chemical or enzymatic alteration of expressed
nucleic acids and polypeptides can be performed by standard
methods. For example, sequence can be modified by addition of
lipids, sugars, peptides, organic or inorganic compounds, by the
inclusion of modified nucleotides or amino acids, or the like. For
example, protein modification techniques are illustrated in
Ausubel, supra. Further details on chemical and enzymatic
modifications can be found herein. These modification methods can
be used to modify any given sequence, or to modify any sequence
produced by the various mutation and artificial evolution
modification methods noted herein.
[0118] Accordingly, the invention provides for modification of any
given nucleic acid by mutation, evolution, chemical or enzymatic
modification, or other available methods, as well as for the
products produced by practicing such methods, e.g., using the
sequences herein as a starting substrate for the various
modification approaches.
[0119] For example, optimized coding sequence containing codons
preferred by a particular prokaryotic or eukaryotic host can be
used e.g., to increase the rate of translation or to produce
recombinant RNA transcripts having desirable properties, such as a
longer half-life, as compared with transcripts produced using a
non-optimized sequence. Translation stop codons can also be
modified to reflect host preference. For example, preferred stop
codons for Saccharomyces cerevisiae and mammals are TAA and TGA,
respectively. The preferred stop codon for monocotyledonous plants
is TGA, whereas insects and E. coli prefer to use TAA as the stop
codon.
[0120] The polynucleotide sequences of the present invention can
also be engineered in order to alter a coding sequence for a
variety of reasons, including but not limited to, alterations which
modify the sequence to facilitate cloning, processing and/or
expression of the gene product. For example, alterations are
optionally introduced using techniques which are well known in the
art, e.g., site-directed mutagenesis, to insert new restriction
sites, to alter glycosylation patterns, to change codon preference,
to introduce splice sites, etc.
[0121] Furthermore, a fragment or domain derived from any of the
polypeptides of the invention can be combined with domains derived
from other transcription factors or synthetic domains to modify the
biological activity of a transcription factor. For instance, a
DNA-binding domain derived from a transcription factor of the
invention can be combined with the activation domain of another
transcription factor or with a synthetic activation domain. A
transcription activation domain assists in initiating transcription
from a DNA-binding site. Examples include the transcription
activation region of VP16 or GAL4 (Moore et al. (1998) Proc. Natl.
Acad. Sci. USA 95: 376-381; and Aoyama et al. (1995) Plant Cell
7:1773-1785), peptides derived from bacterial sequences (Ma and
Ptashne (1987) Cell 51; 113-119) and synthetic peptides (Giniger
and Ptashne, (1987) Nature 330:670-672).
[0122] Expression and Modification of Polypeptides. Typically,
polynucleotide sequences of the invention are incorporated into
recombinant DNA (or RNA) molecules that direct expression of
polypeptides of the invention in appropriate host cells, transgenic
plants, in vitro translation systems, or the like. Due to the
inherent degeneracy of the genetic code, nucleic acid sequences
which encode substantially the same or a functionally equivalent
amino acid sequence can be substituted for any listed sequence to
provide for cloning and expressing the relevant homologue.
[0123] Vectors, Promoters, and Expression Systems. The present
invention includes recombinant constructs comprising one or more of
the nucleic acid sequences herein. The constructs typically
comprise a vector, such as a plasmid, a cosmid, a phage, a virus
(e.g., a plant virus), a bacterial artificial chromosome (BAC), a
yeast artificial chromosome (YAC), or the like, into which a
nucleic acid sequence of the invention has been inserted, in a
forward or reverse orientation. In a preferred aspect of this
embodiment, the construct further comprises regulatory sequences,
including, for example, a promoter, operably linked to the
sequence. Large numbers of suitable vectors and promoters are known
to those of skill in the art, and are commercially available.
[0124] General texts that describe molecular biological techniques
useful herein, including the use and production of vectors,
promoters and many other relevant topics, include Berger, Sambrook
and Ausubel, supra. Any of the identified sequences can be
incorporated into a cassette or vector, e.g., for expression in
plants. A number of expression vectors suitable for stable
transformation of plant cells or for the establishment of
transgenic plants have been described including those described in
Weissbach and Weissbach, (1989) Methods for Plant Molecular
Biology, Academic Press, and Gelvin et al., (1990) Plant Molecular
Biology Manual, Kluwer Academic Publishers. Specific examples
include those derived from a Ti plasmid of Agrobacterium
tumefaciens, as well as those disclosed by Herrera-Estrella et al.
(1983) Nature 303: 209, Bevan (1984) Nucl Acid Res. 12: 8711-8721,
Klee (1985) Bio/Technology 3: 637-642, for dicotyledonous
plants.
[0125] Alternatively, non-Ti vectors can be used to transfer the
DNA into monocotyledonous plants and cells by using free DNA
delivery techniques. Such methods can involve, for example, the use
of liposomes, electroporation, microprojectile bombardment, silicon
carbide whiskers, and viruses. By using these methods transgenic
plants such as wheat, rice (Christou (1991) Bio/Technology 9:
957-962) and corn (Gordon-Kamm (1990) Plant Cell 2: 603-618) can be
produced. An immature embryo can also be a good target tissue for
monocots for direct DNA delivery techniques by using the particle
gun (Weeks et al. (1993) Plant Physiol 102: 1077-1084; Vasil (1993)
Bio/Technology 10: 667-674; Wan and Lemeaux (1994) Plant Physiol
104: 37-48, and for Agrobacterium-mediated DNA transfer (Ishida et
al. (1996) Nature Biotech 14: 745-750).
[0126] Typically, plant transformation vectors include one or more
cloned plant coding sequence (genomic or cDNA) under the
transcriptional control of 5' and 3' regulatory sequences and a
dominant selectable marker. Such plant transformation vectors
typically also contain a promoter (e.g., a regulatory region
controlling inducible or constitutive, environmentally- or
developmentally-regulated, or cell- or tissue-specific expression),
a transcription initiation start site, an RNA processing signal
(such as intron splice sites), a transcription termination site,
and/or a polyadenylation signal.
[0127] Examples of constitutive plant promoters which can be useful
for expressing the TF sequence include: the cauliflower mosaic
virus (CaMV) 35S promoter, which confers constitutive, high-level
expression in most plant tissues (see, e.g., Odell et al. (1985)
Nature 313:810-812); the nopaline synthase promoter (An et al.
(1988) Plant Physiol 88:547-552); and the octopine synthase
promoter (Fromm et al. (1989) Plant Cell 1: 977-984).
[0128] A variety of plant gene promoters that regulate gene
expression in response to environmental, hormonal, chemical,
developmental signals, and in a tissue-active manner can be used
for expression of a TF sequence in plants. Choice of a promoter is
based largely on the phenotype of interest and is determined by
such factors as tissue (e.g., seed, fruit, root, pollen, vascular
tissue, flower, carpel, etc.), inducibility (e.g., in response to
wounding, heat, cold, drought, light, pathogens, etc.), timing,
developmental stage, and the like. Numerous known promoters have
been characterized and can favorably be employed to promote
expression of a polynucleotide of the invention in a transgenic
plant or cell of interest. For example, tissue specific promoters
include: seed-specific promoters (such as the napin, phaseolin or
DC3 promoter described in U.S. Pat. No. 5,773,697), fruit-specific
promoters that are active during fruit ripening (such as the dru 1
promoter (U.S. Pat. No. 5,783,393), or the 2A11 promoter (U.S. Pat.
No. 4,943,674) and the tomato polygalacturonase promoter (Bird et
al. (1988) Plant Mol Biol 11:651), root-specific promoters, such as
those disclosed in U.S. Pat. Nos. 5,618,988, 5,837,848 and
5,905,186, pollen-active promoters such as PTA29, PTA26 and PTA13
(U.S. Pat. No. 5,792,929), promoters active in vascular tissue
(Ringli and Keller (1998) Plant Mol Biol 37:977-988),
flower-specific (Kaiser et al, (1995) Plant Mol Biol 28:231-243),
pollen (Baerson et al. (1994) Plant Mol Biol 26:1947-1959), carpels
(Ohl et al. (1990) Plant Cell 2:837-848), pollen and ovules
(Baerson et al. (1993) Plant Mol Biol 22:255-267), auxin-inducible
promoters (such as that described in van der Kop et al. (1999)
Plant Mol Biol 39:979-990 or Baumann et al. (1999) Plant Cell
11:323-334), cytokinin-inducible promoter (Guevara-Garcia (1998)
Plant Mol Biol 38:743-753), promoters responsive to gibberellin
(Shi et al. (1998) Plant Mol Biol 38:1053-1060, Willmott et al.
(1998) 38:817-825) and the like. Additional promoters are those
that elicit expression in response to heat (Ainley et al. (1993)
Plant Mol Biol 22: 13-23), light (e.g., the pea rbcS-3A promoter,
Kuhlemeier et al. (1989) Plant Cell 1:471, and the maize rbcS
promoter, Schaffner and Sheen (1991) Plant Cell 3: 997); wounding
(e.g., wunl, Siebertz et al. (1989) Plant Cell 1: 961); pathogens
(such as the PR-1 promoter described in Buchel et al. (1999) Plant
Mol. Biol. 40:387-396, and the PDF1.2 promoter described in Manners
et al. (1998) Plant Mol. Biol. 38:1071-80), and chemicals such as
methyl jasmonate or salicylic acid (Gatz et al. (1997) Plant Mol
Biol 48: 89-108). In addition, the timing of the expression can be
controlled by using promoters such as those acting at senescence
(An and Amazon (1995) Science 270: 1986-1988); or late seed
development (Odell et al. (1994) Plant Physiol 106:447-458).
[0129] Plant expression vectors can also include RNA processing
signals that can be positioned within, upstream or downstream of
the coding sequence. In addition, the expression vectors can
include additional regulatory sequences from the 3'-untranslated
region of plant genes, e.g., a 3' terminator region to increase
mRNA stability of the mRNA, such as the PI-II terminator region of
potato or the octopine or nopaline synthase 3' terminator
regions.
[0130] Additional Expression Elements. Specific initiation signals
can aid in efficient translation of coding sequences. These signals
can include, e.g., the ATG initiation codon and adjacent sequences.
In cases where a coding sequence, its initiation codon and upstream
sequences are inserted into the appropriate expression vector, no
additional translational control signals may be needed. However, in
cases where only coding sequence (e.g., a mature protein coding
sequence), or a portion thereof, is inserted, exogenous
transcriptional control signals including the ATG initiation codon
can be separately provided. The initiation codon is provided in the
correct reading frame to facilitate transcription. Exogenous
transcriptional elements and initiation codons can be of various
origins, both natural and synthetic. The efficiency of expression
can be enhanced by the inclusion of enhancers appropriate to the
cell system in use.
[0131] Expression Hosts. The present invention also relates to host
cells which are transduced with vectors of the invention, and the
production of polypeptides of the invention (including fragments
thereof) by recombinant techniques. Host cells are genetically
engineered (i.e., nucleic acids are introduced, e.g., transduced,
transformed or transfected) with the vectors of this invention,
which may be, for example, a cloning vector or an expression vector
comprising the relevant nucleic acids herein. The vector is
optionally a plasmid, a viral particle, a phage, a naked nucleic
acid, etc. The engineered host cells can be cultured in
conventional nutrient media modified as appropriate for activating
promoters, selecting transformants, or amplifying the relevant
gene. The culture conditions, such as temperature, pH and the like,
are those previously used with the host cell selected for
expression, and will be apparent to those skilled in the art and in
the references cited herein, including, Sambrook and Ausubel.
[0132] The host cell can be a eukaryotic cell, such as a yeast
cell, or a plant cell, or the host cell can be a prokaryotic cell,
such as a bacterial cell. Plant protoplasts are also suitable for
some applications. For example, the DNA fragments are introduced
into plant tissues, cultured plant cells or plant protoplasts by
standard methods including electroporation (Fromm et al., (1985)
Proc. Natl. Acad. Sci. USA 82, 5824, infection by viral vectors
such as cauliflower mosaic virus (CaMV) (Hohn et al., (1982)
Molecular Biology of Plant Tumors, (Academic Press, New York) pp.
549-560; U.S. Pat. No. 4,407,956), high velocity ballistic
penetration by small particles with the nucleic acid either within
the matrix of small beads or particles, or on the surface (Klein et
al., (1987) Nature 327, 70-73), use of pollen as vector (WO
85/01856), or use of Agrobacterium tumefaciens or A. rhizogenes
carrying a T-DNA plasmid in which DNA fragments are cloned. The
T-DNA plasmid is transmitted to plant cells upon infection by
Agrobacterium tumefaciens, and a portion is stably integrated into
the plant genome (Horsch et al. (1984) Science 233:496-498; Fraley
et al. (1983) Proc. Natl. Acad. Sci. USA 80, 4803).
[0133] The cell can include a nucleic acid of the invention which
encodes a polypeptide,
[0134] wherein the cell expresses a polypeptide of the invention.
The cell can also include vector sequences, or the like.
Furthermore, cells and transgenic plants that include any
polypeptide or nucleic acid above or throughout this specification,
e.g., produced by transduction of a vector of the invention, are an
additional feature of the invention.
[0135] For long-term, high-yield production of recombinant
proteins, stable expression can be used. Host cells transformed
with a nucleotide sequence encoding a polypeptide of the invention
are optionally cultured under conditions suitable for the
expression and recovery of the encoded protein from cell culture.
The protein or fragment thereof produced by a recombinant cell may
be secreted, membrane-bound, or contained intracellularly,
depending on the sequence and/or the vector used. As will be
understood by those of skill in the art, expression vectors
containing polynucleotides encoding mature proteins of the
invention can be designed with signal sequences which direct
secretion of the mature polypeptides through a prokaryotic or
eukaryotic cell membrane.
[0136] Modified Amino Acid Residues. Polypeptides of the invention
may contain one or more modified amino acid residues. The presence
of modified amino acids may be advantageous in, for example,
increasing polypeptide half-life, reducing polypeptide antigenicity
or toxicity, increasing polypeptide storage stability, or the like.
Amino acid residue(s) are modified, for example, co-translationally
or post-translationally during recombinant production or modified
by synthetic or chemical means.
[0137] Non-limiting examples of a modified amino acid residue
include incorporation or other use of acetylated amino acids,
glycosylated amino acids, sulfated amino acids, prenylated (e.g.,
farnesylated, geranylgeranylated) amino acids, PEG modified (e.g.,
"PEGylated") amino acids, biotinylated amino acids, carboxylated
amino acids, phosphorylated amino acids, etc. References adequate
to guide one of skill in the modification of amino acid residues
are replete throughout the literature.
[0138] The modified amino acid residues may prevent or increase
affinity of the polypeptide for another molecule, including, but
not limited to, polynucleotide, proteins, carbohydrates, lipids and
lipid derivatives, and other organic or synthetic compounds.
[0139] Identification of Additional Factors. A transcription factor
provided by the present invention can also be used to identify
additional endogenous or exogenous molecules that can affect a
phentoype or trait of interest. On the one hand, such molecules
include organic (small or large molecules) and/or inorganic
compounds that affect expression of (i.e., regulate) a particular
transcription factor. Alternatively, such molecules include
endogenous molecules that are acted upon either at a
transcriptional level by a transcription factor of the invention to
modify a phenotype as desired. For example, the transcription
factors can be employed to identify one or more downstream gene
with which is subject to a regulatory effect of the transcription
factor. In one approach, a transcription factor or transcription
factor homologue of the invention is expressed in a host cell,
e.g., a transgenic plant cell, tissue or explant, and expression
products, either RNA or protein, of likely or random targets are
monitored, e.g., by hybridization to a microarray of nucleic acid
probes corresponding to genes expressed in a tissue or cell type of
interest, by two-dimensional gel electrophoresis of protein
products, or by any other method known in the art for assessing
expression of gene products at the level of RNA or protein.
Alternatively, a transcription factor of the invention can be used
to identify promoter sequences (i.e., binding sites) involved in
the regulation of a downstream target. After identifying a promoter
sequence, interactions between the transcription factor and the
promoter sequence can be modified by changing specific nucleotides
in the promoter sequence or specific amino acids in the
transcription factor that interact with the promoter sequence to
alter a plant trait. Typically, transcription factor DNA-binding
sites are identified by gel shift assays. After identifying the
promoter regions, the promoter region sequences can be employed in
double-stranded DNA arrays to identify molecules that affect the
interactions of the transcription factors with their promoters
(Bulyk et al. (1999) Nature Biotechnology 17:573-577).
[0140] The identified transcription factors are also useful to
identify proteins that modify the activity of the transcription
factor. Such modification can occur by covalent modification, such
as by phosphorylation, or by protein-protein (homo or
-heteropolymer) interactions. Any method suitable for detecting
protein-protein interactions can be employed. Among the methods
that can be employed are co-immunoprecipitation, cross-linking and
co-purification through gradients or chromatographic columns, and
the two-hybrid yeast system.
[0141] The two-hybrid system detects protein interactions in vivo
and is described in Chien et al. ((1991), Proc. Natl. Acad. Sci.
USA 88:9578-9582) and is commercially available from Clontech (Palo
Alto, Calif.). In such a system, plasmids are constructed that
encode two hybrid proteins: one consists of the DNA-binding domain
of a transcription activator protein fused to the TF polypeptide
and the other consists of the transcription activator protein's
activation domain fused to an unknown protein that is encoded by a
cDNA that has been recombined into the plasmid as part of a cDNA
library. The DNA-binding domain fusion plasmid and the cDNA library
are transformed into a strain of the yeast Saccharomyces cerevisiae
that contains a reporter gene (e.g., lacZ) whose regulatory region
contains the transcription activator's binding site. Either hybrid
protein alone cannot activate transcription of the reporter gene.
Interaction of the two hybrid proteins reconstitutes the functional
activator protein and results in expression of the reporter gene,
which is detected by an assay for the reporter gene product. Then,
the library plasmids responsible for reporter gene expression are
isolated and sequenced to identify the proteins encoded by the
library plasmids. After identifying proteins that interact with the
transcription factors, assays for compounds that interfere with the
TF protein-protein interactions can be preformed.
[0142] Identification of Modulators. In addition to the
intracellular molecules described above, extracellular molecules
that alter activity or expression of a transcription factor, either
directly or indirectly, can be identified. For example, the methods
can entail first placing a candidate molecule in contact with a
plant or plant cell. The molecule can be introduced by topical
administration, such as spraying or soaking of a plant, and then
the molecule's effect on the expression or activity of the TF
polypeptide or the expression of the polynucleotide monitored.
Changes in the expression of the TF polypeptide can be monitored by
use of polyclonal or monoclonal antibodies, gel electrophoresis or
the like. Changes in the expression of the corresponding
polynucleotide sequence can be detected by use of microarrays,
Northerns, quantitative PCR, or any other technique for monitoring
changes in mRNA expression. These techniques are exemplified in
Ausubel et al. (eds) Current Protocols in Molecular Biology, John
Wiley & Sons (1998, and supplements through 2001). Such changes
in the expression levels can be correlated with modified plant
traits and thus identified molecules can be useful for soaking or
spraying on fruit, vegetable and grain crops to modify traits in
plants.
[0143] Essentially any available composition can be tested for
modulatory activity of expression or activity of any nucleic acid
or polypeptide herein. Thus, available libraries of compounds such
as chemicals, polypeptides, nucleic acids and the like can be
tested for modulatory activity. Often, potential modulator
compounds can be dissolved in aqueous or organic (e.g., DMSO-based)
solutions for easy delivery to the cell or plant of interest in
which the activity of the modulator is to be tested. Optionally,
the assays are designed to screen large modulator composition
libraries by automating the assay steps and providing compounds
from any convenient source to assays, which are typically run in
parallel (e.g., in microtiter formats on microtiter plates in
robotic assays).
[0144] In one embodiment, high throughput screening methods involve
providing a combinatorial library containing a large number of
potential compounds (potential modulator compounds). Such
"combinatorial chemical libraries" are then screened in one or more
assays, as described herein, to identify those library members
(particular chemical species or subclasses) that display a desired
characteristic activity. The compounds thus identified can serve as
target compounds.
[0145] A combinatorial chemical library can be, e.g., a collection
of diverse chemical compounds generated by chemical synthesis or
biological synthesis. For example, a combinatorial chemical library
such as a polypeptide library is formed by combining a set of
chemical building blocks (e.g., in one example, amino acids) in
every possible way for a given compound length (i.e., the number of
amino acids in a polypeptide compound of a set length). Exemplary
libraries include peptide libraries, nucleic acid libraries,
antibody libraries (see, e.g., Vaughn et al. (1996) Nature
Biotechnology, 14(3):309-314 and PCT/US96/10287), carbohydrate
libraries (see, e.g., Liang et al. Science (1996) 274:1520-1522 and
U.S. Pat. No. 5,593,853), peptide nucleic acid libraries (see,
e.g., U.S. Pat. No. 5,539,083), and small organic molecule
libraries (see, e.g., benzodiazepines, Baum C&EN January 18,
page 33 (1993); isoprenoids, U.S. Pat. No. 5,569,588;
thiazolidinones and metathiazanones, U.S. Pat. No. 5,549,974;
pyrrolidines, U.S. Pat. Nos. 5,525,735 and 5,519,134; morpholino
compounds, U.S. Pat. No. 5,506,337) and the like.
[0146] Preparation and screening of combinatorial or other
libraries is well known to those of skill in the art. Such
combinatorial chemical libraries include, but are not limited to,
peptide libraries (see, e.g., U.S. Pat. No. 5,010,175; Furka,
(1991) Int. J. Pept. Prot. Res. 37:487-493; and Houghton et al.
(1991) Nature 354:84-88). Other chemistries for generating chemical
diversity libraries can also be used.
[0147] In addition, as noted, compound screening equipment for
high-throughput screening is generally available, e.g., using any
of a number of well known robotic systems that have also been
developed for solution phase chemistries useful in assay systems.
These systems include automated workstations including an automated
synthesis apparatus and robotic systems utilizing robotic arms. Any
of the above devices are suitable for use with the present
invention, e.g., for high-throughput screening of potential
modulators. The nature and implementation of modifications to these
devices (if any) so that they can operate as discussed herein will
be apparent to persons skilled in the relevant art.
[0148] Indeed, entire high throughput screening systems are
commercially available. These systems typically automate entire
procedures including all sample and reagent pipetting, liquid
dispensing, timed incubations, and final readings of the microplate
in detector(s) appropriate for the assay. These configurable
systems provide high throughput and rapid start up as well as a
high degree of flexibility and customization. Similarly,
microfluidic implementations of screening are also commercially
available.
[0149] The manufacturers of such systems provide detailed protocols
the various high throughput. Thus, for example, Zymark Corp.
provides technical bulletins describing screening systems for
detecting the modulation of gene transcription, ligand binding, and
the like. The integrated systems herein, in addition to providing
for sequence alignment and, optionally, synthesis of relevant
nucleic acids, can include such screening apparatus to identify
modulators that have an effect on one or more polynucleotides or
polypeptides according to the present invention.
[0150] In some assays it is desirable to have positive controls to
ensure that the components of the assays are working properly. At
least two types of positive controls are appropriate. That is,
known transcriptional activators or inhibitors can be incubated
with cells/plants/etc. in one sample of the assay, and the
resulting increase/decrease in transcription can be detected by
measuring the resulting increase in RNA/protein expression, etc.,
according to the methods herein. It will be appreciated that
modulators can also be combined with transcriptional activators or
inhibitors to find modulators that inhibit transcriptional
activation or transcriptional repression. Either expression of the
nucleic acids and proteins herein or any additional nucleic acids
or proteins activated by the nucleic acids or proteins herein, or
both, can be monitored.
[0151] In an embodiment, the invention provides a method for
identifying compositions that modulate the activity or expression
of a polynucleotide or polypeptide of the invention. For example, a
test compound, whether a small or large molecule, is placed in
contact with a cell, plant (or plant tissue or explant), or
composition comprising the polynucleotide or polypeptide of
interest and a resulting effect on the cell, plant, (or tissue or
explant) or composition is evaluated by monitoring, either directly
or indirectly, one or more of: expression level of the
polynucleotide or polypeptide, activity (or modulation of the
activity) of the polynucleotide or polypeptide. In some cases, an
alteration in a plant phenotype can be detected following contact
of a plant (or plant cell, or tissue or explant) with the putative
modulator, e.g., by modulation of expression or activity of a
polynucleotide or polypeptide of the invention. Modulation of
expression or activity of a polynucleotide or polypeptide of the
invention may also be caused by molecular elements in a signal
transduction second messenger pathway and such modulation can
affect similar elements in the same or another signal transduction
second messenger pathway.
[0152] Subsequences. Also contemplated are uses of polynucleotides,
also referred to herein as oligonucleotides, typically having at
least 12 bases, preferably at least 15, more preferably at least
20, 30, or 50 bases, which hybridize under at least highly
stringent (or ultra-high stringent or ultra-ultra-high stringent
conditions) conditions to a polynucleotide sequence described
above. The polynucleotides may be used as probes, primers, sense
and antisense agents, and the like, according to methods as noted
supra.
[0153] Subsequences of the polynucleotides of the invention,
including polynucleotide fragments and oligonucleotides are useful
as nucleic acid probes and primers. An oligonucleotide suitable for
use as a probe or primer is at least about 15 nucleotides in
length, more often at least about 18 nucleotides, often at least
about 21 nucleotides, frequently at least about 30 nucleotides, or
about 40 nucleotides, or more in length. A nucleic acid probe is
useful in hybridization protocols, e.g., to identify additional
polypeptide homologues of the invention, including protocols for
microarray experiments. Primers can be annealed to a complementary
target DNA strand by nucleic acid hybridization to form a hybrid
between the primer and the target DNA strand, and then extended
along the target DNA strand by a DNA polymerase enzyme. Primer
pairs can be used for amplification of a nucleic acid sequence,
e.g., by the polymerase chain reaction (PCR) or other nucleic-acid
amplification methods. See Sambrook and Ausubel, supra.
[0154] In addition, the invention includes an isolated or
recombinant polypeptide including a subsequence of at least about
15 contiguous amino acids encoded by the recombinant or isolated
polynucleotides of the invention. For example, such polypeptides,
or domains or fragments thereof, can be used as immunogens, e.g.,
to produce antibodies specific for the polypeptide sequence, or as
probes for detecting a sequence of interest. A subsequence can
range in size from about 15 amino acids in length up to and
including the full length of the polypeptide.
[0155] To be encompassed by the present invention, an expressed
polypeptide which comprises such a polypeptide subsequence performs
at least one biological function of the intact polypeptide in
substantially the same manner, or to a similar extent, as does the
intact polypeptide. For example, a polypeptide fragment can
comprise a recognizable structural motif or functional domain such
as a DNA binding domain that binds to a specific DNA promoter
region, an activation domain or a domain for protein-protein
interactions.
Production of Transgenic Plants
[0156] Modification of Traits. The polynucleotides of the invention
are favorably employed to produce transgenic plants with various
traits, or characteristics, that have been modified in a desirable
manner, e.g., to improve the seed characteristics of a plant. For
example, alteration of expression levels or patterns (e.g., spatial
or temporal expression patterns) of one or more of the
transcription factors (or transcription factor homologues) of the
invention, as compared with the levels of the same protein found in
a wild type plant, can be used to modify a plant's traits. An
illustrative example of trait modification, improved
characteristics, by altering expression levels of a particular
transcription factor is described further in the Examples and the
Sequence Listing.
[0157] Arabidopsis as a model system. Arabidopsis thaliana is the
object of rapidly growing attention as a model for genetics and
metabolism in plants. Arabidopsis has a small genome, and well
documented studies are available. It is easy to grow in large
numbers and mutants defining important genetically controlled
mechanisms are either available, or can readily be obtained.
Various methods to introduce and express isolated homologous genes
are available (see Koncz, et al., eds. Methods in Arabidopsis
Research. et al. (1992), World Scientific, New Jersey, N.J., in
"Preface"). Because of its small size, short life cycle, obligate
autogamy and high fertility, Arabidopsis is also a choice organism
for the isolation of mutants and studies in morphogenetic and
development pathways, and control of these pathways by
transcription factors (Koncz, supra, p. 72). A number of studies
introducing transcription factors into A. thaliana have
demonstrated the utility of this plant for understanding the
mechanisms of gene regulation and trait alteration in plants. See,
for example, Koncz, supra, and U.S. Pat. No. 6,417,428).
[0158] Arabidopsis genes in transgenic plants. Expression of genes
which encode transcription factors modify expression of endogenous
genes, polynucleotides, and proteins are well known in the art. In
addition, transgenic plants comprising isolated polynucleotides
encoding transcription factors may also modify expression of
endogenous genes, polynucleotides, and proteins. Examples include
Peng et al. (1997, Genes and Development 11:3194-3205) and Peng et
al. (1999, Nature, 400:256-261). In addition, many others have
demonstrated that an Arabidopsis transcription factor expressed in
an exogenous plant species elicits the same or very similar
phenotypic response. See, for example, Fu et al. (2001, Plant Cell
13:1791-1802); Nandi et al. (2000, Curr. Biol. 10:215-218);
Coupland (1995, Nature 377:482-483); and Weigel and Nilsson (1995,
Nature 377:482-500).
[0159] Homologous genes introduced into transgenic plants.
Homologous genes that may be derived from any plant, or from any
source whether natural, synthetic, semi-synthetic or recombinant,
and that share significant sequence identity or similarity to those
provided by the present invention, may be introduced into plants,
for example, crop plants, to confer desirable or improved traits.
Consequently, transgenic plants may be produced that comprise a
recombinant expression vector or cassette with a promoter operably
linked to one or more sequences homologous to presently disclosed
sequences. The promoter may be, for example, a plant or viral
promoter.
[0160] The invention thus provides for methods for preparing
transgenic plants, and for modifying plant traits. These methods
include introducing into a plant a recombinant expression vector or
cassette comprising a functional promoter operably linked to one or
more sequences homologous to presently disclosed sequences. Plants
and kits for producing these plants that result from the
application of these methods are also encompassed by the present
invention.
[0161] Traits of interest. Examples of some of the traits that may
be desirable in plants, and that may be provided by transforming
the plants with the presently disclosed sequences, are listed in
Table 6.
TABLE-US-00004 TABLE 6 Genes, traits and utilities that affect
plant characteristics Transcription factor genes Utility Trait
Category Traits that impact traits Gene effect on: Resistance and
Salt stress resistance G22; G196; G226; G303; G312; Germination
rate, tolerance G325; G353; G482; G545; G801; survivability, yield;
G867; G884; G922; G926; G1452; extended growth G1794; G1820; G1836;
G1843; range G1863; G2053; G2110; G2140; G2153; G2379; G2701;
G2713; G2719; G2789 Osmotic stress G47; G175; G188; G303; G325;
Germination rate, resistance G353; G489; G502; G526; G921;
survivability, yield G922; G926; G1069; G1089; G1452; G1794; G1930;
G2140; G2153; G2379; G2701; G2719; G2789; Cold stress resistance;
G256; G394; G664; G864; G1322; Germination, cold germination G2130
growth, earlier planting Tolerance to freezing G303; G325; G353;
G720; G912; Survivability, yield, G913; G1794; G2053; G2140;
appearance, G2153; G2379; G2701; G2719; extended range G2789 Heat
stress resistance G3; G464; G682; G864; G964; Germination, G1305;
G1645; G2130 G2430 growth, later planting Drought, low humidity
G303; G325; G353; G720; G912; Survivability, yield, resistance
G926; G1452; G1794; G1820; extended range G1843; G2053; G2140;
G2153; G2379; G2583; G2701; G2719; G2789 Radiation resistance G1052
Survivability, vigor, appearance Decreased herbicide G343; G2133;
G2517 Resistant to sensitivity increased herbicide use Increased
herbicide G374; G877; G1519 Use as a herbicide sensitivity target
Oxidative stress G477; G789; G1807; G2133; Improved yield, G2517
appearance, reduced senescence Light response G183; G354; G375;
G1062; Germination, G1322; G1331; G1488; G1494; growth, G1521;
G1786; G1794; G2144; development, G2555; flowering time
Development, Overall plant G24; G27; G31; G33; G47; G147; Vascular
tissues, morphology architecture G156; G160; G182; G187; G195;
lignin content; cell G196; G211; G221; G237; G280; wall content;
G342; G352; G357; G358; G360; appearance G362; G364; G365; G367;
G373; G377; G396; G431; G447; G479; G546; G546; G551; G578; G580;
G596; G615; G617; G620; G625; G638; G658; G716; G725; G727; G730;
G740; G770; G858; G865; G869; G872; G904; G910; G912; G920; G939;
G963; G977; G979; G987; G988; G993; G1007; G1010; G1014; G1035;
G1046; G1049; G1062; G1069; G1070; G1076; G1089; G1093; G1127;
G1131; G1145; G1229; G1246; G1304; G1318; G1320; G1330; G1331;
G1352; G1354; G1360; G1364; G1379; G1384; G1399; G1415; G1417;
G1442; G1453; G1454; G1459; G1460; G1471; G1475; G1477; G1487;
G1487; G1492; G1499; G1499; G1531; G1540; G1543; G1543; G1544;
G1548; G1584; G1587; G1588; G1589; G1636; G1642; G1747; G1749;
G1749; G1751; G1752; G1763; G1766; G1767; G1778; G1789; G1790;
G1791; G1793; G1794; G1795; G1800; G1806; G1811; G1835; G1836;
G1838; G1839; G1843; G1853; G1855; G1865; G1881; G1882; G1883;
G1884; G1891; G1896; G1898; G1902; G1904; G1906; G1913; G1914;
G1925; G1929; G1930; G1954; G1958; G1965; G1976; G2057; G2107;
G2133; G2134; G2151; G2154; G2157; G2181; G2290; G2299; G2340;
G2340; G2346; G2373; G2376; G2424; G2465; G2505; G2509; G2512;
G2513; G2519; G2520; G2533; G2534; G2573; G2589; G2687; G2720;
G2787; G2789; G2893 Size: increased stature G189; G1073; G1435;
G2430 Size: reduced stature or G3; G5; G21; G23; G39; G165;
Ornamental; small dwarfism G184; G194; G258; G280; G340; stature
provides G343; G353; G354; G362; G363; wind resistance; G370; G385;
G396; G439; G440; creation of dwarf G447; G450; G550; G557; G599;
varieties G636; G652; G670; G671; G674; G729; G760; G804; G831;
G864; G884; G898; G900; G912; G913; G922; G932; G937; G939; G960;
G962; G977; G991; G1000; G1008; G1020; G1023; G1053; G1067; G1075;
G1137; G1181; G1198; G1228; G1266; G1267; G1275; G1277; G1309;
G1311; G1314; G1317; G1322; G1323; G1326; G1332; G1334; G1367;
G1381; G1382; G1386; G1421; G1488; G1494; G1537; G1545; G1560;
G1586; G1641; G1652; G1655; G1671; G1750; G1756; G1757; G1782;
G1786; G1794; G1839; G1845; G1879; G1886; G1888; G1933; G1939;
G1943; G1944; G2011; G2094; G2115; G2130; G2132; G2144; G2145;
G2147; G2156; G2294; G2313; G2344; G2431; G2510; G2517; G2521;
G2893; G2893 Fruit size and number G362 Biomass, yield, cotton boll
fiber density Flower structure, G47; G259; G353; G354; G671;
Ornamental inflorescence G732; G988; G1000; G1063; horticulture;
G1140; G1326; G1449; G1543; production of G1560; G1587; G1645;
G1947; saffron or other G2108; G2143; G2893 edible flowers Number
and G225; G226; G247; G362; G585; Resistance to pests development
of G634; G676; G682; G1014; and desiccation; trichomes G1332;
G1452; G1795; G2105 essential oil production Seed size, color, and
G156; G450; G584; G652; G668; Yield number G858; G979; G1040;
G1062; G1145; G1255; G1494; G1531; G1534; G1594; G2105; G2114; Root
development, G9; G1482; G1534; G1794; modifications G1852; G2053;
G2136; G2140 Modifications to root G225; G226 Nutrient, water hairs
uptake, pathogen resistance Apical dominance G559; G732; G1255;
G1275; Ornamental G1411; G1488; G1635; G2452; horticulture G2509
Branching patterns G568; G988; G1548 Ornamental horticulture, knot
reduction, improved windscreen Leaf shape, color, G375; G377; G428;
G438; G447; Appealing shape or modifications G464; G557; G577;
G599; G635; shiny leaves for G671; G674; G736; G804; G903;
ornamental G977; G921; G922; G1038; agriculture, G1063; G1067;
G1073; G1075; increased biomass G1146; G1152; G1198; G1267; or
photosynthesis G1269; G1452; G1484; G1586; G1594; G1767; G1786;
G1792; G1886; G2059; G2094; G2105; G2113; G2117; G2143; G2144;
G2431; G2452; G2465; G2587; G2583; G2724; Silique G1134 Ornamental
Stem morphology G47; G438; G671; G748; G988; Ornamental; G1000
digestibility Shoot modifications G390; G391 Ornamental stem
bifurcations Disease, Pathogen Bacterial G211; G347; G367; G418;
G525; Yield, appearance, Resistance G545; G578; G1049
survivability, extended range Fungal G19; G28; G28; G28; G147;
Yield, appearance, G188; G207; G211; G237; G248; survivability,
G278; G347; G367; G371; G378; extended range G409; G477; G545;
G545; G558; G569; G578; G591; G594; G616; G789; G805; G812; G865;
G869; G872; G881; G896; G940; G1047; G1049; G1064; G1084; G1196;
G1255; G1266; G1363; G1514; G1756; G1792; G1792; G1792; G1792;
G1880; G1919; G1919; G1927; G1927; G1936; G1936; G1950; G2069;
G2130; G2380; G2380; G2555 Nutrients Increased tolerance to G225;
G226; G1792 nitrogen-limited soils Increased tolerance to G419;
G545; G561; G1946 phosphate-limited soils Increased tolerance to
G561; G911 potassium-limited soils Hormonal Hormone sensitivity
G12; G546; G926; G760; G913; Seed dormancy, G926; G1062; G1069;
G1095; drought tolerance; G1134; G1330; G1452; G1666; plant form,
fruit G1820; G2140; G2789 ripening Seed biochemistry Production of
seed G214; G259; G490; G652; G748; Antioxidant activity, prenyl
lipids, including G883; G1052; G1328; G1930; vitamin E tocopherol
G2509; G2520 Production of seed G20 Precursors for sterols human
steroid hormones; cholesterol modulators Production of seed G353;
G484; G674; G1272; Defense against glucosinolates G1506; G1897;
G1946; G2113; insects; putative G2117; G2155; G2290; G2340
anticancer activity; undesirable in animal feeds Modified seed oil
G162; G162; G180; G192; G241; Vegetable oil content G265; G286;
G291; G427; G509; production; G519; G561; G567; G590; G818;
increased caloric G849; G892; G961; G974; G1063; value for animal
G1143; G1190; G1198; G1226; feeds; lutein content G1229; G1323;
G1451; G1471; G1478; G1496; G1526; G1543; G1640; G1644; G1646;
G1672; G1677; G1750; G1765; G1777; G1793; G1838; G1902; G1946;
G1948; G2059; G2123; G2138; G2139; G2343; G2792; G2830 Modified
seed oil G217; G504; G622; G778; G791; Heat stability, composition
G861; G869; G938; G965; G1417; digestibility of seed G2192 oils
Modified seed protein G162; G226; G241; G371; G427; Reduced caloric
content G509; G567; G597; G732; G849; value for humans G865; G892;
G963; G988; G1323; G1323; G1419; G1478; G1488; G1634; G1637; G1641;
G1644; G1652; G1677; G1777; G1777; G1818; G1820; G1903; G1909;
G1946; G1946; G1958; G2059; G2117; G2417; G2509 Leaf biochemistry
Production of flavonoids G1666* Ornamental pigment production;
pathogen resistance; health benefits Production of leaf G264; G353;
G484; G652; G674; Defense against glucosinolates G681; G1069;
G1198; G1322; insects; putative G1421; G1657; G1794; G1897;
anticancer activity; G1946; G2115; G2117; G2144; undesirable in
G2155; G2155; G2340; G2512; animal feeds G2520; G2552 Production of
diterpenes G229 Induction of
enzymes involved in alkaloid biosynthesis Production of G546
Ornamental pigment anthocyanin Production of leaf G561; G2131;
G2424 Precursors for phytosterols, inc. human steroid stigmastanol,
hormones; campesterol cholesterol modulators Leaf fatty acid G214;
G377; G861; G962; G975; Nutritional value; composition G987; G1266;
G1337; G1399; increase in waxes G1465; G1512; G2136; G2147; for
disease G2192 resistance Production of leaf G214; G259; G280; G652;
G987; Antioxidant activity, prenyl lipids, including G1543; G2509;
G2520 vitamin E tocopherol Biochemistry, Production of G229; G663
general miscellaneous secondary metabolites Sugar, starch, G158;
G211; G211; G237; G242; Food digestibility, hemicellulose G274;
G598; G1012; G1266; hemicellulose & composition, G1309; G1309;
G1641; G1765; pectin content; fiber G1865; G2094; G2094; G2589;
content; plant G2589 tensile strength, wood quality, pathogen
resistance, pulp production; tuber starch content Sugar sensing
Plant response to sugars G26; G38; G43; G207; G218; Photosynthetic
rate, G241; G254; G263; G308; G536; carbohydrate G567; G567; G680;
G867; G912; accumulation, G956; G996; G1068; G1225; biomass
production, G1314; G1314; G1337; G1759; source-sink G1804; G2153;
G2379 relationships, senescence Growth, Plant growth rate and G447;
G617; G674; G730; G917; Faster growth, Reproduction development
G937; G1035; G1046; G1131; increased biomass G1425; G1452; G1459;
G1492; or yield, improved G1589; G1652; G1879; G1943; appearance;
delay in G2430; G2431; G2465; G2521 bolting Embryo development G167
Seed germination rate G979; G1792; G2130 Yield Plant, seedling
vigor G561; G2346 Survivability, yield Senescence; cell death G571;
G636; G878; G1050; Yield, appearance; G1463; G1749; G1944; G2130;
response to G2155; G2340; G2383 pathogens; Modified fertility G39;
G340; G439; G470; G559; Prevents or G615; G652; G671; G779; G962;
minimizes escape of G977; G988; G1000; G1063; the pollen of GMOs
G1067; G1075; G1266; G1311; G1321; G1326; G1367; G1386; G1421;
G1453; G1471; G1453; G1560; G1594; G1635; G1750; G1947; G2011;
G2094; G2113; G2115; G2130; G2143; G2147; G2294; G2510; G2893 Early
flowering G147; G157; G180; G183; G183; Faster generation G184;
G185; G208; G227; G294; time; synchrony of G390; G390; G390; G391;
G391; flowering; potential G427; G427; G490; G565; G590; for
introducing new G592; G720; G789; G865; G898; traits to single
G898; G989; G989; G1037; variety G1037; G1142; G1225; G1225; G1226;
G1242; G1305; G1305; G1380; G1380; G1480; G1480; G1488; G1494;
G1545; G1545; G1649; G1706; G1760; G1767; G1767; G1820; G1841;
G1841; G1842; G1843; G1843; G1946; G1946; G2010; G2030; G2030;
G2144; G2144; G2295; G2295; G2347; G2348; G2348; G2373; G2373;
G2509; G2509; G2555; G2555 Delayed flowering G8; G47; G192; G214;
G234; Delayed time to G361; G362; G562; G568; G571; pollen
production of G591; G680; G736; G748; G859; GMO plants; G878; G910;
G912; G913; G971; synchrony of G994; G1051; G1052; G1073;
flowering; increased G1079; G1335; G1435; G1452; yield G1478;
G1789; G1804; G1865; G1865; G1895; G1900; G2007; G2133; G2155;
G2291; G2465 Extended flowering G1947 phase Flower and leaf G259;
G353; G377; G580; G638 Ornamental development G652; G858; G869;
G917; G922; applications; G932; G1063; G1075; G1140; decreased
fertility G1425; G1452; G1499; G1548; G1645; G1865; G1897; G1933;
G2094; G2124; G2140; G2143; G2535; G2557 Flower abscission G1897
Ornamental: longer retention of flowers When co-expressed with G669
and G663
[0162] Significance of modified plant traits. Currently, the
existence of a series of maturity groups for different latitudes
represents a major barrier to the introduction of new valuable
traits. Any trait (e.g. disease resistance) has to be bred into
each of the different maturity groups separately, a laborious and
costly exercise. The availability of single strain, which could be
grown at any latitude, would therefore greatly increase the
potential for introducing new traits to crop species such as
soybean and cotton.
[0163] For many of the traits, listed in Table 6 and below, that
may be conferred to plants, a single transcription factor gene may
be used to increase or decrease, advance or delay, or improve or
prove deleterious to a given trait. For example, overexpression of
a transcription factor gene that naturally occurs in a plant may
cause early flowering relative to non-transformed or wild-type
plants. By knocking out the gene, or suppressing the gene (with,
for example, antisense suppression) the plant may experience
delayed flowering. Similarly, overexpressing or suppressing one or
more genes can impart significant differences in production of
plant products, such as different fatty acid ratios. Thus,
suppressing a gene that causes a plant to be more sensitive to cold
may improve a plant's tolerance of cold.
[0164] Salt stress resistance. Soil salinity is one of the more
important variables that determines where a plant may thrive.
Salinity is especially important for the successful cultivation of
crop plants, particular in many parts of the world that have
naturally high soil salt concentrations, or where the soil has been
over-utilized. Thus, presently disclosed transcription factor genes
that provide increased salt tolerance during germination, the
seedling stage, and throughout a plant's life cycle would find
particular value for imparting survivability and yield in areas
where a particular crop would not normally prosper.
[0165] Osmotic stress resistance. Presently disclosed transcription
factor genes that confer resistance to osmotic stress may increase
germination rate under adverse conditions, which could impact
survivability and yield of seeds and plants.
[0166] Cold stress resistance. The potential utility of presently
disclosed transcription factor genes that increase tolerance to
cold is to confer better germination and growth in cold conditions.
The germination of many crops is very sensitive to cold
temperatures. Genes that would allow germination and seedling vigor
in the cold would have highly significant utility in allowing seeds
to be planted earlier in the season with a high rate of
survivability. Transcription factor genes that confer better
survivability in cooler climates allow a grower to move up planting
time in the spring and extend the growing season further into
autumn for higher crop yields.
[0167] Tolerance to freezing. The presently disclosed transcription
factor genes that impart tolerance to freezing conditions are
useful for enhancing the survivability and appearance of plants
conditions or conditions that would otherwise cause extensive
cellular damage. Thus, germination of seeds and survival may take
place at temperatures significantly below that of the mean
temperature required for germination of seeds and survival of
non-transformed plants. As with salt tolerance, this has the added
benefit of increasing the potential range of a crop plant into
regions in which it would otherwise succumb. Cold tolerant
transformed plants may also be planted earlier in the spring or
later in autumn, with greater success than with non-transformed
plants.
[0168] Heat stress tolerance. The germination of many crops is also
sensitive to high temperatures. Presently disclosed transcription
factor genes that provide increased heat tolerance are generally
useful in producing plants that germinate and grow in hot
conditions, may find particular use for crops that are planted late
in the season, or extend the range of a plant by allowing growth in
relatively hot climates.
[0169] Drought, low humidity tolerance. Strategies that allow
plants to survive in low water conditions may include, for example,
reduced surface area or surface oil or wax production. A number of
presently disclosed transcription factor genes increase a plant's
tolerance to low water conditions and provide the benefits of
improved survivability, increased yield and an extended geographic
and temporal planting range.
[0170] Radiation resistance. Presently disclosed transcription
factor genes have been shown to increase lutein production. Lutein,
like other xanthophylls such as zeaxanthin and violaxanthin, are
important in the protection of plants against the damaging effects
of excessive light. Lutein contributes, directly or indirectly, to
the rapid rise of non-photochemical quenching in plants exposed to
high light. Increased tolerance of field plants to visible and
ultraviolet light impacts survivability and vigor, particularly for
recent transplants. Also affected are the yield and appearance of
harvested plants or plant parts. Crop plants engineered with
presently disclosed transcription factor genes that cause the plant
to produce higher levels of lutein therefore would have improved
photoprotection, leading to less oxidative damage and increase
vigor, survivability and higher yields under high light and
ultraviolet light conditions.
[0171] Decreased herbicide sensitivity. Presently disclosed
transcription factor genes that confer resistance or tolerance to
herbicides (e.g., glyphosate) may find use in providing means to
increase herbicide applications without detriment to desirable
plants. This would allow for the increased use of a particular
herbicide in a local environment, with the effect of increased
detriment to undesirable species and less harm to transgenic,
desirable cultivars.
[0172] Increased herbicide sensitivity. Knockouts of a number of
the presently disclosed transcription factor genes have been shown
to be lethal to developing embryos. Thus, these genes are
potentially useful as herbicide targets.
[0173] Oxidative stress. In plants, as in all living things,
abiotic and biotic stresses induce the formation of oxygen
radicals, including superoxide and peroxide radicals. This has the
effect of accelerating senescence, particularly in leaves, with the
resulting loss of yield and adverse effect on appearance.
Generally, plants that have the highest level of defense
mechanisms, such as, for example, polyunsaturated moieties of
membrane lipids, are most likely to thrive under conditions that
introduce oxidative stress (e.g., high light, ozone, water deficit,
particularly in combination). Introduction of the presently
disclosed transcription factor genes that increase the level of
oxidative stress defense mechanisms would provide beneficial
effects on the yield and appearance of plants. One specific
oxidizing agent, ozone, has been shown to cause significant foliar
injury, which impacts yield and appearance of crop and ornamental
plants. In addition to reduced foliar injury that would be found in
ozone resistant plant created by transforming plants with some of
the presently disclosed transcription factor genes, the latter have
also been shown to have increased chlorophyll fluorescence (Yu-Sen
Chang et al. Bot. Bull. Acad. Sin. (2001) 42: 265-272).
[0174] Heavy metal tolerance. Heavy metals such as lead, mercury,
arsenic, chromium and others may have a significant adverse impact
on plant respiration. Plants that have been transformed with
presently disclosed transcription factor genes that confer improved
resistance to heavy metals, through, for example, sequestering or
reduced uptake of the metals will show improved vigor and yield in
soils with relatively high concentrations of these elements.
Conversely, transgenic transcription factors may also be introduced
into plants to confer an increase in heavy metal uptake, which may
benefit efforts to clean up contaminated soils.
[0175] Light response. Presently disclosed transcription factor
genes that modify a plant's response to light may be useful for
modifying a plant's growth or development, for example,
photomorphogenesis in poor light, or accelerating flowering time in
response to various light intensities, quality or duration to which
a non-transformed plant would not similarly respond. Examples of
such responses that have been demonstrated include leaf number and
arrangement, and early flower bud appearances.
[0176] Overall plant architecture. Several presently disclosed
transcription factor genes have been introduced into plants to
alter numerous aspects of the plant's morphology. For example, it
has been demonstrated that a number of transcription factors may be
used to manipulate branching, such as the means to modify lateral
branching, a possible application in the forestry industry.
Transgenic plants have also been produced that have altered cell
wall content, lignin production, flower organ number, or overall
shape of the plants. Presently disclosed transcription factor genes
transformed into plants may be used to affect plant morphology by
increasing or decreasing internode distance, both of which may be
advantageous under different circumstances. For example, for fast
growth of woody plants to provide more biomass, or fewer knots,
increased internode distances are generally desirable. For improved
wind screening of shrubs or trees, or harvesting characteristics
of, for example, members of the Gramineae family, decreased
internode distance may be advantageous. These modifications would
also prove useful in the ornamental horticulture industry for the
creation of unique phenotypic characteristics of ornamental
plants.
[0177] Increased stature. For some ornamental plants, the ability
to provide larger varieties may be highly desirable. For many
plants, including t fruit-bearing trees or trees and shrubs that
serve as view or wind screens, increased stature provides obvious
benefits. Crop species may also produce higher yields on larger
cultivars.
[0178] Reduced stature or dwarfism. Presently disclosed
transcription factor genes that decrease plant stature can be used
to produce plants that are more resistant to damage by wind and
rain, or more resistant to heat or low humidity or water deficit.
Dwarf plants are also of significant interest to the ornamental
horticulture industry, and particularly for home garden
applications for which space availability may be limited.
[0179] Fruit size and number. Introduction of presently disclosed
transcription factor genes that affect fruit size will have
desirable impacts on fruit size and number, which may comprise
increases in yield for fruit crops, or reduced fruit yield, such as
when vegetative growth is preferred (e.g., with bushy ornamentals,
or where fruit is undesirable, as with ornamental olive trees).
[0180] Flower structure, inflorescence, and development. Presently
disclosed transgenic transcription factors have been used to create
plants with larger flowers or arrangements of flowers that are
distinct from wild-type or non-transformed cultivars. This would
likely have the most value for the ornamental horticulture
industry, where larger flowers or interesting presentations
generally are preferred and command the highest prices. Flower
structure may have advantageous effects on fertility, and could be
used, for example, to decrease fertility by the absence, reduction
or screening of reproductive components. One interesting
application for manipulation of flower structure, for example, by
introduced transcription factors could be in the increased
production of edible flowers or flower parts, including saffron,
which is derived from the stigmas of Crocus sativus.
[0181] Number and development of trichomes. Several presently
disclosed transcription factor genes have been used to modify
trichome number and amount of trichome products in plants. Trichome
glands on the surface of many higher plants produce and secrete
exudates that give protection from the elements and pests such as
insects, microbes and herbivores. These exudates may physically
immobilize insects and spores, may be insecticidal or ant-microbial
or they may act as allergens or irritants to protect against
herbivores. Trichomes have also been suggested to decrease
transpiration by decreasing leaf surface air flow, and by exuding
chemicals that protect the leaf from the sun.
[0182] Seed size, color and number. The introduction of presently
disclosed transcription factor genes into plants that alter the
size or number of seeds may have a significant impact on yield,
both when the product is the seed itself, or when biomass of the
vegetative portion of the plant is increased by reducing seed
production. In the case of fruit products, it is often advantageous
to modify a plant to have reduced size or number of seeds relative
to non-transformed plants to provide seedless or varieties with
reduced numbers or smaller seeds. Presently disclosed transcription
factor genes have also been shown to affect seed size, including
the development of larger seeds. Seed size, in addition to seed
coat integrity, thickness and permeability, seed water content and
by a number of other components including antioxidants and
oligosaccharides, may affect seed longevity in storage. This would
be an important utility when the seed of a plant is the harvested
crops, as with, for example, peas, beans, nuts, etc. Presently
disclosed transcription factor genes have also been used to modify
seed color, which could provide added appeal to a seed product.
[0183] Root development, modifications. By modifying the structure
or development of roots by transforming into a plant one or more of
the presently disclosed transcription factor genes, plants may be
produced that have the capacity to thrive in otherwise unproductive
soils. For example, grape roots that extend further into rocky
soils, or that remain viable in waterlogged soils, would increase
the effective planting range of the crop. It may be advantageous to
manipulate a plant to produce short roots, as when a soil in which
the plant will be growing is occasionally flooded, or when
pathogenic fungi or disease-causing nematodes are prevalent.
[0184] Modifications to root hairs. Presently disclosed
transcription factor genes that increase root hair length or number
potentially could be used to increase root growth or vigor, which
might in turn allow better plant growth under adverse conditions
such as limited nutrient or water availability.
[0185] Apical dominance. The modified expression of presently
disclosed transcription factors that control apical dominance could
be used in ornamental horticulture, for example, to modify plant
architecture.
[0186] Branching patterns. Several presently disclosed
transcription factor genes have been used to manipulate branching,
which could provide benefits in the forestry industry. For example,
reduction in the formation of lateral branches could reduce knot
formation. Conversely, increasing the number of lateral branches
could provide utility when a plant is used as a windscreen, or may
also provide ornamental advantages.
[0187] Leaf shape, color and modifications. It has been
demonstrated in laboratory experiments that overexpression of some
of the presently disclosed transcription factors produced marked
effects on leaf development. At early stages of growth, these
transgenic seedlings developed narrow, upward pointing leaves with
long petioles, possibly indicating a disruption in circadian-clock
controlled processes or nyctinastic movements. Other transcription
factor genes can be used to increase plant biomass; large size
would be useful in crops where the vegetative portion of the plant
is the marketable portion.
[0188] Siliques. Genes that later silique conformation in
brassicates may be used to modify fruit ripening processes in
brassicates and other plants, which may positively affect seed or
fruit quality.
[0189] Stem morphology and shoot modifications. Laboratory studies
have demonstrated that introducing several of the presently
disclosed transcription factor genes into plants can cause stem
bifurcations in shoots, in which the shoot meristems split to form
two or three separate shoots. This unique appearance would be
desirable in ornamental applications.
[0190] Diseases, pathogens and pests. A number of the presently
disclosed transcription factor genes have been shown to or are
likely to confer resistance to various plant diseases, pathogens
and pests. The offending organisms include fungal pathogens
Fusarium oxysporum, Botrytis cinerea, Sclerotinia sclerotiorum, and
Erysiphe orontii. Bacterial pathogens to which resistance may be
conferred include Pseudomonas syringae. Other problem organisms may
potentially include nematodes, mollicutes, parasites, or
herbivorous arthropods. In each case, one or more transformed
transcription factor genes may provide some benefit to the plant to
help prevent or overcome infestation. The mechanisms by which the
transcription factors work could include increasing surface waxes
or oils, surface thickness, local senescence, or the activation of
signal transduction pathways that regulate plant defense in
response to attacks by herbivorous pests (including, for example,
protease inhibitors).
[0191] Increased tolerance of plants to nutrient-limited soils.
Presently disclosed transcription factor genes introduced into
plants may provide the means to improve uptake of essential
nutrients, including nitrogenous compounds, phosphates, potassium,
and trace minerals. The effect of these modifications is to
increase the seedling germination and range of ornamental and crop
plants. The utilities of presently disclosed transcription factor
genes conferring tolerance to conditions of low nutrients also
include cost savings to the grower by reducing the amounts of
fertilizer needed, environmental benefits of reduced fertilizer
runoff; and improved yield and stress tolerance. In addition, this
gene could be used to alter seed protein amounts and/or composition
that could impact yield as well as the nutritional value and
production of various food products.
[0192] Hormone sensitivity. One or more of the presently disclosed
transcription factor genes have been shown to affect plant abscisic
acid (ABA) sensitivity. This plant hormone is likely the most
important hormone in mediating the adaptation of a plant to stress.
For example, ABA mediates conversion of apical meristems into
dormant buds. In response to increasingly cold conditions, the
newly developing leaves growing above the meristem become converted
into stiff bud scales that closely wrap the meristem and protect it
from mechanical damage during winter. ABA in the bud also enforces
dormancy; during premature warm spells, the buds are inhibited from
sprouting. Bud dormancy is eliminated after either a prolonged cold
period of cold or a significant number of lengthening days. Thus,
by affecting ABA sensitivity, introduced transcription factor genes
may affect cold sensitivity and survivability. ABA is also
important in protecting plants from drought tolerance.
[0193] Several other of the present transcription factor genes have
been used to manipulate ethylene signal transduction and response
pathways. These genes can thus be used to manipulate the processes
influenced by ethylene, such as seed germination or fruit ripening,
and to improve seed or fruit quality.
[0194] Production of seed and leaf prenyl lipids, including
tocopherol. Prenyl lipids play a role in anchoring proteins in
membranes or membranous organelles. Thus, modifying the prenyl
lipid content of seeds and leaves could affect membrane integrity
and function. A number of presently disclosed transcription factor
genes have been shown to modify the tocopherol composition of
plants. Tocopherols have both anti-oxidant and vitamin E
activity.
[0195] Production of seed and leaf phytosterols: Presently
disclosed transcription factor genes that modify levels of
phytosterols in plants may have at least two utilities. First,
phytosterols are an important source of precursors for the
manufacture of human steroid hormones. Thus, regulation of
transcription factor expression or activity could lead to elevated
levels of important human steroid precursors for steroid
semi-synthesis. For example, transcription factors that cause
elevated levels of campesterol in leaves, or sitosterols and
stigmasterols in seed crops, would be useful for this purpose.
Phytosterols and their hydrogenated derivatives phytostanols also
have proven cholesterol-lowering properties, and transcription
factor genes that modify the expression of these compounds in
plants would thus provide health benefits.
[0196] Production of seed and leaf glucosinolates. Some
glucosinolates have anti-cancer activity; thus, increasing the
levels or composition of these compounds by introducing several of
the presently disclosed transcription factors might be of interest
from a nutraceutical standpoint. (3) Glucosinolates form part of a
plants natural defense against insects. Modification of
glucosinolate composition or quantity could therefore afford
increased protection from predators. Furthermore, in edible crops,
tissue specific promoters might be used to ensure that these
compounds accumulate specifically in tissues, such as the
epidermis, which are not taken for consumption.
[0197] Modified seed oil content. The composition of seeds,
particularly with respect to seed oil amounts and/or composition,
is very important for the nutritional value and production of
various food and feed products. Several of the presently disclosed
transcription factor genes in seed lipid saturation that alter seed
oil content could be used to improve the heat stability of oils or
to improve the nutritional quality of seed oil, by, for example,
reducing the number of calories in seed, increasing the number of
calories in animal feeds, or altering the ratio of saturated to
unsaturated lipids comprising the oils.
[0198] Seed and leaf fatty acid composition. A number of the
presently disclosed transcription factor genes have been shown to
alter the fatty acid composition in plants, and seeds in
particular. This modification may find particular value for
improving the nutritional value of, for example, seeds or whole
plants. Dietary fatty acids ratios have been shown to have an
effect on, for example, bone integrity and remodeling (see, for
example, Weiler, H. A., Pediatr Res (2000) 47:5 692-697). The ratio
of dietary fatty acids may alter the precursor pools of long-chain
polyunsaturated fatty acids that serve as precursors for
prostaglandin synthesis. In mammalian connective tissue,
prostaglandins serve as important signals regulating the balance
between resorption and formation in bone and cartilage. Thus
dietary fatty acid ratios altered in seeds may affect the etiology
and outcome of bone loss.
[0199] Modified seed protein content. As with seed oils, the
composition of seeds, particularly with respect to protein amounts
and/or composition, is very important for the nutritional value and
production of various food and feed products. A number of the
presently disclosed transcription factor genes modify the protein
concentrations in seeds would provide nutritional benefits, and may
be used to prolong storage, increase seed pest or disease
resistance, or modify germination rates.
[0200] Production of flavonoids in leaves and other plant parts.
Expression of presently disclosed transcription factor genes that
increase flavonoid production in plants, including anthocyanins and
condensed tannins, may be used to alter in pigment production for
horticultural purposes, and possibly increasing stress resistance.
Flavonoids have antimicrobial activity and could be used to
engineer pathogen resistance. Several flavonoid compounds have
health promoting effects such as the inhibition of tumor growth and
cancer, prevention of bone loss and the prevention of the oxidation
of lipids. Increasing levels of condensed tannins, whose
biosynthetic pathway is shared with anthocyanin biosynthesis, in
forage legumes is an important agronomic trait because they prevent
pasture bloat by collapsing protein foams within the rumen. For a
review on the utilities of flavonoids and their derivatives, refer
to Dixon et al. (1999) Trends Plant Sci. 4:394-400.
[0201] Production of diterpenes in leaves and other plant parts.
Depending on the plant species, varying amounts of diverse
secondary biochemicals (often lipophilic terpenes) are produced and
exuded or volatilized by trichomes. These exotic secondary
biochemicals, which are relatively easy to extract because they are
on the surface of the leaf, have been widely used in such products
as flavors and aromas, drugs, pesticides and cosmetics. Thus, the
overexpression of genes that are used to produce diterpenes in
plants may be accomplished by introducing transcription factor
genes that induce said overexpression. One class of secondary
metabolites, the diterpenes, can effect several biological systems
such as tumor progression, prostaglandin synthesis and tissue
inflammation. In addition, diterpenes can act as insect pheromones,
termite allomones, and can exhibit neurotoxic, cytotoxic and
antimitotic activities. As a result of this functional diversity,
diterpenes have been the target of research several pharmaceutical
ventures. In most cases where the metabolic pathways are impossible
to engineer, increasing trichome density or size on leaves may be
the only way to increase plant productivity.
[0202] Production of anthocyanin in leaves and other plant parts.
Several presently disclosed transcription factor genes can be used
to alter anthocyanin production in numerous plant species. The
potential utilities of these genes include alterations in pigment
production for horticultural purposes, and possibly increasing
stress resistance in combination with another transcription
factor.
[0203] Production of miscellaneous secondary metabolites.
Microarray data suggests that flux through the aromatic amino acid
biosynthetic pathways and primary and secondary metabolite
biosynthetic pathways are up-regulated. Presently disclosed
transcription factors have been shown to be involved in regulating
alkaloid biosynthesis, in part by up-regulating the enzymes
indole-3-glycerol phosphatase and strictosidine synthase.
Phenylalanine ammonia lyase, chalcone synthase and trans-cinnamate
mono-oxygenase are also induced, and are involved in
phenylpropenoid biosynthesis.
[0204] Sugar, starch, hemicellulose composition. Overexpression of
the presently disclosed transcription factors that affect sugar
content resulted in plants with altered leaf insoluble sugar
content. Transcription factors that alter plant cell wall
composition have several potential applications including altering
food digestibility, plant tensile strength, wood quality, pathogen
resistance and in pulp production. The potential utilities of a
gene involved in glucose-specific sugar sensing are to alter energy
balance, photosynthetic rate, carbohydrate accumulation, biomass
production, source-sink relationships, and senescence.
[0205] Hemicellulose is not desirable in paper pulps because of its
lack of strength compared with cellulose. Thus modulating the
amounts of cellulose vs. hemicellulose in the plant cell wall is
desirable for the paper/lumber industry. Increasing the insoluble
carbohydrate content in various fruits, vegetables, and other
edible consumer products will result in enhanced fiber content.
Increased fiber content would not only provide health benefits in
food products, but might also increase digestibility of forage
crops. In addition, the hemicellulose and pectin content of fruits
and berries affects the quality of jam and catsup made from them.
Changes in hemicellulose and pectin content could result in a
superior consumer product.
[0206] Plant response to sugars and sugar composition. In addition
to their important role as an energy source and structural
component of the plant cell, sugars are central regulatory
molecules that control several aspects of plant physiology,
metabolism and development. It is thought that this control is
achieved by regulating gene expression and, in higher plants,
sugars have been shown to repress or activate plant genes involved
in many essential processes such as photosynthesis, glyoxylate
metabolism, respiration, starch and sucrose synthesis and
degradation, pathogen response, wounding response, cell cycle
regulation, pigmentation, flowering and senescence. The mechanisms
by which sugars control gene expression are not understood.
[0207] Because sugars are important signaling molecules, the
ability to control either the concentration of a signaling sugar or
how the plant perceives or responds to a signaling sugar could be
used to control plant development, physiology or metabolism. For
example, the flux of sucrose (a disaccharide sugar used for
systemically transporting carbon and energy in most plants) has
been shown to affect gene expression and alter storage compound
accumulation in seeds. Manipulation of the sucrose signaling
pathway in seeds may therefore cause seeds to have more protein,
oil or carbohydrate, depending on the type of manipulation.
Similarly, in tubers, sucrose is converted to starch which is used
as an energy store. It is thought that sugar signaling pathways may
partially determine the levels of starch synthesized in the tubers.
The manipulation of sugar signaling in tubers could lead to tubers
with a higher starch content.
[0208] Thus, the presently disclosed transcription factor genes
that manipulate the sugar signal transduction pathway may lead to
altered gene expression to produce plants with desirable traits. In
particular, manipulation of sugar signal transduction pathways
could be used to alter source-sink relationships in seeds, tubers,
roots and other storage organs leading to increase in yield.
[0209] Plant growth rate and development. A number of the presently
disclosed transcription factor genes have been shown to have
significant effects on plant growth rate and development. These
observations have included, for example, more rapid or delayed
growth and development of reproductive organs. This would provide
utility for regions with short or long growing seasons,
respectively. Accelerating plant growth would also improve early
yield or increase biomass at an earlier stage, when such is
desirable (for example, in producing forestry products).
[0210] Embryo development. Presently disclosed transcription factor
genes that alter embryo development has been used to alter seed
protein and oil amounts and/or composition which is very important
for the nutritional value and production of various food products.
Seed shape and seed coat may also be altered by these genes, which
may provide for improved storage stability.
[0211] Seed germination rate. A number of the presently disclosed
transcription factor genes have been shown to modify seed
germination rate, including when the seeds are in conditions
normally unfavorable for germination (e.g., cold, heat or salt
stress, or in the presence of ABA), and may thus be used to modify
and improve germination rates under adverse conditions.
[0212] Plant, seedling vigor. Seedlings transformed with presently
disclosed transcription factors have been shown to possess larger
cotyledons and appeared somewhat more advanced than control plants.
This indicates that the seedlings developed more rapidly that the
control plants. Rapid seedling development is likely to reduce loss
due to diseases particularly prevalent at the seedling stage (e.g.,
damping off) and is thus important for survivability of plants
germinating in the field or in controlled environments.
[0213] Senescence, cell death. Presently disclosed transcription
factor genes may be used to alter senescence responses in plants.
Although leaf senescence is thought to be an evolutionary
adaptation to recycle nutrients, the ability to control senescence
in an agricultural setting has significant value. For example, a
delay in leaf senescence in some maize hybrids is associated with a
significant increase in yields and a delay of a few days in the
senescence of soybean plants can have a large impact on yield.
Delayed flower senescence may also generate plants that retain
their blossoms longer and this may be of potential interest to the
ornamental horticulture industry.
[0214] Modified fertility. Plants that overexpress a number of the
presently disclosed transcription factor genes have been shown to
possess reduced fertility. This could be a desirable trait, as it
could be exploited to prevent or minimize the escape of the pollen
of genetically modified organisms (GMOs) into the environment.
[0215] Early and delayed flowering. Presently disclosed
transcription factor genes that accelerate flowering could have
valuable applications in such programs since they allow much faster
generation times. In a number of species, for example, broccoli,
cauliflower, where the reproductive parts of the plants constitute
the crop and the vegetative tissues are discarded, it would be
advantageous to accelerate time to flowering. Accelerating
flowering could shorten crop and tree breeding programs.
Additionally, in some instances, a faster generation time might
allow additional harvests of a crop to be made within a given
growing season. A number of Arabidopsis genes have already been
shown to accelerate flowering when constitutively expressed. These
include LEAFY, APETALA1 and CONSTANS (Mandel, M. et al., 1995,
Nature 377, 522-524; Weigel, D. and Nilsson, O., 1995, Nature 377,
495-500; Simon et al., 1996, Nature 384, 59-62).
[0216] By regulating the expression of potential flowering using
inducible promoters, flowering could be triggered by application of
an inducer chemical. This would allow flowering to be synchronized
across a crop and facilitate more efficient harvesting. Such
inducible systems could also be used to tune the flowering of crop
varieties to different latitudes. At present, species such as
soybean and cotton are available as a series of maturity groups
that are suitable for different latitudes on the basis of their
flowering time (which is governed by day-length). A system in which
flowering could be chemically controlled would allow a single
high-yielding northern maturity group to be grown at any latitude.
In southern regions such plants could be grown for longer, thereby
increasing yields, before flowering was induced. In more northern
areas, the induction would be used to ensure that the crop flowers
prior to the first winter frosts.
[0217] In a sizeable number of species, for example, root crops,
where the vegetative parts of the plants constitute the crop and
the reproductive tissues are discarded, it would be advantageous to
delay or prevent flowering. Extending vegetative development with
presently disclosed transcription factor genes could thus bring
about large increases in yields. Prevention of flowering might help
maximize vegetative yields and prevent escape of genetically
modified organism (GMO) pollen.
[0218] Extended flowering phase. Presently disclosed transcription
factors that extend flowering time have utility in engineering
plants with longer-lasting flowers for the horticulture industry,
and for extending the time in which the plant is fertile.
[0219] Flower and leaf development. Presently disclosed
transcription factor genes have been used to modify the development
of flowers and leaves. This could be advantageous in the
development of new ornamental cultivars that present unique
configurations. In addition, some of these genes have been shown to
reduce a plant's fertility, which is also useful for helping to
prevent development of pollen of GMOs.
[0220] Flower abscission. Presently disclosed transcription factor
genes introduced into plants have been used to retain flowers for
longer periods. This would provide a significant benefit to the
ornamental industry, for both cut flowers and woody plant varieties
(of, for example, maize), as well as have the potential to lengthen
the fertile period of a plant, which could positively impact yield
and breeding programs.
[0221] A listing of specific effects and utilities that the
presently disclosed transcription factor genes have on plants, as
determined by direct observation and assay analysis, is provided in
Table 4.
[0222] Antisense and Co-suppression. In addition to expression of
the nucleic acids of the invention as gene replacement or plant
phenotype modification nucleic acids, the nucleic acids are also
useful for sense and anti-sense suppression of expression, e.g., to
down-regulate expression of a nucleic acid of the invention, e.g.,
as a further mechanism for modulating plant phenotype. That is, the
nucleic acids of the invention, or subsequences or anti-sense
sequences thereof, can be used to block expression of naturally
occurring homologous nucleic acids. A variety of sense and
anti-sense technologies are known in the art, e.g., as set forth in
Lichtenstein and Nellen (1997) Antisense Technology: A Practical
Approach IRL Press at Oxford University Press, Oxford, U.K. In
general, sense or anti-sense sequences are introduced into a cell,
where they are optionally amplified, e.g., by transcription. Such
sequences include both simple oligonucleotide sequences and
catalytic sequences such as ribozymes.
[0223] For example, a reduction or elimination of expression (i.e.,
a "knock-out") of a transcription factor or transcription factor
homologue polypeptide in a transgenic plant, e.g., to modify a
plant trait, can be obtained by introducing an antisense construct
corresponding to the polypeptide of interest as a cDNA. For
antisense suppression, the transcription factor or homologue cDNA
is arranged in reverse orientation (with respect to the coding
sequence) relative to the promoter sequence in the expression
vector. The introduced sequence need not be the full length cDNA or
gene, and need not be identical to the cDNA or gene found in the
plant type to be transformed. Typically, the antisense sequence
need only be capable of hybridizing to the target gene or RNA of
interest. Thus, where the introduced sequence is of shorter length,
a higher degree of homology to the endogenous transcription factor
sequence will be needed for effective antisense suppression. While
antisense sequences of various lengths can be utilized, preferably,
the introduced antisense sequence in the vector will be at least 30
nucleotides in length, and improved antisense suppression will
typically be observed as the length of the antisense sequence
increases. Preferably, the length of the antisense sequence in the
vector will be greater than 100 nucleotides. Transcription of an
antisense construct as described results in the production of RNA
molecules that are the reverse complement of mRNA molecules
transcribed from the endogenous transcription factor gene in the
plant cell.
[0224] Suppression of endogenous transcription factor gene
expression can also be achieved using a ribozyme. Ribozymes are RNA
molecules that possess highly specific endoribonuclease activity.
The production and use of ribozymes are disclosed in U.S. Pat. No.
4,987,071 and U.S. Pat. No. 5,543,508. Synthetic ribozyme sequences
including antisense RNAs can be used to confer RNA cleaving
activity on the antisense RNA, such that endogenous mRNA molecules
that hybridize to the antisense RNA are cleaved, which in turn
leads to an enhanced antisense inhibition of endogenous gene
expression.
[0225] Vectors in which RNA encoded by a transcription factor or
transcription factor homologue cDNA is over-expressed can also be
used to obtain co-suppression of a corresponding endogenous gene,
e.g., in the manner described in U.S. Pat. No. 5,231,020 to
Jorgensen. Such co-suppression (also termed sense suppression) does
not require that the entire transcription factor cDNA be introduced
into the plant cells, nor does it require that the introduced
sequence be exactly identical to the endogenous transcription
factor gene of interest. However, as with antisense suppression,
the suppressive efficiency will be enhanced as specificity of
hybridization is increased, e.g., as the introduced sequence is
lengthened, and/or as the sequence similarity between the
introduced sequence and the endogenous transcription factor gene is
increased.
[0226] Vectors expressing an untranslatable form of the
transcription factor mRNA, e.g., sequences comprising one or more
stop codon, or nonsense mutation) can also be used to suppress
expression of an endogenous transcription factor, thereby reducing
or eliminating its activity and modifying one or more traits.
Methods for producing such constructs are described in U.S. Pat.
No. 5,583,021. Preferably, such constructs are made by introducing
a premature stop codon into the transcription factor gene.
Alternatively, a plant trait can be modified by gene silencing
using double-strand RNA (Sharp (1999) Genes and Development 13:
139-141). Another method for abolishing the expression of a gene is
by insertion mutagenesis using the T-DNA of Agrobacterium
tumefaciens. After generating the insertion mutants, the mutants
can be screened to identify those containing the insertion in a
transcription factor or transcription factor homologue gene. Plants
containing a single transgene insertion event at the desired gene
can be crossed to generate homozygous plants for the mutation. Such
methods are well known to those of skill in the art. (See for
example Koncz et al. (1992) Methods in Arabidopsis Research, World
Scientific.)
[0227] Alternatively, a plant phenotype can be altered by
eliminating an endogenous gene, such as a transcription factor or
transcription factor homologue, e.g., by homologous recombination
(Kempin et al. (1997) Nature 389:802-803).
[0228] A plant trait can also be modified by using the Cre-lox
system (for example, as described in U.S. Pat. No. 5,658,772). A
plant genome can be modified to include first and second lox sites
that are then contacted with a Cre recombinase. If the lox sites
are in the same orientation, the intervening DNA sequence between
the two sites is excised. If the lox sites are in the opposite
orientation, the intervening sequence is inverted.
[0229] The polynucleotides and polypeptides of this invention can
also be expressed in a plant in the absence of an expression
cassette by manipulating the activity or expression level of the
endogenous gene by other means. For example, by ectopically
expressing a gene by T-DNA activation tagging (Ichikawa et al.
(1997) Nature 390 698-701; Kakimoto et al. (1996) Science 274:
982-985). This method entails transforming a plant with a gene tag
containing multiple transcriptional enhancers and once the tag has
inserted into the genome, expression of a flanking gene coding
sequence becomes deregulated. In another example, the
transcriptional machinery in a plant can be modified so as to
increase transcription levels of a polynucleotide of the invention
(See, e.g., PCT Publications WO 96/06166 and WO 98/53057 which
describe the modification of the DNA-binding specificity of zinc
finger proteins by changing particular amino acids in the
DNA-binding motif).
[0230] The transgenic plant can also include the machinery
necessary for expressing or altering the activity of a polypeptide
encoded by an endogenous gene, for example by altering the
phosphorylation state of the polypeptide to maintain it in an
activated state.
[0231] Transgenic plants (or plant cells, or plant explants, or
plant tissues) incorporating the polynucleotides of the invention
and/or expressing the polypeptides of the invention can be produced
by a variety of well established techniques as described above.
Following construction of a vector, most typically an expression
cassette, including a polynucleotide, e.g., encoding a
transcription factor or transcription factor homologue, of the
invention, standard techniques can be used to introduce the
polynucleotide into a plant, a plant cell, a plant explant or a
plant tissue of interest. Optionally, the plant cell, explant or
tissue can be regenerated to produce a transgenic plant.
[0232] The plant can be any higher plant, including gymnosperms,
monocotyledonous and dicotyledenous plants. Suitable protocols are
available for Leguminosae (alfalfa, soybean, clover, etc.),
Umbelliferae (carrot, celery, parsnip), Cruciferae (cabbage,
radish, rapeseed, broccoli, etc.), Curcurbitaceae (melons and
cucumber), Gramineae (wheat, corn, rice, barley, millet, etc.),
Solanaceae (potato, tomato, tobacco, peppers, etc.), and various
other crops. See protocols described in Ammirato et al. (1984)
Handbook of Plant Cell Culture--Crop Species, Macmillan Publ. Co.
Shimamoto et al. (1989) Nature 338:274-276; Fromm et al. (1990)
Bio/Technology 8:833-839; and Vasil et al. (1990) Bio/Technology
8:429-434.
[0233] Transformation and regeneration of both monocotyledonous and
dicotyledonous plant cells is now routine, and the selection of the
most appropriate transformation technique will be determined by the
practitioner. The choice of method will vary with the type of plant
to be transformed; those skilled in the art will recognize the
suitability of particular methods for given plant types. Suitable
methods can include, but are not limited to: electroporation of
plant protoplasts; liposome-mediated transformation; polyethylene
glycol (PEG) mediated transformation; transformation using viruses;
micro-injection of plant cells; micro-projectile bombardment of
plant cells; vacuum infiltration; and Agrobacterium tumefaciens
mediated transformation. Transformation means introducing a
nucleotide sequence into a plant in a manner to cause stable or
transient expression of the sequence.
[0234] Successful examples of the modification of plant
characteristics by transformation with cloned sequences which serve
to illustrate the current knowledge in this field of technology,
and which are herein incorporated by reference, include: U.S. Pat.
Nos. 5,571,706; 5,677,175; 5,510,471; 5,750,386; 5,597,945;
5,589,615; 5,750,871; 5,268,526; 5,780,708; 5,538,880; 5,773,269;
5,736,369 and 5,610,042.
[0235] Following transformation, plants are preferably selected
using a dominant selectable marker incorporated into the
transformation vector. Typically, such a marker will confer
antibiotic or herbicide resistance on the transformed plants, and
selection of transformants can be accomplished by exposing the
plants to appropriate concentrations of the antibiotic or
herbicide.
[0236] After transformed plants are selected and grown to maturity,
those plants showing a modified trait are identified. The modified
trait can be any of those traits described above. Additionally, to
confirm that the modified trait is due to changes in expression
levels or activity of the polypeptide or polynucleotide of the
invention can be determined by analyzing mRNA expression using
Northern blots, RT-PCR or microarrays, or protein expression using
immunoblots or Western blots or gel shift assays.
[0237] Integrated Systems--Sequence Identity. Additionally, the
present invention may be an integrated system, computer or computer
readable medium that comprises an instruction set for determining
the identity of one or more sequences in a database. In addition,
the instruction set can be used to generate or identify sequences
that meet any specified criteria. Furthermore, the instruction set
may be used to associate or link certain functional benefits, such
improved characteristics, with one or more identified sequence.
[0238] For example, the instruction set can include, e.g., a
sequence comparison or other alignment program, e.g., an available
program such as, for example, the Wisconsin Package Version 10.0,
such as BLAST, FASTA, PILEUP, FINDPATTERNS or the like (GCG,
Madison, Wis.). Public sequence databases such as GenBank, EMBL,
Swiss-Prot and PIR or private sequence databases such as PHYTOSEQ
sequence database (Incyte Genomics, Palo Alto, Calif.) can be
searched.
[0239] Alignment of sequences for comparison can be conducted by
the local homology algorithm of Smith and Waterman (1981) Adv.
Appl. Math. 2:482, by the homology alignment algorithm of Needleman
and Wunsch (1970) J. Mol. Biol. 48:443-453, by the search for
similarity method of Pearson and Lipman (1988) Proc. Natl. Acad.
Sci. U.S.A. 85:2444-2448, by computerized implementations of these
algorithms. After alignment, sequence comparisons between two (or
more) polynucleotides or polypeptides are typically performed by
comparing sequences of the two sequences over a comparison window
to identify and compare local regions of sequence similarity. The
comparison window can be a segment of at least about 20 contiguous
positions, usually about 50 to about 200, more usually about 100 to
about 150 contiguous positions. A description of the method is
provided in Ausubel et al., supra.
[0240] A variety of methods for determining sequence relationships
can be used, including manual alignment and computer assisted
sequence alignment and analysis. This later approach is a preferred
approach in the present invention, due to the increased throughput
afforded by computer assisted methods. As noted above, a variety of
computer programs for performing sequence alignment are available,
or can be produced by one of skill.
[0241] One example algorithm that is suitable for determining
percent sequence identity and sequence similarity is the BLAST
algorithm, which is described in Altschul et al. J. Mol. Biol.
215:403-410 (1990). Software for performing BLAST analyses is
publicly available, e.g., through the National Center for
Biotechnology Information (see internet website at
ncbi.nlm.nih.gov). This algorithm involves first identifying high
scoring sequence pairs (HSPs) by identifying short words of length
W in the query sequence, which either match or satisfy some
positive-valued threshold score T when aligned with a word of the
same length in a database sequence. T is referred to as the
neighborhood word score threshold (Altschul et al., supra). These
initial neighborhood word hits act as seeds for initiating searches
to find longer HSPs containing them. The word hits are then
extended in both directions along each sequence for as far as the
cumulative alignment score can be increased. Cumulative scores are
calculated using, for nucleotide sequences, the parameters M
(reward score for a pair of matching residues; always >0) and N
(penalty score for mismatching residues; always <0). For amino
acid sequences, a scoring matrix is used to calculate the
cumulative score. Extension of the word hits in each direction are
halted when: the cumulative alignment score falls off by the
quantity X from its maximum achieved value; the cumulative score
goes to zero or below, due to the accumulation of one or more
negative-scoring residue alignments; or the end of either sequence
is reached. The BLAST algorithm parameters W, T, and X determine
the sensitivity and speed of the alignment. The BLASTN program (for
nucleotide sequences) uses as defaults a wordlength (W) of 11, an
expectation (E) of 10, a cutoff of 100, M=5, N=-4, and a comparison
of both strands. For amino acid sequences, the BLASTP program uses
as defaults a wordlength (W) of 3, an expectation (E) of 10, and
the BLOSUM62 scoring matrix (see Henikoff & Henikoff (1989)
Proc. Natl. Acad. Sci. USA 89:10915). Unless otherwise indicated,
"sequence identity" here refers to the % sequence identity
generated from a tblastx using the NCBI version of the algorithm at
the default settings using gapped alignments with the filter "off"
(see, for example, internet website at ncbi.nlm.nih.gov).
[0242] In addition to calculating percent sequence identity, the
BLAST algorithm also performs a statistical analysis of the
similarity between two sequences (see, e.g., Karlin & Altschul
(1993) Proc. Natl. Acad. Sci. USA 90:5873-5787). One measure of
similarity provided by the BLAST algorithm is the smallest sum
probability (P(N)), which provides an indication of the probability
by which a match between two nucleotide or amino acid sequences
would occur by chance. For example, a nucleic acid is considered
similar to a reference sequence (and, therefore, in this context,
homologous) if the smallest sum probability in a comparison of the
test nucleic acid to the reference nucleic acid is less than about
0.1, or less than about 0.01, and or even less than about 0.001. An
additional example of a useful sequence alignment algorithm is
PILEUP. PILEUP creates a multiple sequence alignment from a group
of related sequences using progressive, pairwise alignments. The
program can align, e.g., up to 300 sequences of a maximum length of
5,000 letters.
[0243] The integrated system, or computer typically includes a user
input interface allowing a user to selectively view one or more
sequence records corresponding to the one or more character
strings, as well as an instruction set which aligns the one or more
character strings with each other or with an additional character
string to identify one or more region of sequence similarity. The
system may include a link of one or more character strings with a
particular phenotype or gene function. Typically, the system
includes a user readable output element that displays an alignment
produced by the alignment instruction set.
[0244] The methods of this invention can be implemented in a
localized or distributed computing environment. In a distributed
environment, the methods may implemented on a single computer
comprising multiple processors or on a multiplicity of computers.
The computers can be linked, e.g. through a common bus, but more
preferably the computer(s) are nodes on a network. The network can
be a generalized or a dedicated local or wide-area network and, in
certain preferred embodiments, the computers may be components of
an intra-net or an internet.
[0245] Thus, the invention provides methods for identifying a
sequence similar or homologous to one or more polynucleotides as
noted herein, or one or more target polypeptides encoded by the
polynucleotides, or otherwise noted herein and may include linking
or associating a given plant phenotype or gene function with a
sequence. In the methods, a sequence database is provided (locally
or across an inter or intra net) and a query is made against the
sequence database using the relevant sequences herein and
associated plant phenotypes or gene functions.
[0246] Any sequence herein can be entered into the database, before
or after querying the database. This provides for both expansion of
the database and, if done before the querying step, for insertion
of control sequences into the database. The control sequences can
be detected by the query to ensure the general integrity of both
the database and the query. As noted, the query can be performed
using a web browser based interface. For example, the database can
be a centralized public database such as those noted herein, and
the querying can be done from a remote terminal or computer across
an internet or intranet.
EXAMPLES
[0247] It is to be understood that this invention is not limited to
the particular devices, machines, materials and methods described.
Although particular embodiments are described, equivalent
embodiments may be used to practice the invention.
[0248] The invention, now being generally described, will be more
readily understood by reference to the following examples, which
are included merely for purposes of illustration of certain aspects
and embodiments of the present invention and are not intended to
limit the invention. The complete descriptions of the traits
associated with each polynucleotide of the invention is fully
disclosed in Table 4 and Table 6. It will be recognized by one of
skill in the art that a polypeptide that is associated with a
particular first trait may also be associated with at least one
other, unrelated and inherent second trait which was not predicted
by the first trait.
Example I
Full Length Gene Identification and Cloning
[0249] Putative transcription factor sequences (genomic or ESTs)
related to known transcription factors were identified in the
Arabidopsis thaliana GenBank database using the tblastn sequence
analysis program using default parameters and a P-value cutoff
threshold of -4 or -5 or lower, depending on the length of the
query sequence. Putative transcription factor sequence hits were
then screened to identify those containing particular sequence
strings. If the sequence hits contained such sequence strings, the
sequences were confirmed as transcription factors.
[0250] Alternatively, Arabidopsis thaliana cDNA libraries derived
from different tissues or treatments, or genomic libraries were
screened to identify novel members of a transcription family using
a low stringency hybridization approach. Probes were synthesized
using gene specific primers in a standard PCR reaction (annealing
temperature 60.degree. C.) and labeled with .sup.32P dCTP using the
High Prime DNA Labeling Kit (Boehringer Mannheim). Purified
radiolabelled probes were added to filters immersed in Church
hybridization medium (0.5 M NaPO.sub.4 pH 7.0, 7% SDS, 1% w/v
bovine serum albumin) and hybridized overnight at 60.degree. C.
with shaking. Filters were washed two times for 45 to 60 minutes
with 1.times.SCC, 1% SDS at 60.degree. C.
[0251] To identify additional sequence 5' or 3' of a partial cDNA
sequence in a cDNA library, 5' and 3' rapid amplification of cDNA
ends (RACE) was performed using the Marathon.TM. cDNA amplification
kit (Clontech, Palo Alto, Calif.). Generally, the method entailed
first isolating poly(A) mRNA, performing first and second strand
cDNA synthesis to generate double stranded cDNA, blunting cDNA
ends, followed by ligation of the Marathon.TM. Adaptor to the cDNA
to form a library of adaptor-ligated ds cDNA.
[0252] Gene-specific primers were designed to be used along with
adaptor specific primers for both 5' and 3' RACE reactions. Nested
primers, rather than single primers, were used to increase PCR
specificity. Using 5' and 3' RACE reactions, 5' and 3' RACE
fragments were obtained, sequenced and cloned. The process can be
repeated until 5' and 3' ends of the full-length gene were
identified. Then the full-length cDNA was generated by PCR using
primers specific to 5' and 3' ends of the gene by end-to-end
PCR.
Example II
Construction of Expression Vectors
[0253] The sequence was amplified from a genomic or cDNA library
using primers specific to sequences upstream and downstream of the
coding region. The expression vector was pMEN20 or pMEN65, which
are both derived from pMON316 (Sanders et al, (1987) Nucleic Acids
Research 15:1543-1558) and contain the CaMV 35S promoter to express
transgenes. To clone the sequence into the vector, both pMEN20 and
the amplified DNA fragment were digested separately with SalI and
NotI restriction enzymes at 37.degree. C. for 2 hours. The
digestion products were subject to electrophoresis in a 0.8%
agarose gel and visualized by ethidium bromide staining. The DNA
fragments containing the sequence and the linearized plasmid were
excised and purified by using a Qiaquick gel extraction kit
(Qiagen, Valencia Calif.). The fragments of interest were ligated
at a ratio of 3:1 (vector to insert). Ligation reactions using T4
DNA ligase (New England Biolabs, Beverly Mass.) were carried out at
16.degree. C. for 16 hours. The ligated DNAs were transformed into
competent cells of the E. coli strain DHSalpha by using the heat
shock method. The transformations were plated on LB plates
containing 50 mg/l kanamycin (Sigma, St. Louis, Mo.). Individual
colonies were grown overnight in five milliliters of LB broth
containing 50 mg/l kanamycin at 37.degree. C. Plasmid DNA was
purified by using Qiaquick Mini Prep kits (Qiagen).
Example III
Transformation of Agrobacterium with the Expression Vector
[0254] After the expression constructs are generated, the
constructs are used to transform Agrobacterium tumefaciens cells
expressing the gene products. The stock of Agrobacterium
tumefaciens cells for transformation is made as described by Nagel
et al. (1990) FEMS Microbiol Letts. 67: 325-328. Agrobacterium
strain ABI is grown in 250 ml LB medium (Sigma) overnight at
28.degree. C. with shaking until an absorbance over 1 cm at 600 nm
(A.sub.600) of 0.5-1.0 is reached. Cells are harvested by
centrifugation at 4,000.times.g for 15 min at 4.degree. C. Cells
are then resuspended in 250 .mu.l chilled buffer (1 mM HEPES, pH
adjusted to 7.0 with KOH). Cells are centrifuged again as described
above and resuspended in 125 .mu.l chilled buffer. Cells are then
centrifuged and resuspended two more times in the same HEPES buffer
as described above at a volume of 100 .mu.l and 750 .mu.l,
respectively. Resuspended cells are then distributed into 40 .mu.l
aliquots, quickly frozen in liquid nitrogen, and stored at
-80.degree. C.
[0255] Agrobacterium cells are transformed with constructs prepared
as described above following the protocol described by Nagel et al.
(supra). For each DNA construct to be transformed, 50-100 ng DNA
(generally resuspended in 10 mM Tris-HCl, 1 mM EDTA, pH 8.0) is
mixed with 40 .mu.l of Agrobacterium cells. The DNA/cell mixture is
then transferred to a chilled cuvette with a 2 mm electrode gap and
subject to a 2.5 kV charge dissipated at 25 .mu.F and 200 .mu.F
using a Gene Pulser II apparatus (Bio-Rad, Hercules, Calif.). After
electroporation, cells are immediately resuspended in 1.0 ml LB and
allowed to recover without antibiotic selection for 2-4 hours at
28.degree. C. in a shaking incubator. After recovery, cells are
plated onto selective medium of LB broth containing 100 .mu.g/ml
spectinomycin (Sigma ChemCo., St. Louis, Mo.) and incubated for
24-48 hours at 28.degree. C. Single colonies are then picked and
inoculated in fresh medium. The presence of the plasmid construct
is verified by PCR amplification and sequence analysis.
Example IV
Transformation of Arabidopsis Plants with Agrobacterium tumefaciens
with Expression Vector
[0256] After transformation of Agrobacterium tumefaciens with
plasmid vectors containing the gene, single Agrobacterium colonies
were identified, propagated, and used to transform Arabidopsis
plants. Briefly, 500 ml cultures of LB medium containing 50 mg/l
kanamycin were inoculated with the colonies and grown at 28.degree.
C. with shaking for 2 days until an optical absorbance at 600 nm
wavelength over 1 cm (A.sub.600) of >2.0 is reached. Cells were
then harvested by centrifugation at 4,000.times.g for 10 min, and
resuspended in infiltration medium (1/2.times. Murashige and Skoog
salts (Sigma), 1.times. Gamborg's B-5 vitamins (Sigma), 5.0% (w/v)
sucrose (Sigma), 0.044 .mu.M benzylamino purine (Sigma), 200
.mu.l/l Silwet L-77 (Lehle Seeds) until an A.sub.600 of 0.8 was
reached.
[0257] Prior to transformation, Arabidopsis thaliana seeds (ecotype
Columbia) were sown at a density of .about.10 plants per 4'' pot
onto Pro-Mix BX potting medium (Hummert International) covered with
fiberglass mesh (18 mm.times.16 mm) Plants were grown under
continuous illumination (50-75 .mu.E/m.sup.2/sec) at 22-23.degree.
C. with 65-70% relative humidity. After about 4 weeks, primary
inflorescence stems (bolts) are cut off to encourage growth of
multiple secondary bolts. After flowering of the mature secondary
bolts, plants were prepared for transformation by removal of all
siliques and opened flowers.
[0258] The pots were then immersed upside down in the mixture of
Agrobacterium infiltration medium as described above for 30 sec,
and placed on their sides to allow draining into a 1'.times.2' flat
surface covered with plastic wrap. After 24 h, the plastic wrap was
removed and pots are turned upright. The immersion procedure was
repeated one week later, for a total of two immersions per pot.
Seeds were then collected from each transformation pot and analyzed
following the protocol described below.
Example V
Identification of Arabidopsis Primary Transformants
[0259] Seeds collected from the transformation pots were sterilized
essentially as follows. Seeds were dispersed into in a solution
containing 0.1% (v/v) Triton X-100 (Sigma) and sterile H.sub.2O and
washed by shaking the suspension for 20 min. The wash solution was
then drained and replaced with fresh wash solution to wash the
seeds for 20 min with shaking. After removal of the second wash
solution, a solution containing 0.1% (v/v) Triton X-100 and 70%
ethanol (Equistar) was added to the seeds and the suspension was
shaken for 5 min. After removal of the ethanol/detergent solution,
a solution containing 0.1% (v/v) Triton X-100 and 30% (v/v) bleach
(Clorox) was added to the seeds, and the suspension was shaken for
10 min. After removal of the bleach/detergent solution, seeds were
then washed five times in sterile distilled H.sub.2O. The seeds
were stored in the last wash water at 4.degree. C. for 2 days in
the dark before being plated onto antibiotic selection medium
(1.times. Murashige and Skoog salts (pH adjusted to 5.7 with 1M
KOH), 1.times. Gamborg's B-5 vitamins, 0.9% phytagar (Life
Technologies), and 50 mg/l kanamycin). Seeds were germinated under
continuous illumination (50-75 .mu.E/m.sup.2/sec) at 22-23.degree.
C. After 7-10 days of growth under these conditions, kanamycin
resistant primary transformants (T.sub.i generation) were visible
and obtained. These seedlings were transferred first to fresh
selection plates where the seedlings continued to grow for 3-5 more
days, and then to soil (Pro-Mix BX potting medium).
[0260] Primary transformants were crossed and progeny seeds
(T.sub.2) collected; kanamycin resistant seedlings were selected
and analyzed. The expression levels of the recombinant
polynucleotides in the transformants varies from about a 5%
expression level increase to a least a 100% expression level
increase. Similar observations are made with respect to polypeptide
level expression.
Example VI
Identification of Arabidopsis Plants with Transcription Factor Gene
Knockouts
[0261] The screening of insertion mutagenized Arabidopsis
collections for null mutants in a known target gene was essentially
as described in Krysan et al (1999) Plant Cell 11:2283-2290.
Briefly, gene-specific primers, nested by 5-250 base pairs to each
other, were designed from the 5' and 3' regions of a known target
gene. Similarly, nested sets of primers were also created specific
to each of the T-DNA or transposon ends (the "right" and "left"
borders). All possible combinations of gene specific and
T-DNA/transposon primers were used to detect by PCR an insertion
event within or close to the target gene. The amplified DNA
fragments were then sequenced which allows the precise
determination of the T-DNA/transposon insertion point relative to
the target gene. Insertion events within the coding or intervening
sequence of the genes were deconvoluted from a pool comprising a
plurality of insertion events to a single unique mutant plant for
functional characterization. The method is described in more detail
in Yu and Adam, U.S. application Ser. No. 09/177,733 filed Oct. 23,
1998.
Example VII
Identification of Modified Phenotypes in Overexpression or Gene
Knockout Plants
[0262] Experiments were performed to identify those transformants
or knockouts that exhibited modified biochemical characteristics.
Among the biochemicals that were assayed were insoluble sugars,
such as arabinose, fucose, galactose, mannose, rhamnose or xylose
or the like; prenyl lipids, such as lutein, beta-carotene,
xanthophyll-1, xanthophyll-2, chlorophylls A or B, or alpha-,
delta- or gamma-tocopherol or the like; fatty acids, such as 16:0
(palmitic acid), 16:1 (palmitoleic acid), 18:0 (stearic acid), 18:1
(oleic acid), 18:2 (linoleic acid), 20:0, 18:3 (linolenic acid),
20:1 (eicosenoic acid), 20:2, 22:1 (erucic acid) or the like;
waxes, such as by altering the levels of C29, C31, or C33 alkanes;
sterols, such as brassicasterol, campesterol, stigmasterol,
sitosterol or stigmastanol or the like, glucosinolates, protein or
oil levels.
[0263] Fatty acids were measured using two methods depending on
whether the tissue was from leaves or seeds. For leaves, lipids
were extracted and esterified with hot methanolic H.sub.2SO.sub.4
and partitioned into hexane from methanolic brine. For seed fatty
acids, seeds were pulverized and extracted in
methanol:heptane:toluene:2,2-dimethoxypropane:H.sub.2 SO.sub.4
(39:34:20:5:2) for 90 minutes at 80.degree. C. After cooling to
room temperature the upper phase, containing the seed fatty acid
esters, was subjected to GC analysis. Fatty acid esters from both
seed and leaf tissues were analyzed with a Supelco SP-2330
column.
[0264] Glucosinolates were purified from seeds or leaves by first
heating the tissue at 95.degree. C. for 10 minutes. Preheated
ethanol:water (50:50) is and after heating at 95.degree. C. for a
further 10 minutes, the extraction solvent is applied to a DEAE
Sephadex column which had been previously equilibrated with 0.5 M
pyridine acetate. Desulfoglucosinolates were eluted with 300 ul
water and analyzed by reverse phase HPLC monitoring at 226 nm.
[0265] For wax alkanes, samples were extracted using an identical
method as fatty acids and extracts were analyzed on a HP 5890 GC
coupled with a 5973 MSD. Samples were chromatographically isolated
on a J&W DB35 mass spectrometer (J&W Scientific).
[0266] To measure prenyl lipids levels, seeds or leaves were
pulverized with 1 to 2% pyrogallol as an antioxidant. For seeds,
extracted samples were filtered and a portion removed for
tocopherol and carotenoid/chlorophyll analysis by HPLC. The
remaining material was saponified for sterol determination. For
leaves, an aliquot was removed and diluted with methanol and
chlorophyll A, chlorophyll B, and total carotenoids measured by
spectrophotometry by determining optical absorbance at 665.2 nm,
652.5 nm, and 470 nm. An aliquot was removed for tocopherol and
carotenoid/chlorophyll composition by HPLC using a Waters uBondapak
C18 column (4.6 mm.times.150 mm) The remaining methanolic solution
was saponified with 10% KOH at 80.degree. C. for one hour. The
samples were cooled and diluted with a mixture of methanol and
water. A solution of 2% methylene chloride in hexane was mixed in
and the samples were centrifuged. The aqueous methanol phase was
again re-extracted 2% methylene chloride in hexane and, after
centrifugation, the two upper phases were combined and evaporated.
2% methylene chloride in hexane was added to the tubes and the
samples were then extracted with one ml of water. The upper phase
was removed, dried, and resuspended in 400 ul of 2% methylene
chloride in hexane and analyzed by gas chromatography using a 50 m
DB-5 ms (0.25 mm ID, 0.25 um phase, J&W Scientific).
[0267] Insoluble sugar levels were measured by the method
essentially described by Reiter et al. (1999), Plant Journal
12:335-345. This method analyzes the neutral sugar composition of
cell wall polymers found in Arabidopsis leaves. Soluble sugars were
separated from sugar polymers by extracting leaves with hot 70%
ethanol. The remaining residue containing the insoluble
polysaccharides was then acid hydrolyzed with allose added as an
internal standard. Sugar monomers generated by the hydrolysis were
then reduced to the corresponding alditols by treatment with NaBH4,
then were acetylated to generate the volatile alditol acetates
which were then analyzed by GC-FID. Identity of the peaks was
determined by comparing the retention times of known sugars
converted to the corresponding alditol acetates with the retention
times of peaks from wild-type plant extracts. Alditol acetates were
analyzed on a Supelco SP-2330 capillary column (30 m.times.250
um.times.0.2 um) using a temperature program beginning at
180.degree. C. for 2 minutes followed by an increase to 220.degree.
C. in 4 minutes. After holding at 220.degree. C. for 10 minutes,
the oven temperature is increased to 240.degree. C. in 2 minutes
and held at this temperature for 10 minutes and brought back to
room temperature.
[0268] To identify plants with alterations in total seed oil or
protein content, 150 mg of seeds from T2 progeny plants were
subjected to analysis by Near Infrared Reflectance Spectroscopy
(NIRS) using a Foss NirSystems Model 6500 with a spinning cup
transport system. NIRS is a non-destructive analytical method used
to determine seed oil and protein composition. Infrared is the
region of the electromagnetic spectrum located after the visible
region in the direction of longer wavelengths. `Near infrared` owns
its name for being the infrared region near to the visible region
of the electromagnetic spectrum. For practical purposes, near
infrared comprises wavelengths between 800 and 2500 nm. NIRS is
applied to organic compounds rich in O--H bonds (such as moisture,
carbohydrates, and fats), C--H bonds (such as organic compounds and
petroleum derivatives), and N--H bonds (such as proteins and amino
acids). The NIRS analytical instruments operate by statistically
correlating NIRS signals at several wavelengths with the
characteristic or property intended to be measured. All biological
substances contain thousands of C--H, O--H, and N--H bonds.
Therefore, the exposure to near infrared radiation of a biological
sample, such as a seed, results in a complex spectrum which
contains qualitative and quantitative information about the
physical and chemical composition of that sample.
[0269] The numerical value of a specific analyte in the sample,
such as protein content or oil content, is mediated by a
calibration approach known as chemometrics. Chemometrics applies
statistical methods such as multiple linear regression (MLR),
partial least squares (PLS), and principle component analysis (PCA)
to the spectral data and correlates them with a physical property
or other factor, that property or factor is directly determined
rather than the analyte concentration itself. The method first
provides "wet chemistry" data of the samples required to develop
the calibration.
[0270] Calibration for Arabidopsis seed oil composition was
performed using accelerated solvent extraction using 1 g seed
sample size and was validated against certified canola seed. A
similar wet chemistry approach was performed for seed protein
composition calibration.
[0271] Data obtained from NIRS analysis was analyzed statistically
using a nearest-neighbor (N--N) analysis. The N--N analysis allows
removal of within-block spatial variability in a fairly flexible
fashion which does not require prior knowledge of the pattern of
variability in the chamber. Ideally, all hybrids are grown under
identical experimental conditions within a block (rep). In reality,
even in many block designs, significant within-block variability
exists. Nearest-neighbor procedures are based on assumption that
environmental effect of a plot is closely related to that of its
neighbors. Nearest-neighbor methods use information from adjacent
plots to adjust for within-block heterogeneity and so provide more
precise estimates of treatment means and differences. If there is
within-plot heterogeneity on a spatial scale that is larger than a
single plot and smaller than the entire block, then yields from
adjacent plots will be positively correlated. Information from
neighboring plots can be used to reduce or remove the unwanted
effect of the spatial heterogeneity, and hence improve the estimate
of the treatment effect. Data from neighboring plots can also be
used to reduce the influence of competition between adjacent plots.
The Papadakis N--N analysis can be used with designs to remove
within-block variability that would not be removed with the
standard split plot analysis (Papadakis, 1973, Inst. d'Amelior.
Plantes Thessaloniki (Greece) Bull. Scientif, No. 23; Papadakis,
1984, Proc. Acad. Athens, 59, 326-342).
[0272] Experiments were performed to identify those transformants
or knockouts that exhibited an improved pathogen tolerance. For
such studies, the transformants were exposed to biotropic fungal
pathogens, such as Erysiphe orontii, and necrotropic fungal
pathogens, such as Fusarium oxysporum. Fusarium oxysporum isolates
cause vascular wilts and damping off of various annual vegetables,
perennials and weeds (Mauch-Mani and Slusarenko (1994) Molecular
Plant-Microbe Interactions 7: 378-383). For Fusarium oxysporum
experiments, plants grown on Petri dishes were sprayed with a fresh
spore suspension of F. oxysporum. The spore suspension was prepared
as follows: A plug of fungal hyphae from a plate culture was placed
on a fresh potato dextrose agar plate and allowed to spread for one
week. 5 ml sterile water was then added to the plate, swirled, and
pipetted into 50 ml Armstrong Fusarium medium. Spores were grown
overnight in Fusarium medium and then sprayed onto plants using a
Preval paint sprayer. Plant tissue was harvested and frozen in
liquid nitrogen 48 hours post infection.
[0273] Erysiphe orontii is a causal agent of powdery mildew. For
Erysiphe orontii experiments, plants were grown approximately 4
weeks in a greenhouse under 12 hour light (20.degree. C., .+-.30%
relative humidity (rh)). Individual leaves were infected with E.
orontii spores from infected plants using a camel's hair brush, and
the plants were transferred to a Percival growth chamber
(20.degree. C., 80% rh.). Plant tissue was harvested and frozen in
liquid nitrogen 7 days post infection.
[0274] Botrytis cinerea is a necrotrophic pathogen. Botrytis
cinerea was grown on potato dextrose agar in the light. A spore
culture was made by spreading 10 ml of sterile water on the fungus
plate, swirling and transferring spores to 10 ml of sterile water.
The spore inoculum (approx. 105 spores/ml) was used to spray 10
day-old seedlings grown under sterile conditions on MS (minus
sucrose) media. Symptoms were evaluated every day up to
approximately 1 week.
[0275] Infection with bacterial pathogens Pseudomonas syringae pv
maculicola (Psm) strain 4326 and pv maculicola strain 4326 was
performed by hand inoculation at two doses. Two inoculation doses
allows the differentiation between plants with enhanced
susceptibility and plants with enhanced resistance to the pathogen.
Plants were grown for 3 weeks in the greenhouse, then transferred
to the growth chamber for the remainder of their growth. Psm ES4326
was hand inoculated with 1 ml syringe on 3 fully-expanded leaves
per plant (41/2 wk old), using at least 9 plants per overexpressing
line at two inoculation doses, OD=0.005 and OD=0.0005. Disease
scoring occurred at day 3 post-inoculation with pictures of the
plants and leaves taken in parallel.
[0276] In some instances, expression patterns of the
pathogen-induced genes (such as defense genes) was monitored by
microarray experiments. cDNAs were generated by PCR and resuspended
at a final concentration of .about.100 ng/ul in 3.times.SSC or 150
mM Na-phosphate (Eisen and Brown (1999) Methods Enzymol.
303:179-205). The cDNAs were spotted on microscope glass slides
coated with polylysine. The prepared cDNAs were aliquoted into 384
well plates and spotted on the slides using an x-y-z gantry
(OmniGrid) purchased from GeneMachines (Menlo Park, Calif.)
outfitted with quill type pins purchased from Telechem
International (Sunnyvale, Calif.). After spotting, the arrays were
cured for a minimum of one week at room temperature, rehydrated and
blocked following the protocol recommended by Eisen and Brown
(1999; supra).
[0277] Sample total RNA (10 ug) samples were labeled using
fluorescent Cy3 and Cy5 dyes. Labeled samples were resuspended in
4.times.SSC/0.03% SDS/4 ug salmon sperm DNA/2 ug tRNA/50 mM
Na-pyrophosphate, heated for 95.degree. C. for 2.5 minutes, spun
down and placed on the array. The array was then covered with a
glass coverslip and placed in a sealed chamber. The chamber was
then kept in a water bath at 62.degree. C. overnight. The arrays
were washed as described in Eisen and Brown (1999) and scanned on a
General Scanning 3000 laser scanner. The resulting files are
subsequently quantified using Imagene, a software purchased from
BioDiscovery (Los Angeles, Calif.).
[0278] Experiments were performed to identify those transformants
or knockouts that exhibited an improved environmental stress
tolerance. For such studies, the transformants were exposed to a
variety of environmental stresses. Plants were exposed to chilling
stress (6 hour exposure to 4-8.degree. C.)., heat stress (6 hour
exposure to 32-37.degree. C.), high salt stress (6 hour exposure to
200 mM NaCl (or 150 mM NaCl if the latter is indicated below),
dehydrwater deficit stress (168 hours after removing water from
watering trays, or, alternatively, watering was withheld and pots
were placed on absorbent paper for a period of 8-10 days to apply a
drought treatment), hyperosmotic stress (6 hour exposure to 3 M
mannitol, or tolerance to 150 mM NaCl and 9.4% sucrose), or
nutrient limitation (nitrogen, phosphate, and potassium) (Nitrogen:
all components of MS medium remained constant except N was reduced
to 20 mg/l of NH.sub.4NO.sub.3, or Phosphate: All components of MS
medium except KH.sub.2PO.sub.4, which was replaced by
K.sub.2SO.sub.4, Potassium: All components of MS medium except
removal of KNO.sub.3 and KH.sub.2PO.sub.4, which were replaced by
NaH.sub.4PO.sub.4).
[0279] Experiments were performed to identify those transformants
or knockouts that exhibited a modified structure and development
characteristics. For such studies, the transformants were observed
by eye to identify novel structural or developmental
characteristics associated with the ectopic expression of the
polynucleotides or polypeptides of the invention.
[0280] Experiments were performed to identify those transformants
or knockouts that exhibited modified sugar-sensing. For such
studies, seeds from transformants were germinated on media
containing 5% glucose or 9.4% sucrose which normally partially
restrict hypocotyl elongation. Plants with altered sugar sensing
may have either longer or shorter hypocotyls than normal plants
when grown on this media. Additionally, other plant traits may be
varied such as root mass.
[0281] Flowering time was measured by the number of rosette leaves
present when a visible inflorescence of approximately 3 cm is
apparent Rosette and total leaf number on the progeny stem are
tightly correlated with the timing of flowering (Koornneef et al
(1991) Mol. Gen. Genet. 229:57-66. The vernalization response was
measured. For vernalization treatments, seeds were sown to MS agar
plates, sealed with micropore tape, and placed in a 4.degree. C.
cold room with low light levels for 6-8 weeks. The plates were then
transferred to the growth rooms alongside plates containing freshly
sown non-vernalized controls. Rosette leaves were counted when a
visible inflorescence of approximately 3 cm was apparent.
[0282] Modified phenotypes observed for particular overexpressor or
knockout plants are provided in Table 4. For a particular
overexpressor that shows a less beneficial characteristic, it may
be more useful to select a plant with a decreased expression of the
particular transcription factor. For a particular knockout that
shows a less beneficial characteristic, it may be more useful to
select a plant with an increased expression of the particular
transcription factor.
[0283] The sequences of the Sequence Listing or those in Tables 4
or 5 or those disclosed here can be used to prepare transgenic
plants and plants with altered traits. The specific transgenic
plants listed below are produced from the sequences of the Sequence
Listing, as noted. Table 4 provides exemplary polynucleotide and
polypeptide sequences of the invention. Table 4 includes, from left
to right for each sequence: the first column shows the
polynucleotide SEQ ID NO; the second column shows the Mendel Gene
ID No., GID; the third column shows the trait(s) resulting from the
knock out or overexpression of the polynucleotide in the transgenic
plant; the fourth column shows the category of the trait; the fifth
column shows the transcription factor family to which the
polynucleotide belongs; the sixth column ("Comment"), includes
specific effects and utilities conferred by the polynucleotide of
the first column; the seventh column shows the SEQ ID NO of the
polypeptide encoded by the polynucleotide; and the eighth column
shows the amino acid residue positions of the conserved domain in
amino acid (AA) co-ordinates.
[0284] G720: The complete sequence of G720 (SEQ ID NO: 25); similar
to a portion of APRR2, Arabidopsis pseudo-response regulator
(APRR2; Makino et al. 2000 Plant Cell Physiol. 41:791-803) was
determined A line homozygous for a T-DNA insertion in G720 and
lines overexpressing G720 under the 35S promoter were used to
determine the function of this gene. The T-DNA insertion in G720
was approximately half-way into the coding sequence, just before
the conserved domain, and therefore should result in a null
mutation. G720 knockout mutants were slightly more sensitive to
freezing than the wild-type controls when the seedlings were
cold-acclimated prior to freezing. G720 overexpressing lines were
slightly more tolerant to freezing. When seedlings were frozen at
-10.degree. C. for 20 hours, the G720 plants recovered slightly
better compared to the wild-type control in two separate
experiments. G720 was induced by ABA, salt, osmotic stress,
drought, heat, and auxin. The combination of enhanced sensitivity
to freezing in the knockout mutants, enhanced resistance in the
overexpressing lines, and the induction pattern of G720 comprised
strong evidence that G720 functions in regulation of dehydration
tolerance, as freezing is a form of dehydration stress.
[0285] Plants overexpressing G720 also showed reduced time to
flowering in the T1 generation. One third of the 35S::G720 T1
seedlings, from each of two separate batches, flowered markedly
earlier (up to 1 week sooner, 24-hour light conditions) than
controls plants. All of the T1 lines showed high levels of G720
overexpression (determined by RT-PCR). Three early flowering T1
plants were selected for further study. However, none of these
lines flowered early in the T2, suggesting that activity of the
transgene might have been reduced between the generations
Closely Related Genes from Other Species
[0286] G720 showed significant similarity to a drought-induced M.
truncatula EST, GenBank accession number BG450227, that encodes a
pseudo-receiver domain. The sequence similarity is high enough to
suggest that the two proteins are orthologs, and the fact that G720
was also drought-induced is consistent with this hypothesis. Other
ESTs from tomato and potato (BG642566, BG128919, BG129142, and
BG887673) also showed high similarity to G720 and represent
potential orthologs.
[0287] G1792: G1792 (SEQ ID NO: 45) was studied using transgenic
plants in which the gene was expressed under the control of the 35S
promoter. 35S::G1792 plants were more tolerant to the fungal
pathogens Fusarium oxysporum and Botrytis cinerea and showed fewer
symptoms after inoculation with a low dose of each pathogen. This
result was confirmed using individual T2 lines. The effect of G1792
overexpression in increasing tolerance to pathogens received
further, incidental confirmation. T2 plants of 35S::G1792 lines 5
and 12 had been growing in a room that suffered a serious powdery
mildew infection. For each line, a pot of 6 plants was present in a
flat containing 9 other pots of lines from unrelated genes. In
either of the two different flats, the only plants that were free
from infection were those from the 35S::G1792 line. This
observation suggests that G1792 overexpression might increase
resistance to powdery mildew. Additional experiments confirmed that
35S::G1792 plants showed increased tolerance to Erysiphe. G1792 was
ubiquitously expressed, but appears to be induced by salicylic
acid.
[0288] 35S::G1792 overexpressing plants also showed more tolerance
to growth under nitrogen-limiting conditions. In a root growth
assay under conditions of limiting N, 35S::G1792 lines were
slightly less stunted. In a germination assay that monitors the
effect of C on N signaling through anthocyanin production on high
sucrose plus and minus glutamine the 35S::G1792 lines make less
anthocyanin on high sucrose plus glutamine, suggesting that the
gene can be involved in the plants ability to monitor their carbon
and nitrogen status.
[0289] G1792 overexpressing plants showed several mild
morphological alterations: leaves were dark green and shiny, and
plants bolted, subsequently senesced, slightly later than wild-type
controls. Among the T1 plants, additional morphological variation
(not reproduced later in the T2 plants) was observed: many showed
reductions in size as well as aberrations in leaf shape,
phyllotaxy, and flower development.
Closely Related Genes from Other Species
[0290] G1792 shows sequence similarity, outside the conserved AP2
domain, with a portion of a predicted protein from tomato,
represented by EST sequence AI776626 (AI776626 EST257726 tomato
resistant, Cornell Lycopersicon esculentum cDNA clone cLER19A14,
mRNA sequence).
[0291] G1756: G1756 (SEQ ID NO:175) was studied using transgenic
plants in which the gene was expressed under the control of the 35S
promoter. Overexpression of G1756 caused alterations in plant
growth and development, reducing overall plant size and fertility.
In addition, 35S::G1756 overexpressing lines show more disease
symptoms following inoculation with a low dose of the fungal
pathogen Botrytis cinerea compared to the wild-type controls. G1756
was ubiquitously expressed and transcript levels were altered by a
variety of environmental or physiological conditions; G1756
expression can be induced by auxin, cold, and Fusarium.
Closely Related Genes from Other Species
[0292] G1756 shows some sequence similarity with known genes from
other plant species within the conserved WRKY domain.
[0293] G481: Northern blot data from five different tissue samples
indicates that G481 (SEQ ID NO: 113) was primarily expressed in
flower and/or silique, and root tissue. G481 was analyzed through
its ectopic overexpression in plants. G481 overexpressors were more
tolerant to high sucrose in a germination assay. The phenotype of
G481 was mild; however, there was a consistent difference in the
hypocotyl and root elongation in the overexpressor plants compared
to wild-type controls. Sucrose-sensing has been implicated in the
regulation of source-sink relationships in plants. Consistent with
the sugar sensing phenotype of the G481 overexpressors were the
results from the biochemical analysis of G481 overexpressor plants
suggesting that line 14 had higher amounts of seed oils and lower
amounts of seed protein. This suggested that G481 was involved in
the allocation of storage compounds to the seed. G481 overexpressor
line 8 was darker green in the T2 generation which can mean a
higher photosynthetic rate consistent with the possible role of
G481 in sugar sensing.
Closely Related Genes from Other Species
[0294] There are several sequences from higher plants that show
significant homology to G481 including, X59714 from corn, and two
ESTs from tomato, AI486503 and AI782351.
[0295] G2133: G2133 (SEQ ID NO: 141) was studied using transgenic
plants in which the gene was expressed under the control of the 35S
promoter. Overexpression of G2133 caused a variety of alterations
in plant growth and development: delayed flowering, altered
inflorescence architecture, and a decrease in overall size and
fertility. At early stages, 35S::G2133 transformants were markedly
smaller than controls and displayed curled, dark-green leaves. Most
of these plants remained in a vegetative phase of development
substantially longer than controls, and produced an increased
number of leaves before bolting. In the most severely affected
plants, bolting occurred more than a month later than in wild type
(24-hour light). In addition, the plants displayed a reduction in
apical dominance and formed large numbers of shoots simultaneously,
from the axils of rosette leaves. These inflorescence stems had
short internodes, and carried increased numbers of cauline leaf
nodes, giving them a very leafy appearance. The fertility of
35S::G2133 plants was generally very low. In addition, G2133
overexpressing lines were more resistant to the herbicide
glyphosate. In a repeat experiment, lines 4 and 5 were more
tolerant while line 2 was wild-type. G2133 expression was detected
in a variety of tissues: flower, leaf, embryo, and silique samples.
Its expression was altered by several conditions, including auxin
treatment, osmotic stress, and Fusarium infection. G2133 can be
used for the generation of glyphosate resistant plants, and to
increase plant resistance to oxidative stress.
Closely Related Genes from Other Species
[0296] G2133 shows some sequence similarity with known genes from
other plant species within the conserved AP2/EREBP domain.
[0297] G2517: G2517 (SEQ ID NO: 143) was studied using transgenic
plants in which the gene was expressed under the control of the 35S
promoter. Overexpression of G2517 caused alterations in plant
growth and development: size variation was apparent in the
35S::G2517 T1 generation, with at least half the lines being very
small. Additionally, 4/12 T1 plants formed flower buds marginally
earlier than wild type. Three T1 lines (#8,11,12) were examined in
the T2 generation, and all three T2 populations were slightly
smaller than controls. In the physiological analysis of the T2
populations, G2517 overexpressing lines were more resistant to the
herbicide glyphosate. G2517 can be used for the generation of
glyphosate resistant plants, and to increase plant resistance to
oxidative stress.
Closely Related Genes from Other Species
[0298] G2517 shows some sequence similarity with known genes from
other plant species within the conserved WRKY domain.
[0299] G2140: The complete sequence of G2140 (SEQ ID NO: 81) was
determined. G2140 was expressed throughout the plant. It showed
repression by salicylic acid and Erysiphe infection. Overexpressing
G2140 in Arabidopsis resulted in seedlings that were more tolerant
to osmotic stress conditions. In germination assays where seedlings
were exposed to high concentrations of sucrose or NaCl, all three
lines tested showed better cotyledon expansion and seedling vigor.
Additionally, G2140 overexpressing plants showed insensitivity to
ABA in a germination assay. In general, G2140 overexpressing plants
were small and sickly with short roots when grown in Petri plates.
The combination of ABA insensitivity and resistance to osmotic
stress at germination had also been observed for other genes, for
example, G1820 (SEQ ID NO:13) and G926 (SEQ ID NO:111).
Significantly, the ABA resistance was detected in a germination
assay. ABA is involved in maintaining seed dormancy, and it is
possible that ABA insensitivity at the germination stage promotes
germination despite unfavorable conditions.
[0300] When grown in soil, G2140 overexpressing plants displayed
marked changes in Arabidopsis leaf and root morphology. All twenty
of the 35S::G2140 primary transformants displayed, to various
extents, leaves with upcurled margins. In the most severe cases,
the leaves became highly contorted and the plants were slightly
small and grew more slowly than controls. Three T1 lines (#12, 15
and 16) that showed substantial levels of G2140 overexpression
(determined by RT-PCR) were chosen for further study. The T2
seedlings from each of these lines exhibited stunted roots compared
with controls. Seedlings from two of the lines (#15,16) also showed
upcurled cotyledons. At later stages, however, T2-16 plants
appeared wild type. Plants from the T2-12 and T2-15 populations
were rather varied in size and showed hints of leaf curling later
in development. However, this effect was less severe than that seen
in the T1 lines. To verify the leaf-curling phenotype, two further
T2 populations (#3,18) were morphologically examined; seedlings
from T2-3 were extremely tiny with thickened hypocotyls and short
stunted roots. Such plants were too small for transfer to soil.
However, T2-18 plants showed slightly contorted cotyledons and
formed severely upcurled leaves, confirming the effects seen in the
T1 generation.
[0301] G2140 is useful for creating plants that germinate better
under conditions of high salt. Evaporation from the soil surface
causes upward water movement and salt accumulation in the upper
soil layer where the seeds are placed. Thus, germination normally
takes place at a salt concentration much higher than the mean salt
concentration in the whole soil profile. Increased salt tolerance
during the germination stage of a crop plant will impact
survivability and yield. In addition, G2140 can be used to alter a
plant's response to water deficit conditions and, therefore, can be
used to engineer plants with enhanced tolerance to drought, and
freezing.
Closely Related Genes from Other Species
[0302] G2140 proteins show extensive sequence similarity with a
tomato ovary cDNA, TAMU Lycopersicon esculentum (AI488313) and a
Glycine max cDNA clone (BE020519).
[0303] G1946: G1946 (SEQ ID NO:49) was studied using transgenic
plants in which the gene was expressed under the control of the 35S
promoter. Overexpression of G1946 resulted in accelerated
flowering, with 35S::G1946 transformants producing flower buds up
to a week earlier than wild-type controls (24-hour light
conditions). These effects were seen in 12/20 primary transformants
and in two independent plantings of each of the three T2 lines.
Unlike many early flowering Arabidopsis transgenic lines, which are
dwarfed, 35S::G1946 transformants often reached full-size at
maturity, and produced large quantities of seeds, although the
plants were slightly pale in coloration and had slightly flat
leaves compared to wild-type. In addition, 35S::G1946 plants showed
an altered response to phosphate deprivation. Seedlings of G 1946
overexpressors showed more secondary root growth on phosphate-free
media, when compared to wild-type control. In a repeat experiment,
all three lines showed the phenotype. Overexpression of G1946 in
Arabidopsis also resulted in an increase in seed glucosinolate
M39501 in T2 lines land 3. An increase in seed oil and a decrease
in seed protein was also observed in these two lines. G1946 was
ubiquitously expressed, and does not appear to be significantly
induced or repressed by any of the biotic and abiotic stress
conditions tested, with the exception of cold, which repressed
G1946 expression. G1946 can be used to modify flowering time, as
well as to improve the plant's performance in conditions of limited
phosphate, and to alter seed oil, protein, and glucosinolate
composition.
Closely Related Genes from Other Species
[0304] A comparison of the amino acid sequence of G1946 with
sequences available from GenBank showed strong similarity with
plant HSFs of several species (Lycopersicon peruvianum, Medicago
truncatula, Lycopersicon esculentum, Glycine max, Solanum
tuberosum, Oryza sativa and Hordeum vulgare subsp. Vulgare).
[0305] G1852: G1852 (SEQ ID NO:71) was analyzed through its ectopic
overexpression in plants. Analysis of the endogenous level of G1852
transcripts by RT-PCR revealed expression in all tissues tested.
G1852 expression was induced in response to ABA, heat and drought
treatment. 35S::G1852 overexpressor plants were more tolerant to
osmotic stress in a root growth assay on PEG (polyethylene
glycol)-containing media compared with wild-type controls.
Seedlings were slightly larger and have more root growth. G1852 can
be used to alter a plant's response to water deficit conditions and
therefore, be used to engineer plants with enhanced tolerance to
drought, salt stress, and freezing.
Closely Related Genes from Other Species
[0306] A comparison of the amino acid sequence of G1852 with
entries available from GenBank shows strong similarity with plant
ankyrins of several species (Malus domestica, Solanum tuberosum,
Oryza sativa, Gossypium arboreum, Medicago truncatula, Glycine max,
Lycopersicon esculentum, Pinus taeda, Lotus japonicus and Gossypium
hirsutum).
[0307] G325: G325 (SEQ ID NO:95) was analyzed using transgenic
plants in which G325 was expressed under the control of the 35S
promoter. G325 overexpressing plants showed more tolerance to
osmotic stress in a germination assay in three separate
experiments. They showed more seedling vigor than wild-type control
when germinated on plates containing high salt and high sucrose.
G325 was expressed at high levels in flowers and cauline leaves,
and at lower levels in shoots, rosette leaves, and seedlings. G325
was induced by auxin, cold and heat stress. Expression of G325 was
reduced in response to Fusarium infection or salicylic acid
treatment. G325 can be useful for enhancing seed germination under
high salt conditions or other conditions of osmotic stress.
Evaporation from the soil surface causes upward water movement and
salt accumulation in the upper soil layer where the seeds are
placed. Thus, germination normally takes place at a salt
concentration much higher than the mean salt concentration of in
the whole soil profile. Increased salt tolerance during the
germination stage of a crop plant will impact survivability and
yield. G325 can also be used to engineer plants with enhanced
tolerance to drought, salt stress, and freezing at later stages
during growth and development.
Closely Related Genes from Other Species
[0308] G325 showed homology to non-Arabidopsis proteins within the
conserved domain.
[0309] G2583: G2583 (SEQ ID NO: 17) was studied using transgenic
plants in which the gene was expressed under the control of the 35S
promoter. 35S::G2583 plants exhibited extremely glossy leaves. At
early stages, 35S::G2583 seedlings appeared normal, but by about
two weeks after sowing, the plants exhibited very striking shiny
leaves, which were apparent until very late in development. Many
lines displayed a variety of other effects such as a reduction in
overall size, narrow curled leaves, or various non-specific floral
abnormalities, which reduced fertility. These effects on leaf
appearance were observed in 18/20 primary transformants, and in all
the plants from 4/6 of the T2 lines (#2,4,9 and 15) examined. The
glossy nature of the leaves from 35S::G2583 plants can be a
consequence of changes in epicuticular wax content or composition.
G2583 belongs to a small clade within the large AP2/EREBP
Arabidopsis family that also contains G975 (SEQ ID NO: 19), G1387
(SEQ ID NO: 21), and G977 (SEQ ID NO: 23). Overexpression of G975
caused a substantial increase in leaf wax components, as well as
morphological phenotypes resembling those observed in 35S::G2583
plants. G2583 was ubiquitously expressed, at higher levels in root,
flower, embryo, and silique tissues. G2583 can be used to modify
plant appearance (shiny leaves). In addition, it can be used to
manipulate wax composition, amount, or distribution, which in turn
can modify plant tolerance to drought and/or low humidity or
resistance to insects.
Closely Related Genes from Other Species
[0310] G2583 showed some sequence similarity with known genes from
other plant species within the conserved AP2/EREBP domain.
[0311] G1322: G1322 (SEQ ID NO: 21) was analyzed using transgenic
plants in which the gene was expressed under the control of the 35S
promoter. 35S::G1322 transgenic plants were wild-type in phenotype
with respect to the biochemical analyses performed. Overexpression
of G1322 produced changes in overall plant size and leaf
development. At all stages, 35S::G1322 plants were distinctly
smaller than controls and developed curled dark-green leaves.
Following the switch to flowering, the plants formed relatively
thin inflorescence stems and had a rather poor seed yield. In
addition, overexpression of G1322 resulted in plants with an
altered etiolation response as well as enhanced tolerance to
germination under chilling conditions. When germinated in the dark,
G1322 overexpressing transgenic plant lines had open, slightly
green cotyledons. Under chilling conditions, all three transgenic
lines displayed a similar germination response, seedlings were
slightly larger and had longer roots. In addition, an increase in
the leaf glucosinolate M39480 was observed in all three T2 lines.
According to RT-PCR analysis, G1322 was expressed primarily in
flower tissue. The utilities of G1322 include altering a plant's
chilling sensitivity and altering a plant's light response. The
germination of many crops is very sensitive to cold temperatures. A
gene that will enhance germination and seedling vigor in the cold
has tremendous utility in allowing seeds to be planted earlier in
the season with a higher survival rate. G1322 can also be useful
for altering leaf glucosinolate composition. Increases or decreases
in specific glucosinolates or total glucosinolate content are
desirable depending upon the particular application. Modification
of glucosinolate composition or quantity can therefore afford
increased protection from predators. Furthermore, in edible crops,
tissue specific promoters can be used to ensure that these
compounds accumulate specifically in tissues, such as the
epidermis, which are not taken for consumption.
Closely Related Genes from Other Species
[0312] G1322 shows some sequence similarity with known genes from
other plant species within the conserved Myb domain.
[0313] G303: The complete sequence of G303 (SEQ ID NO: 23) was
determined G303 was detected at very low levels in roots and
rosette leaves. G303 was analyzed using transgenic plants in which
G303 was expressed under the control of the 35S promoter. G303
overexpressing plants showed more tolerance to osmotic stress in a
germination assay in three separate experiments. They showed more
seedling vigor than wild-type control when germinated on plates
containing high salt and high sucrose. G303 are useful for
enhancing seed germination under high salt conditions or other
conditions of osmotic stress. Evaporation from the soil surface
causes upward water movement and salt accumulation in the upper
soil layer where the seeds are placed. Thus, germination normally
takes place at a salt concentration much higher than the mean salt
concentration in the whole soil profile. Increased salt tolerance
during the germination stage of a crop plant will impact
survivability and yield. G303 can also be used to engineer plants
with enhanced tolerance to drought, salt stress, and freezing.
Closely Related Genes from Other Species
[0314] G303 shows some sequence similarity with known genes from
other plant species within the conserved basic HLH domain.
[0315] G1927: G1927 (SEQ ID NO: 239) was analyzed using transgenic
plants in which the gene was expressed under the control of the 35S
promoter. Overexpression of G1927 in Arabidopsis resulted in plants
that had an altered response to pathogen. Plants overexpressing
G1927 showed fewer disease symptoms following infection with the
fungal pathogen Sclerotinia sclerotiorum compared with control
plants. The experiment was repeated on individual lines, and all
three lines showed the enhanced pathogen tolerance phenotype. G1927
expression appeared to be ubiquitous according to RT-PCR analysis.
G1927 can be used to manipulate the defense response in order to
generate pathogen-resistant plants.
Closely Related Genes from Other Species
[0316] G1927 showed extensive sequence similarity to a NAC protein
from tomato (BG350410).
[0317] G2153, SEQ ID NO: 83 and 84. The sequence of G2153 was
obtained from Arabidopsis genomic sequencing project, GenBank
accession number AC011437, based on its sequence similarity within
the conserved domain to other AT-hook related proteins in
Arabidopsis. G2153 corresponds to gene F7018.4 (AAF04888). To date,
there is no published information regarding the functions of this
gene.
[0318] The complete sequence of G2153 was determined at Mendel
Biotechnology. G2153 is strongly expressed in roots, embryos,
siliques, and germinating seed, but at low or undetectable levels
in shoots, flowers, and rosette leaves. It is not significantly
induced or repressed by any condition tested.
[0319] The function of this gene was analyzed using transgenic
plants in which G2153 was expressed under the control of the 35S
promoter. Lines for both direct fusion and two component constructs
were generated. In the two-component system, two separate
constructs were used, a 35S::LexA-GAL4TA and opLexA::TF (where TF
encoded the G2153 polypeptide). The first of these
(Promoter::LexA-GAL4TA) comprised a desired promoter cloned in
front of a LexA DNA binding domain fused to a GAL4 activation
domain. The construct vector backbone also carried a kanamycin
resistance marker, along with an opLexA::GFP reporter. Transgenic
lines were obtained containing the first component, and a "driver"
line selected that shows reproducible expression of the in-cis
reporter gene in the desired pattern through a number of
generations. A homozygous population was established for that line,
and the population was supertransformed with the second construct
(opLexA::TF) carrying the transcription factor sequence of interest
cloned behind a LexA operator site. This second construct vector
backbone also contained a sulfonamide resistance marker.
[0320] The Arabidopsis plant lines from the direct fusion and
two-component approaches exhibited similar effects, although small
size was more likely to occur in lines produced with the
two-component approach (two-component lines may have greater
expression levels in comparison with direct fusion constructs,
suggesting that the deleterious morphological effects may be
dose-dependent). At least one T1 two-component line had greater
biomass at later stages of growth than control plants. The T2
generations of three two-component Arabidopsis lines produced large
rosettes relative to controls greater biomass at late stages of
growth than control plants. A significant proportion of the
35S::G2153 direct fusion plant lines developed enlarged lateral
organs (leaves and flowers), particularly at later developmental
stages. The 35S::G2153 direct fusion plant lines generally produced
greater biomass than controls at late stages.
[0321] Overexpression of G2153 in tomato plants using the
two-component approach produced significantly larger tomato plants
than control, non-transformed tomato plants.
[0322] Overexpression of G2153 in Arabidopsis resulted in seedlings
with an altered response to hyperosmotic stress. In a germination
assay on media containing high sucrose (9.4%), G2153 overexpressors
had more expanded cotyledons and longer roots than wild-type
controls. This phenotype was confirmed in repeat experiments on
individual lines, and all three lines showed hyperosmotic
tolerance. Increased tolerance to high sucrose could also be
indicative of effects on sugar sensing.
[0323] Three different direct fusion lines also showed a strong
performance relative to controls in soil-based water deficit assays
with mature plants. G2153 overexpression under the regulatory
control of the CaMV 35 S promoter also produced transgenic plants
that had greater tolerance to NaCl (150 mM), later flowering,
decreased sensitivity to abscisic acid, greater tolerance to cold,
and greater tolerance to hyperosmotic stress relative to control
plants.
[0324] Related sequences. A number of sequences derived from
various diverse plant species were found to be
phylogenetically-related to G2153. These include following
orthologs and paralogs from Arabidopsis, rice, soy, and maize. Each
of these related sequences contains an At-hook domain and a second
conserved domain subsequence, the latter comprising a core sequence
found within the larger DUF296 domain.
[0325] The At-hook transcription factors are DNA-binding proteins
that are known to contain at least one AT-hook domain, a small DNA
binding motif that bind to the minor groove of DNA (Aravind and
Landsman (1998) Nucleic Acids Res. 26: 4413-4421, incorporated
herein by reference).
[0326] The DUF 296 putative domain is "is found in proteins that
contain AT-hook motifs pfam02178, which strongly suggests a
DNA-binding function for the proteins as a whole, however the
function of this domain is unknown" (The NCBI Conserved Domain
Database; presently found at
www.ncbi.nlm.nih.gov/sites/entrez?db=cdd).
[0327] A CLUSTALX (ver. 1.81)-derived multiple sequence alignment
of the second conserved domains within the DUF296 domain appears
below (SEQ ID NOs: appear in parentheses, asterisks indicate highly
conserved residues, and colons show similar residues).
TABLE-US-00005 G2153 (84)
GGAAVLALQGRFEILSLTGSFLPGP-APPGSTGLTIYLAGGQGQVV G3456 (248)
APGAVMALHGRFDILSLTGSFLPGP-SPPGATGLTIYLAGGQGQIV G3401 (250)
APSAVVALRGRFEILSLTGTFLPGP-APPGSTGLTVYLAGGQGQVV G1069 (64)
APGGVVSLQGRFEILSLTGAFLPGP-SPPGSTGLTVYLAGVQGQVV G3556 (272)
TGAAAVALRGRFEILSMSGAFLPAP-APPGATGLAVYLAGGQGQVV G2157 (270)
SGG-VVSLRGQFEILSMCGAFLPTSGSPAAAAGLTIYLAGAQGQVV G3462 (266)
APAGVITLHGRFEILSLSGAFLPSP-SPSGATGLTVYLAGGQGQVV G596 (258)
GGSSVVNLHGRFEILSLSGSFLPPP-APPAASGLTIYLAGGQGQVV G2789 (92)
PGGGVVSLHGRFEILSLSGSFLPPP-APPAASGLKVYLAGGQGQVI G3457 (260)
SPGAVVTLHGRFEILSLSGSFLPPP-APPAASGLAIYLAGGQGQVV G3459 (274)
AAGAVVTLHGRFEILSLSGSFLPPP-APPGATSLTIYLAGGQGQVV G3460 (258)
AAGAVVRLHGRFEILSLSGSFLPPP-APPGATSLTIYLAGGQGQVV G3406 (254)
PAGAVVSLHGRFEILSLSGSFLPPP-APPGATSLTIFLAGGQGQVV G3407 (262)
ASPAVATLHGRFEILSLAGSFLPPP-APPGATSLAAFLAGGQGQVV G1667 (280)
SSGAIVTLHGRYEILSLLGSILPPP-APLGITGLTIYLAGPQGQVV G1067 (256)
GGGGVVTLHGRFEILSLTGTVLPPP-APPGAGGLSIFLAGGQGQVV G2156 (264)
GTGGVVALHGRFEILSLTGTVLPPP-APPGSGGLSIFLSGVQGQVI G3399 (252)
PGSMVATLRGRFEILSLTGTVLPPP-APPGASGLTVFLSGGQGQVI G3400 (278)
PGSLVATMRGQFEILSLTGTVLPPP-APPSASGLTVFLSGGQGQVV G1073 (276)
AGGGVITLHGRFDILSLTGTALPPP-APPGAGGLTVYLAGGQGQVV ::*:::***: *: ** .
:* . .* :*:* ***:: Consensus (281) GXXXILSXXGXXLP X.sub.3-4
PXXXXXLXXXLXGXQGQ
[0328] Alignments such as the above related subsequences may be
used to identify relatedness within these domains. An alignment may
suitably be determined by means of computer programs known in the
art, such as CLUSTAL, or Accelrys Gene (Accelrys, Inc., San Diego,
Calif.).
[0329] Some of the traits associated with overexpression of the
transcription factors in plants containing the above subsequences
may be found in US patent publication US20090138981A1, published
May 28, 2009, herein incorporated by reference.
Utilities
[0330] Overexpression of G2153 may be used to produce larger plants
with greater biomass than control plants, which may have a
significant positive impact on yield, for example, when the product
is a plant organ, plant seed, or when the vegetative portion of the
plant is harvested.
[0331] G2153 could be used to alter a plant's response to cold,
salt, and water deficit conditions and could be used to engineer
plants with enhanced tolerance to drought, salt stress, and cold or
freezing.
[0332] G2153 may also be useful for altering a plant's response to
sugars. In addition to their important role as an energy source and
structural component of the plant cell, sugars are central
regulatory molecules that control several aspects of plant
physiology, metabolism and development. It is thought that this
control is achieved by regulating gene expression and, in higher
plants, sugars have been shown to repress or activate plant genes
involved in many essential processes such as photosynthesis,
gloxylate metabolism, respiration, starch and sucrose synthesis and
degradation, pathogen response, wounding response, cell cycle
regulation, pigmentation, flowering and senescence. The mechanisms
by which sugars control gene expression are not understood.
[0333] Because sugars are important signaling molecules, the
ability to control either the concentration of a signaling sugar or
how the plant perceives or responds to a signaling sugar could be
used to control plant development, physiology or metabolism. For
example, the flux of sucrose (a disaccharide sugar used for
systemically transporting carbon and energy in most plants) has
been shown to affect gene expression and alter storage compound
accumulation in seeds. Manipulation of the sucrose signaling
pathway in seeds may therefore cause seeds to have more protein,
oil or carbohydrate, depending on the type of manipulation.
Similarly, in tubers, sucrose is converted to starch which is used
as an energy store. It is thought that sugar signaling pathways may
partially determine the levels of starch synthesized in the tubers.
The manipulation of sugar signaling in tubers could lead to tubers
with a higher starch content. Thus, manipulating the sugar signal
transduction pathway may lead to altered gene expression to produce
plants with desirable traits. In particular, manipulation of sugar
signal transduction pathways could be used to alter source-sink
relationships in seeds, tubors, roots and other storage organs
leading to increase in yield.
Example VIII
Identification of Homologous Sequences
[0334] Homologous sequences from Arabidopsis and plant species
other than Arabidopsis were identified using database sequence
search tools, such as the Basic Local Alignment Search Tool (BLAST)
(Altschul et al. (1990) J. Mol. Biol. 215:403-410; and Altschul et
al. (1997) Nucl. Acid Res. 25: 3389-3402). The tblastx sequence
analysis programs were employed using the BLOSUM-62 scoring matrix
(Henikoff, S, and Henikoff, J. G. (1992) Proc. Natl. Acad. Sci. USA
89: 10915-10919).
[0335] Identified non-Arabidopsis sequences homologous to the
Arabidopsis sequences are provided in Table 5. The percent sequence
identity among these sequences can be as low as 47%, or even lower
sequence identity. The entire NCBI GenBank database was filtered
for sequences from all plants except Arabidopsis thaliana by
selecting all entries in the NCBI GenBank database associated with
NCBI taxonomic ID 33090 (Viridiplantae; all plants) and excluding
entries associated with taxonomic ID 3701 (Arabidopsis thaliana).
These sequences are compared to sequences representing genes of SEQ
IDs NOs:2-2N, where N=2-123, using the Washington University
TBLASTX algorithm (version 2.0a19MP) at the default settings using
gapped alignments with the filter "off". For each gene of SEQ IDs
NOs:2-2N, where N=2-123, individual comparisons were ordered by
probability score (P-value), where the score reflects the
probability that a particular alignment occurred by chance. For
example, a score of 3.6e-40 is 3.6.times.10.sup.-40. In addition to
P-values, comparisons were also scored by percentage identity.
Percentage identity reflects the degree to which two segments of
DNA or protein are identical over a particular length. Examples of
sequences so identified are presented in Table 5. Homologous or
orthologous sequences are readily identified and available in
GenBank by Accession number (Table 5; Test sequence ID) The
identified homologous polynucleotide and polypeptide sequences and
homologues of the Arabidopsis polynucleotides and polypeptides may
be orthologs of the Arabidopsis polynucleotides and
polypeptides.
Example IX
Introduction of Polynucleotides into Dicotyledonous Plants
[0336] SEQ ID NOs: 1-(2N-1), wherein N=2-123, paralogous,
orthologous, and homologous sequences recombined into pMEN20 or
pMEN65 expression vectors are transformed into a plant for the
purpose of modifying plant traits. The cloning vector may be
introduced into a variety of cereal plants by means well-known in
the art such as, for example, direct DNA transfer or Agrobacterium
tumefaciens-mediated transformation. It is now routine to produce
transgenic plants using most dicot plants (see Weissbach and
Weissbach, (1989) supra; Gelvin et al., (1990) supra;
Herrera-Estrella et al. (1983) supra; Bevan (1984) supra; and Klee
(1985) supra). Methods for analysis of traits are routine in the
art and examples are disclosed above.
Example X
Transformation of Cereal Plants with an Expression Vector
[0337] Cereal plants such as corn, wheat, rice, sorghum or barley,
may also be transformed with the present polynucleotide sequences
in pMEN20 or pMEN65 expression vectors for the purpose of modifying
plant traits. For example, pMEN020 may be modified to replace the
NptII coding region with the BAR gene of Streptomyces hygroscopicus
that confers resistance to phosphinothricin. The KpnI and BglII
sites of the Bar gene are removed by site-directed mutagenesis with
silent codon changes.
[0338] The cloning vector may be introduced into a variety of
cereal plants by means well-known in the art such as, for example,
direct DNA transfer or Agrobacterium tumefaciens-mediated
transformation. It is now routine to produce transgenic plants of
most cereal crops (Vasil, I., Plant Molec. Biol. 25: 925-937
(1994)) such as corn, wheat, rice, sorghum (Cassas, A. et al.,
Proc. Natl. Acad Sci USA 90: 11212-11216 (1993) and barley (Wan, Y.
and Lemeaux, P. Plant Physiol. 104:37-48 (1994). DNA transfer
methods such as the microprojectile can be used for corn (Fromm. et
al. Bio/Technology 8: 833-839 (1990); Gordon-Kamm et al. Plant Cell
2: 603-618 (1990); Ishida, Y., Nature Biotechnology 14:745-750
(1990)), wheat (Vasil, et al. Bio/Technology 10:667-674 (1992);
Vasil et al., Bio/Technology 11:1553-1558 (1993); Weeks et al.,
Plant Physiol. 102:1077-1084 (1993)), rice (Christou Bio/Technology
9:957-962 (1991); Hiei et al. Plant J. 6:271-282 (1994); Aldemita
and Hodges, Planta 199:612-617; Hiei et al., Plant Mol. Biol.
35:205-18 (1997)). For most cereal plants, embryogenic cells
derived from immature scutellum tissues are the preferred cellular
targets for transformation (Hiei et al., Plant Mol. Biol. 35:205-18
(1997); Vasil, Plant Molec. Biol. 25: 925-937 (1994)).
[0339] Vectors according to the present invention may be
transformed into corn embryogenic cells derived from immature
scutellar tissue by using microprojectile bombardment, with the
A188XB73 genotype as the preferred genotype (Fromm, et al.,
Bio/Technology 8: 833-839 (1990); Gordon-Kamm et al., Plant Cell 2:
603-618 (1990)). After microprojectile bombardment the tissues are
selected on phosphinothricin to identify the transgenic embryogenic
cells (Gordon-Kamm et al., Plant Cell 2: 603-618 (1990)).
Transgenic plants are regenerated by standard corn regeneration
techniques (Fromm, et al., Bio/Technology 8: 833-839 (1990);
Gordon-Kamm et al., Plant Cell 2: 603-618 (1990)).
[0340] The plasmids prepared as described above can also be used to
produce transgenic wheat and rice plants (Christou, Bio/Technology
9:957-962 (1991); Hiei et al., Plant J. 6:271-282 (1994); Aldemita
and Hodges, Planta 199:612-617 (1996); Hiei et al., Plant Mol.
Biol. 35:205-18 (1997)) that coordinately express genes of interest
by following standard transformation protocols known to those
skilled in the art for rice and wheat Vasil, et al. Bio/Technology
10:667-674 (1992); Vasil et al., Bio/Technology 11:1553-1558
(1993); Weeks et al., Plant Physiol. 102:1077-1084 (1993)), where
the bar gene is used as the selectable marker.
[0341] All references, publications, patent documents, web pages,
and other documents cited or mentioned herein are hereby
incorporated by reference in their entirety for all purposes.
Although the invention has been described with reference to
specific embodiments and examples, it should be understood that one
of ordinary skill can make various modifications without departing
from the spirit of the invention. The scope of the invention is not
limited to the specific embodiments and examples provided.
TABLE-US-00006 TABLE 4 Poly- Poly- nucleotide peptide SEQ ID GID
SEQ ID Conserved NO: No. Trait Category Family Comment NO: Domains
1 G1322 Cold Abiotic MYB- Increased seedling vigor 2 (26-130)
stress (R1) R2R3 3 G2130 Cold; heat; Abiotic AP2 Increased
susceptibility to chilling; better 4 (93-160) Botrytis stress;
germination in heat; increased susceptibilty disease to Botrytis 5
G256 Cold Abiotic MYB- Better germination and growth in cold 6
(13-115) stress (R1) R2R3 7 G394 Cold Abiotic HB More sensitive to
chilling. 8 (121-182) stress 9 G664 Cold Abiotic MYB- Better
germination and growth in cold 10 (13-116) stress (R1) R2R3 11 G864
Cold; heat Abiotic AP2 Adult stage chilling sensitivity; better 12
(119-186) stress germination in heat 13 G1820 Drought; Abiotic CAAT
Increased tolerance to drought; better 14 (70-133) osmotic; stress;
germination in high salt; reduced ABA hormone hormone sensitivity
sensitivity sensitivity 15 G912 Drought; Abiotic AP2 Increased
survival in drought condtions, 16 (51-118) freezing stress freezing
tolerant 17 G2583 Drought; low Abiotic AP2 Tolerance to drought
and/or low humidity; 18 (4-71) humidity; insect stress; resistance
to insects resistance disease 19 G975 Drought; low Abiotic AP2
Tolerance to drought and/or low humidity; 20 (4-71) humidity;
insect stress; resistance to insects resistance disease 21 G1322
Drought; low Abiotic MYB- Tolerance to drought and/or low humidity;
22 (26-130) humidity; insect stress; (R1) resistance to insects
resistance disease R2R3 23 G303 Drought; low Abiotic HLH/ Tolerance
to drought and/or low humidity; 24 (92-161) humidity; insect
stress; MYC resistance to insects resistance disease 25 G720
Freezing Abiotic GARP Knockout: increased susceptibility to 26
(301-349) stress freezing (knockout); overexpressor: slightly more
freezing tolerant 27 G913 Freezing Abiotic AP2 Increased tolerance
to freezing 28 (62-128) stress 29 G1305 Heat Abiotic MYB- Reduced
chlorosis 30 (15-118) stress (R1) R2R3 31 G1645 Heat Abiotic MYB-
Reduced germination vigor 32 (90-210) stress (R1) R2R3 33 G1841
Heat Abiotic AP2 Better germination under heat stress 34 (83-150)
stress 35 G2430 Heat Abiotic GARP Increased tolerance 36 (425-478)
stress 37 G3 Heat Abiotic AP2 More sensitive 38 (28-95) stress 39
G464 Heat Abiotic IAA Better germination and growth in heat 40
(20-28, 71-82, stress 126-142, 187-224) 41 G682 Heat Abiotic MYB-
Better germination and growth in heat; increased 42 (27-63) stress
related tolerance to nitrogen-limited medium; increased tolerance
to 150 mM salt; increased tolerance to cold (8 C.) at germination
and seedling stages; decreased sensitivity to abscisic acid:
increased tolerance to 9.4% sucrose; increased root hairs;
decreased leaf trichome density; increased tolerance to dehydration
and/or water deficit 43 G964 Heat Abiotic HB Better germination and
growth 44 (126-186) stress 45 G1792 Nutrient uptake; Abiotic AP2
Increased tolerance to nitrogen-limited medium; 46 (17-85)
Botrytis; Erysiphe; stress; increased fungal disease resistance
Fusarium disease 47 G1794 Nutrient uptake; Abiotic AP2 Reduced root
growth; increased sensitivity to 48 (182-248) osmotic stress
osmotic stress 49 G1946 Nutrient uptake Abiotic HS Increased root
growth on phosphate-free media 50 (32-130) stress 51 G225 Nutrient
uptake Abiotic MYB- Increased tolerance to nitrogen-limited medium;
52 (39-76) stress related increased root hairs; decreased leaf
trichome density; 53 G226 Nutrient uptake; Abiotic MYB- Increased
tolerance to nitrogen-limited medium; 54 (28-78) sodium chloride
stress related increased tolerance to 150 mM salt; increased
tolerance to cold (8 C.); decreased sensitivity to abscisic acid:
increased tolerance to 9.4% sucrose; increased root hairs;
decreased leaf trichome density; increased seed protein content 55
G419 Nutrient uptake Abiotic HB Increased tolerance to
potassium-free medium 56 (392-452) stress 57 G545 Nutrient uptake;
Abiotic Z- Increased tolerance to phosphate-free medium, high 58
(82-102, sodium chloride; stress; C2H2 salt; increased
susceptibility to disease 136-154) Erysiphe; disease Fusarium;
Pseudomonas 59 G561 Nutrient uptake Abiotic bZIP Increased
tolerance to potassium-free medium 60 (248-308) stress 61 G911
Nutrient uptake Abiotic RING/ Increased growth on potassium-free
medium 62 (86-129) stress C3H2C3 63 G1069 Osmotic; hormone Abiotic
AT- Better germination under osmotic stress; 64 (67-74) sensitivity
stress; hook reduced ABA sensitivity hormone sensitivity 65 G1089
Osmotic Abiotic BZIPT2 Better germination under osmotic stress 66
(425-500) stress 67 G1452 Osmotic; hormone Abiotic NAC Better
germination on sucrose and salt; 68 (30-177) sensitivity stress;
reduced sensitivity to ABA hormone sensitivity 69 G175 Osmotic
Abiotic WRKY Increased tolerance 70 (178-234, stress 372-428) 71
G1852 Osmotic Abiotic AKR Better root growth 72 (1-601) stress 73
G1863 Osmotic Abiotic GRF- Decreased germination under salt stress
74 (76-187) stress like 75 G188 Osmotic; Abiotic WRKY Better
germination under osmotic stress; 76 (175-222) Fusarium stress;
increased susceptibility disease 77 G1930 Osmotic Abiotic AP2
Better germination under osmotic stress 78 (59-124) stress 79 G2053
Osmotic Abiotic NAC Increased root growth 80 (10-149) stress 81
G2140 Osmotic; hormone Abiotic HLH/ Better germination on NaCl and
sucrose; 82 (167-242) sensitivity stress MYC decreased sensitivity
to ABA hormone sensitivity 83 G2153 Osmotic Abiotic AT- Greater
tolerance to NaCl (150 mM); greater 84 (75-94, stress hook
tolerance to sucrose (9.4%); greater tolerance to 162-206) water
deficit (soil drought treatment); late DUF296: flowering; greater
biomass; large flower; 107-232 decreased sensitivity to abscisic
acid; greater tolerance to cold; greater tolerance to hyperosmotic
stress 85 G2379 Osmotic Abiotic TH Increased seedling vigor on high
sucrose media 86 (19-110, stress 173-232) 87 G2701 Osmotic Abiotic
MYB- Better germination on high NaCl and sucrose 88 (33-81, stress
related 129-183) 89 G2719 Osmotic Abiotic MYB- Increased seedling
vigor on high sucrose 90 (56-154) stress (R1) R2R3 91 G2789
Osmotic; hormone Abiotic AT- Better germination on high sucrose;
reduced ABA 92 (53-73, sensitivity stress hook sensitivity 121-165)
hormone sensitivity 93 G303 Osmotic Abiotic HLH/ Better germination
on high sucrose and high NaCl 94 (92-161) stress MYC 95 G325
Osmotic Abiotic Z-CO- Slightly better germination on high sucrose
96 (5-28, stress like and high NaCl 48-71) 97 G353 Osmotic Abiotic
Z- Increased seedling vigor on PEG 98 (41-61, stress C2H2 84-104)
99 G47 Osmotic Abiotic AP2 Better root growth 100 (11-80) stress
101 G489 Osmotic Abiotic CAAT Increased tolerance to osmotic stress
102 (57-156) stress 103 G502 Osmotic Abiotic NAC Increased
sensitivity to osmotic stress 104 (10-155) stress 105 G526 Osmotic
Abiotic NAC Increased sensitivity to osmotic stress 106 (21-149)
stress 107 G921 Osmotic Abiotic WRKY Increased sensitivity to
osmotic stress 108 (146-203) stress 109 G922 Osmotic; sodium
Abiotic SCR Better germination on high sucrose; better 110
(225-242) chloride stress germination and increased root growth on
high salt 111 G926 Osmotic; hormone Abiotic CAAT Increased
tolerance to osmotic stress 112 (131-225) sensitivity stress; (salt
and sucrose); reduced sensitivity hormone to ABA 113 G481 Osmotic
sensitivity CAAT Overexpressors more tolerant to high 114 (20-109)
Abiotic sucrose in a germination assay stress 115 G1807 Oxidative
Abiotic bZIP More sensitive to acifluorfen 116 (249-297) stress 117
G477 Oxidative; Abiotic SBP Increased sensitivity to oxidative
stress; 118 (108-233) Sclerotina stress; increased susceptibility
to Sclerotinia- disease caused disease 119 G789 Oxidative; Abiotic
HLH/ Increased sensitivity to oxidative stress; 120 (253-313)
Sclerotina stress; MYC increased susceptibility to Sclerotina-
disease caused disease 121 G1836 Sodium chloride Abiotic CAAT
Better germination in high salt 122 (30-164) stress 123 G196 Sodium
chloride Abiotic WRKY Increased tolerance 124 (223-283) stress 125
G2110 Sodium chloride Abiotic WRKY Increased tolerance 126
(239-298) stress 127 G22 Sodium chloride Abiotic AP2 Increased
tolerance to high salt 128 (89-157) stress 129 G2713 Sodium
chloride Abiotic TUBBY Increased root growth 130 (59-270, stress
400-445) 131 G312 Sodium chloride Abiotic SCR Slightly better
germination on 132 (320-336) stress high NaCl 133 G482 Sodium
chloride Abiotic CAAT Increased tolerance to high salt 134 (25-116)
stress 135 G801 Sodium chloride Abiotic PCF Better germination on
NaCl 136 (32-93) stress 137 G867 Sodium chloride Abiotic AP2 Better
seedling vigor 138 (59-124) stress
139 G884 Sodium chloride Abiotic WRBCY Increased root growth 140
(227-285, stress 407-465) 141 G2133 Glyphosate Herbicide AP2
Increased tolerance 142 (11-83) sensitivity 143 G2517 Glyphosate
Herbicide WRKY Increased tolerance 144 (117-177) sensitivity 145
G343 Glyphosate Herbicide GATA/ Increase in resistance 146
(178-214) sensitivity Zn 147 G1062 Hormone Hormone HLH/ Altered
response to the growth 148 (308-359) sensitivity sensitivity MYC
hormone ethylene 149 G1095 Hormone Hormone RING/ Increased
sensitivity to ACC 150 (134-159) sensitivity sensitivity C3H2C3 151
G1134 Hormone Hormone HLH/ Altered response to the growth 152
(198-247) sensitivity sensitivity MYC hormone ethylene 153 G12
Hormone Hormone AP2 Increased sensitivity to ACC 154 (27-94)
sensitivity sensitivity 155 G1330 Hormone Hormone MYB- Altered
response to ethylene 156 (28-134) sensitivity sensitivity (R1) R2R3
157 G1666 Hormone Hormone HLH/ Increased sensitivity to ACC 158
(353-420) sensitivity sensitivity MYC 159 G546 Hormone Hormone
RING/ Decreased sensitivity to ABA 160 (114-155) sensitivity
sensitivity C3H2C3 161 G760 Hormone Hormone NAC hypersensitive to
ACC 162 (12-156) sensitivity sensitivity 163 G913 Hormone Hormone
AP2 Increased sensitivity to ACC 164 (62-128) sensitivity
sensitivity 165 G1064 Botrytis Disease PCF Increased sensitivity
166 (116-179) 167 G1084 Botrytis Disease BZIPT2 Increased
susceptibility 168 (1-53, 490-619) 169 G1196 Botrytis Disease AKR
Increased susceptibility 170 (179-254) 171 G1255 Botrytis Disease
Z-CO- Increased susceptibility 172 (18-56) like 173 G1514 Botrytis
Disease RING/ Increased susceptibility 174 (20-50) C3HC4 175 G1756
Botrytis Disease WRKY Increased susceptibility 176 (138-200) 177
G1880 Botrytis Disease Z- Increased resistance 178 (69-89, C2H2
111-139) 179 G1919 Botrytis Disease RING/ Increased tolerance 180
(214-287) C3HC4 181 G1936 Botrytis; Disease PCF Increased
susceptibility 182 (64-129) Sclerotina 183 G1950 Botrytis Disease
AKR Increased tolerance 184 (65-228) 185 G2069 Botrytis Disease
bZIP Increased susceptibility 186 (to be determined) 187 G207
Botrytis Disease MYB- Increased susceptibility 188 (6-106) (R1)
R2R3 189 G2380 Botrytis Disease TH Increased susceptibility 190
(107-181) 191 G248 Botrytis Disease MYB- Increased susceptibility
192 (264-332) (R1) R2R3 193 G2555 Botrytis Disease HLH/ Increased
susceptibility 194 (175-245) MYC 195 G28 Botrytis; Disease AP2
Botrytis, Sclerotina: increased 196 (145-213) Sclerotina;
tolerance; Erysiphe: increased Erysiphe resistance 197 G371
Botrytis Disease RING/ Increased susceptibility 198 (21-74) C3HC4
199 G812 Botrytis Disease HS Increased tolerance 200 (31-120) 201
G865 Botrytis Disease AP2 Increased susceptibility 202 (36-103) 203
G940 Botrytis Disease EIL Increased susceptibility 204 (86-96) 205
G558 Defense gene Disease bZIP Increased expression of defense
genes 206 (45-105) expression 207 G569 Defense gene Disease bZIP
Decreased expression of defense genes 208 (90-153) expression 209
G1266 Erysiphe Disease AP2 Increased tolerance 210 (79-147) 211 G19
Erysiphe Disease AP2 Increased tolerance; repressed by 212 (76-145)
methyl jasmonate and induced by ACC 213 G237 Erysiphe Disease MYB-
Increased tolerance 214 (11-113) (R1) R2R3 215 G378 Erysiphe
Disease RING/ Increased resistance 216 (196-237) C3H2C3 217 G409
Erysiphe Disease HB Increased tolerance 218 (64-124) 219 G591
Erysiphe Disease HLH/ Increased tolerance 220 (143-240) MYC 221
G616 Erysiphe Disease TEO Increased tolerance 222 (39-95) 223 G869
Erysiphe Disease AP2 Increased tolerance 224 (109-177) 225 G881
Erysiphe Disease WRKY Increased susceptibility 226 (176-233) 227
G1047 Fusarium Disease bZIP Increased tolerance 228 (129-180) 229
G1363 Fusarium Disease CAAT Increased tolerance 230 (174-226) 231
G147 Fusarium Disease MADS Increased susceptibility 232 (2-57) 233
G896 Fusarium Disease Z- Increased susceptibility 234 (18-39)
LSDlike 235 G418 Pseudomonas Disease HB Increased tolerance 236
(500-560) 237 G525 Pseudomonas Disease NAC Increased tolerance 238
(23-167) 239 G1927 Sclerotinia Disease NAC Increased tolerance 240
(17-188) 241 G278 Sclerotinia Disease AKR Increased susceptibility
242 (2-593) 243 G594 Sclerotinia Disease HLH/ Increased
susceptibility 244 (140-204) MYC 245 G805 Sclerotinia Disease PCF
Increased susceptibility 246 (51-114)
TABLE-US-00007 TABLE 5 Smallest SEQ ID Test Sum NO GID Sequence ID
Probability Test Sequence Species Test Sequence GenBank Annotation
25 G720 BG450227 3.20E-31 [Medicago truncatula] NF015E11DT1F1087
Drought Medicago trunc 25 G720 AF318580 3.60E-26 [Zea mays]
putative transcription factor ZmGLK1 (Glk1) mRNA, 25 G720 AF318581
1.50E-22 [Oryza sativa] putative transcription factor OsGLK1 (Glk1)
mR 25 G720 AW906970 5.50E-20 [Solanum tuberosum] EST343197 potato
stolon, Cornell Universi 25 G720 BE330069 2.20E-15 [Glycine max]
so73a08.y1 Gm-c1040 Glycine max cDNA clone GENO 25 G720 AI896489
4.20E-15 [Lycopersicon esculentum] EST265932 tomato callus, TAMU
Lycop 25 G720 BI070070 4.70E-14 [Populus tremula .times. C013P55U
Populus stra Populus tremuloides] 25 G720 AW618051 3.10E-11
[Lycopersicon pennellii] EST314101 L. pennellii trichome, Cor 25
G720 BG049455 1.80E-09 [Sorghum bicolor] OV1_20_B11.g1_A002 Ovary 1
(OV1) Sorghum bi 25 G720 AW719680 1.20E-08 [Lotus japonicus]
LjNEST8C3r Lotus japonicus nodule library 5 25 G720 gi11177540
1.30E-28 [Zea mays] putative transcription factor Golden2. 25 G720
gi13940498 6.90E-28 [Oryza sativa] putative transcription factor
OsGLK1. 25 G720 gi4519671 5.60E-05 [Nicotiana tabacum] transfactor.
25 G720 gi6942190 0.0022 [Mesembryanthemum CDPK substrate protein
1; C crystallinum] 25 G720 gi5916207 0.0053 [Chlamydomonas
reinhardtii] regulatory protein of P-starvat 25 G720 gi1247386 0.23
[Nicotiana alata] PRP2. 25 G720 gi169878 0.24 [Sesbania rostrata]
nodulin. 25 G720 gi1808688 0.3 [Sporobolus stapfianus] hypothetical
protein. 25 G720 gi99948 0.61 [Glycine max] proline-rich protein 2
precursor - soybean. 25 G720 gi82091 0.7 [Lycopersicon esculentum]
hydroxyproline-rich glycoprotein 45 G1792 AI776626 1.20E-32
[Lycopersicon esculentum] EST257726 tomato resistant, Cornell 45
G1792 BF646324 1.30E-29 [Medicago truncatula] NF074E05EC1F1038
Elicited cell culture 45 G1792 BM178875 4.60E-29 [Glycine max]
saj60f01.y1 Gm-c1072 Glycine max cDNA clone SOY 45 G1792 AC025907
4.20E-27 [Oryza sativa] chromosome 10 clone nbxb0094K20, ***
SEQUENCIN 45 G1792 AP004623 1.90E-22 [Oryza sativa ( ) chromosome 8
clo (japonica cultivar-group)] 45 G1792 BM268956 2.10E-22 [Zea
mays] MEST402-H11.univ ISUM5-RN Zea mays cDNA clone MEST 45 G1792
AF245119 3.80E-22 [Mesembryanthemum AP2-related transcription fac
crystallinum] 45 G1792 BH517030 2.10E-21 [Brassica oleracea]
BOHRB76TF BOHR Brassica oleracea genomic 45 G1792 BM437083 5.00E-21
[Vitis vinifera] VVA014A06_53661 An expressed sequence tag da 45
G1792 BF275652 5.90E-21 [Gossypium arboreum] GA_Eb0024J23f
Gossypium arboreum 7-10 d 45 G1792 gi1732406 1.00E-24 [Nicotiana
tabacum] S25-XP1 DNA binding protein. 45 G1792 gi12597874 1.70E-24
[Oryza sativa] putative ethylene-responsive element binding 45
G1792 gi7528276 3.60E-24 [Mesembryanthemum AP2-related
transcription f crystallinum] 45 G1792 gi2213783 3.30E-23
[Lycopersicon esculentum] Pti5. 45 G1792 gi19034045 8.60E-23 [Oryza
sativa putative DNA bindi (japonica cultivar-group)] 45 G1792
gi8980313 8.60E-23 [Catharanthus roseus] AP2-domain DNA-binding
protein. 45 G1792 gi8809571 8.60E-23 [Nicotiana sylvestris]
ethylene-responsive element binding 45 G1792 gi17385636 5.50E-21
[Matricaria chamomilla] ethylene-responsive element binding 45
G1792 gi8571476 5.00E-20 [Atriplex hortensis] apetala2
domain-containing protein. 45 G1792 gi1688233 1.30E-19 [Solanum
tuberosum] DNA binding protein homolog. 175 G1756 AV423663 6.50E-34
[Lotus japonicus] AV423663 Lotus japonicus young plants (two- 175
G1756 AW596933 3.10E-30 [Glycine max] sj84f07.y1 Gm-c1034 Glycine
max cDNA clone GENO 175 G1756 AW447931 8.40E-24 [Triticum aestivum]
BRY_1082 BRY Triticum aestivum cDNA clone 175 G1756 BI266533
1.50E-22 [Medicago truncatula] NF100A09IN1F1097 Insect herbivory
Medic 175 G1756 AW218278 1.10E-19 [Lycopersicon esculentum]
EST303459 tomato radicle, 5 d post- 175 G1756 AP002744 2.60E-18
[Oryza sativa] genomic DNA, chromosome 1, PAC clone: P0006C01, 175
G1756 BG600477 3.00E-15 [Solanum tuberosum] EST505372 cSTS Solanum
tuberosum cDNA clo 175 G1756 gi11761072 7.10E-23 [Oryza sativa]
hypothetical protein. 175 G1756 gi4322940 3.10E-15 [Nicotiana
tabacum] DNA-binding protein 2. 175 G1756 gi1432056 9.00E-12
[Petroselinum crispum] WRKY3. 175 G1756 gi4894963 2.00E-11 [Avena
sativa] DNA-binding protein WRKY3. 175 G1756 gi927025 7.40E-11
[Cucumis sativus] SPF1-like DNA-binding protein. 175 G1756
gi13620227 2.50E-10 [Lycopersicon esculentum] hypothetical protein.
175 G1756 gi11993901 6.10E-10 [Dactylis glomerata] somatic
embryogenesis related protein. 175 G1756 gi1159877 7.20E-10 [Avena
fatua] DNA-binding protein. 175 G1756 gi484261 8.60E-10 [Ipomoea
batatas] SPF1 protein. 175 G1756 gi3420906 1.30E-09 [Pimpinella
brachycarpa] zinc finger protein; WRKY1. 113 G481 BG440251 9.00E-42
[Gossypium arboreum] GA_Ea0006K20f Gossypium arboreum 7-10 d 113
G481 BM887558 3.90E-41 [Glycine max] sam40c09.y1 Gm-c1068 Glycine
max cDNA clone SOY 113 G481 ZMNFYB 1.70E-40 [Zea mays] Z. mays mRNA
for CAAT-box DNA binding protein subun 113 G481 AI728916 2.40E-40
[Gossypium hirsutum] BNLGHil2022 Six-day Cotton fiber Gossypi 113
G481 AW775623 3.80E-40 [Medicago truncatula] EST334688 DSIL
Medicago truncatula cDNA 113 G481 AW738727 9.80E-40 [Lycopersicon
esculentum] EST340154 tomato flower buds, anthe 113 G481 BG599785
1.70E-38 [Solanum tuberosum] EST504680 cSTS Solanum tuberosum cDNA
clo 113 G481 BE413647 2.50E-38 [Triticum aestivum]
SCU001.E10.R990714 ITEC SCU Wheat Endospe 113 G481 BF065056
5.80E-38 [Hordeum vulgare] HV_CEb0022M01f Hordeum vulgare seedling
gre 113 G481 BG314203 1.00E-37 [Triticum monococcum]
WHE2460_E10_I20ZS Triticum monococcum i 113 G481 gi22380 1.10E-45
[Zea mays] CAAT-box DNA binding protein subunit B (NF-YB). 113 G481
gi15408794 2.60E-30 [Oryza sativa] putative CCAAT-binding
transcription factor 113 G481 gi16902054 1.00E-28 [Vernonia
galamensis] CCAAT-box binding factor HAP3 B domai 113 G481
gi16902050 2.70E-28 [Glycine max] CCAAT-box binding factor HAP3 B
domain. 113 G481 gi16902056 4.30E-28 [Argemone mexicana] CCAAT-box
binding factor HAP3 B domain. 113 G481 gi16902058 1.50E-23
[Triticum aestivum] CCAAT-box binding factor HAP3 B domain. 141
G2133 BE320193 1.20E-22 [Medicago truncatula] NF024B04RT1F1029
Developing root Medica 141 G2133 AP003379 2.10E-20 [Oryza sativa]
chromosome 1 clone P0408G07, *** SEQUENCING IN 141 G2133 BG832521
1.50E-16 [Pinus taeda] NXPV_073_H03_FNXPV (Nsf Xylem Planings wood
Ve 141 G2133 BG046836 1.50E-15 [Glycine max] saa62d08.y1 Gm-c1060
Glycine max cDNA clone GEN 141 G2133 BG321374 1.60E-15 [Descurainia
sophia] Ds01_06d08_R Ds01_AAFC_ECORC_cold_stress 141 G2133 BE432190
4.00E-15 [Lycopersicon esculentum] EST398719 tomato breaker fruit,
TIG 141 G2133 BI431368 6.70E-15 [Solanum tuberosum] EST534129 P.
infestans-challenged leaf So 141 G2133 AU085418 1.20E-14
[Cryptomeria japonica] AU085418 Cryptomeria japonica inner ba 141
G2133 BG446456 2.80E-14 [Gossypium arboreum] GA_Eb0034M18f
Gossypium arboreum 7-10 d 141 G2133 AI728590 3.10E-14 [Gossypium
hirsutum] BNLGHi11133 Six-day Cotton fiber Gossypi 141 G2133
gi8571476 2.50E-16 [Atriplex hortensis] apetala2 domain-containing
protein. 141 G2133 gi14140155 3.30E-15 [Oryza sativa] putative AP2
domain transcription factor. 141 G2133 gi5616086 3.00E-14 [Brassica
napus] dehydration responsive element binding pro 141 G2133
gi12225916 1.10E-13 [Zea mays] unnamed protein product. 141 G2133
gi10798644 4.20E-13 [Nicotiana tabacum] AP2 domain-containing
transcription fac 141 G2133 gi8980313 1.90E-12 [Catharanthus
roseus] AP2-domain DNA-binding protein. 141 G2133 gi2213785
1.30E-11 [Lycopersicon esculentum] Pti6. 141 G2133 gi6478845
7.30E-11 [Matricaria chamomilla] ethylene-responsive element
binding 141 G2133 gi12658319 1.20E-10 [Hordeum vulgare] CBF1-like
protein BCBF1. 141 G2133 gi8809573 1.50E-10 [Nicotiana sylvestris]
ethylene-responsive element binding 143 G2517 BI470088 1.50E-35
[Glycine max] saf38f09.y3 Gm-c1077 Glycine max cDNA clone GEN 143
G2517 BI208323 2.60E-31 [Lycopersicon esculentum] EST526363 cTOS
Lycopersicon esculen 143 G2517 BE445081 4.40E-28 [Triticum
aestivum] WHE1131_B06_D11ZS Wheat etiolated seedlin 143 G2517
AV408330 2.40E-26 [Lotus japonicus] AV408330 Lotus japonicus young
plants (two- 143 G2517 BE362650 7.10E-26 [Sorghum bicolor]
DG1_88_H02.b1_A002 Dark Grown 1 (DG1) Sorgh 143 G2517 BI308031
4.70E-25 [Medicago truncatula] EST529441 GPOD Medicago truncatula
cDNA 143 G2517 AP002839 2.00E-23 [Oryza sativa] genomic DNA,
chromosome 1, PAC clone: P0688A04, 143 G2517 BE216050 4.60E-21
[Hordeum vulgare] HV_CEb0009E04f Hordeum vulgare seedling gre 143
G2517 BG889690 8.70E-21 [Solanum tuberosum] EST515541 cSTD Solanum
tuberosum cDNA clo 143 G2517 L35779 7.50E-19 [Brassica rapa]
BNAESTG Mustard flower buds Brassica rapa cDN 143 G2517 gi11761085
2.10E-25 [Oryza sativa] putative DNA-binding protein homolog. 143
G2517 gi9187622 1.10E-20 [Solanum tuberosum] WRKY DNA binding
protein. 143 G2517 gi4322940 6.70E-17 [Nicotiana tabacum]
DNA-binding protein 2. 143 G2517 gi1432058 5.40E-15 [Petroselinum
crispum] WRKY2. 143 G2517 gi1159877 5.10E-14 [Avena fatua]
DNA-binding protein. 143 G2517 gi3420906 5.80E-13 [Pimpinella
brachycarpa] zinc finger protein; WRKY1. 143 G2517 gi13620227
1.50E-12 [Lycopersicon esculentum] hypothetical protein. 143 G2517
gi927025 6.40E-12 [Cucumis sativus] SPF1-like DNA-binding protein.
143 G2517 gi4894963 1.40E-11 [Avena sativa] DNA-binding protein
WRKY3. 143 G2517 gi6723482 4.70E-11 [Betula pendula] wrky-type DNA
binding protein. 81 G2140 AI488313 4.80E-59 [Lycopersicon
esculentum] EST246635 tomato ovary, TAMU Lycope 81 G2140 BE020519
6.10E-55 [Glycine max] sm44g03.y1 Gm-c1028 Glycine max cDNA clone
GENO 81 G2140 AU093196 9.70E-46 [Oryza sativa subsp. AU093196 Rice
callus Oryza sat japonica] 81 G2140 AP003908 8.00E-39 [Oryza
sativa] chromosome 8 clone OJ1300_C09, *** SEQUENCING 81 G2140
BF647687 5.30E-37 [Medicago truncatula] NF025A04EC1F1024 Elicited
cell culture 81 G2140 AI054433 1.70E-26 [Mesembryanthemum R6-R97
Ice plant Lambda Uni-Z crystallinum] 81 G2140 BE922838 1.70E-24
[Solanum tuberosum] EST426607 potato leaves and petioles Sola 81
G2140 AU085144 1.80E-16 [Cryptomeria japonica] AU085144 Cryptomeria
japonica inner ba 81 G2140 BG275442 1.90E-13 [Pinus taeda]
NXSI_141_F07_F NXSI (Nsf Xylem Side wood Inclin 81 G2140 BE051300
6.30E-13 [Zea mays] za74h04.b50 Maize Glume cDNAs Library Zea mays
cDN 81 G2140 gi8570062 1.70E-27 [Oryza sativa] ESTs C26093(C11622),
AU090634(C12429) corresp 81 G2140 gi527655 0.00014 [Pennisetum
glaucum] myc-like regulatory R gene product. 81 G2140 gi22472
0.0055 [Zea mays] R-S protein (AA 1-612). 81 G2140 gi527665 0.017
[Sorghum bicolor] myc-like regulatory R gene product. 81 G2140
gi1086526 0.058 [Oryza australiensis] transcriptional activator Ra
homolog. 81 G2140 gi1086534 0.081 [Oryza officinalis]
transcriptional activator Ra
homolog. 81 G2140 gi10998404 0.15 [Petunia .times. hybrida]
anthocyanin 1. 81 G2140 gi527663 0.15 [Tripsacum australe] myc-like
regulatory R gene product. 81 G2140 gi1086536 0.4 [Oryza rufipogon]
transcriptional activator Ra homolog. 81 G2140 gi1086530 0.49
[Oryza longistaminata] transcriptional activator Ra homolog 49
G1946 LPHSF8 1.10E-119 [Lycopersicon peruvianum] L. peruvianum
Lp-hsf8 mRNA for heat 49 G1946 AC087771 4.10E-112 [Medicago
truncatula] clone 8D15, *** SEQUENCING IN PROGRESS 49 G1946 LEHSF8
5.90E-103 [Lycopersicon esculentum] L. esculentum Le-hsf8 gene for
heat 49 G1946 AW569138 3.10E-75 [Glycine max] si63g09.y1 Gm-r1030
Glycine max cDNA clone GENO 49 G1946 BG890899 1.30E-70 [Solarium
tuberosum] EST516750 cSTD Solanum tuberosum cDNA clo 49 G1946
AC027658 4.60E-53 [Oryza sativa] subsp. japonica BAC nbxb0006I13,
chromosome 10 49 G1946 AV833112 4.90E-52 [Hordeum vulgare AV833112
K. Sato unpublished subsp. vulgare] 49 G1946 gi19492 2.80E-121
[Lycopersicon peruvianum] heat shock transcription factor 8 49
G1946 gi19260 5.10E-106 [Lycopersicon esculentum] heat stress
transcription factor 49 G1946 gi662924 2.00E-47 [Glycine max] heat
shock transcription factor 21. 49 G1946 gi5821138 9.70E-46
[Nicotiana tabacum] heat shock factor. 49 G1946 gi11761077 2.90E-40
[Oryza sativa] putative heat shock factor protein 1 (HSF 1) 49
G1946 gi886742 3.20E-40 [Zea mays] heat shock factor. 49 G1946
gi7158882 2.70E-38 [Medicago sativa] heat shock transcription
factor. 49 G1946 gi3550588 1.90E-30 [Pisum sativum] heat shock
transcription factor (HSFA). 49 G1946 gi100546 0.46 [Avena sativa]
avenin precursor - oat. 49 G1946 gi14190783 1 [Apium graveolens]
putative phloem transcription factor M1. 71 G1852 AF220204 2.00E-95
[Malus domestica] unknown mRNA. 71 G1852 BG597959 3.30E-95 [Solanum
tuberosum] EST496637 cSTS Solanum tuberosum cDNA clo 71 G1852
AC077693 4.50E-93 [Oryza sativa] chromosome 10 clone OSJNBa0095C07,
*** SEQUENC 71 G1852 BG445922 5.90E-91 [Gossypium arboreum]
GA_Ea0030A23f Gossypium arboreum 7-10 d 71 G1852 BG581705 1.60E-90
[Medicago truncatula] EST483440 GVN Medicago truncatula cDNA 71
G1852 BF009089 5.30E-86 [Glycine max] ss73d04.y1 Gm-c1062 Glycine
max cDNA clone GENO 71 G1852 BE434670 2.20E-71 [Lycopersicon
esculentum] EST405748 tomato breaker fruit, TIG 71 G1852 BG317894
5.90E-56 [Pinus taeda] NXPV_006_H10_F NXPV (Nsf Xylem Planings wood
Ve 71 G1852 AV422410 1.20E-55 [Lotus japonicus] AV422410 Lotus
japonicus young plants (two- 71 G1852 AI055434 1.20E-50 [Gossypium
hirsutum] coau0003P22 Cotton Boll Abscission Zone 71 G1852
gi5734619 1.30E-103 [Oryza sativa] Similar to Arabidopsis thaliana
BAC F15P23 ( 71 G1852 gi6752888 1.80E-98 [Malus .times. domestica]
unknown. 71 G1852 gi498042 0.81 [Senecio odorus] ORF. 71 G1852
gi4432741 1 [Dioscorea tenuipes] phosphoglucose isomerase. 95 G325
AB001888 9.20E-43 [Oryza sativa] mRNA for zinc finger protein,
complete cds, 95 G325 BE558327 5.40E-30 [Hordeum vulgare]
HV_CEb0017D19f Hordeum vulgare seedling gre 95 G325 BG644908
1.80E-29 [Medicago truncatula] EST506527 KV3 Medicago truncatula
cDNA 95 G325 BG605313 3.10E-29 [Triticum aestivum]
WHE2331_C04_F07ZS Wheat pre-anthesis spik 95 G325 BG459023 1.60E-28
[Zea mays] 947052H08.y1 947 - 2 week shoot from Barkan lab Ze 95
G325 BG590826 3.20E-28 [Solanum tuberosum] EST498668 P.
infestans-challenged leaf So 95 G325 BG412316 4.40E-27 [Sorghum
bicolor] OV2_40_D10.b1_A002 Ovary 2 (OV2) Sorghum bi 95 G325
BG127619 1.50E-25 [Lycopersicon esculentum] EST473181 tomato
shoot/meristem Lyc 95 G325 AW399335 7.70E-22 [Lycopersicon
pennellii] EST309835 L. pennellii trichome, Cor 95 G325 AW780799
3.90E-21 [Glycine max] sl76c08.y1 Gm-c1027 Glycine max cDNA clone
GENO 95 G325 gi3618320 5.60E-49 [Oryza sativa] zinc finger protein.
95 G325 gi3341723 1.40E-13 [Raphanus sativus] CONSTANS-like 1
protein. 95 G325 gi11037311 5.00E-13 [Brassica nigra] constans-like
protein. 95 G325 gi2303683 6.00E-13 [Brassica napus] unnamed
protein product. 95 G325 gi4091806 2.80E-12 [Malus .times.
domestica] CONSTANS-like protein 2. 95 G325 gi10946337 7.00E-11
[Ipomoea nil] CONSTANS-like protein. 95 G325 gi4557093 6.50E-10
[Pinus radiata] zinc finger protein. 17 G2583 AW928465 1.40E-43
[Lycopersicon esculentum] EST337253 tomato flower buds 8 mm t 17
G2583 BE023297 2.40E-42 [Glycine max] sm80e10.y1 Gm-c1015 Glycine
max cDNA clone GENO 17 G2583 AP003615 1.60E-30 [Oryza sativa]
chromosome 6 clone P0486H12, *** SEQUENCING IN 17 G2583 AU088998
2.90E-21 [Lotus japonicus] AU088998 Lotus japonicus flower bud cDNA
Lo 17 G2583 AT001828 4.60E-20 [Brassica rapa subsp. AT001828 Flower
bud cDNA Br pekinensis] 17 G2583 BG415973 2.40E-18 [Hordeum
vulgare] HVSMEk0009E06f Hordeum vulgare testa/perica 17 G2583
BF647090 3.80E-17 [Medicago truncatula] NF007A06EC1F1038 Elicited
cell culture 17 G2583 BG560598 2.90E-16 [Sorghum propinquum]
RHIZ2_59_D07.b1_A003 Rhizome2 (RHIZ2) So 17 G2583 AW011200 6.60E-16
[Pinus taeda] ST17H08 Pine TriplEx shoot tip library Pinus ta 17
G2583 BF479478 1.60E-15 [Mesembryanthemum crystallinum] L48-3155T3
Ice plant Lambda U 17 G2583 gi19507 1.40E-16 [Lupinus polyphyllus]
put. pPLZ2 product (AA 1-164). 17 G2583 gi10798644 1.00E-12
[Nicotiana tabacum] AP2 domain-containing transcription fac 17
G2583 gi8571476 4.70E-12 [Atriplex hortensis] apetala2
domain-containing protein. 17 G2583 gi2213783 8.40E-12
[Lycopersicon esculentum] Pti5. 17 G2583 gi8809573 5.30E-11
[Nicotiana sylvestris] ethylene-responsive element binding 17 G2583
gi4099914 8.40E-11 [Stylosanthes hamata] ethylene-responsive
element binding p 17 G2583 gi6478845 8.90E-11 [Matricaria
chamomilla] ethylene-responsive element binding 17 G2583 gi15290041
9.40E-11 [Oryza sativa] hypothetical protein. 17 G2583 gi12225884
1.70E-10 [Zea mays] unnamed protein product. 17 G2583 gi3264767
3.40E-10 [Prunus armeniaca] AP2 domain containing protein. 21 G1322
AW032656 3.60E-43 [Lycopersicon esculentum] EST276215 tomato
callus, TAMU Lycop 21 G1322 BF649523 5.40E-42 [Medicago truncatula]
NF080G02EC1F1019 Elicited cell culture 21 G1322 BG369720 1.50E-41
[Hordeum vulgare] HVSMEi0025K10f Hordeum vulgare 20 DAP spike 21
G1322 BF325282 2.60E-41 [Glycine max] su20e03.y1 Gm-c1066 Glycine
max cDNA clone GENO 21 G1322 CPU33917 6.40E-41 [Craterostigma
plantagineum] myb-related transcription factor 21 G1322 AW255388
2.40E-40 [Mentha .times. piperita] ML407 peppermint glandular
trichome Menth 21 G1322 AB052230 1.30E-39 [Arabis gemmifera] gene
for MYB transcription factor Atmyb2, 21 G1322 AY026332 9.40E-39
[Oryza sativa] Myb transcription factor JAMyb mRNA, complete 21
G1322 PSMYB26 1.10E-37 [Pisum sativum] P. sativum mRNA for Myb-like
protein (Myb26). 21 G1322 AI055122 4.30E-37 [Gossypium hirsutum]
coau0003B15 Cotton Boll Abscission Zone 21 G1322 gi1002796 5.50E-49
[Craterostigma plantagineum] Cpm10. 21 G1322 gi13177578 3.00E-46
[Oryza sativa] Myb transcription factor JAMyb. 21 G1322 gi1841475
1.50E-39 [Pisum sativum] Myb26. 21 G1322 gi14249015 9.00E-39
[Gossypium hirsutum] myb-like transcription factor Myb 5. 21 G1322
gi82306 3.10E-37 [Antirrhinum majus] myb protein 305 - garden
snapdragon. 21 G1322 gi8247759 7.40E-34 [Triticum aestivum] GAMyb
protein. 21 G1322 gi2130046 2.30E-33 [Hordeum vulgare] MybHv5
protein - barley. 21 G1322 gi15082210 7.50E-33 [Fragaria .times.
ananassa] transcription factor MYB1. 21 G1322 gi5139806 1.10E-31
[Glycine max] GmMYB29A2. 21 G1322 gi1732247 2.90E-31 [Nicotiana
tabacum] transcription factor Myb1. 23 G303 BE021887 5.70E-28
[Glycine max] sm63g05.y1 Gm-c1028 Glycine max cDNA clone GENO 23
G303 BI480474 8.60E-28 [Triticum aestivum] WHE2903_F02_L03ZS Wheat
aluminum-stressed 23 G303 AC079935 5.40E-27 [Oryza sativa] clone
OSJNBa0095C06, *** SEQUENCING IN PROGRES 23 G303 AW573949 1.50E-22
[Medicago truncatula] EST316540 GVN Medicago truncatula cDNA 23
G303 BF200153 1.30E-21 [Triticum monococcum] WHE2252_F02_K04ZE
Triticum monococcum s 23 G303 CAR011013 2.20E-18 [Cicer arietinum]
epicotyl EST, clone Can133. 23 G303 BE357342 2.60E-11 [Sorghum
bicolor] DG1_148_D06.g1_A002 Dark Grown 1 (DG1) Sorg 23 G303
BG275269 3.10E-11 [Pinus taeda] NXSI_138_F10_F NXSI (Nsf Xylem Side
wood Inclin 23 G303 BF588006 7.50E-10 [Sorghum propinquum]
FM1_35_E08.g1_A003 Floral-Induced Merist 23 G303 AI491136 2.00E-09
[Lycopersicon esculentum] EST241845 tomato shoot, Cornell Lyc 23
G303 gi3641870 1.40E-22 [Cicer arietinum] hypothetical protein. 23
G303 gi1086538 9.60E-05 [Oryza rufipogon] transcriptional activator
Rb homolog. 23 G303 gi1086534 0.00082 [Oryza officinalis]
transcriptional activator Ra homolog. 23 G303 gi527661 0.0015
[Phyllostachys acuta] myc-like regulatory R gene product. 23 G303
gi527653 0.005 [Pennisetum glaucum] myc-like regulatory R gene
product. 23 G303 gi22195 0.0078 [Zea mays] regulatory protein. 23
G303 gi13161337 0.014 [Oryza sativa] putative transcription
activator. 23 G303 gi10998404 0.014 [Petunia .times. hybrida]
anthocyanin 1. 23 G303 gi1086526 0.052 [Oryza australiensis]
transcriptional activator Ra homolog. 23 G303 gi527665 0.072
[Sorghum bicolor] myc-like regulatory R gene product. 239 G1927
BG350410 3.30E-63 [Solarium tuberosum] 091B07 Mature tuber lambda
ZAP Solanum tu 239 G1927 BF066070 8.80E-48 [Hordeum vulgare]
HV_CEb0014M06f Hordeum vulgare seedling gre 239 G1927 AW736414
1.80E-47 [Medicago truncatula] EST332428 KV3 Medicago truncatula
cDNA 239 G1927 BG159075 7.10E-47 [Sorghum propinquum]
RHIZ2_17_E07.b1_A003 Rhizome2 (RHIZ2) So 239 G1927 BI543350
7.70E-39 [Beta vulgaris] S1A_F6 Sugar Beet peroxide germination
cDNA 1 239 G1927 BE131060 9.20E-38 [Mesembryanthemum L48-1010T3 Ice
plant Lambda U crystallinum] 239 G1927 BI140602 1.00E-37 [Sorghum
bicolor] IP1_51_D12.b1_A002 Immature pannicle 1 (IP1 239 G1927
AI779001 4.30E-37 [Lycopersicon esculentum] EST259880 tomato
susceptible, Corne 239 G1927 BF484725 6.40E-36 [Triticum aestivum]
WHE2319_A01_B01ZS Wheat pre-anthesis spik 239 G1927 BE449422
7.30E-35 [Lycopersicon hirsutum] EST356181 L. hirsutum trichome,
Corne 239 G1927 gi7716952 4.10E-40 [Medicago truncatula] NACl. 239
G1927 gi6175246 1.10E-35 [Lycopersicon esculentum] jasmonic acid 2.
239 G1927 gi15148914 4.70E-35 [Phaseolus vulgaris] NAC domain
protein NAC2. 239 G1927 gi1279640 3.30E-34 [Petunia .times.
hybrida] NAM. 239 G1927 gi6730938 4.70E-34 [Oryza sativa] OsNAC4
protein. 239 G1927 gi4485513 4.10E-31 [Solanum tuberosum] putative
NAC domain protein. 239 G1927 gi6732156 4.20E-31 [Triticum
monococcum] unnamed protein product. 239 G1927 gi4218535 1.30E-30
[Triticum sp.] GRAB1 protein. 239 G1927 gi4996349 6.30E-25
[Nicotiana tabacum] NAC-domain protein. 239 G1927 gi2982275
2.60E-08 [Picea mariana] ATAF1-like protein. 53 G226 EE451172
1.00E-43 [Brassica napus] BNBS2DCT Brassica napus cDNA 5-, mRNA
sequence 53 G226 AC189293 4.00E-31 [Brassica rapa] Brassica rapa
subsp. pekinensis clone KBrB026F 53 G226 CS49378 6.00E-15 [Vitis
vinifera] Sequence 664 from Patent WO2006130156 53 G226 AI495284
1.10E-14 [Glycine max] sa90e06.y1 Gm-c1004 Glycine max cDNA clone
GENO 53 G226 DW174878 1.00E-09 [Lactuca virosa] CLVZ637.b1_I16.ab1
CLV(XYZ) lettuce virosa Lactuca virosa 53 G226 CO051707.1 5.00E-06
[Malus .times. domestica] Mdfw2055b05 5- similar to TR: O22059
O22059 PUTATIVE 53 G226 CV241641 8.00E-05 [Populus trichocarpa]
WS02512_N01 3-, mRNA sequence 53 G226 BE412359 3.30E-05 [Triticum
aestivum] JJL005.E04R990604 ITEC JJL Wheat Leaf Lib
53 G226 BF617445 9.60E-05 [Hordeum vulgare] HVSMEc0017G08f Hordeum
vulgare seedling sho 53 G226 AP002843 2.30E-03 [Oryza sativa]
genomic DNA, chromosome 1, PAC clone: P0407B12. 53 G226 gi54290864
4.00E-12 [Oryza sativa] BAD61525 hypothetical protein [Oryza sativa
53 G226 gi7446159 2.00E-09 [Gossypium hirsutum] T09744 myb-related
protein - upland cotton 53 G226 gi2921334 2.00E-09 [Gossypium
hirsutum] MYB-like DNA-binding domain protein 53 G226 gi15082210
8.00E-09 [Fragaria .times. ananassa] transcription factor MYB1
[Fragaria .times. ananassa] 53 G226 gi29824962 1.00E-08 [Anthurium
andraeanum] putative flavonoid/anthocyanin regulator 53 G226
gi29569834 1.00E-08 [Zea mays] myb-related protein c1-I-2K1 [Zea
mays] 53 G226 gi15042124 1.70E-05 [Zea luxurians] CI protein 53
G226 gi14701793 5.40E-05 [Sorghum bicolor] Myb1-like protein. 53
G226 gi14701793 5.10E-04 [Petunia axillaris] An2 truncated protein
53 G226 gi14269335 7.60E-04 [Gossypium herbaceum] myb-like
transcription factor Myb 3
Sequence CWU 0 SQTB SEQUENCE LISTING The patent application
contains a lengthy "Sequence Listing" section. A copy of the
"Sequence Listing" is available in electronic form from the USPTO
web site
(http://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20100083395A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
0 SQTB SEQUENCE LISTING The patent application contains a lengthy
"Sequence Listing" section. A copy of the "Sequence Listing" is
available in electronic form from the USPTO web site
(http://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20100083395A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
* * * * *
References