U.S. patent application number 12/548366 was filed with the patent office on 2010-04-01 for kim-1 antagonists and use to modulate immune system.
This patent application is currently assigned to BIOGEN IDEC MA INC.. Invention is credited to Paul D. Rennert.
Application Number | 20100080798 12/548366 |
Document ID | / |
Family ID | 32713106 |
Filed Date | 2010-04-01 |
United States Patent
Application |
20100080798 |
Kind Code |
A1 |
Rennert; Paul D. |
April 1, 2010 |
KIM-1 ANTAGONISTS AND USE TO MODULATE IMMUNE SYSTEM
Abstract
The use of KIM-1 antagonists to inhibit signaling between a T
cell and a second cell, e.g., an antigen-presenting cell, is
disclosed. Such inhibition is useful for treatment of diseases
including various autoimmune diseases and graft-versus-host
disease. Also disclosed is the use of a KIM-1 antagonist to inhibit
secretion of IFN-.gamma. by lymphocytes or other immune cells in a
mammal. Inhibition of IFN-.gamma. is useful for treatment of
inflammatory diseases or disorders, e.g., inflammatory bowel
disease.
Inventors: |
Rennert; Paul D.;
(Holliston, MA) |
Correspondence
Address: |
FISH & RICHARDSON
P.O. BOX 1022
MINNEAPOLIS
MN
55440-1022
US
|
Assignee: |
BIOGEN IDEC MA INC.
Cambridge
MA
|
Family ID: |
32713106 |
Appl. No.: |
12/548366 |
Filed: |
August 26, 2009 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
10540959 |
Apr 4, 2006 |
7597887 |
|
|
PCT/US2003/041294 |
Dec 29, 2003 |
|
|
|
12548366 |
|
|
|
|
60436934 |
Dec 30, 2002 |
|
|
|
Current U.S.
Class: |
424/130.1 ;
424/178.1 |
Current CPC
Class: |
C07K 16/2803 20130101;
A61P 1/04 20180101; A61P 21/04 20180101; A61K 49/0008 20130101;
A61P 9/00 20180101; A61P 1/00 20180101; A61P 9/14 20180101; A61P
13/12 20180101; A61P 35/00 20180101; C07K 2317/76 20130101; A61P
37/06 20180101; C07K 2319/32 20130101; C07K 2319/30 20130101; A61P
7/06 20180101; A61P 37/00 20180101; A61K 2039/505 20130101; C07K
14/70503 20130101; A61P 29/00 20180101; A61K 47/60 20170801; A61P
43/00 20180101 |
Class at
Publication: |
424/130.1 ;
424/178.1 |
International
Class: |
A61K 39/395 20060101
A61K039/395 |
Claims
1. A method of inhibiting signaling between a T cell and a second
cell participating in an immune response in a mammal, comprising:
(a) identifying a mammal selected from the group consisting of a
mammal with an immune disease or disorder and a mammal in
preparation for a tissue graft; and (b) administering to the mammal
an effective amount of a KIM-1 antagonist selected from the group
consisting of: (i) a polypeptide comprising a KIM-1 Ig domain, and
lacking a transmembrane domain and a KIM-1 cytoplasmic domain; (ii)
an anti-KIM-1 antibody; and (iii) an antigen-binding fragment of an
anti-KIM-1 antibody.
2. The method of claim 1, wherein the second cell is an antigen
presenting cell (APC).
3. The method of claim 1, wherein the T cell is an activated T
cell.
4. The method of claim 1, wherein the T cell is a T helper
cell.
5. The method of claim 4, wherein the T helper cell is a Th2
cell.
6. The method of claim 1, wherein the T cell is a grafted, donor T
cell.
7. The method of claim 1, wherein the APC is selected from the
group consisting of a monocyte, a macrophage, a dendritic cell, and
a B cell.
8. The method of claim 1, wherein the APC is presenting an
autoantigen.
9. The method of claim 1, wherein the polypeptide further comprises
a KIM-1 mucin domain.
10. The method of claim 1 wherein the polypeptide further comprises
a heterologous moiety.
11. The method of claim 10, wherein the heterologous moiety is
selected from the group consisting of an immunoglobulin (Ig)
moiety, a serum albumin moiety, a targeting moiety, a reporter
moiety, and a purification-facilitating moiety.
12. The method of claim 11, wherein the heterologous moiety is an
Ig moiety.
13. The method of claim 12, wherein the Ig moiety is an Fc
moiety.
14. The method of claim 1, wherein the polypeptide is conjugated to
a polymer.
15. The method of claim 14, wherein the polymer is selected from
the group consisting of a polyalkylene glycol, a sugar polymer, and
a polypeptide.
16. The method of claim 15, wherein the polymer is a polyalkylene
glycol.
17. The method of claim 16, wherein the polyalkylene glycol is
polyethylene glycol (PEG).
18. The method of claim 17, wherein the average molecular weight of
the polymer is from 2,000 Da to 30,000 Da.
19. The method of claim 18, wherein the average molecular weight of
the polymer is from 5,000 Da to 20,000 Da.
20. The method of claim 19, wherein the average molecular weight of
the polymer is about 10,000 Da.
21. A method of inhibiting activation of a B cell in a mammal,
comprising contacting the B cell with an effective amount of a
KIM-1 antagonist selected from the group consisting of: (a) a
polypeptide comprising a KIM-1 Ig domain, and lacking a
transmembrane domain and a KIM-1 cytoplasmic domain; (b) an
anti-KIM-1 antibody; and (c) an antigen-binding fragment of an
anti-KIM-1 antibody.
22. The method of claim 21, wherein the activation of the B cell is
mediated by an activated T cell.
23. The method of claim 22, wherein the activated T cell is a Th2
cell.
24. The method of claim 22, wherein the activated T cell is a
grafted, donor T cell.
25. A method of inhibiting production in a mammal of a subset of
antibodies against one or more antigens, comprising administering
an effective amount of a KIM-1 antagonist selected from the group
consisting of: (a) a polypeptide comprising a KIM-1 Ig domain, and
lacking a transmembrane domain and a KIM-1 cytoplasmic domain; (b)
an anti-KIM-1 antibody; and (c) an antigen-binding fragment of an
anti-KIM-1 antibody.
26. The method of claim 25, wherein the antibodies are of the IgG
class.
27. The method of claim 26, wherein the antibodies are of IgG1
subclass.
28. The method of claim 27, wherein the effective amount of the
polypeptide is administered to the mammal between 30 minutes and 30
days before the immune system of the mammal first recognizes the
one or more antigens.
29. The method of claim 28, wherein the one or more antigens are
alloantigens.
30. The method of claim 28, wherein the one or more antigens are
autoantigens.
31. The method of claim 28, wherein the immune system of the mammal
first recognizes the one or more antigens as part of an epitope
spreading process in the course of an autoimmune disease.
32. A method of inhibiting epitope spreading in an autoimmune
disease, comprising administering an effective amount of a KIM-1
antagonist selected from the group consisting of: (a) a polypeptide
comprising a KIM-1 Ig domain, and lacking a transmembrane domain
and a KIM-1 cytoplasmic domain; (b) an anti-KIM-1 antibody; and (c)
an antigen-binding fragment of an anti-KIM-1 antibody.
33. A method of treating a Th2 cell-mediated disease, comprising
administering an effective amount of a KIM-1 antagonist selected
from the group consisting of: (a) a polypeptide comprising a KIM-1
Ig domain, and lacking a transmembrane domain and a KIM-1
cytoplasmic domain; (b) an anti-KIM-1 antibody; and (c) an
antigen-binding fragment of an anti-KIM-1 antibody.
34. The method of claim 33, wherein the Th2 cell-mediated disease
is selected from the group consisting of myasthenia gravis,
autoimmune hemolytic anemia, Chagas disease, Graves disease,
idiopathic thrombocytopenia purpura (ITP), Wegener's
granulomatosis, polyarteritis nodosa, rapidly progressive
crescentic glomerulonephritis, graft-versus-host disease (GVHD),
and systemic lupus nephritis (SLE).
35. A method of inhibiting GVHD, comprising administering an
effective amount of a KIM-1 antagonist selected from the group
consisting of: (a) a polypeptide comprising a KIM-1 Ig domain, and
lacking a transmembrane domain and a KIM-1 cytoplasmic domain; (b)
an anti-KIM-1 antibody; and (c) an antigen-binding fragment of an
anti-KIM-1 antibody.
36. A polypeptide comprising a KIM-1 Ig domain and an Fc moiety,
and lacking a transmembrane domain and a KIM-1 cytoplasmic
domain.
37. A method of inhibiting secretion of IFN-.gamma. by lymphocytes
in a mammal, comprising administering to the mammal an effective
amount of a KIM-1 antagonist.
38. A method of treating an inflammatory disease or disorder in a
mammal, comprising administering to the mammal an effective amount
of a KIM-1 antagonist.
39. The method of claim 38, wherein the inflammatory disease or
disorder is inflammatory bowel disease.
40. The method of claim 38, wherein the inflammatory disease or
disorder is acute or chronic inflammation.
41. The method of claim 4, wherein the T helper cell is a Th1 cell.
Description
FIELD OF THE INVENTION
[0001] The field of the invention is medicine, immunology,
molecular biology and protein chemistry.
BACKGROUND OF THE INVENTION
[0002] KIM-1 (Kidney injury Molecule-1) is a type I cell membrane
glycoprotein (Ichimura et al., 1998, J. Biol. Chem. 273:4135-4142).
The extracellular portion (ectodomain) of KIM-1 contains a
six-cysteine immunoglobulin-like domain and a T/SP rich domain
characteristic of mucin-like O-glycosylated proteins. The mucin
domain extends the Ig-like domain away from the cell surface like a
stalk (Jentoft, 1990, Trends Biochem. Sci. 15:291-294). KIM-1 has
been identified as the receptor for hepatitis A virus (Kaplan et
al., 1996, EMBO J. 15:4282-4296; WO 96/04376; U.S. Pat. No.
5,622,861). Two human KIM-1 splice variants have been discovered,
with one being predominant in the liver (Feigelstock, 1998, J.
Virol. 72:6621-6628), and the other being predominant in the kidney
(Ichimura et al., supra).
[0003] KIM-1 is a member of a gene family known as the TIM (T cell
Immunoglobulin and Mucin domain) family. In addition to KIM-1,
there are at least two other members of the TIM family in humans.
One member was cloned and originally designated the "200 gene"
(WO200073498), but subsequently came to be known as TIM-3. Another
member was cloned and designated "gene 58" (WO99/38881).
[0004] KIM-1 has attracted interest as a clinical diagnostic marker
for kidney damage (Bailly et al., 2002, J. Biol. Chem.
277:39739-39748; Han et al., 2002, Kidney Intl. 62:237-244). A
mouse homolog of KIM-1 (TIM-1) has been reported to exist within a
genetic locus thought to be involved in the development of airway
hyperreactivity (McIntire et al., 2001, Nature Immunology 2:1109).
A mouse protein known as TIM-2 has been reported to play a role in
the in vivo generation of antigen-specific T cells (Kumanogoh et
al., 2002, Nature 419:629-633). A mouse protein known as TIM-3 has
been associated with immune response regulation in mice (Monney et
al., 2002. Nature 415:536-541).
SUMMARY OF THE INVENTION
[0005] It has been discovered that treatment of a mammal with a
KIM-1 antagonist alters the interaction of T cells with other
immune system cells, e.g., dendritic cells, monocytes macrophages,
and B cells, and thereby strongly suppresses an IgG response to an
antigen. In addition, it has been discovered that such treatment
almost eliminates IgG1 production by memory B cells in response to
subsequent challenge with the antigen. In addition, it has been
discovered that blockade of the binding of KIM-1 to its receptor
reduces secretion of IFN-.gamma. by immune cells engaged in an
antigen response in the mixed lymphocyte response (MLR) assay.
Based on these discoveries, the invention provides methods for
therapeutically modulating immune function in autoimmune diseases
and other disorders of the mammalian immune system.
[0006] The invention provides a method of inhibiting signaling
between a T cell and a second cell, e.g., an antigen-presenting
cell (APC), in a mammal. The method includes identifying a mammal,
e.g., one with an immune disease or disorder, or one preparing to
receive a tissue graft; and administering to the mammal an
effective amount of one of the following types of KIM-1 antagonist:
(a) a polypeptide comprising a KIM-1 Ig domain, and lacking a
transmembrane domain and a KIM-1 cytoplasmic domain; (b) an
anti-KIM-1 antibody; and (c) an antigen-binding fragment of an
anti-KIM-1 antibody.
[0007] The T cell may be an activated T cell, e.g., a T helper
cell. It can be a Th2 cell or a Th1 cell. In some embodiments of
the invention the T cell is a grafted, donor T cell. The APC can
be, but is not limited to, a monocyte, a macrophage, a dendritic
cell, or a B cell. In some embodiments of the invention, the APC is
presenting an autoantigen.
[0008] Preferably, the KIM-1 antagonist is a soluble polypeptide,
which can include a KIM-1 mucin domain in addition to the KIM-1 Ig
domain. In some embodiments the polypeptide includes a heterologous
moiety, e.g., an immunoglobulin (Ig) moiety, a serum albumin
moiety, a targeting moiety, a reporter moiety, a multimerization
moiety, and a purification-facilitating moiety. A preferred
heterologous moiety is an Ig moiety such as an Fc moiety.
[0009] In some embodiments the KIM-1 antagonist is a polypeptide
conjugated to a polymer such as polyalkylene glycol, a sugar
polymer, or a polypeptide. A preferred polymer is a polyalkylene
glycol, with polyethylene glycol (PEG) being particularly
preferred. The average molecular weight of the polymer preferably
is from 2,000 Da to 30,000 Da., and more preferably from 5,000 Da
to 20,000 Da., e.g., about 10,000 Da.
[0010] The invention provides a method of inhibiting activation of
a B cell in a mammal, e.g., by an activated T cell such as a Th2
cell. The method includes contacting the B cell or other APC with
an effective amount of a KIM-1 antagonist, or the T cell, if the
antagonist is an anti-KIM-1 antibody. In some embodiments of the
invention, the activated T cell is a grafted, donor T cell.
[0011] The invention provides a method of inhibiting production in
a mammal of a subset of antibodies such as IgG, e.g., IgG1,
reactive against one or more antigens. The method includes
administering an effective amount of a KIM-1 antagonist. In some
embodiments the effective amount of the KIM-1 antagonist is
administered between 30 minutes and 30 days before the immune
system of the mammal first recognizes the one or more antigens. The
antigens are autoantigens or autoantigens, depending on the
disease, disorder or condition being treated.
[0012] The invention provides a method of inhibiting disease
relapse in an autoimmune disease. The method includes administering
an effective amount of a KIM-1 antagonist.
[0013] The invention provides a method of inhibiting epitope
spreading in an autoimmune disease. The method includes
administering an effective amount of a KIM-1 antagonist.
[0014] The invention provides a method of treating a Th2
cell-mediated disease, e.g., systematic lupus erythromatosis,
myasthenia gravis, autoimmune hemolytic anemia, Chagas disease,
Graves disease, idiopathic thrombocytopenia purpura (ITP),
Wegener's granulomatosis, polyarteritis. nodosa, rapidly
progressive crescentic glomerulonephritis, or graft-versus-host
disease (GVHD), asthma, atopic dermatitis, atopy disorders such as
airway hyperresponsive diseases and airway distress syndromes. The
method includes administering an effective amount of a KIM-1
antagonist.
[0015] The invention provides a method of inhibiting GVHD. The
method includes administering an effective amount of a KIM-1
antagonist between 30 minutes and 30 days before the graft.
[0016] The invention provides a method of inhibiting secretion of
IFN-.gamma. by lymphocytes in a mammal. The method includes
administering to the mammal an effective amount of a KIM-1
antagonist.
[0017] The invention provides a method of inhibiting the activation
of Th1 T cell effector function, and therefore cellular immune
responses that occur in inflammatory situations. An example of such
an inflammatory situation is inflammatory bowel disease. The method
includes administering to the mammal an effective amount of a KIM-1
antagonist.
[0018] The invention provides a method of treating an inflammatory
disease or disorder in a mammal, e.g., inflammatory bowel diseases
such as Crohn's disease, ulcerative colitis, and ileitis. The
method includes administering to the mammal an effective amount of
a KIM-1 antagonist.
[0019] As used herein, "anti-KIM-1 antibody" means an antibody,
e.g., an IgG molecule, that binds specifically to the extracellular
portion of a full length KIM-1 polypeptide.
[0020] As used herein, "full length human KIM-1 polypeptide" means
the polypeptide of SEQ ID NO:1 in its entirety or SEQ ID NO:2 in
its entirety. These two polypeptides represent splice variants of
the human KIM-1 gene.
[0021] As used herein, "heterologous moiety" means an amino acid
sequence not present in a full-length KIM-1 polypeptide.
[0022] As used herein, "KIM-1 antagonist" means (a) a polypeptide
comprising a KIM-1 Ig domain, and lacking a transmembrane domain
and a KIM-1 cytoplasmic domain; (b) an anti-KIM-1 antibody; or (c)
an antigen-binding fragment of an anti-KIM-1 antibody, each of
which blocks, inhibits, or interferes with the biological activity
of a naturally-occurring KIM-1.
[0023] As used herein, "KIM-1 fusion protein" means a fusion
protein that includes a KIM-1 moiety fused to a heterologous
moiety.
[0024] As used herein, "KIM-1 moiety" means a biologically active
fragment of a full-length KIM-1 polypeptide.
[0025] As used herein, "KIM-1 polypeptide" means a KIM-1 moiety
alone or a fusion protein that includes a KIM-1 moiety.
[0026] As used herein, "KIM-1 Ig domain" means a portion of SEQ ID
NO:1 whose amino terminus is amino acid 29-36, and whose carboxy
terminus is amino acid 105-107.
[0027] As used herein, "KIM-1 mucin domain" means a portion of SEQ
ID NO:1 whose amino terminus is amino acid 126-130, and whose
carboxy terminus is amino acid 255-274.
[0028] As used herein, "KIM-1 transmembrane domain" means amino
acids 290-311 of SEQ ID NO:1.
[0029] As used herein, "KIM-1 cytoplasmic domain" means amino acids
312-334 of SEQ ID NO:1, or 312-359 of SEQ ID NO:2.
[0030] Unless otherwise defined, all technical and scientific terms
used herein have the same meaning as commonly understood by one of
ordinary skill in the art to which the invention pertains. In case
of conflict, the present specification, including definitions, will
control. All publications, patents and other references mentioned
herein are incorporated by reference.
[0031] Although methods and materials similar or equivalent to
those described herein can be used in the practice or testing of
the invention, the preferred methods and materials are described
below. The materials, methods and examples are illustrative only,
and are not intended to be limiting. Other features and advantages
of the invention will be apparent from the detailed description and
from the claims.
BRIEF DESCRIPTION OF THE DRAWINGS
[0032] FIG. 1 (prior art) is a schematic representation of two
naturally-occurring splice variants of the human KIM-1 polypeptide.
The two amino acid sequences are identical through residue 323. The
signal sequence (residues 1-20) is indicated by an underline. The
transmembrane domain (residues 290-311) is indicated by a double
underline.
[0033] FIG. 2 (prior art) is a schematic representation of the
359-amino acid human KIM-1 splice variant. The signal sequence and
transmembrane domains are indicated by dark shading. Cysteine
residues in the Ig domain are indicated by "C." Inverted triangles
indicated N-glycan attachment points. A TSP-rich region, which
corresponds to the mucin domain, is indicated by shaded
thickening.
[0034] FIG. 3 is a histogram summarizing immunoglobulin titers
measured on day 14 in Balb/c mice receiving a primary challenge
with sheep red blood cells (experiment 1).
[0035] FIG. 4 is a histogram summarizing immunoglobulin titers
measured on day 14 in Balb/c mice receiving a primary challenge
with sheep red blood cells (experiment 2).
[0036] FIG. 5 is a histogram summarizing immunoglobulin titers
measured on day 7 in C57B1/6 mice receiving a primary challenge
with sheep red blood cells.
[0037] FIG. 6 is a histogram summarizing immunoglobulin titers
measured in mice from experiment 1 after being allowed full
recovery from the primary challenge (FIG. 3) and then rechallenged.
Immunoglobulin titer was measured on day 3 after rechallenge.
[0038] FIG. 7 is a histogram summarizing immunoglobulin titers
measured in mice from experiment 2 after being allowed full
recovery from the primary challenge (FIG. 4) and then rechallenged.
Immunoglobulin titer was measured on day 3 after rechallenge.
[0039] FIG. 8 is a histogram summarizing data on IFN.gamma.
production in mouse MLR cultures. Irradiated Balb/c splenocytes
were used to stimulate splenocytes derived from C57B16 mice. After
48 h in culture the supernatants were harvested and used to measure
IFN.gamma. levels. Treatment of the cultures with mAbs 3A2 and 1H9
during incubation significantly reduced the level of IFN.gamma.
secreted into the supernatant.
[0040] FIG. 9 is a histogram summarizing data on cell proliferation
in mouse MLR cultures. Irradiated Balb/c splenocytes were used to
stimulate splenocytes derived from C57B16 mice. After 72 h in
culture a vital dye was added to the cultures, and allowed to
develop for 1-4 hours. Treatment of the cultures with anti-KIM-1
antibodies during the 3 day culturing period did not affect cell
proliferation.
[0041] FIG. 10 is a histogram summarizing data on IFN.gamma.
production in mouse MLR cultures. Irradiated Balb/c splenocytes
were used to stimulate splenocytes derived from C57B16 mice. After
48 h in culture the supernatants were harvested and used to measure
IFN.gamma. levels. Treatment of the cultures with KIM-1-Ig fusion
protein during incubation significantly reduced the level of
IFN.gamma. secreted into the supernatant.
[0042] FIG. 11 is a histogram summarizing data on cell
proliferation in mouse MLR cultures. Irradiated Balb/c splenocytes
were used to stimulate splenocytes derived from C57B16 mice. After
72 h in culture a vital dye was added to the cultures, and allowed
to develop for 1-4 hours. Treatment of the cultures with KIM-1-Ig
fusion protein during the 3 day culturing period did not affect
cell proliferation.
[0043] FIGS. 12A and 12B are histograms summarizing data on
IFN.gamma. production in human MLR cultures. Irradiated JY cells
were used to stimulate peripheral blood mononuclear cells from a
normal human donor. After 5 days in culture the supernatants were
harvested and used to measure IFN.gamma. and 1'-2 levels. Treatment
of the cultures with mAbs AUF1 and AKG7 during incubation
significantly reduced the level of IFN.gamma. secreted into the
supernatant (FIG. 12A), while the level of Il-2 produced remained
unchanged (FIG. 12B).
[0044] FIG. 13 is a histogram summarizing data on cell
proliferation in human MLR cultures. Irradiated JY cells were used
to stimulate peripheral blood mononuclear cells from a normal human
donor. After 6 days in culture a vital dye was added to the
cultures, and allowed to develop for 1-4 hours. Treatment of the
cultures with anti-human KIM-1 mAbs during the 6 day culturing
period did not significantly effect cell proliferation.
[0045] FIG. 14 is a histogram summarizing data on weight loss
following induction of inflammatory bowel disease in mice. Female
Balb/c mice were exposed to dextran sulfate sodium (DSS). After 8
days, mice were switched back onto plain water and allowed to
recover from DSS exposure. Three days later, the mice were weighed.
The weight was calculated as percent of weight at the start of the
experiment. Treatment with the KIM-1-Ig fusion protein conferred
significant protection to mice, as indicated by the improvement in
the weight score. There were 10 mice/group. A test of the
equivalence of the means gave a significance of >p=0.0001.
[0046] FIGS. 15A and 15B are histograms summarizing clinical score
data following induction of inflammatory bowel disease in mice.
After a 3-day recovery period, mice were assessed for diarrhea and
the presence of blood in the feces. Mice treated with KIM-1-Ig
fusion protein had a significantly better score than untreated or
control-Ig treated groups (FIG. 15A). This was due in part to
significantly fewer mice having blood present in the fecal pellets
(FIG. 15B). The means equivalence tests gave a significant value
for the differences in the clinical score (p=0.05) of untested
controls as compared to KIM-1-Ig treated cohorts.
DETAILED DESCRIPTION OF THE INVENTION
[0047] The native human KIM-1 gene encodes a polypeptide (FIG. 1)
containing 334 amino acids or 359 amino acids (SEQ ID NO:1),
depending on splice variation, is at least partially
tissue-dependent. Both sequences include: a signal sequence, an I
domain, a mucin domain, a transmembrane domain, and a cytoplasmic
domain.
[0048] Using a soluble, dimerized, KIM-1 ectodomain-Fc fusion
protein (each monomer containing the mouse KIM-1 ectodomain and a
human Fc moiety) and a recognized animal model (murine SRBC
response), the inventors have achieved a profound alteration of the
mammalian immune response. Without intending to be bound by theory,
the inventors interpret the observed results as indicating that the
fusion protein acts as a KIM-1 antagonist, and that this antagonism
interferes with a KIM-1-mediated signaling interaction between T
cells and APCs. The downstream effects of this interference include
useful modulation of the mammalian immune response. Such modulation
can be used to treat autoimmune diseases and other diseases and
disorders in which a mammalian immune system attacks an
inappropriate target, either through T cell cytotoxicity or through
an immunoglobulin response. Examples of diseases or disorders in
which immune system modulation would be beneficial include, but are
not limited to, arthritis, systemic lupus erythromatosis (also
known as SLE or lupus), and graft-versus-host-disease (GVHD).
[0049] In methods of the present invention, a soluble KIM-1
antagonist polypeptide or a KIM-1 blocking antibody (or
antigen-binding antibody fragment) can be administered directly as
a pre-formed polypeptide. Alternatively, it can be administered
indirectly through a nucleic acid vector (encoding and expressing
the polypeptide). Either way, the result is to antagonize
KIM-1-mediated effects on T cells, including T cell activation and
stimulation of T cell proliferation. This antagonism of KIM-1
located on T cells can achieve a desired therapeutic effect
directly by blocking destructive actions of the T cells themselves.
In addition, the antagonism can achieve the desired therapeutic
effect indirectly, by blocking activated T cell-mediated activation
of B cells, thereby reducing deleterious antibody production.
[0050] In various diseases, including autoimmune diseases and
certain types of pathogenic infections, damage results from
autoantibody responses, i.e., production of antibodies that
recognize self-antigens. The present invention provides methods and
molecules for reducing such damage by interfering with T cell
activation and differentiation. This, in turn, interferes with
activated T cell-mediated B cell activation, which interferes with
production and secretion of specific immunoglobulins, e.g., IgG1,
by the B cells. Accordingly, any disease or disorder characterized
by autoantibody responses can be treated by using methods and
molecules of the invention.
[0051] When certain autoimmune diseases are being treated, exposure
to antigens, and the immune system responses, are transient. This
results in remissions during which administration of an effective
amount of a KIM-1 antagonist would inhibit subsequent reactivation
of the immune responses to one or more antigens. In this way the
invention can be used to block disease relapse. When certain
autoimmune diseases are being treated, the immune system of the
mammal first recognizes the one or more antigens as part of an
epitope spreading process in the course of an autoimmune
disease.
[0052] Much of the damage in graft-versus-host disease (GVHD)
results directly from actions of donor T cells that become
activated in the host (in response to host antigens), once grafted,
e.g., in a bone marrow transplant. By virtue of its ability to
interfere with T cell activation, the present invention is useful
for inhibiting GVHD. In addition to damage from direct actions of
activated donor T cells, there is also an antibody-mediated
component in GVHD. Because this antibody-mediated component depends
on activation of donor T cells, which activate the
autoantibody-producing B cells, the invention reduces
autoantibody-mediated damage, as well as cellular immunity-mediated
damage in GVHD.
Antibody-Mediated Autoimmune Diseases
[0053] Systematic lupus erythromatosis (SLE; lupus) is a T.sub.H-2
mediated autoimmune disorder characterised by high levels of
autoantibodies directed against intracellular antigens such as
double stranded DNA, single stranded DNA, and histones. In view of
these characteristics, lupus exemplifies an autoimmune disease that
can be treated according to the present invention.
[0054] Examples of other organ-specific or systemic autoimmune
diseases suitable for treatment according to the invention include
myasthenia gravis, autoimmune hemolytic anemia, Chagas' disease,
Graves disease, idiopathic thrombocytopenia purpura (ITP),
Wegener's Granulomatosis, poly-arteritis Nodosa and Rapidly
Progressive Crescentic Glomerulonephritis. See, e.g., Benjamin et
al., 1996, Immunology, A Short Course, Third Ed. (Wiley-Liss, New
York). In addition, rheumatoid arthritis (RA), once thought to be
mediated by T cell cytotoxic activity, is now known to have a B
cell and/or antibody component (Leandro et al., 2002, Ann. Rheum.
Dis., 61:863-866; De Vita et al., Arthritis Rheum. 46:2029-2033;
Tsuji et al., 2002, J. Exp. Med. 196:1277-1290), and thus is
suitable for treatment according to the invention.
[0055] The normal immune response to some pathogenic infectious
agents elicits deleterious autoantibody responses. One example is
Chagas' disease, an inflammatory cardiomyopathy that develops in
humans and experimental animals chronically infected with
Trypanosoma cruzi. Anti-self antibodies occur in the sera of
Chagas' disease patients (Bach-Elias et al., 1998, Parasitol. Res.
84:796-799; Tibbetts, et al., 1994, J. Immunol. 152:1493-1499), and
thus this disease is suitable for treatment according to the
invention.
[0056] Another example of cell destruction by autoantibodies
resulting from infection is idiopathic thrombocytopenia purpura
(ITP), in which autoantibodies cause platelet destruction (by
complement or phagocytic cells with Fc or C3b receptor) and can
lead to bleeding. ITP is suitable for treatment according to the
invention.
Graft-Versus Host Disease (GVHD)
[0057] GVHD exemplifies a T cell-mediated condition that can be
treated using methods of the invention. GVHD is initiated when
donor T cells recognize host antigens as foreign. GVHD, often a
fatal consequence of bone marrow transplantation (BMT) in human
patients, can be acute or chronic. Acute and chronic forms of GVHD
exemplify the development of antigen specific Th1 and Th2
responses, respectively. Acute GVHD occurs within the first 2
months following BMT, and is characterized by donor cytotoxic T
cell-mediated damage to skin, gut, liver, and other organs. Chronic
GVHD appears later (over 100 days post-BMT) and is characterized by
hyperproduction of immunoglobulin (Ig), including autoantibodies,
and damage to the skin, kidney, and other organs caused by
Ig-deposition. Nearly 90% of acute GVHD patients go on to develop
chronic GVHD. Chronic GVHD appears to be a Th2 T cell mediated
disease (De Wit et al., 1993, J. Immunol. 150:361-366). Acute GVHD
is a Th1 mediated disease (Krenger et al., 1996, Immunol. Res.
15:50-73; Williamson et al., 1996, J. Immunol. 157:689-699). T cell
cytotoxicity is a characteristic of acute GVHD. The consequence of
donor anti-host cytotoxicity can be seen in various ways. First,
host lymphocytes are rapidly destroyed, such that mice experiencing
acute GVHD are profoundly immunosuppressed. Second, donor
lymphocytes become engrafted and expand in the host spleen, and
their cytotoxic activity can be directly measured in vitro by
taking advantage of cell lines that express the host antigens that
can be recognized (as foreign) by the donor cells. Third, the
disease becomes lethal as additional tissues and cell populations
are destroyed.
[0058] Chronic GVHD results from antibody-mediated destruction of
host tissues and cells and has been called "SLE-like" GVHD.
Manifestations include autoantibody formation, Ig-deposition in
various organs (kidney, liver), skin rash, lymphoid hyperplasia,
Sjogren-like lesions, scleroderma-like lesions, polyarteritis, and
other pathologies. This disease is partly mediated by autoantibody
formation. In view of the foregoing, chronic GVHD is suitable for
treatment according to the invention.
Other Th2-Related Diseases
[0059] Atopic disorders are characterized by the expression by
immune system cells, including activated T cells and APC, of
cytokines, chemokines, and other molecules which are characteristic
of Th2 responses, such as the IL-4, IL-5 and IL-13 cytokines, among
others. Such atopic disorders therefore will be amenable to
treatment by methods that antagonize the development of the Th2
response, such as the KIM-1 antagonists of the invention. Atopic
disorders include asthma, the airway hypersensitivity and distress
syndromes, and pathologies such as atopic dermatitis. The invention
provides a method of inhibiting atopic disorders. The method
includes administering an effective amount of a KIM-1
antagonist.
Inflammatory Diseases and Disorders Mediated by Activated
Lymphocytes, APC and Pro-Inflammatory Cytokines
[0060] Using the mixed lymphocyte reaction assay (MLR) in the mouse
and human model systems, the inventors have shown that blockade of
KIM-1 binding to its receptor, e.g., using anti-KIM-1 mAbs or a
KIM-1-Ig fusion protein, reduces the secretion of IFN.gamma. by
responder cells. Accordingly, a KIM-1 antagonist can be used to
treat any disease or disorder mediated by IFN.gamma..
[0061] IFN.gamma. is a critical cytokine in immune responses. It
has pleotropic effects on the development and extent of
inflammatory and immune processes (Boehm et al. 1997, Ann Rev
Immunol 15:749-795). Deficiencies in IFN.gamma. production reduce
anti-viral and anti-bacterial responses and attenuate inflammatory
responses. A KIM-1 antagonist can be used advantageously to reduce
IFN.gamma. production in diseases or disorders where IFN.gamma.
production is excessive or inappropriate. Examples of such diseases
or disorders include autoimmune diseases, colitis and chronic
inflammation.
[0062] IFN.gamma. is a key component of T cell activation and B
cell responses. It influences T cell effector cell development
(e.g., via cross regulation with Il-4) and B cell activation (e.g.,
via regulation of MHC-mediated antigen presentation and expression
of B7 molecules). IFN.gamma. is a critical component of Th1 T
cell-mediated immune responses. IFN.gamma. has pronounced effects
on other immune system components such as macrophages and
neutrophils. It stimulates their activation and release of toxic
effector molecules.
[0063] IFN.gamma. has potent effects on tissue resident cell types.
Endothelium is activated by IFN.gamma.. When stimulated with
IFN.gamma., resident cells in diseased tissue, e.g., synoviocytes
in rheumatoid arthritis, secrete TNF and other cytokines, MCP-1 and
other chemokines, and toxic effector molecules such as nitric
oxide. All of these latter functions mediated by IFN.gamma.
influence cell trafficking into tissues during inflammation.
[0064] As shown in Example 5 (below), blockade of KIM-1 binding to
its receptor reduces or eliminates IgG1 production in the SRBC
model system. In the MLR assay, the inventor has found that
blockade of KIM-1 binding to its receptor reduces IFN.gamma.
production by lymphocytes. Without intending to be bound by theory,
it is noted that the reduction in IgG1 production and the reduction
in IFN.gamma. production may represent two separate effects of
KIM-1 blockade, and may not directly related. Therefore, when a
KIM-1 antagonist is used to modulate immune function according to
the invention, the KIM-1 antagonist may provide a beneficial effect
through two separate mechanisms of action.
Fusion Proteins and Conjugated Polypeptides
[0065] Some embodiments of the invention involve a KIM-1 antagonist
polypeptide wherein a KIM-1 moiety is fused to a heterologous
moiety to form a KIM-1 fusion protein. KIM-1 fusion proteins, as
opposed to a KIM-1 moiety alone, can be used to accomplish various
objectives. Such objectives include, for example, increased serum
half-life, improved bioavailability, in vivo targeting to a
specific organ or tissue type, improved recombinant expression
efficiency, improved host cell secretion, and ease of purification.
Depending on the objective(s) to be achieved, the heterologous
moiety can be inert or biologically active. Also, it can be chosen
to be stably fused to the KIM-1 moiety or to be cleavable, in vitro
or in vivo. Heterologous moieties to accomplish different
objectives are known in the art.
[0066] As an alternative to expression of a KIM-1 fusion protein, a
chosen heterologous moiety can be preformed and chemically
conjugated to the KIM-1 moiety. In most cases, a chosen
heterologous moiety will function similarly, whether fused or
conjugated to the KIM-1 moiety. Therefore, in the following
discussion of heterologous amino acid sequences, unless otherwise
noted, it is to be understood that the heterologous sequence can be
joined to the KIM-1 moiety in the form of a fusion protein or as a
chemical conjugate.
[0067] Pharmacologically active polypeptides such as a KIM-1
polypeptide often exhibit rapid in vivo clearance, necessitating
large doses to achieve therapeutically effective concentrations in
the body. In addition, polypeptides smaller than about 20 kDa
potentially undergo glomerular filtration, which sometimes leads to
nephrotoxicity. Fusion or conjugation of relatively small
polypeptides such as KIM-1 fragments can be employed to reduce or
avoid the risk of such nephrotoxicity. Various heterologous amino
acid sequences, i.e., polypeptide moieties or "carriers," for
increasing the in vivo stability, i.e., serum half-life, of
therapeutic polypeptides are known.
[0068] Due to its long half-life, wide in vivo distribution, and
lack of enzymatic or immunological function, essentially
full-length human serum albumin (HSA), or an HSA fragment, is a
preferred heterologous moiety. Through application of methods and
materials such as those taught in Yeh et al., 1992, Proc. Natl.
Acad. Sci. USA, 89:1904-1908 and Syed et al., 1997, Blood
89:3243-3252, HSA can be used to form a KIM-1 fusion protein or
conjugate that displays pharmacological activity by virtue of the
KIM-1 moiety while displaying significantly increased, e.g.,
10-fold to 100-fold higher, in vivo stability. Preferably, the
N-terminus of the HSA is fused to the C-terminus of the KIM-1
moiety. Since HSA is a naturally secreted protein, the HSA signal
sequence can be exploited to obtain secretion of the KIM-1 fusion
protein into the cell culture medium, when the fusion protein is
produced in a eukaryotic, e.g., mammalian, expression system.
[0069] Some embodiments of the invention employ a KIM-1 polypeptide
wherein a KIM-1 moiety is fused to an Fc region, i.e., the
C-terminal portion of an Ig heavy chain constant region. Potential
advantages of a KIM-1-Fc fusion include solubility, in vivo
stability, and multivalency, e.g., dimerization. The Fc region used
can be an IgA, IgD, or IgG Fc region (hinge-CH2-CH3).
Alternatively, it can be an IgE or IgM Fc region
(hinge-CH2-CH3-CH4). An IgG Fc region is preferred, e.g., an IgG1
Fc region or IgG4 Fc region. Materials and methods for constructing
and expressing DNA encoding Fc fusions are known in the art and can
be applied to obtain KIM-1 fusions without undue
experimentation.
[0070] Preferably, the KIM-1-Fc fusion is constructed with an
orientation wherein the KIM-1 moiety forms the amino-terminal
portion of the fusion protein. For an example of construction and
expression of an Fc fusion with this orientation, see, e.g., Wanner
et al., U.S. Pat. No. 5,547,853 (pSAB152). Alternatively, the
fusion can be constructed with the opposite orientation, i.e.,
wherein the KIM-1 moiety forms the carboxy-terminal portion of the
fusion. For examples and discussion of this orientation, see, e.g.,
Lo et al., U.S. Pat. No. 5,541,087.
[0071] Some embodiments of the invention employ a KIM-1 fusion
protein obtained by constructing a KIM-1 immunofusin DNA in
accordance with Lo et al., U.S. Pat. No. 5,541,087. An immunofusin
DNA includes a polynucleotide encoding a secretion cassette. The
secretion cassette includes sequences encoding (in the 5' to 3'
direction) a signal sequence, an immunoglobulin Fc region, and a
KIM-1 moiety fused to the 3' end of the secretion cassette. DNA can
be expressed at high levels in a host cell, and the fusion protein
is efficiently produced and secreted from the host cell. The
secreted immunofusin can be collected from the culture media
without the need for lysis of the host cell.
[0072] In some embodiments the DNA sequence encodes a proteolytic
cleavage site between the KIM-1 moiety and the heterologous moiety.
A cleavage site provides for the proteolytic cleavage of the
encoded fusion protein, thus separating the Fc domain from the
target protein. Useful proteolytic cleavage sites include amino
acids sequences recognized by proteolytic enzymes such as trypsin,
plasmin or enterokinase K.
[0073] A KIM-1 polypeptide construct can be incorporated into a
replicable expression vector. Useful vectors include linear nucleic
acids, plasmids, phagemids, cosmids and the like. An exemplary
expression vector is pSAB152 (Wanner et al., U.S. Pat. No.
5,547,853. Another exemplary expression vector is pdC, in which the
transcription of the immunofusin DNA is placed under the control of
the enhancer and promoter of the human cytomegalovirus (Lo et al.,
1991, Biochim. Biophys. Acta 1088:712; and Lo et al., 1998, Protein
Engineering 11:495-500). An appropriate host cell can be
transformed or transfected with a DNA that encodes a KIM-1
polypeptide, and is used for the expression and secretion of the
KIM-1 polypeptide. Preferred host cells include immortal hybridoma
cells, myeloma cells, 293 cells, Chinese hamster ovary (CHO) cells,
Hela cells, and COS cells.
[0074] Fully intact, wild type Fc regions display effector
functions that normally are unnecessary and undesired in an Fc
fusion protein according to the present invention. Therefore,
certain binding sites preferably are deleted from the Fc region
during the construction of a KIM-1-Fc fusion protein. For example,
since coexpression with the light chain is unnecessary, the binding
site for the heavy chain binding protein, Bip (Hendershot et al.,
1987, Immunol. Today 8:111-114), is deleted from the Fc region of
IgE, such that this site does not interfere with the efficient
secretion of the fusion protein. Likewise, the cysteine residues
present in the Fc regions which are responsible for binding to the
light chain of the immunoglobulin should be deleted or substituted
with another amino acid, such that these cysteine residues do not
interfere with the proper folding of the Fc region when it is
produced as an immunofusin. Transmembrane domain sequences, such as
those present in IgM, should be deleted.
[0075] The IgG1 Fc region is preferred. Alternatively, the Fc
region of the other subclasses of immunoglobulin gamma (gamma-2,
gamma-3 and gamma-4) can be used in the secretion cassette. The
IgG1 Fc region of immunoglobulin gamma-1 that is preferably used in
the secretion cassette includes the hinge region (at least part),
the CH2 region, and the CH3 region. In some embodiments, the Fc
region of immunoglobulin gamma-1 is a CH2-deleted-Fc, which
includes part of the hinge region and the CH3 region, but not the
CH2 region. A CH2-deleted-Fc has been described by Gillies et al.,
1990, Hum. Antibod Hybridomas, 1:47. In some embodiments, the Fc
regions of IgA, IgD, IgE, or IgM, are used.
[0076] KIM-1-Fc fusion proteins can be constructed in several
different configurations. In one configuration the C-terminus of
the KIM-1 moiety is fused directly to the N-terminus of the Fc
moiety. In a slightly different configuration, a short linker,
e.g., 2-10 amino acids, is incorporated into the fusion between the
C-terminus of the KIM-1 moiety and the N-terminus of the Fc moiety.
Such a linker provides conformational flexibility, which may
improve biological activity in some circumstances. If a sufficient
portion of the hinge region is retained in the Fc moiety, the
KIM-1-Fc fusion will dimerize, thus forming a divalent molecule. A
homogeneous population of monomeric Fc fusions will yield
monospecific, bivalent dimers. A mixture of two monomeric Fc
fusions each having a different specificity will yield bispecific,
bivalent dimers.
[0077] KIM-1 conjugates can be constructed using methods known in
the art. Any of a number of cross-linkers that contain a
corresponding amino reactive group and thiol reactive group can be
used to link KIM-1 to serum albumin. Examples of suitable linkers
include amine reactive cross-linkers that insert a thiol
reactive-maleimide. These include, e.g., SMCC, AMAS, BMPS, MBS,
EMCS, SMPB, SMPH, KMUS, or GMBS. Other suitable linkers insert a
thiol reactive-haloacetate group. These include, e.g., SBAP, SIA,
SLAB and that provide a protected or non protected thiol for
reaction with sulfhydryl groups to product a reducible linkage are
SPDP, SMPT, SATA, or SAW all of which are commercially available
(e.g., Pierce Chemicals). One skilled in the art can similarly
envision with alternative strategies that will link the N-terminus
of KIM-1 with serum albumin.
[0078] One skilled in the art can generate conjugates to serum
albumin that are not targeted at the N-terminus of a KIM-1
polypeptide or at the thiol moiety on serum albumin. For example
KIM-1-albumin fusions can be generated using genetic engineering
techniques, wherein the KIM-1 moiety is fused to the serum albumin
gene at its amino-terminus (N-ter), carboxy-terminus (C-ter), or at
both ends.
[0079] Other derivatives of KIM-1 polypeptides include covalent or
aggregate conjugates of modified KIM-1 or its fragments with other
proteins or polypeptides, such as by synthesis in recombinant
culture as additional N-termini, or C termini. For example, the
conjugated peptide may be a signal (or leader) polypeptide sequence
at the N-terminal region of the protein which co-translationally or
post-translationally directs transfer of the protein from its site
of synthesis to its site of function inside or outside of the cell
membrane or wall (e.g., the yeast alpha-factor leader). KIM-1
polypeptides can be fused to heterologous peptides to facilitate
purification or identification of the KIM-1 moiety (e.g.,
histidine/KIM-1 fusions). The KIM-1 moiety also can be linked to
the peptide Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys (DYKDDDDK) (SEQ ID NO:)
(Hopp et al., 1988, Biotechnology 6:1204). This sequence is highly
antigenic and provides an epitope reversibly bound by a specific
monoclonal antibody. Consequently, it facilitates assay and
purification of the expressed recombinant protein. This sequence is
specifically cleaved by bovine mucosal enterokinase at the residue
immediately following the Asp-Lys pairing.
[0080] Expression systems employing gene fusion constructs have
been used to enhance the production of proteins in bacteria.
Employing a bacterial protein that is normally expressed at a very
high level as the amino-terminal fusion partner of a fusion protein
helps to ensure efficient transcription and translation of the
message, and in some cases the secretion and solubilization of the
fusion protein (Smith et al., 1988 Gene 67:31; Hopp et al., supra;
La Vallie et al., 1993, Biotechnology 11:187).
Conjugated Polymers (Other Than Polypeptides)
[0081] Some embodiments of the invention involve a KIM-1
polypeptide wherein one or more polymers are conjugated (covalently
linked) to the KIM-1 polypeptide. Examples of polymers suitable for
such conjugation include polypeptides (discussed above), sugar
polymers and polyalkylene glycol chains. Typically, but not
necessarily, a polymer is conjugated to the KIM-1 polypeptide for
the purpose of improving one or more of the following: solubility,
stability, or bioavailability.
[0082] A preferred class of polymer for conjugation to a KIM-1
polypeptide is a polyalkylene glycol. Polyethylene glycol (PEG) is
a preferred polyalkylene glycol. PEG moieties, e.g., 1-6 PEG
polymers, can be conjugated to each KIM-1 polypeptide to increase
serum half life, as compared, to the KIM-1 polypeptide alone. PEG
moieties are non-antigenic and essentially biologically inert. PEG
moieties used in the practice of the invention may be branched or
unbranched.
[0083] The number of PEG moieties attached to the KIM-1 polypeptide
and the molecular weight of the individual PEG chains can vary. In
general, the higher the molecular weight of the polymer, the fewer
polymer chains attached to the polypeptide. Preferably, the average
molecular weight of PEG is from 2 kDa to 100 kDa. More preferably,
the average molecular weight is from 5 kDa to 20 kDa, with 8-12 kDa
being most preferred.
[0084] The polymer, e.g., PEG, can be linked to the KIM-1
polypeptide through any suitable, exposed reactive group on the
polypeptide. The exposed reactive group(s) can be, for example, an
N-terminal amino group or the epsilon amino group of an internal
lysine residue, or both. Naturally-occurring lysine residues can be
exploited for this purpose, or lysine residue(s) can be engineered
into the KIM-1 amino acid sequence. An activated polymer can react
and covalently link at any free amino group on the KIM-1
polypeptide. Free carboxylic groups, suitably activated carbonyl
groups, hydroxyl, guanidyl, imidazole, oxidized carbohydrate
moieties and mercapto groups of the KIM-1 (if available) also can
be used as reactive groups for polymer attachment.
[0085] Preferably, in a conjugation reaction, from about 1.0 to
about 10 moles of activated polymer per mole of polypeptide,
depending on polypeptide concentration, is employed. Usually, the
ratio chosen represents a balance between maximizing the reaction
while minimizing side reactions (often non-specific) that can
impair the desired pharmacological activity of the KIM-1 moiety.
Preferably, at least 50% of the biological activity of the KIM-1
polypeptide is retained, and most preferably nearly 100% is
retained.
[0086] The polymer can be conjugated to the KIM-1 polypeptide using
conventional chemistry. For example, a polyalkylene glycol moiety
can be coupled to a lysine epsilon amino group of the KIM-1
polypeptide. Linkage to the lysine side chain can be performed with
an N-hydroxylsuccinimide (NHS) active ester such as PEG
succinimidyl succinate (SS-PEG) and succinimidyl propionate
(SPA-PEG). Suitable polyalkylene glycol moieties include, e.g.,
carboxymethyl-NHS, norleucine-NHS, SC-PEG, tresylate, aldehyde,
epoxide, carbonylimidazole, and PNP carbonate. These reagents are
commercially available. Additional amine reactive PEG linkers can
be substituted for the succinimidyl moiety. These include, e.g.,
isothiocyanates, nitrophenylcarbonates, epoxides, and benzotriazole
carbonates. Conditions preferably are chosen to maximize the
selectivity and extent or reaction. Such optimization of reaction
conditions is within ordinary skill in the art.
[0087] PEGylation can be carried out by any of the PEGylation
reactions known in the art. See, e.g., Focus on Growth Factors,
3:4-10, 1992; published European patent applications EP 0 154 316
and EP 0 401 384. PEGylation may be carried out using an acylation
reaction or an alkylation reaction with a reactive polyethylene
glycol molecule (or an analogous reactive water-soluble
polymer).
[0088] PEGylation by acylation generally involves reacting an
active ester derivative of polyethylene glycol. Any reactive PEG
molecule can be employed in the PEGylation. A preferred activated
PEG ester is PEG esterified to N-hydroxysuccinimide (NHS). As used
herein, "acylation" includes the following types of linkages
between the therapeutic protein and a water soluble polymer such as
PEG: amide, carbamate, urethane, and the like. See, e.g.,
Bioconjugate Chem. 5:133-140, 1994. Reaction parameters should be
chosed to avoid temperature, solvent, and pH conditions that would
damage or inactivate the KIM-1 polypeptide.
[0089] Preferably, the connecting linkage is an amide. Preferably,
the at least 95% of the resulting product is mono, di- or
tri-PEGylated. However, some species with higher degrees of
PEGylation may be formed in amounts depending on the specific
reaction conditions used. Optionally, purified PEGylated species
are separated from the mixture, particularly unreacted species, by
conventional purification methods, including, e.g., dialysis,
salting-out, ultrafiltration, ion-exchange chromatography, gel
filtration chromatography, and electrophoresis.
[0090] PEGylation by alkylation generally involves reacting a
terminal aldehyde derivative of PEG with KIM-1 in the presence of a
reducing agent. In addition, one can manipulate the reaction
conditions to favor PEGylation substantially only at the
.alpha.-amino group of the N-terminus of KIM-1 (i.e., a
mono-PEGylated protein). In either case of mono-PEGylation or
poly-PEGylation, the PEG groups are preferably attached to the
protein via a --CH.sub.2--NH-- group. With particular reference to
the --CH.sub.2-- group, this type of linkage is known as an "alkyl"
linkage.
[0091] Derivatization via reductive alkylation to produce a
mono-PEGylated product exploits differential reactivity of
different types of primary amino groups (lysine versus the
N-terminal) available for derivatization. The reaction is performed
at a pH that allows one to take advantage of the pKa differences
between the .epsilon.-amino groups of the lysine residues and that
of the .alpha.-amino group of the N-terminal residue of the
protein. By such selective derivatization, attachment of a water
soluble polymer that contains a reactive group such as an aldehyde,
to a protein is controlled: the conjugation with the polymer takes
place predominantly at the N-terminus of the protein and no
significant modification of other reactive groups, such as the
lysine side chain amino groups, occurs. The polymer molecules used
in both the acylation and alkylation approaches may be selected
from among water soluble polymers as described above. The polymer
selected should be modified to have a single reactive group, such
as an active ester for acylation or an aldehyde for alkylation,
preferably, so that the degree of polymerization may be controlled
as provided for in the present methods. An exemplary reactive PEG
aldehyde is polyethylene glycol propionaldehyde, which is water
stable, or mono C.sub.1-C.sub.10 alkoxy or aryloxy derivatives
thereof (see, U.S. Pat. No. 5,252,714). The polymer may be branched
or unbranched. For the acylation reactions, the polymer(s) selected
should have a single reactive ester group. For reductive
alkylation, the polymer(s) selected should have a single reactive
aldehyde group. Generally, the water soluble polymer will not be
selected from naturally-occurring glycosyl residues since these are
usually made more conveniently by mammalian recombinant expression
systems.
[0092] Methods for preparing a PEGylated KIM-1 generally includes
the steps of (a) reacting a KIM-1 protein or polypeptide with
polyethylene glycol (such as a reactive ester or aldehyde
derivative of PEG) under conditions whereby the molecule becomes
attached to one or more PEG groups, and (b) obtaining the reaction
product(s). In general, the optimal reaction conditions for the
acylation reactions will be determined case by case based on known
parameters and the desired result. For example, the larger the
ratio of PEG:protein, the greater the percentage of poly-PEGylated
product.
[0093] Reductive alkylation to produce a substantially homogeneous
population of mono-polymer/KIM-1 generally includes the steps of:
(a) reacting a KIM-1 polypeptide with a reactive PEG molecule under
reductive alkylation conditions, at a pH suitable to pen-nit
selective modification of the .alpha.-amino group at the amino
terminus of KIM-1; and (b) obtaining the reaction product(s).
[0094] For a substantially homogeneous population of
mono-polymer/KIM-1 polypeptide, the reductive alkylation reaction
conditions are those that permit the selective attachment of the
water soluble polymer moiety to the N-terminus of KIM-1. Such
reaction conditions generally provide for pKa differences between
the lysine amino groups and the .alpha.-amino group at the
N-terminus (the pKa being the pH at which 50% of the amino groups
are protonated and 50% are not). The pH also affects the ratio of
polymer to protein to be used. In general, if the pH is lower, a
larger excess of polymer to protein will be desired (i.e., the less
reactive the N-terminal .alpha.-amino group, the more polymer
needed to achieve optimal conditions). If the pH is higher, the
polymer:protein ratio need not be as large. (Because more reactive
groups are available, fewer polymer molecules are needed). For
purposes of the present invention, the preferred pH is in the range
of 3-9, preferably 3-6.
[0095] KIM-1 polypeptides can include a tag, e.g., a moiety that
can be subsequently released by proteolysis. Thus, the lysine
moiety can be selectively modified by first reacting a His-tag
modified with a low molecular weight linker such as Traut's reagent
(Pierce) which will react with both the lysine and N-terminus, and
then releasing the his tag. The polypeptide will then contain a
free SH group that can be selectively modified with a PEG
containing a thiol reactive head group such as a maleimide group, a
vinylsulfone group, a haloacetate group, or a free or protected
SH.
[0096] Traut's reagent can be replaced with any linker that will
set up a specific site for PEG attachment. By way of example,
Traut's reagent could be replaced with SPDP, SMPT, SATA, or SATP
(all available from Pierce). Similarly one could react the protein
with an amine reactive linker that inserts a maleimide (for example
SMCC, AMAS, BMPS, MBS, EMCS, SMPB, SMPH, KMUS, or GMBS), a
haloacetate group (SBAP, SIA, SIAB), or a vinylsulfone group and
react the resulting product with a PEG that contains a free SH. The
only limitation to the size of the linker that is employed is that
it cannot block the subsequent removal of the N-terminal tag.
[0097] In some embodiments, the polyalkylene glycol moiety is
coupled to a cysteine group of the KIM-1 polypeptide. Coupling can
be effected using, e.g., a maleimide group, a vinylsulfone group, a
haloacetate group, and a thiol group.
[0098] Optionally, the KIM-1 polypeptide is conjugated to the
polyethylene glycol moiety through a labile bond. The labile bond
can be cleaved in, e.g., biochemical hydrolysis, proteolysis, or
sulfhydryl cleavage. For example, the bond can be cleaved under in
vivo (physiological) conditions.
[0099] The reactions may take place by any suitable method used for
reacting biologically active materials with inert polymers,
preferably at about pH 5-8, e.g., pH 5, 6, 7, or 8, if the reactive
groups are on the alpha amino group at the N-terminus. Generally
the process involves preparing an activated polymer and thereafter
reacting the protein with the activated polymer to produce the
soluble protein suitable for formulation.
[0100] One or more sites on a KIM-1 polypeptide can be coupled to a
polymer. For example, one two, three, four, or five PEG moieties
can be attached to the polypeptide. In some embodiments, a PEG
moiety is attached at the amino terminus.
Anti-KIM-1 Antibodies
[0101] An anti-KIM-1 antibody or antigen-binding fragment thereof
used according to the invention can be any of various types of
molecules, including, but not limited to, a polyclonal antibody,
monoclonal antibody (mAb), humanized antibody, fully human
antibody, chimeric antibody, single-chain antibody, diabody, Fab
fragment, Fab' fragment, F(ab').sub.2, Fv fragment, Fd fragment,
dAb fragment, and complementarity determining region
(CDR)-containing fragment.
[0102] As used herein: Fd means a fragment that consists of the
V.sub.H and C.sub.H1 domains; Fv means a fragment that consists of
the V.sub.L and V.sub.H domains of a single arm of an antibody; and
dAb means a fragment that consists of a V.sub.H domain (Ward et
al., 1989, Nature 341:544-546). As used herein, single-chain
antibody (scFv) means an antibody in which a V.sub.L region and a
V.sub.H region are paired to form a monovalent molecules via a
synthetic linker that enables them to be made as a single protein
chain (Bird et al., 1988, Science 242:423-426; Huston et al., 1988,
Proc. Natl. Acad. Sci. USA 85:5879-5883). As used herein, diabody
means a bispecific antibody in which V.sub.H and V.sub.L domains
are expressed on a single polypeptide chain, but using a linker
that is too short to allow for pairing between the two domains on
the same chain, thereby forcing the domains to pair with
complementary domains of another chain and creating two antigen
binding sites (see e.g., Holliger, et al., 1993, Proc. Natl. Acad.
Sci. USA 90:6444-6448; and Poljak et al., 1994, Structure
2:1121-1123.
[0103] Generally applicable methods for obtaining antibodies are
known in the art. For a review of methods and materials useful for
making anti-KIM-1 antibodies, see e.g., Harlow et al., 1988,
Antibodies, A Laboratory Manual; Yelton, et al., 1981, Ann. Rev.
Biochem., 50:657-80.; and Ausubel et al., 1989, Current Protocols
in Molecular Biology (New York: John Wiley & Sons).
Antigen-binding properties of anti-KIM-1 antibodies can be
determined by one of ordinary skill in the art, using any of
various conventional methods, including, e.g., radioimmunoassay,
immunoblot assay and ELISA. Other suitable techniques for producing
an antibody of the invention involve in vitro exposure of
lymphocytes to a KIM-1 polypeptide, or screening of libraries of
antibodies in phage or similar vectors. See, e.g., Huse et al.,
1989. Science, 246:1275-1281.
Vectors
[0104] The invention provides vectors comprising the nucleic acids
encoding KIM-1 polypeptides. The choice of vector and expression
control sequences to which the nucleic acids of this invention is
operably linked depends on the functional properties desired, e.g.,
protein expression, and the host cell to be transformed. A vector
of the present invention may be at least capable of directing the
replication or insertion into the host chromosome, and preferably
also expression, of the structural gene included in the rDNA
molecule.
[0105] Expression control elements useful for regulating the
expression of an operably linked coding sequence are known in the
art. Examples include, but are not limited to, inducible promoters,
constitutive promoters, secretion signals, and other regulatory
elements. When an inducible promoter is used, it can be controlled,
e.g., by a change in nutrient status, or a change in temperature,
in the host cell medium.
[0106] The vector can include a prokaryotic replicon, i.e., a DNA
sequence having the ability to direct autonomous replication and
maintenance of the recombinant DNA molecule extra-chromosomally in
a prokaryotic host cell, such as a bacterial host cell, transformed
therewith. Such replicons are well known in the art. In addition,
vectors that include a prokaryotic replicon may also include a gene
whose expression confers a detectable marker such as a drug
resistance. Typical of bacterial drug resistance genes are those
that confer resistance to ampicillin or tetracycline.
[0107] Vectors that include a prokaryotic replicon can further
include a prokaryotic or bacteriophage promoter for directing
expression of the coding gene sequences in a bacterial host cell.
Promoter sequences compatible with bacterial hosts are typically
provided in plasmid vectors containing convenient restriction sites
for insertion of a DNA segment of the present invention. Examples
of such vector plasmids are pUC8, pUC9, pBR322 and pBR329 (BioRad
Laboratories), pPL and pKK223 (Pharmacia). Any suitable prokaryotic
host can be used to express a recombinant DNA molecule encoding a
protein of the invention.
[0108] Eukaryotic cell expression vectors are known in the art and
are commercially available. Typically, such vectors contain
convenient restriction sites for insertion of the desired DNA
segment. Exemplary vectors include pSVL and pKSV-10 (Pharmacia),
pBPV-1, pML2d (International Biotechnologies), pTDT1 (ATCC
31255).
[0109] Eukaryotic cell expression vectors may include a selectable
marker, e.g., a drug resistance gene. A preferred drug resistance
gene confers neomycin resistance, i.e., the neomycin
phosphotransferase (neo) gene (Southern et al., 1982, J. Mol. Anal.
Genet. 1:327-341).
[0110] To express the antibodies or antibody fragments, DNAs
encoding partial or full-length light and heavy chains are inserted
into expression vectors. Expression vectors include plasmids,
retroviruses, cosmids, YACs, EBV derived episomes, and the like.
The expression vector and expression control sequences are chosen
to be compatible with the expression host cell used. The antibody
light chain gene and the antibody heavy chain gene can be inserted
into separate vectors. In some embodiments, both genes are inserted
into the same expression vector.
[0111] A convenient vector is one that encodes a functionally
complete human C.sub.H or C.sub.L immunoglobulin sequence.
Preferably, restriction sites engineered so that any V.sub.H or
V.sub.L sequence can be easily inserted and expressed, as described
above. In such vectors, splicing usually occurs between the splice
donor site in the inserted J region and the splice acceptor site
preceding the human C region, and also at the splice regions that
occur within the human C.sub.H exons. Polyadenylation and
transcription termination occur at native chromosomal sites
downstream of the coding regions. The recombinant expression vector
can also encode a signal peptide that facilitates secretion of the
antibody chain from a host cell.
[0112] Preferred regulatory sequences for mammalian host cell
expression include viral elements that direct high levels of
protein expression in mammalian cells, such as promoters and
enhancers derived from retroviral LTRs, cytomegalovirus (CMV) (such
as the CMV promoter/enhancer), Simian Virus 40 (SV40) (such as the
SV40 promoter/enhancer), adenovirus, (e.g., the adenovirus major
late promoter (AdMLP)), polyoma and strong mammalian promoters such
as native immunoglobulin and actin promoters. For further
description of viral regulatory elements, and sequences thereof,
see e.g., U.S. Pat. No. 5,168,062 by Stinski, U.S. Pat. No.
4,510,245 by Bell et al. and U.S. Pat. No. 4,968,615 by Schaffner
et al.
[0113] The recombinant expression vectors may carry sequences that
regulate replication of the vector in host cells (e.g., origins of
replication) and selectable marker genes. The selectable marker
gene facilitates selection of host cells into which the vector has
been introduced (see e.g., U.S. Pat. Nos. 4,399,216, 4,634,665 and
5,179,017, all by Axel et al.). For example, typically the
selectable marker gene confers resistance to drugs, such as G418,
hygromycin or methotrexate, on a host cell into which the vector
has been introduced. Preferred selectable marker genes include the
dihydrofolate reductase (DHFR) gene (for use in dhfr.sup.- host
cells with methotrexate selection/amplification) and the neo gene
(for G418 selection).
[0114] Nucleic acid molecules encoding KIM-1 polypeptides and
anti-KIM-1 antibodies, and vectors comprising these nucleic acid
molecules, can be used for transformation of a suitable host cell.
Methods for introduction of exogenous DNA into mammalian cells are
well known in the art and include dextran-mediated transfection,
calcium phosphate precipitation, polybrene-mediated transfection,
protoplast fusion, electroporation, encapsulation of the
polynucleotide(s) in liposomes, and direct microinjection of the
DNA into nuclei. In addition, nucleic acid molecules may be
introduced into mammalian cells by viral vectors.
[0115] Transformation of host cells can be accomplished by
conventional methods suited to the vector and host cell employed.
With regard to transformation of prokaryotic host cells,
electroporation and salt treatment methods can be employed (Cohen
et al., 1972, Proc. Natl. Acad. Sci. USA 69:2110-2114). With regard
to transformation of vertebrate cells, electroporation, cationic
lipid or salt treatment methods can be employed. See, e.g., Graham
et al., 1973, Virology 52:456-467; Wigler et al., 1979, Proc. Natl.
Acad. Sci. USA 76:1373-1376).
[0116] Host cells can be prokaryotic or eukaryotic. Preferred
eukaryotic host cells include, but are not limited to, yeast and
mammalian cells. Examples of useful eukaryotic host cells include
Chinese hamster ovary (CHO) cells (ATCC Accession No. CCL61), NIH
Swiss mouse embryo cells NIH-3T3 (ATCC Accession No. CRL1658), and
baby hamster kidney cells (BHK). Mammalian cell lines available as
hosts for expression are known in the art and include many
immortalized cell lines available from the American Type Culture
Collection (ATCC). These include, inter alis, Chinese hamster ovary
(CHO) cells, NSO, SP2 cells, HeLa cells, baby hamster kidney (BHK)
cells, monkey kidney cells (COS), human hepatocellular carcinoma
cells (e.g., Hep G2), A549 cells, and a number of other cell
lines.
[0117] Expression of polypeptides from production cell lines can be
enhanced using known techniques. For example, the glutamine
synthetase (GS) system is commonly used for enhancing expression
under certain conditions. See, e.g., European Patent Nos. 0216846,
0256055, and 0323997 and European Patent Application No.
89303964.4.
Formulations
[0118] Compositions containing KIM-1 polypeptides, anti-KIM-1
antibodies, or antigen binding fragments of anti-KIM-1 antibodies
may contain suitable pharmaceutically acceptable carriers. For
example, they may contain excipients and/or auxiliaries that
facilitate processing of the active compounds into preparations
designed for delivery to the site of action. Suitable formulations
for parenteral administration include aqueous solutions of the
active compounds in water-soluble form, for example, water-soluble
salts. In addition, suspensions of the active compounds as
appropriate oily injection suspensions may be administered.
Suitable lipophilic solvents or vehicles include fatty oils, for
example, sesame oil, or synthetic fatty acid esters, for example,
ethyl oleate or triglycerides. Aqueous injection suspensions may
contain substances that increase the viscosity of the suspension
include, for example, sodium carboxymethyl cellulose, sorbitol and
dextran. Optionally, the suspension may also contain stabilizers.
Liposomes also can be used to encapsulate the molecules of the
invention for delivery into cells or interstitial spaces. Exemplary
pharmaceutically acceptable carriers are physiologically compatible
solvents, dispersion media, coatings, antibacterial and antifungal
agents, isotonic and absorption delaying agents, water, saline,
phosphate buffered saline, dextrose, glycerol, ethanol and the
like. In some embodiments, the composition comprises isotonic
agents, for example, sugars, polyalcohols such as mannitol,
sorbitol, or sodium chloride. In some embodiments, the compositions
comprise pharmaceutically acceptable substances such as wetting or
minor amounts of auxiliary substances such as wetting or
emulsifying agents, preservatives or buffers, which enhance the
shelf life or effectiveness of the active ingredients.
[0119] Compositions of the invention may be in a variety of forms,
including, for example, liquid, semi-solid and solid dosage forms,
such as liquid solutions (e.g., injectable and infusible
solutions), dispersions or suspensions. The preferred form depends
on the intended mode of administration and therapeutic application.
In some embodiments, compositions are in the form of injectable or
infusible solutions, such as compositions similar to those used for
passive immunization of humans.
[0120] The composition can be formulated as a solution, micro
emulsion, dispersion, liposome, or other ordered structure suitable
to high drug concentration. Sterile injectable solutions can be
prepared by incorporating the active ingredient in the required
amount in an appropriate solvent with one or a combination of
ingredients enumerated above, as required, followed by filtered
sterilization. Generally, dispersions are prepared by incorporating
the active ingredient into a sterile vehicle that contains a basic
dispersion medium and the required other ingredients from those
enumerated above. In the case of sterile powders for the
preparation of sterile injectable solutions, the preferred methods
of preparation are vacuum drying and freeze-drying that yields a
powder of the active ingredient plus any additional desired
ingredient from a previously sterile-filtered solution thereof, the
proper fluidity of a solution can be maintained, for example, by
the use of a coating such as lecithin, by the maintenance of the
required particle size in the case of dispersion and by the use of
surfactants. Prolonged absorption of injectable compositions can be
brought about by including in the composition an agent that delays
absorption, for example, monostearate salts and gelatin.
[0121] In some embodiments, the active ingredient is formulated
with a controlled-release formulation or device. Examples of such
formulations and devices include implants, transdermal patches, and
microencapsulated delivery systems. Biodegradable, biocompatible
polymers can be used, for example, ethylene vinyl acetate,
polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and
polylactic acid. Methods for the preparation of such formulations
and devices are known in the art. See e.g., Sustained and
Controlled Release Drug Delivery Systems, 1978, J. R. Robinson,
ed., Marcel Dekker, Inc., New York.
[0122] Supplementary active compounds also can be incorporated into
the compositions.
[0123] In some embodiments, a KIM-1 polypeptide, anti-KIM-1
antibody or fragment thereof is coadministered with a second
immunomodulatory agent, e.g., BAFF-R-Ig, LTB-R-Ig, CTLA4-Ig,
anti-CD40L, or an anti-CD20 monoclonal antibody.
[0124] Dosage regimens may be adjusted to provide the optimum
desired response. For example, a single bolus may be administered,
several divided doses may be administered over time or the dose may
be proportionally reduced or increased as indicated by the
exigencies of the therapeutic situation. It is advantageous to
formulate parenteral compositions in dosage unit form for ease of
administration and uniformity of dosage unit form as used herein
refers to physically discrete units suited as unitary dosages for
the mammalian subjects to be treated, each unit containing a
predetermined quantity of active compound calculated to produce the
desired therapeutic effect in association with the required
pharmaceutical carrier.
[0125] In some embodiments, a therapeutically effective dose for a
KIM-1 polypeptide is in the range of 0.1 to 100 mg/kg. In some
embodiments the therapeutically effective dose is in the range of
0.5 to 50 mg/kg. In some embodiments, the therapeutically effective
dose is in the range of 1.0 to 10 mg/kg, e.g., about 5 mg/kg.
Determination of a therapeutically effective dose can also be
assessed by performing in vitro experiments that measure the
concentration of the modifying agent required to coat target cells
(KIM-1 or KIM-1-Receptor-positive cells depending on the modifying
agent) for suitable (therapeutic) time periods. FACS and ELISA
receptor-ligand binding assays can be used to monitor the cell
coating reaction. Based on the results of such in vitro binding
assays, a range of suitable modifying agent concentrations can be
selected.
[0126] Molecules of the invention can be formulated into
pharmaceutical compositions by admixture with pharmaceutically
acceptable nontoxic excipients or carriers. Such compositions can
be prepared for use in parenteral administration, particularly in
the form of liquid solutions or suspensions. The composition can be
administered in unit dosage form and can be prepared by any
suitable method. Such methods are known in the art. For example,
see Remington's Pharmaceutical Sciences (Mack Pub. Co., Easton, Pa.
1980).
[0127] Liquid dosage forms include pharmaceutically acceptable
solutions, emulsions, microemulsions, and suspensions. In addition
to the active compound, the liquid dosage form may contain inert
ingredients including water, ethyl alcohol, ethyl carbonate, ethyl
acetate, benzyl alcohol, benzyl benzoate, propylene glycol,
1,3-butylene glycol, dimethylformamide, oils, glycerol,
tetrahydrofurfuryl alcohol, polyethylene glycols, fatty acid esters
of sorbitan, and mixtures thereof.
[0128] Injectable depot formulations can be made by forming
microencapsulated matrices of the drug in biodegradable polymers
such as polylactide-polyglycolide. Depending on the ratio of drug
to polymer, and the nature of the polymer employed, the rate of
drug release can be controlled. Other exemplary biodegradable
polymers include polyorthoesters and polyanhydrides. Depot
injectable formulations also can be prepared by entrapping the drug
in liposomes or microemulsions that are compatible with body
tissues.
EXAMPLES
[0129] The invention is further illustrated by the following
experimental examples. The examples are provided for illustrative
purposes only, and are not to be construed as limiting the scope or
content of the invention in any way.
Example 1
Human KIM-1 Extracellular Domain-Fc Construct (pHI105)
[0130] The extracellular domain (residues 1-290) of human KIM-1 was
fused to the Fc portion of human IgG1 (hinge, CH2, CH3) and cloned
into pEAG347, a Biogen mammalian expression plasmid. The plasmid
contained a tandem promotor for constitutive expression and the
dihydrofolate reductase gene for methotrexate selection of stably
expressing cell lines. The amino acid sequence of the encoded
fusion polypeptide was as follows:
TABLE-US-00001 1 10 20 30 40 50
MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLPCHYSGAVTSMCWNRG 60 70 80 90 100
SCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDS 110 120 130 140
150 GVYCCRVEHRGWFNDMKITVSLEIVPPKVTTTPIVTTVPTVTTVRTSTTV 160 170 180
190 200 PTTTTVPTTTVPTTMSIPTTTTVPTTMTVSTTTSVPTTTSIPTTTSVPVT 210 220
230 240 250 TTVSTFVPPMPLPRQNHEPVATSPSSPQPAETHPTTLQGAIRREPTSSPL 260
270 280 290 300 YSYTTDGNDTVTESSDGLWNNNQTQLFLEHSLLTANTTKGVDKTHT 310
320 330 340 350 PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV
360 370 380 390 400
DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP 410 420 430 440
450 APIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAV 460 470 480
490 500 EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH 510 518
EALHNHYTQKSLSLSPGK
The signal sequence is indicated by an underline. The Fc hinge is
indicated by a box.
Example 2
Human KIM1.sub.ECDmucinA-Fc (pHI100)
[0131] DNA encoding residues 1-129 of human KIM-1 fused to the Fc
portion of human IgG1 (hinge, CH2, CH3) was cloned into pEAG347, a
Biogen mammalian expression plasmid containing a tandem promotor
for constitutive expression and the dihydrofolate reductase gene
for methotrexate selection of stably expressing cell lines. The
amino acid sequence of the encoded fusion polypeptide was as
follows:
TABLE-US-00002 10 20 30 40 50
MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLPCHYSGAVTSMCWNRG 60 70 80 90 100
SCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDS 110 120 130 140
150 GVYCCRVEHRGWFNDMKITVSLEIVPPKVVDKTHT PAPELLGGPSV 160 170 180 190
200 FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK 210 220 230
240 250 PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK 260 270
280 290 300 GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN 310
320 330 340 350 YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS
LSLSPGK
Example 3
Human KIM1.sub.ECD-6xHis (pVB602)
[0132] The extracellular domain (residues 1-290) of human KIM-1 was
fused to a short C-terminal peptide [VEHHHHHH] including a repeat
of 6 histidine residues and cloned into pCA125, a BIOGEN mammalian
expression plasmid containing a CMV promotor for transient
constitutive expression in mammalian cells. The amino acid sequence
of the encoded fusion polypeptide was as follows:
TABLE-US-00003 10 20 30 40 50
MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLPCHYSGAVTSMCWNRG 60 70 80 90 100
SCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDS 110 120 130 140
150 GVYCCRVEHRGWFNDMKITVSLEIVPPKVTTTPIVTTVPTVTTVRTSTTV 160 170 180
190 200 PTTTTVPTTTVPTTMSIPTTTTVPTTMTVSTTTSVPTTTSIPTTTSVPVT 210 220
230 240 250 TTVSTFVPPMPLPRQNHEPVATSPSSPQPAETHPTTLQGAIRREPTSSPL 260
270 280 290 YSYTTDGNDTVTESSDGLWNNNQTQLFLEHSLLTANTTKGVEHHHHHH
Example 4
Murine KIM-1-Fc Fusion
[0133] A PCR-amplified ectodomain of murine kim-1 flanked by NotI
and SalI sites was fused with human IgG1Fc (isolated from EAG409 as
a SalI-NotI fragment) and cloned into Ebna 293 cell expression
vector CH269 (construct PEM073-6) and CHO cell expression vector
pV90 (construct PEM078-1). The SalI site is at the junction between
kim1 and Fc. The resulting nucleotide sequence of the ORF for the
fusion protein was as follows (SalI site in upper case):
TABLE-US-00004 atgaatcagattcaagtcttcatttcaggcctcatactgcttctcccagg
cactgtggattcttatgtggaagtaaagggggtagtgggtcaccctgtca
cacttccatgtacttactcaacatatcgtggaatcacaacgacatgttgg
ggccgagggcaatgcccatcttctgcttgtcaaaatacacttatttggac
caatggacatcgtgtcacctatcagaagagcagtcggtacaacttaaagg
ggcatatttcagaaggagatgtgtccttgacgatagagaactctgttgag
agtgacagtggtctgtattgttgtcgagtggagattcctggatggtttaa
tgatcagaaagtgaccttttcattgcaagttaaaccagagattcccacac
gtcctccaacaagacccacaactacaaggcccacagctacaggaagaccc
acgactatttcaacaagatccacacatgtaccaacatcaatcagagtctc
tacctccactcctccaacatctacacacacatggactcacaaaccagaac
ccactacattttgtccccatgagacaacagctgaggtgacaggaatccca
tcccatactcctacagactggaatggcactgcgacatcctcaggagatac
ctggagtaatcacactgaagcaatccctccagggaagccgcagaaaaacc
ctactaagggcGTCGACaaaactcacacatgcccaccgtgcccagcacct
gaactcctggggggaccgtcagtcttcctcttccccccaaaacccaagga
caccctcatgatctcccggacccctgaggtcacatgcgtggtggtggacg
tgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtg
gaggtgcataatgccaagacaaagccgcgggaggagcagtacaacagcac
gtaccgtgtggtcagcgtcctcaccgtcctgcaccaggactggctgaatg
gcaaggagtacaagtgcaaggtctccaacaaagccctcccagcccccatc
gagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgta
caccctgcccccatcccggatgagctgaccaagaaccaggtcagcctgac
ctgcctggtcaaaggcttctatcccagcgacatcgccgtggagtgggaga
gcaatgggcagccggagaacaactacaagaccacgcctcccgtgttggac
tccgacggctccttcttcctctacagcaagctcaccgtggacaagagcag
gtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgc
acaaccactacacgcagaagagcctctccctgtctcccgggaaatga
The translated sequence of mukim-1 ectodomain-human Fc was as
follows. Two junction amino acids contributed by the SalI site are
indicated in bold:
TABLE-US-00005 MNQIQVFISGLILLLPGTVDSYVEVKGVVGHPVTLPCTYSTYRGITTTCW
GRGQCPSSACQNTLIWTNGHRVTYQKSSRYNLKGHISEGDVSLTIENSVE
SDSGLYCCRVEIPGWFNDQKVTFSLQVKPEIPTRPPTRPTTTRPTATGRP
TTISTRSTHVPTSIRVSTSTPPTSTHTWTHKPEPTTFCPHETTAEVTGIP
SHTPTDWNGTATSSGDTWSNHTEAIPPGKPQKNPTKGVDKTHTCPPCPAP
ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV
EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI
EKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWE
SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL
HNHYTQKSLSLSPGK
Example 5
KIM-1-Fc Fusion in Murine SRBC Model
[0134] The immune response of rodents to sheep red blood cells
(SRBC) depends upon competent T cell interaction with APCs and B
cells. Therefore the anti-SRBC response is a useful model to
examine the role that cellular proteins on lymphocytes and APC play
in the development and maturation of the immune response. The
anti-SRBC response in mice consists of production of IgM and of the
various IgG isotypes, including high levels of the IgG1 isotype,
with considerable levels of IgG2a and IgG2b seen as well. IgG1 is
considered to be an isotype that is driven by a Th2-mediated immune
response, which is characterized by the expression of cytokines
such as Il-4, Il-5, and Il-13. IgG2a and IgG2b isotypes are more
characteristic of a Th1-driven immune response, and are associated
with expression of Il-12. Finally, the IgG3 isotype is typical of
T-independent immune responses. All 4 isotypes are represented in
the anti-SRBC response.
[0135] The course of the anti-SRBC response was followed in mice
treated with murine KIM-1-Ig fusion protein (mKIM-1-Ig) to
interrupt KIM-1-dependent activity on T cells. Mice were treated
the day before challenge (D-1) with 150 ugs/mouse challenged with
100 .mu.l of a 10% solution of SRBC (Colorado Serum Company) in PBS
on day 0, then treated again with 150 .mu.g of mKIM-1-Ig on days 3
and 6. The mice were bled for a serum samples on days 7, 14, 21,
and 30 following immunization, and anti-SRBC antibody titers were
obtained using the hemagglutination assay. This assay relied on the
ability of antibodies to crosslink and cluster ("agglutinate") SRBC
based on their pentameric structure (for IgM) or on the presence of
a third species anti-idiotypic antisera (for the Ig classes).
[0136] In brief, the protocol was as follows. Serum samples were
diluted as appropriate (1:15 to 1:200), depending on the isotype
being measured, and the day of the response). then titered in 1:2
steps using 96 well assay plates which we obtained from Corning
(Costar.RTM. #3795). For the IgM assay, the sera samples were
assayed in duplicate. 25 .mu.l of 10% SRBC in glucose-PBS (G-PBS)
was added to the wells and the agglutination response was allowed
to develop for 1 hour at 37.degree. C. For the Ig assays, serum
samples were loaded into the plates and diluted in triplicate. 25
.mu.l of 1% 2-mercaptoethanol (Sigma), diluted in G-PBS, was added
to each serum sample series, then the plate was incubated for 30
minutes at 37.degree. C. This was done to break all the disulfide
bonds which hold together IgM pentamers, and thus to eliminate any
IgM background. Then, 25 .mu.l of 10% SRBC in G-PBS, and 25 .mu.l
of a 1:250 dilution in G-PBS of anti-idiotypic antisera (goat
anti-mouse IgG1, IgG2a, IgG2b, or IgG3, all from Southern
Biotechnology Associates) was added to the first 2 of each
triplicate to cross-link the anti-SRBC IgGs of that subtype
present. The third well of each triplicate was left uncrosslinked
to serve as a control for any residual IgM activity that might have
survived the 2-mercaptoethanol treatment. The plates were incubated
for 1 hour at 37.degree. C. All assay plates were left overnight at
4.degree. C. to stabilize the resulting hemagglutination before
being scored and photographed. All titers were scored as the last
dilution that gave a positive agglutination readout.
[0137] The effect of mKIM-1-Ig treatment on the anti-SRBC response
was compared to control groups of mice not challenged with SRBC, or
challenged with SRBC but dosed with anti-CD40L, nonspecific
polyclonal hIgG, or PBS. The unchallenged and anti-CD40L-treated
mice had no anti-SRBC response, as expected. The mice given SRBC
and dosed either with PBS or hIgG had robust antibody titers to all
classes of Ig tested. The mice treated with mKIM-1-Ig in contrast
had a very striking and specific defect in the IgG1 anti-SRBC
isotype. In 2 independent experiments using the Balb/c strain of
mice, markedly defective levels of IgG1 anti-SBRC were detected
(FIGS. 3 and 4). Seven days after induction of the anti-SRBC
response the IgG1 titer was on average 70% lower in mKIM-1-Ig
treated mice than in control treated mice. By day 14 after
induction of the anti-SRBC response the IgG1 titer was reduced by
more than 85%. A similar defect was observed in 1 experiment using
the C57B1/6 strain of mice (FIG. 5). Balb/c mice and C57B1/6 mice
are considered to have different biases in their immune responses,
with Balb/c mice being characterized as having a predominantly
Th2-mediated response and C57B1/6 mice having a predominantly
Th1-mediated response. Therefore, in these mouse strains the
ability of murine KIM-1-Ig fusion protein to block the IgG1 isotype
production overrode inherent Th-biases in the strains.
Surprisingly, the effect of mKIM-1-Ig treatment extended to the
secondary response, whereby no IgG1 was produced by memory B cells
in response to subsequent SRBC challenge (FIGS. 6 and 7).
Example 6
Graft Versus Host Disease (GVHD)
[0138] GVHD is modeled in the mouse using parental into F1 cell
transplantation regimens. Splenocytes from the DBA2 strain of mice
are injected iv into (DBA2.times.57B1/6) F1 mice, which are
referred to as B6D2F1. The injected splenocytes constitute the
graft, and the DBA2 mouse is the donor of that graft. The F1 mouse
which receives the graft is the host. Donor T cells present in the
graft recognize half of the MHC markers (haplotypes) on host cells
as foreign, because they are derived from the other, C57B1/6
parent. This induces a donor T cell response against the host
resulting in GVHD. When DBA/2 parental splenocytes are injected
into the B6D2F1 host, chronic GVHD develops. In contrast, when
C57B1/6 splenocytes are injected into the B6D2F1 host, acute GVHD
develops. Although it remains unclear what underlying mechanism is
responsible for the distinct disease outcomes using these 2
injection protocols it is believed that the cytokines expressed by
the cells contained within the DBA/2 splenocyte graft favor the
development of chronic GVHD while the cytokines expressed by the
cells contained within the C5781/6 splenocyte graft favor the
development of acute GVHD. Reagents which interfere with T cell
interactions with antigen presenting cells (e.g., dendritic cells,
macrophages, B cells: APC) effectively block both acute and chronic
GVHD.
KIM-1 antagonists modify the development of an immunological
response in a mouse model of chronic GVHD. The ability to block
chronic GVHD includes effects on B cell activation and
proliferation, and on the generation of secreted IgG. Mice are
treated intraperitoneally (ip) with KIM-1 antagonists or modifying
agents, control treatments, or are left untreated. 4 hours later
mice receive 1.times.10.sup.8 splenocytes isolated from DBA/2 mice,
in an 0.5 ml injection given intravenously (iv). The iv injected
DBA/2 splenocytes constituted the allograft. 2, 4, and 6 days after
the graft is given, the mice are again treated with KIM-1
antagonists or modifying agents or with control treatments. An
additional control group of mice receives 1.times.10.sup.8 B6D2F1
splenocytes, which cannot induce disease in B6D2F1 recipients.
Alternatively, ungrafted and untreated B6D2F1 mice are used as
controls. Fourteen days after the graft is given the mice are
sacrificed and examined for evidence of disease.
[0139] Untreated graft-recipient mice manifest a variety of
symptoms that are indicative of the development of chronic GVHD.
Splenomegaly, or enlargement of the spleen, is evidence that donor
T cells and host B cells have become activated, and are undergoing
polyclonal expansion, with dramatic increases in cell number. The
appearance of cell surface proteins such as CD69 on a subset of B
cells is indicative of B cell activation. The loss of L-selectin
molecules from CD4+ and CD8+ T cells is evidence of T cell
activation. The secretion of Ig molecules, such as IgG classes,
IgA, and IgE, either into the serum, or in in vitro cell culture
assays, indicates that B cells have become activated, and have
switched their Ig class. In this regard the appearance of anti-self
Igs in the serum or in in vitro cell culture assays shows that Igs
that are being produced have inappropriate autoantigen recognition.
Finally, survivorship can be measured as an outcome of different
treatment regimens. Treatment with KIM-1 antagonists (e.g.,
KIM-1-Ig) or blocks these readouts of the development of chronic
GVHD, as shown by reduction in the extent of splenomegaly,
reduction in the polyclonal expansion of lymphocyte populations,
reduction in the appearance or disappearance of cell surface
markers indicating lymphocyte activation, reduction of Ig
secretion, and/or reduction in mortality.
[0140] We compare control mice to untreated allograft-recipient
mice to examine the extent of splenomegaly, B cell activation, and
Ig secretion during GVHD. Anti-CD40L mAb MR1 is used as a positive
control in these experiments, since it has been previously shown
that blocking the CD40L/CD40 interaction is an effective means of
interfering with the development of chronic GVHD (Durie et al.,
1994, J. Clin. Invest. 94: 1333-1338). To investigate cell
populations affected by treatment with KIM-1 antagonists FACS
analyses are performed on splenocytes taken from the recipient mice
14 days after graft injection. Spleen cells from 3-4 mice per group
are isolated and pooled. Activation of recipient B cells is a
defining feature of chronic GVHD. In mice undergoing chronic GVHD a
small but readily visible proportion of the B200+ B cells express
the activation marker CD69. Therefore CD69 expression is used as a
measure of the extent of disease. Total IgG in cultures of
splenocytes in mice from different treatment groups is also
determined, sice the expression of CD69 by B cells is indicative of
their activation state.
[0141] In the mouse model the development of the disease is
dependent on the Th2 cytokine 114, and can be blocked by treating
with anti-114 mAb. Such treatment blocks the expansion of host B
cells, and the concomitant hyper-Ig production. The development of
GVHD can be followed in a number of ways. The expansion of the
donor T cell and host B cell populations is measured by the spleen
index, which is the ratio of spleen weight to body weight,
normalized to control (non-diseased) mice. The activation of B
cells in diseased mice is measured using analyses of B cell
activation markers. Finally, the effects of B cell activation is
seen in the levels of Ig in circulation (e.g., in serum) or
produced by cultures of host splenocytes harvested several weeks
after disease induction. Circulating Ig in diseased animals will
contain anti-self antibodies. Ultimately, diseased animals succumb
to kidney and other organ failure due to accumulated Ig deposition,
and therefore survivorship is a relevant measure of disease
activity.
Example 7
SCID-hu Mouse Models
[0142] It is possible to study human immune responses in the
SCID-hu mouse. For example, SCID mice are injected
intraperitoneally with 2-5.times.10.sup.7 human peripheral blood
mononuclear cells, and these cells reside and function in the gut
for some time, and respond to antigen challenge. NOD-SCID mice are
reconstituted with human PBLs and these mice have the additional
advantage of the seeding of human cells (T, B, APC) into the
spleen, where systemic immune responses may be supported.
Appropriate models are discussed in Berney et al., 2001,
Transplantation 72:133-140. Other models of immune responses use
the SCID/beige mouse and involve cotransplantation of PBLs or fetal
cells with fetal mesenteric lymph nodes to provide support for
immune responses (Carballido et al., 2000, Nat. Med. 6:103-106.
[0143] SCID-hu or NOD-SCID-hu mice are reconstituted with
peripheral blood mononuclear cells (PBMCs) isolated from
tetanus-toxoid (TT) immunized human donors. SCID-hu mice so
reconstituted have human cells residing in various compartments,
including the peritoneum. NOD-SOD-hu mice so reconstituted have
human T cells residing in various compartments including within
their secondary lymphoid organs, such as the spleen. Primary immune
responses are induced in these reconstituted mice by immunization
with antigen coupled to TT, or to an antigenic portion of TT, or to
liposomes, or to liposomes containing TT. Mice so reconstituted and
challenged produce a high titer (>1:1000) Ig response to antigen
(e.g., NP, DNP, KLH, OVA, HIV gp120 or portions thereof,
melanoma-associated antigen GD2, and ovine mucin, are just a few of
many examples). Some examples are presented in Ifverson et al.,
1995, Immunology 84:111-116. Mice so reconstituted and then treated
with KIM-1 antagonists or modifying agents do not produce a high
titer to antigen challenge.
[0144] In another methodology, SCID-hu mice are reconstituted with
fetal human bone, thymus, fragments of skin, and mesenteric lymph
nodes (MLN). The presence of MLN is sufficient to support robust
immune responses to TT-immunization (and, since all donor tissue is
fetal, this is strictly a primary immune response). This model is
discussed in detail in Carballido et al., 2000, Nat. Med.
6:103-106. TT-immunization causes human lymphocyte proliferation,
and activation, and IgM and IgG-secretion by B cells. Treatment of
SCID mice so reconstituted with KIM-1 antagonists or modifying
agents reduces the human lymphocyte proliferation, activation, and
the secretion of immunoglobulins upon TT-challenge.
[0145] In a modification of these models, or other similar
NOD-SCID-hu or SCID-hu models, secondary immune responses are
measured in a disease setting, e.g., of delayed type
hypersensitivity (DTH). In this instance the TT-challenge is given
in the footpad of SCID or NOD-SCID mice reconstituted with PBMCs
from TT-immune individuals, and the swelling of the footpad is
measured in response. The DTH responses relies on the presence of
human memory T cells in circulation in the reconstituted mouse.
Such models can also be used to detect the possible rejection of
donor tissue in transplant patients, as in the "trans vivo" models.
An example of this type of approach is discussed in Carrodeguas et
al., 1999, Hum. Immunol. 60: 640-651. Treatment of mice so
reconstituted with KIM-1 antagonists or modifying agents prevents
DTH responses. Other models of human disease responses in the SCID
mouse include transfer of splenocytes or PBMCs from autoimmune
patients in the mouse, whereby they continue expression of
immunoglobulins and other markers of disease (see Martino and
Grinaldim 1997, In: Immunology Methods Manual, vol 3. Lefkovits,
ed. Academic Press, San Diego). Treatment of these mice with KIM-1
antagonists or modifying agents prior to the transfer of autoimmune
cells from patients reduces the expression of immunoglobulins or
other markers of the autoimmune pathology.
[0146] A very valuable methodology utilizing the SCID mouse involve
the xenografting of disease tissue onto the recipient mouse.
Methods of transferring skin from psoriasis or atopic dermatitis
patients for instance are widely used models of these diseases.
Atopic dermatitis is a Th2 mediated cellular immune disease that
can be modeled in SCID mice by transferring the PBMCs and biopsies
of skin together to the recipient mouse. Treatment of these mice
with KIM-1 antagonists or modifiers prevents the cellular
accumulation and local cytokine secretion which is evidence of
activation of lymphocytes and effector cells (eosinophils,
basophils, etc.) in the skin graft. This is evidence of efficacy in
preventing dermatitis in the donor patient.
Example 8
Other Murine Models of Atopic Disease
[0147] Useful models of allergy, asthma, airway hypersensitivity
(AHR), and other atopic diseases are run in the mouse. For example,
allergic skin inflammation is induced by epicutaneous sensitization
with antigen. In one example the antigen is ovalbumin (OVA). The
Th2 response to this sensitization is shown by the presence of
eosinophils in the skin, local expression in the skin of Th2
cytokines, and airway hyperresponsiveness (AHR) to inhaled antigen.
Eosinophils are absent from the skin of OVA-sensitized mice that
are first treated with KIM-1 antagonists or modifiers, and the
level of Th2 cytokines is reduced. Mice that are repeatedly
sensitized produce OVA-specific IgE, and their splenocytes secrete
the Th2 cytokines IL-4 and IL-5 following in vitro stimulation with
OVA. These readouts of the Th2 immune response are blocked upon
treatment with KIM-1 antagonists or modifiers. Alternatively, mice
(e.g., BALB/c mice) can be sensitized with an i.p. injection of
antigen (day 0), then rechallenged with intranasal antigen 3 weeks
later (once) and 4 weeks later (3 times: days 26, 27, 28, e.g.).
This produces lung hyperresponsiveness (AHR), which is mediated by
Th2 cytokines such as IL-13. This Th2 immune response is blocked
upon treatment with KIM-1 antagonists or modifiers.
[0148] Using the OVA-specific TCR transgenic model (DO11.10), we
induce an OVA-specific immune response, then transfer
Th20VA-specific T cells to naive recipients, which then are
challenged with OVA-aerosal. These mice rapidly develop
antigen-specific AHR. This response is blocked when mice are
treated with KIM-1 antagonists or modifiers prior to OVA aerosal
challenge.
[0149] Methacholine aerosol treatment induces the recruitment of
eosinophils to the lung, causing AHR in mice. Treatment of mice
with KIM-1 antagonists or modifying agents will block AHR
development.
Example 9
Collagen-Induced Arthritis
[0150] In this murine model of arthritis, collagen is used to
trigger T cell-mediated B cell activation and autoantibody
production, which attacks the joints, resulting in a condition
which resembles rheumatoid arthritis. In various stains of mice
this response is dominated by high titers of IgG1. In particular,
in mice lacking Il-12 by genetic deficiency (Il-12 knockout mice:
Il-12-/-) the IgG1 titer is very high, and these Abs effectively
mediate joint destruction.
[0151] Mice are treated with collagen in complete freund's adjuvant
by injecting intradermally at 2 sites: a small volume delivered to
each ear, and a small volume delivered to the skin between the
shoulders. Three weeks later the mice are boosted with soluble
collagen in saline, using an intraperitoneal route. Within a week,
joint damage is assessed by measuring the swelling of the joint
with a caliper and by measuring antibody titers. Treatment of mice
during the course of disease development ameliorates disease score.
In particular, treatment with 0.1-1 mg/kg of KIM-1 antagonists or
modifying agents the day prior to disease initiation, followed by
treatments thereafter, will block disease development, as assessed
by reduced joint swelling and reduced immunolglobulin titers. This
is a prophylatic course of treatment.
[0152] Treatment with KM-1 a antagonist after induction, and prior
to boosting, ameliorates disease development, as assessed by
reduced joint swelling and reduced immunolglobulin titers. This is
a therapeutic course of treatment. Treatment with KIM-1 antagonists
or modifying agents after the boost injection blocks disease
development, as assessed by reduced joint swelling and reduced
immunolglobulin titers. This is a therapeutic course of
treatment.
Example 10
Murine Models of Lupus
[0153] In the NZB/W model, mice from the NZB strain are mated with
mice from the NZW strain, and the F1 progeny develop a lupus like
disease over time. Manifestations of disease include the production
of auto-antibodies and rheumatoid factor. Ig-deposition in the
kidney results from the high amount of Ig and RF produced, leading
to decreased kidney function over time, as can be measured by
proteinuria in the urine.
[0154] The NZB/W F1 progeny begin to manifest symptoms of disease
at around 5 months of age, with moderate proteinuria scores at that
time (PU of 2). By 9 months of age the mice will have reached a
maximum PU=4, and will begin to succomb to disease as a consequence
of kidney failure. Another model called SNF1 (SWR.times.NZB F1
cross) follows similar kinetics.
[0155] Mice are treated with 0.1-1 mg/kg of KIM-1 antagonists the
day prior to disease initiation, followed by treatments thereafter.
This blocks disease development, as measured by the PU score,
and/or by measuring titers of immunoglobulin in the serum, and/or
by immunohistochemical analysis of hyperplasia in the spleen,
and/or by immunohistochemical analysis of immune complex deposition
and changes in the structure of the glomeruli in the kidney.
[0156] Treatment with KIM-1 antagonists after induction of disease,
for example at the 5th month, but prior to severe disease (i.e.,
PU=2-3, ameliorates disease development or reverses disease damage.
This can be measured by the PU score, and/or by measuring titers of
immunoglobulin in the serum, and/or by immunohistochemical analysis
of hyperplasia in the spleen, and/or by immunohistochemical
analysis of immune complex deposition and changes in the structure
of the glomeruli in the kidney.
[0157] Treatment with KIM-1 antagonists after disease is severe
(PU=3-4) blocks disease development or reverses disease damage.
This can be measured by the PU score, and/or by measuring titers of
immunoglobulin in the serum, and/or by immunohistochemical analysis
of hyperplasia in the spleen, and/or by immunohistochemical
analysis of immune complex deposition and changes in the structure
of the glomeruli in the kidney.
Example 11
Mixed Lymphocyte Reaction (MLR)
[0158] Mouse MLR assays and antagonism of KIM-1. Mixed lymphocyte
reactions (MLR) were run as follows: Spleens were isolated from
C57B16 and Balb/c mice using sterile technique, ground roughly to
release lymphocytes, then treated with a hypotonic solution (Gey's
solution) to lyse red blood cells. The remaining cells were
separated from residual tissue by passing them through a cell
strainer (BD Falcon, Bedford, Mass. USA), and then were washed with
sterile, pyrogen-free PBS, and centrifuged to pellet the cells. The
cells were resuspended in the PBS solution a second time, pelleted
again, then resuspended in complete RPMI media. The cells were
counted and diluted as necessary. The Balb/c lymphocytes were used
as the stimulator cells, therefore, these were irradiated at 3000
RAD prior to use.
[0159] To set up the assays, stimulator cells were added to the
well as varying ratios relative to the number of responder cells
(2.times.10.sup.5/well). Media was supplemented with rat anti-KIM-1
antibodies, or KIM-1-Ig fusion protein and control-Ig fusion
proteins at 20 .mu.g/ml, as indicated. Cultures were set up in
three identical plates, and each experimental condition was
represented by 3 wells per plate. One plate was used to generate
cell proliferation data using an MTS assay (CellTiter 96, Promega,
Madison, Wis. USA). The other plates were used to collect
supernatant samples for cytokine analyses. ELISAs (Pierce Endogen,
Rockford, Ill. USA) were used to measure the levels of mIFN.gamma.,
mTNF, and mIl-2 in culture supernatants. Standard errors for values
derived from the proliferation assays and ELISAs were less than
10%, and have been omitted from the figures. Large deviations from
the positive control values for IFN.gamma. were noted, while the
levels of Il-2 and TNF in the cultures were not significantly
different between the positive control and treatment groups.
Therefore, the Il-2 and TNF data have been omitted; the data for
IFN.gamma. and cell proliferation are shown for each representative
experiment.
[0160] Treatment of the MLR culture with the rat anti-mouse KIM-1
mAbs 3A2.5 and 1H9.11 significantly reduced the level of IFN.gamma.
secreted into the supernatant (FIG. 8). This effect was specific
for IFN.gamma., since no decrease in the level of Il-2 or TNF
secreted into the supernatant was observed. The effect was not due
to decreased cell number in these cultures, since the cell
proliferation assay showed that the number of live cells in the
cultures was similar (FIG. 9).
[0161] Treatment of the MLR culture with KIM-1-Ig fusion protein
significantly reduced the level of IFN.gamma. secreted into the
supernatant (FIG. 10). This effect was specific for IFN.gamma.,
since no decrease in the level of Il-2 or TNF secreted into the
supernatant was noted (data not shown). The effect was not due to
decreased cell number in these cultures, since the cell
proliferation assay showed that the number of live cells in the
culture treated with KIM-1-Ig fusion protein was very similar to
the untreated control (FIG. 11).
[0162] Human MLR assays and antagonism of KIM-1. Mixed lymphocyte
reactions (MLR) were run as follows: Peripheral blood mononuclear
cells were isolated from whole blood taken from normal human donors
using Ficoll gradient centrifugation. The cells were then washed
with sterile, pyrogen-free PBS, and centrifuged to pellet the
cells. The cells were resuspended in the PBS solution a second
time, pelleted again, then resuspended in complete RPMI media. The
cells were counted and diluted as necessary. JY cells (ATCC,
Bethesda, Md. USA) were used as the stimulator cells, therefore,
these were irradiated at 10000 RAD prior to use.
[0163] To set up the assays, stimulator were added to the well as
varying ratios relative to the number of responder cells
(2.times.10.sup.5/well). Media was supplemented with mouse
anti-KIM-1 antibodies, at 20 .mu.g/ml, as indicated. Cultures were
set up in three identical plates, and each experimental condition
was represented by 3 wells per plate. One plate was used to
generate cell proliferation data using an MTS assay (CellTiter 96,
Promega, Madison, Wis. USA). The other plates were used to collect
supernatant samples for cytokine analyses. ELISAs (Pierce Endogen,
Rockford, Ill. USA or R-1-D Systems, Minneapolis, Minn. USA) were
used to measure the levels of hIFN.gamma., hTNF, and hIl-2 in
culture supernatants. Standard errors for values derived from the
proliferation assays and ELISAs were less than 10%, and have been
omitted from the figures. Large deviations from the positive
control values for IFN.gamma. were observed, while the levels of
Il-2 and TNF in the cultures were not significantly different
between the positive control and treatment groups. The TNF data
have been omitted. Data for Il-2, IFN.gamma. and cell proliferation
are shown for this representative experiment.
[0164] Treatment of the MLR culture with the mouse anti-human KIM-1
mAbs AUF1 and AKG7 significantly reduced the level of IFN.gamma.
secreted into the supernatant (FIG. 12A). This effect was specific
for IFN.gamma., since no decrease in the level of 1'-2 or TNF
secreted into the supernatant was noted (FIG. 12B). The effect was
not due to decreased cell number in these cultures, since the cell
proliferation assay showed the number of live cells in the cultures
to be similar (FIG. 13).
Example 12
Mouse Inflammatory Bowel Disease (IBD) Model
[0165] The ability of a soluble form of KIM-1-Ig fusion protein to
influence the course or severity of symptoms in a model of IBD in
experimental mice. In this model, DSS was used to chronically
irritate the large bowel (colon), causing inflammation to develop.
It was known that pro-inflammatory mediators such as IFN.gamma.,
TNF, and 1'-12 are important to the development and severity of
IBD, both in mouse models and in human patients (Egger et al.,
2000, Digestion 62:240-248; Monteleone et al., 2000, Ann. Med.
32:552-560; Bouma et al., 2003, Nat. Rev. Immunol. 3:521-533). As
described above, MLR data had suggested that KIM-1 modulation could
influence the production of proinflammatory mediators such as
IFN.gamma.. Therefore, a KIM-1-modifying reagent was tested in
vivo. It was hypothesized that the KIM-1-Ig fusion protein was
acting by interrupting the interaction of one or more ligands with
KIM-1 expressed on cells such as activated lymphocytes or other
immune cells.
[0166] IBD was induced in mice using the dextran sulfate sodium
(DSS) model (Copper et al., 1993, Lab. Invest. 69:238-249). A
solution of 4.5% DSS (ICN Biomedicals, Aurora Ohio USA) in sterile
distilled water was provided as the drinking source. Mice were
weighed just prior to introduction to DSS, and weighed daily
thereafter. Mice were also scored for extent of diarrhea (1: soft
pellet, 2: loose pellet, 3: overtly fluid feces, 4: gross
incontinence) and for the presence of blood in the feces (0: none,
1: blood) using the ColoScreen slides (Helena Labs, Beaumont Tex.
USA). Small, but detectable, amounts of blood were given an
intermediate score of 0.5. Mice were dosed ip with 200 .mu.s of
KIM-1-Ig fusion protein or polyclonal hIgG control (S and Immune,
Sandoz, Geneva Switzerland) on day 0, day 2, and day 5. On day 8,
mice were taken off of DSS-water, and given normal drinking water.
Monitoring for weight and clinical scores continued until day 12,
at which time the experiment ended.
[0167] Treatment of mice during the induction phase of IBD (days 0,
2 and 5) had a significant impact on cumulative weight loss and
disease score, up to and including day 8. Therefore, mice were
taken off of DSS and returned to normal drinking water, and their
recovery was monitored. Mice that had received KIM-1-Ig fusion
protein on days 0, 2 and 5 were consistently healthier on day 11 (3
days into recovery) as indicated by the extent of weight loss (FIG.
14) and by their clinical score (diarrhea and bleeding; FIG. 15A).
Many fewer mice in the KIM-1-Ig-treated cohort had blood present in
the stool (FIG. 15B).
[0168] These data suggested that KIM-I modulation in vivo has
protective effects in an acute inflammatory context, such as is
present after DSS insult to the gut mucosa. These results suggested
that KIM-1 antagonists will be efficacious in other acute or
chronic inflammatory settings, e.g., in rheumatoid arthritis,
multiple sclerosis, psoriasis and pancreatitis.
[0169] Other embodiments are within the following claims.
Sequence CWU 1
1
91359PRTHomo sapiens 1Met His Pro Gln Val Val Ile Leu Ser Leu Ile
Leu His Leu Ala Asp1 5 10 15Ser Val Ala Gly Ser Val Lys Val Gly Gly
Glu Ala Gly Pro Ser Val 20 25 30Thr Leu Pro Cys His Tyr Ser Gly Ala
Val Thr Ser Met Cys Trp Asn 35 40 45Arg Gly Ser Cys Ser Leu Phe Thr
Cys Gln Asn Gly Ile Val Trp Thr 50 55 60Asn Gly Thr His Val Thr Tyr
Arg Lys Asp Thr Arg Tyr Lys Leu Leu65 70 75 80Gly Asp Leu Ser Arg
Arg Asp Val Ser Leu Thr Ile Glu Asn Thr Ala 85 90 95Val Ser Asp Ser
Gly Val Tyr Cys Cys Arg Val Glu His Arg Gly Trp 100 105 110Phe Asn
Asp Met Lys Ile Thr Val Ser Leu Glu Ile Val Pro Pro Lys 115 120
125Val Thr Thr Thr Pro Ile Val Thr Thr Val Pro Thr Val Thr Thr Val
130 135 140Arg Thr Ser Thr Thr Val Pro Thr Thr Thr Thr Val Pro Thr
Thr Thr145 150 155 160Val Pro Thr Thr Met Ser Ile Pro Thr Thr Thr
Thr Val Pro Thr Thr 165 170 175Met Thr Val Ser Thr Thr Thr Ser Val
Pro Thr Thr Thr Ser Ile Pro 180 185 190Thr Thr Thr Ser Val Pro Val
Thr Thr Thr Val Ser Thr Phe Val Pro 195 200 205Pro Met Pro Leu Pro
Arg Gln Asn His Glu Pro Val Ala Thr Ser Pro 210 215 220Ser Ser Pro
Gln Pro Ala Glu Thr His Pro Thr Thr Leu Gln Gly Ala225 230 235
240Ile Arg Arg Glu Pro Thr Ser Ser Pro Leu Tyr Ser Tyr Thr Thr Asp
245 250 255Gly Asn Asp Thr Val Thr Glu Ser Ser Asp Gly Leu Trp Asn
Asn Asn 260 265 270Gln Thr Gln Leu Phe Leu Glu His Ser Leu Leu Thr
Ala Asn Thr Thr 275 280 285Lys Gly Ile Tyr Ala Gly Val Cys Ile Ser
Val Leu Val Leu Leu Ala 290 295 300Leu Leu Gly Val Ile Ile Ala Lys
Lys Tyr Phe Phe Lys Lys Glu Val305 310 315 320Gln Gln Leu Ser Val
Ser Phe Ser Ser Leu Gln Ile Lys Ala Leu Gln 325 330 335Asn Ala Val
Glu Lys Glu Val Gln Ala Glu Asp Asn Ile Tyr Ile Glu 340 345 350Asn
Ser Leu Tyr Ala Thr Asp 3552334PRTHomo sapiens 2Met His Pro Gln Val
Val Ile Leu Ser Leu Ile Leu His Leu Ala Asp1 5 10 15Ser Val Ala Gly
Ser Val Lys Val Gly Gly Glu Ala Gly Pro Ser Val 20 25 30Thr Leu Pro
Cys His Tyr Ser Gly Ala Val Thr Ser Met Cys Trp Asn 35 40 45Arg Gly
Ser Cys Ser Leu Phe Thr Cys Gln Asn Gly Ile Val Trp Thr 50 55 60Asn
Gly Thr His Val Thr Tyr Arg Lys Asp Thr Arg Tyr Lys Leu Leu65 70 75
80Gly Asp Leu Ser Arg Arg Asp Val Ser Leu Thr Ile Glu Asn Thr Ala
85 90 95Val Ser Asp Ser Gly Val Tyr Cys Cys Arg Val Glu His Arg Gly
Trp 100 105 110Phe Asn Asp Met Lys Ile Thr Val Ser Leu Glu Ile Val
Pro Pro Lys 115 120 125Val Thr Thr Thr Pro Ile Val Thr Thr Val Pro
Thr Val Thr Thr Val 130 135 140Arg Thr Ser Thr Thr Val Pro Thr Thr
Thr Thr Val Pro Thr Thr Thr145 150 155 160Val Pro Thr Thr Met Ser
Ile Pro Thr Thr Thr Thr Val Pro Thr Thr 165 170 175Met Thr Val Ser
Thr Thr Thr Ser Val Pro Thr Thr Thr Ser Ile Pro 180 185 190Thr Thr
Thr Ser Val Pro Val Thr Thr Thr Val Ser Thr Phe Val Pro 195 200
205Pro Met Pro Leu Pro Arg Gln Asn His Glu Pro Val Ala Thr Ser Pro
210 215 220Ser Ser Pro Gln Pro Ala Glu Thr His Pro Thr Thr Leu Gln
Gly Ala225 230 235 240Ile Arg Arg Glu Pro Thr Ser Ser Pro Leu Tyr
Ser Tyr Thr Thr Asp 245 250 255Gly Asn Asp Thr Val Thr Glu Ser Ser
Asp Gly Leu Trp Asn Asn Asn 260 265 270Gln Thr Gln Leu Phe Leu Glu
His Ser Leu Leu Thr Ala Asn Thr Thr 275 280 285Lys Gly Ile Tyr Ala
Gly Val Cys Ile Ser Val Leu Val Leu Leu Ala 290 295 300Leu Leu Gly
Val Ile Ile Ala Lys Lys Tyr Phe Phe Lys Lys Glu Val305 310 315
320Gln Gln Leu Arg Pro His Lys Ser Cys Ile His Gln Arg Glu 325
3303518PRTArtificial SequenceHuman KIM-1 Extracellular Domain Fc
Construct 3Met His Pro Gln Val Val Ile Leu Ser Leu Ile Leu His Leu
Ala Asp1 5 10 15Ser Val Ala Gly Ser Val Lys Val Gly Gly Glu Ala Gly
Pro Ser Val 20 25 30Thr Leu Pro Cys His Tyr Ser Gly Ala Val Thr Ser
Met Cys Trp Asn 35 40 45Arg Gly Ser Cys Ser Leu Phe Thr Cys Gln Asn
Gly Ile Val Trp Thr 50 55 60Asn Gly Thr His Val Thr Tyr Arg Lys Asp
Thr Arg Tyr Lys Leu Leu65 70 75 80Gly Asp Leu Ser Arg Arg Asp Val
Ser Leu Thr Ile Glu Asn Thr Ala 85 90 95Val Ser Asp Ser Gly Val Tyr
Cys Cys Arg Val Glu His Arg Gly Trp 100 105 110Phe Asn Asp Met Lys
Ile Thr Val Ser Leu Glu Ile Val Pro Pro Lys 115 120 125Val Thr Thr
Thr Pro Ile Val Thr Thr Val Pro Thr Val Thr Thr Val 130 135 140Arg
Thr Ser Thr Thr Val Pro Thr Thr Thr Thr Val Pro Thr Thr Thr145 150
155 160Val Pro Thr Thr Met Ser Ile Pro Thr Thr Thr Thr Val Pro Thr
Thr 165 170 175Met Thr Val Ser Thr Thr Thr Ser Val Pro Thr Thr Thr
Ser Ile Pro 180 185 190Thr Thr Thr Ser Val Pro Val Thr Thr Thr Val
Ser Thr Phe Val Pro 195 200 205Pro Met Pro Leu Pro Arg Gln Asn His
Glu Pro Val Ala Thr Ser Pro 210 215 220Ser Ser Pro Gln Pro Ala Glu
Thr His Pro Thr Thr Leu Gln Gly Ala225 230 235 240Ile Arg Arg Glu
Pro Thr Ser Ser Pro Leu Tyr Ser Tyr Thr Thr Asp 245 250 255Gly Asn
Asp Thr Val Thr Glu Ser Ser Asp Gly Leu Trp Asn Asn Asn 260 265
270Gln Thr Gln Leu Phe Leu Glu His Ser Leu Leu Thr Ala Asn Thr Thr
275 280 285Lys Gly Val Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala
Pro Glu 290 295 300Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro
Lys Pro Lys Asp305 310 315 320Thr Leu Met Ile Ser Arg Thr Pro Glu
Val Thr Cys Val Val Val Asp 325 330 335Val Ser His Glu Asp Pro Glu
Val Lys Phe Asn Trp Tyr Val Asp Gly 340 345 350Val Glu Val His Asn
Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn 355 360 365Ser Thr Tyr
Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp 370 375 380Leu
Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro385 390
395 400Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg
Glu 405 410 415Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu
Thr Lys Asn 420 425 430Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe
Tyr Pro Ser Asp Ile 435 440 445Ala Val Glu Trp Glu Ser Asn Gly Gln
Pro Glu Asn Asn Tyr Lys Thr 450 455 460Thr Pro Pro Val Leu Asp Ser
Asp Gly Ser Phe Phe Leu Tyr Ser Lys465 470 475 480Leu Thr Val Asp
Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys 485 490 495Ser Val
Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu 500 505
510Ser Leu Ser Pro Gly Lys 5154357PRTArtificial SequenceHuman KIM-1
Partial Extracellular Domain Fc Construct 4Met His Pro Gln Val Val
Ile Leu Ser Leu Ile Leu His Leu Ala Asp1 5 10 15Ser Val Ala Gly Ser
Val Lys Val Gly Gly Glu Ala Gly Pro Ser Val 20 25 30Thr Leu Pro Cys
His Tyr Ser Gly Ala Val Thr Ser Met Cys Trp Asn 35 40 45Arg Gly Ser
Cys Ser Leu Phe Thr Cys Gln Asn Gly Ile Val Trp Thr 50 55 60Asn Gly
Thr His Val Thr Tyr Arg Lys Asp Thr Arg Tyr Lys Leu Leu65 70 75
80Gly Asp Leu Ser Arg Arg Asp Val Ser Leu Thr Ile Glu Asn Thr Ala
85 90 95Val Ser Asp Ser Gly Val Tyr Cys Cys Arg Val Glu His Arg Gly
Trp 100 105 110Phe Asn Asp Met Lys Ile Thr Val Ser Leu Glu Ile Val
Pro Pro Lys 115 120 125Val Val Asp Lys Thr His Thr Cys Pro Pro Cys
Pro Ala Pro Glu Leu 130 135 140Leu Gly Gly Pro Ser Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp Thr145 150 155 160Leu Met Ile Ser Arg Thr
Pro Glu Val Thr Cys Val Val Val Asp Val 165 170 175Ser His Glu Asp
Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 180 185 190Glu Val
His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser 195 200
205Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu
210 215 220Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu
Pro Ala225 230 235 240Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly
Gln Pro Arg Glu Pro 245 250 255Gln Val Tyr Thr Leu Pro Pro Ser Arg
Asp Glu Leu Thr Lys Asn Gln 260 265 270Val Ser Leu Thr Cys Leu Val
Lys Gly Phe Tyr Pro Ser Asp Ile Ala 275 280 285Val Glu Trp Glu Ser
Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 290 295 300Pro Pro Val
Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu305 310 315
320Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser
325 330 335Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser
Leu Ser 340 345 350Leu Ser Pro Gly Lys 35558PRTArtificial
SequenceC-terminal peptide for Human KIM-1 Extracellular Domain
Histag Construct 5Val Glu His His His His His His1 568PRTArtificial
SequenceSynthetically generated peptide 6Asp Tyr Lys Asp Asp Asp
Asp Lys1 57298PRTArtificial SequenceHuman KIM-1 Extracellular
Domain Histag Construct 7Met His Pro Gln Val Val Ile Leu Ser Leu
Ile Leu His Leu Ala Asp1 5 10 15Ser Val Ala Gly Ser Val Lys Val Gly
Gly Glu Ala Gly Pro Ser Val 20 25 30Thr Leu Pro Cys His Tyr Ser Gly
Ala Val Thr Ser Met Cys Trp Asn 35 40 45Arg Gly Ser Cys Ser Leu Phe
Thr Cys Gln Asn Gly Ile Val Trp Thr 50 55 60Asn Gly Thr His Val Thr
Tyr Arg Lys Asp Thr Arg Tyr Lys Leu Leu65 70 75 80Gly Asp Leu Ser
Arg Arg Asp Val Ser Leu Thr Ile Glu Asn Thr Ala 85 90 95Val Ser Asp
Ser Gly Val Tyr Cys Cys Arg Val Glu His Arg Gly Trp 100 105 110Phe
Asn Asp Met Lys Ile Thr Val Ser Leu Glu Ile Val Pro Pro Lys 115 120
125Val Thr Thr Thr Pro Ile Val Thr Thr Val Pro Thr Val Thr Thr Val
130 135 140Arg Thr Ser Thr Thr Val Pro Thr Thr Thr Thr Val Pro Thr
Thr Thr145 150 155 160Val Pro Thr Thr Met Ser Ile Pro Thr Thr Thr
Thr Val Pro Thr Thr 165 170 175Met Thr Val Ser Thr Thr Thr Ser Val
Pro Thr Thr Thr Ser Ile Pro 180 185 190Thr Thr Thr Ser Val Pro Val
Thr Thr Thr Val Ser Thr Phe Val Pro 195 200 205Pro Met Pro Leu Pro
Arg Gln Asn His Glu Pro Val Ala Thr Ser Pro 210 215 220Ser Ser Pro
Gln Pro Ala Glu Thr His Pro Thr Thr Leu Gln Gly Ala225 230 235
240Ile Arg Arg Glu Pro Thr Ser Ser Pro Leu Tyr Ser Tyr Thr Thr Asp
245 250 255Gly Asn Asp Thr Val Thr Glu Ser Ser Asp Gly Leu Trp Asn
Asn Asn 260 265 270Gln Thr Gln Leu Phe Leu Glu His Ser Leu Leu Thr
Ala Asn Thr Thr 275 280 285Lys Gly Val Glu His His His His His His
290 29581398DNAArtificial SequenceHuman KIM-1 Extracellular Domain
Fe Construct Fc 8atgaatcaga ttcaagtctt catttcaggc ctcatactgc
ttctcccagg cactgtggat 60tcttatgtgg aagtaaaggg ggtagtgggt caccctgtca
cacttccatg tacttactca 120acatatcgtg gaatcacaac gacatgttgg
ggccgagggc aatgcccatc ttctgcttgt 180caaaatacac ttatttggac
caatggacat cgtgtcacct atcagaagag cagtcggtac 240aacttaaagg
ggcatatttc agaaggagat gtgtccttga cgatagagaa ctctgttgag
300agtgacagtg gtctgtattg ttgtcgagtg gagattcctg gatggtttaa
tgatcagaaa 360gtgacctttt cattgcaagt taaaccagag attcccacac
gtcctccaac aagacccaca 420actacaaggc ccacagctac aggaagaccc
acgactattt caacaagatc cacacatgta 480ccaacatcaa tcagagtctc
tacctccact cctccaacat ctacacacac atggactcac 540aaaccagaac
ccactacatt ttgtccccat gagacaacag ctgaggtgac aggaatccca
600tcccatactc ctacagactg gaatggcact gcgacatcct caggagatac
ctggagtaat 660cacactgaag caatccctcc agggaagccg cagaaaaacc
ctactaaggg cgtcgacaaa 720actcacacat gcccaccgtg cccagcacct
gaactcctgg ggggaccgtc agtcttcctc 780ttccccccaa aacccaagga
caccctcatg atctcccgga cccctgaggt cacatgcgtg 840gtggtggacg
tgagccacga agaccctgag gtcaagttca actggtacgt ggacggcgtg
900gaggtgcata atgccaagac aaagccgcgg gaggagcagt acaacagcac
gtaccgtgtg 960gtcagcgtcc tcaccgtcct gcaccaggac tggctgaatg
gcaaggagta caagtgcaag 1020gtctccaaca aagccctccc agcccccatc
gagaaaacca tctccaaagc caaagggcag 1080ccccgagaac cacaggtgta
caccctgccc ccatcccggg atgagctgac caagaaccag 1140gtcagcctga
cctgcctggt caaaggcttc tatcccagcg acatcgccgt ggagtgggag
1200agcaatgggc agccggagaa caactacaag accacgcctc ccgtgttgga
ctccgacggc 1260tccttcttcc tctacagcaa gctcaccgtg gacaagagca
ggtggcagca ggggaacgtc 1320ttctcatgct ccgtgatgca tgaggctctg
cacaaccact acacgcagaa gagcctctcc 1380ctgtctcccg ggaaatga
13989465PRTArtificial SequenceKIM-1 Fc Fusion 9Met Asn Gln Ile Gln
Val Phe Ile Ser Gly Leu Ile Leu Leu Leu Pro1 5 10 15Gly Thr Val Asp
Ser Tyr Val Glu Val Lys Gly Val Val Gly His Pro 20 25 30Val Thr Leu
Pro Cys Thr Tyr Ser Thr Tyr Arg Gly Ile Thr Thr Thr 35 40 45Cys Trp
Gly Arg Gly Gln Cys Pro Ser Ser Ala Cys Gln Asn Thr Leu 50 55 60Ile
Trp Thr Asn Gly His Arg Val Thr Tyr Gln Lys Ser Ser Arg Tyr65 70 75
80Asn Leu Lys Gly His Ile Ser Glu Gly Asp Val Ser Leu Thr Ile Glu
85 90 95Asn Ser Val Glu Ser Asp Ser Gly Leu Tyr Cys Cys Arg Val Glu
Ile 100 105 110Pro Gly Trp Phe Asn Asp Gln Lys Val Thr Phe Ser Leu
Gln Val Lys 115 120 125Pro Glu Ile Pro Thr Arg Pro Pro Thr Arg Pro
Thr Thr Thr Arg Pro 130 135 140Thr Ala Thr Gly Arg Pro Thr Thr Ile
Ser Thr Arg Ser Thr His Val145 150 155 160Pro Thr Ser Ile Arg Val
Ser Thr Ser Thr Pro Pro Thr Ser Thr His 165 170 175Thr Trp Thr His
Lys Pro Glu Pro Thr Thr Phe Cys Pro His Glu Thr 180 185 190Thr Ala
Glu Val Thr Gly Ile Pro Ser His Thr Pro Thr Asp Trp Asn 195 200
205Gly Thr Ala Thr Ser Ser Gly Asp Thr Trp Ser Asn His Thr Glu Ala
210 215 220Ile Pro Pro Gly Lys Pro Gln Lys Asn Pro Thr Lys Gly Val
Asp Lys225 230 235 240Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu
Leu Leu Gly Gly Pro 245 250 255Ser Val Phe Leu Phe Pro Pro Lys Pro
Lys Asp Thr Leu Met Ile Ser 260 265 270Arg Thr Pro Glu Val Thr Cys
Val Val Val Asp Val Ser His Glu Asp 275 280
285Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn
290 295 300Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr
Arg Val305 310 315 320Val Ser Val Leu Thr Val Leu His Gln Asp Trp
Leu Asn Gly Lys Glu 325 330 335Tyr Lys Cys Lys Val Ser Asn Lys Ala
Leu Pro Ala Pro Ile Glu Lys 340 345 350Thr Ile Ser Lys Ala Lys Gly
Gln Pro Arg Glu Pro Gln Val Tyr Thr 355 360 365Leu Pro Pro Ser Arg
Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr 370 375 380Cys Leu Val
Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu385 390 395
400Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu
405 410 415Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val
Asp Lys 420 425 430Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser
Val Met His Glu 435 440 445Ala Leu His Asn His Tyr Thr Gln Lys Ser
Leu Ser Leu Ser Pro Gly 450 455 460Lys465
* * * * *