U.S. patent application number 12/482790 was filed with the patent office on 2010-01-28 for novel death associated proteins, and thap1 and par4 pathways in apoptosis control.
Invention is credited to Francois Amalric, Thomas Clouaire, Jean-Philippe Girard, Myriam Roussigne.
Application Number | 20100021482 12/482790 |
Document ID | / |
Family ID | 23339898 |
Filed Date | 2010-01-28 |
United States Patent
Application |
20100021482 |
Kind Code |
A1 |
Girard; Jean-Philippe ; et
al. |
January 28, 2010 |
NOVEL DEATH ASSOCIATED PROTEINS, AND THAP1 AND PAR4 PATHWAYS IN
APOPTOSIS CONTROL
Abstract
The invention relates to genes and proteins of the THAP
(THanatos (death)-Associated Protein) family comprising a THAP
domain, and their use in diagnostics, treatment of disease, and in
the identification of molecules for the treatment of disease. The
invention also relates to the Par4 protein and SLC chemokine
pathways, including the interaction of Par4 and SLC with THAP
family proteins, and the recruitment and localization of Par4 to
PML nuclear bodies.
Inventors: |
Girard; Jean-Philippe;
(Rebigue, FR) ; Amalric; Francois; (Toulouse,
FR) ; Roussigne; Myriam; (La Bastide sur L'Hers,
FR) ; Clouaire; Thomas; (Toulouse, FR) |
Correspondence
Address: |
KNOBBE MARTENS OLSON & BEAR LLP
2040 MAIN STREET, FOURTEENTH FLOOR
IRVINE
CA
92614
US
|
Family ID: |
23339898 |
Appl. No.: |
12/482790 |
Filed: |
June 11, 2009 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
10317832 |
Dec 10, 2002 |
7572886 |
|
|
12482790 |
|
|
|
|
60341997 |
Dec 18, 2001 |
|
|
|
Current U.S.
Class: |
424/178.1 |
Current CPC
Class: |
A61P 35/02 20180101;
A61P 19/08 20180101; A61P 25/00 20180101; A61P 25/28 20180101; A61P
3/04 20180101; A61P 9/00 20180101; A61P 15/12 20180101; A61P 43/00
20180101; A61P 35/04 20180101; A61P 1/04 20180101; A61P 3/10
20180101; A61P 7/06 20180101; A61P 17/06 20180101; A61P 1/16
20180101; A61P 21/04 20180101; A61P 19/02 20180101; A61P 9/10
20180101; A61P 25/16 20180101; A61K 38/00 20130101; A61P 17/00
20180101; C07K 2319/30 20130101; C07K 14/4747 20130101; A61P 35/00
20180101; A61P 17/02 20180101; A61P 27/02 20180101 |
Class at
Publication: |
424/178.1 |
International
Class: |
A61K 39/395 20060101
A61K039/395; A61P 35/00 20060101 A61P035/00 |
Claims
1. A method of ameliorating a condition associated with the
activity of SLC in an individual comprising administering a
polypeptide comprising the SLC binding domain of a THAP-family
protein to said individual.
2. The method of claim 1, wherein said polypeptide comprises a
fusion protein comprising an Fc region of an immunoglobulin fused
to a polypeptide comprising the amino acid sequence selected from
the group consisting of amino acids 143-213 of SEQ ID NO: 3 and
homologs thereof having at least 70% amino acid identity.
3. The method of claim 2, wherein said amino acid identity is at
least 80%.
4. The method of claim 3, wherein said amino acid identity is at
least 90%.
5. The method of claim 1, wherein said polypeptide comprises an
oligomeric THAP protein comprising a plurality of THAP
polypeptides, wherein each THAP polypeptide comprises the amino
acid sequence selected from the group consisting of amino acid
143-213 of SEQ ID NO: 3 and homologs thereof having at least 70%
amino acid identity.
6. The method of claim 5, wherein said amino acid identity is at
least 80%.
7. The method of claim 6, wherein said amino acid identity is at
least 90%.
8. The method of claim 1, wherein said condition is
inflammation.
9. The method of claim 1, wherein said polypeptide comprises SEQ ID
NO: 3.
10. The method of claim 1, wherein said polypeptide is a fragment
of SEQ ID NO: 3.
11. The method of claim 10, wherein said fragment comprises at
least 60 consecutive amino acids of SEQ ID NO: 3.
12. The method of claim 10, wherein said fragment comprises at
least 70 consecutive amino acids of SEQ ID NO: 3.
13. The method of claim 10, wherein said fragment comprises at
least 80 consecutive amino acids of SEQ ID NO: 3.
14. The method of claim 1, wherein said SLC binding domain
comprises the amino acid sequence selected from the group
consisting of amino acid 143-213 of SEQ ID NO: 3 and homologs
thereof having at least 70% amino acid identity.
15. The method of claim 14, wherein said amino acid identity is at
least 80%.
16. The method of claim 15, wherein said amino acid identity is at
least 90%.
Description
RELATED APPLICATIONS
[0001] This application is a division of U.S. patent application
Ser. No. 10/317,832, entitled NOVEL DEATH ASSOCIATED PROTEINS, AND
THAP1 AND PAR4 PATHWAYS IN APOPTOSIS CONTROL, filed Dec. 10, 2002,
which is a nonprovisional application of and claims priority to
U.S. Provisional Patent Application No. 60/341,997, entitled NOVEL
DEATH ASSOCIATED PROTEINS, AND THAP1 AND PAR4 PATHWAYS IN APOPTOSIS
CONTROL, filed Dec. 18, 2001, the disclosures of which are
incorporated herein by reference in their entireties.
REFERENCE TO SEQUENCE LISTING
[0002] The present application is being filed along with a Sequence
Listing in electronic format. The Sequence Listing is provided as a
text file entitled CNRS009DV1.TXT, created Jun. 11, 2009, which is
239 KB in size. The information in the electronic format of the
Sequence Listing is incorporated herein by reference in its
entirety.
FIELD OF THE INVENTION
[0003] The present invention relates to genes and proteins of the
THAP (THanatos (death)-Associated Protein) family, and uses
thereof. In particular, the invention relates to polypeptides
comprising a THAP domain, the modulation of THAP-mediated
activities and the identification of compounds which modulate these
activities.
BACKGROUND
[0004] Coordination of cell proliferation and cell death is
required for normal development and tissue homeostasis in
multicellular organisms. A defect in the normal coordination of
these two processes is a fundamental requirement for
tumorigenesis.
[0005] Progression through the cell cycle is highly regulated,
requiring the transit of numerous checkpoints (for review, see
Hunter, 1993). The extent of cell death is physiologically
controlled by activation of a programmed suicide pathway that
results in morphologically recognizable form of death termed
apoptosis (Jacobson et al, 1997; Vaux et al., 1994). Both
extra-cellular signals, such as tumor necrosis factor, and
intracellular signals, like p53, can induce apoptotic cell death.
Although many proteins involved in apoptosis or the cell cycle have
been identified, the mechanisms by which these two processes are
coordinated are not well understood.
[0006] It is well established that molecules which modulate
apoptosis have the potential to treat a wide range of conditions
relating to cell death and cell proliferation. For example, such
molecules may be used for inducing cell death for the treatment of
cancers, inhibiting cell death for the treatment of
neurodegenerative disorders, and inhibiting or inducing cell death
for regulating angiogenesis. However, because many biological
pathways controlling cell cycle and apoptosis have not yet been
fully elucidated, there is a need for the identification of
biological targets for the development of therapeutic molecules for
the treatment of these disorders.
PML Nuclear Bodies
[0007] PML nuclear bodies (PML-NBs), also known as PODs (PML
oncogenic domains), ND10 (nuclear domain 10) and Kr bodies, are
discrete subnuclear domains that are specifically disrupted in
cells from acute promyelocytic leukemia (APL), a distinct subtype
of human myeloid leukemia (Maul et al., 2000; Ruggero et al., 2000;
Zhong et al., 2000a). Their name derives from their most
intensively studied protein component, the promyelocytic leukemia
protein (PML), a RING finger IFN-inducible protein encoded by a
gene originally cloned as the t(15; 17) chromosomal translocation
partner of the retinoic acid receptor (RAR) locus in APL. In APL
cells, the presence of the leukemogenic fusion protein, PML-RAR,
leads to the disruption of PML-NBs and the delocalization of PML
and other PML-NB proteins into aberrant nuclear structures (Zhong
et al., 2000a). Treatment of both APL cell lines and patients with
retinoic acid, which induces the degradation of the PML-RAR
oncoprotein, results in relocalization of PML and other NBs
components into PML-NBs and complete remission of clinical disease,
respectively. The deregulation of the PML-NBs by PML-RAR thus
appears to play a critical role in tumorigenesis. The analysis of
mice, where the PML gene was disrupted by homologous recombination,
has revealed that PML functions as a tumor suppressor in vivo (Wang
et al., 1998a), that is essential for multiple apoptotic pathways
(Wang et al., 1998b). Pml -/- mice and cells are protected from
Fas, TNF.alpha., ceramide and IFN-induced apoptosis as well as from
DNA damage-induced apoptosis. However, the molecular mechanisms
through which PML modulates the response to pro-apoptotic stimuli
are not well understood (Wang et al., 1998b; Quignon et al., 1998).
Recent studies indicate that PML can participate in both
p53-dependent and p53-independent apoptosis pathways (Guo et al.,
2000; Fogal et al., 2000). p53-dependent DNA-damage induced
apoptosis, transcriptional activation by p53 and induction of p53
target genes are all impaired in PML -/- primary cells (Guo et al.,
2000). PML physically interacts with p53 and acts as a
transcriptional co-activator for p53. This co-activatory role of
PML is absolutely dependent on its ability to recruit p53 in the
PML-NBs (Guo et al., 2000; Fogal et al., 2000). The existence of a
cross-talk between PML- and p53-dependent growth suppression
pathways implies an important role for PML-NBs and
PML-NBs-associated proteins as modulators of p53 functions. In
addition to p53, the pro-apoptotic factor Daxx could be another
important mediator of PML pro-apoptotic activities (Ishov et al.,
1999; Zhong et al., 2000b; Li et al., 2000). Daxx was initially
identified by its ability to enhance Fas-induced cell death. Daxx
interacts with PML and localizes preferentially in the nucleus
where it accumulates in the PML-NBs (Ishov et al., 1999; Zhong et
al., 2000b; Li et al., 2000). Inactivation of PML results in
delocalization of Daxx from PML-NBs and complete abrogation of Daxx
pro-apoptotic activity (Zhong et al., 2000b). Daxx has recently
been found to possess strong transcriptional repressor activity (Li
et al., 2000). By recruiting Daxx to the PML-NBs, PML may inhibit
Daxx-mediated transcriptional repression, thus allowing the
expression of certain pro-apoptotic genes.
[0008] PML-NBs contain several other proteins in addition to Daxx
and p53. These include the autoantigens Sp100 (Sternsdorf et al.,
1999) and Sp100-related protein Sp140 (Bloch et al., 1999), the
retinoblastoma tumor suppressor pRB (Alcalay et al., 1998), the
transcriptional co-activator CBP (LaMorte et al., 1998), the Bloom
syndrome DNA helicase BLM (Zhong et al., 1999) and the small
ubiquitin-like modifier SUMO-1 (also known as sentrin-1 or PIC1;
for recent reviews see Yeh et al., 2000; Melchior, 2000; Jentsch
and Pyrowolakis, 2000). Covalent modification of PML by SUMO-1
(sumoylation) appears to play a critical role in PML accumulation
into NBs (Muller et al., 1998) and the recruitment of other NBs
components to PML-NBs (Ishov et al., 1999; Zhong et al.,
2000c).
Prostate Apoptosis Response-4
[0009] Prostate apoptosis response-4 (PAR4) is a 38 kDa protein
initially identified as the product of a gene specifically
upregulated in prostate tumor cells undergoing apoptosis (for
reviews see Rangnekar, 1998; Mattson et al., 1999). Consistent with
an important role of PAR4 in apoptosis, induction of PAR4 in
cultured cells is found exclusively during apoptosis and ectopic
expression of PAR4 in NIH-3T3 cells (Diaz-Meco et al., 1996),
neurons (Guo et al., 1998), prostate cancer and melanoma cells
(Sells et al., 1997) has been shown to sensitize these cells to
apoptotic stimuli. In addition, down regulation of PAR4 is critical
for ras-induced survival and tumor progression (Barradas et al.,
1999) and suppression of PAR4 production by antisense technology
prevents apoptosis in several systems (Sells et al., 1997; Guo et
al., 1998), including different models of neurodegenerative
disorders (Mattson et al., 1999), further emphasizing the critical
role of PAR4 in apoptosis. At the carboxy terminus, PAR4 contains
both a leucine zipper domain (Par4LZ, amino acids 290-332), and a
partially overlapping death domain (Par4DD, amino acids 258-332).
Deletion of this carboxy-terminal part abrogates the pro-apoptotic
function of PAR4 (Diaz-Meco et al., 1996; Sells et al., 1997; Guo
et al., 1998). On the other hand, overexpression of PAR4 leucine
zipper/death domain acts in a dominant negative manner to prevent
apoptosis induced by full-length PAR4 (Sells et al., 1997; Guo et
al., 1998). The PAR4 leucine zipper/death domain mediates PAR4
interaction with other proteins by recognizing two different kinds
of motifs: zinc fingers of the Wilms tumor suppressor protein WT1
(Johnstone et al., 1996) and the atypical isoforms of protein
kinase C (Diaz-Meco et al., 1996), and an arginine-rich domain from
the death-associated-protein (DAP)-like kinase Dlk (Page et al.,
1999). Among these interactions, the binding of PAR4 to aPKCs and
the resulting inhibition of their enzymatic activity is of
particular functional relevance because the aPKCs are known to play
a key role in cell survival and their overexpression has been shown
to abrogate the ability of PAR4 to induce apoptosis (Diaz-Meco et
al., 1996; Berra et al., 1997).
SLC/CCL21
[0010] Chemokine SLC/CCL21 (also known as SLC, CK.beta.-9, 6Ckine,
and exodus-2) is a member of the CC (beta)-chemokine subfamily.
SLC/CCL21 contains the four conserved cysteines characteristic of
beta chemokines plus two additional cysteines in its unusually long
carboxyl-terminal domain. Human SLC/CCL21 cDNA encodes a 134 amino
acid residue, highly basic, precursor protein with a 23 amino acid
residue signal peptide that is cleaved to form the predicted 111
amino acid residues mature protein. Mouse SLC/CCL21 cDNA encodes a
133 amino acid residue protein with 23 residue signal peptide that
is cleaved to generate the 110 residue mature protein. Human and
mouse SLC/CCL21 is highly conserved, exhibiting 86% amino acid
sequence identity. The gene for human SLC/CCL21 has been localized
at human chromosome 9p13 rather than chromosome 17, where the genes
of many human CC chemokines are clustered. The SLC/CCL21 gene
location is within a region of about 100 kb as the gene for MIP-3
beta/ELC/CCL19, another recently identified CC chemokine. SLC/CCL21
was previously known to be highly expressed in lymphoid tissues at
the mRNA level, and to be a chemoattractant for T and B lymphocytes
(Nagira, et al. (1997) J. Biol. Chem. 272:19518-19524; Hromas, et
al. (1997) J. Immunol. 159:2554-2558; Hedrick, et al. (1997) J.
Immunol. 159:1589-1593; Gunn, et al. (1998) Proc. Natl. Acad. Sci.
95:258-263). SLC/CCL21 also induces both adhesion of lymphocytes to
intercellular adhesion molecule-1 and arrest of rolling cells
(Campbell, et al. (1998) Science 279:381-384). All of the above
properties are consistent with a role for SLC/CCL21 in regulating
trafficking of lymphocytes through lymphoid tissues. Unlike most CC
chemokines, SLC/CCL21 is not chemotactic for monocytes. However, it
has been reported to inhibit hemopoietic progenitor colony
formation in a dose-dependent manner (Hromas et al. (1997) J.
Immunol. 159: 2554-58).
[0011] Chemokine SLC/CCL21 is a ligand for chemokine receptor CCR7
(Rossi et al. (1997) J. Immunol. 158:1033; Yoshida et al. (1997) J.
Biol. Chem. 272:13803; Yoshida et al. (1998) J. Biol. Chem.
273:7118; Campbell et al. (1998) J Cell Biol 141:1053). CCR7 is
expressed on T cells and dendritic cells (DC), consistent with the
chemotactic action of SLC/CCL21 for both lymphocytes and mature DC.
Both memory (CD45RO.sup.+) and naive (CD45RA.sup.+) CD4.sup.+ and
CD8.sup.+ T cells express the CCR7 receptor (Sallusto et al. (1999)
Nature 401:708). Within the memory T cell population, CCR7
expression discriminates between T cells with effector function
that can migrate to inflamed tissues (CCR7.sup.-) vs. T cells that
require a secondary stimulus prior to displaying effector functions
(CCR7.sup.+) (Sallusto et al. (1999) Nature 401:708). Unlike mature
DC, immature DC do not express CCR7 nor do they respond to the
chemotactic action of CCL21 (Sallusto et al. (1998) Eur. J.
Immunol. 28:2760; Dieu et al. (1998) J. Exp. Med. 188:373).
[0012] A key function of CCR7 and its two ligands SLC/CCL21 and
MIP3b/CCL19 is facilitating recruitment and retention of cells to
secondary lymphoid organs in order to promote efficient antigen
exposure to T cells. CCR7-deficient mice demonstrate poorly
developed secondary organs and exhibit an irregular distribution of
lymphocytes within lymph nodes, Peyer's patches, and splenic
periarteriolar lymphoid sheaths (Forster et al. (1999) Cell 99:23).
These animals have severely impaired primary T cell responses
largely due to the inability of interdigitating DC to migrate to
the lymph nodes (Forster et al. (1999) Cell 99:23). The overall
findings to date support the notion that CCR7 and its two ligands,
CCL19 and CCL21, are key regulators of T cell responses via their
control of T cell/DC interactions. CCR7 is an important regulatory
molecule with an instructive role in determining the migration of
cells to secondary lymphoid organs (Forster et al. (1999) Cell
99:23; Nakano et al. (1998) Blood 91:2886).
SUMMARY OF THE INVENTION
THAP1
THanatos-Associated-Protein-1
[0013] In the past few years, the inventors have focused on the
molecular characterization of novel genes expressed in the
specialized endothelial cells (HEVECs) of post-capillary high
endothelial venules (Girard and Springer, 1995a; Girard and
Springer, 1995b; Girard et al., 1999). In the present invention,
they report the analysis of THAP1 (for THanatos (death)-Associated
Protein-1), a protein that localizes to PML-NBs. Two hybrid
screening of an HEVEC cDNA library with the THAP1 bait lead to the
identification of a unique interacting partner, the pro-apoptotic
protein PAR4. PAR4 is also found to accumulate into PML-NBs and
targeting of the THAP1/PAR4 complex to PML-NLs is mediated by PML.
Similarly to PAR4, THAP1 is a pro-apoptotic polypeptide. Its
pro-apoptotic activity requires a novel protein motif in the
amino-terminal part called THAP domain. Together these results
define a novel PML-NBs pathway for apoptosis that involves the
THAP1/PAR4 pro-apoptotic complex.
[0014] The present invention includes genes, proteins and
biological pathways involved in apoptosis. In some embodiments, the
genes, proteins, and pathways disclosed herein may be used for the
development of polypeptide, nucleic acid or small molecule
therapeutics.
[0015] The present invention provides a novel protein motif, the
THAP domain. The present inventors initially identified the THAP
domain as a 90 residue protein motif in the amino-terminal part of
THAP1 and which is essential for THAP1 pro-apoptotic activity.
THAP1 (THanatos (death) Associated Protein-1), as determined by the
present inventors, is a pro-apoptotic polypeptide which forms a
complex with the pro-apoptotic protein PAR4 and localizes in
discrete subnuclear domains known as PML nuclear bodies. However,
the THAP domain also defines a novel family of proteins, the THAP
family, and the inventors have also provided at least twelve
distinct members in the human genome (THAP-0 to THAP11), all of
which contain a THAP domain (typically 80-90 amino acids) in their
amino-terminal part. The present invention thus includes nucleic
acid molecules, including in particular the complete cDNA
sequences, encoding members of the THAP family, portions thereof
encoding the THAP domain or polypeptides homologous thereto, as
well as to polypeptides encoded by the THAP family genes. The
invention thus also includes diagnostic and activity assays, and
uses in therapeutics, for THAP family proteins or portions thereof,
as well as drug screening assays for identifying compounds capable
of inhibiting (or stimulating) pro-apoptotic activity of a THAP
family member.
[0016] In one example of a THAP family member, THAP1 is determined
to be an apoptosis inducing polypeptide expressed in human
endothelial cells (HEVECs), providing characterization of the THAP
sequences required for apoptosis activity in the THAP1 polypeptide.
In further aspects, the invention is also directed to the
interaction of THAP1 with the pro-apoptotic protein PAR4 and with
PML-NBs, including methods of modulating THAP1/PAR4 interactions
for the treatment of disease. The invention also concerns
interaction between PAR4 and PML-NBs, diagnostics for detection of
said interaction (or localization) and modulation of said
interactions for the treatment of disease.
[0017] Compounds which modulate interactions between a THAP family
member and a THAP-family target molecule, a THAP domain or
THAP-domain target molecule, or a PAR4 and a PML-NBs protein may be
used in inhibiting (or stimulating) apoptosis of different cell
types in various human diseases. For example, such compounds may be
used to inhibit or stimulate apoptosis of endothelial cells in
angiogenesis-dependent diseases including but not limited to
cancer, cardiovascular diseases, inflammatory diseases, and to
inhibit apoptosis of neurons in acute and chronic neurodegenerative
disorders, including but not limited to Alzheimer's, Parkinson's
and Huntington's diseases, amyotrophic lateral sclerosis, HIV
encephalitis, stroke, epileptic seizures).
[0018] Oligonucleotide probes or primers hybridizing specifically
with a THAP1 genomic DNA or cDNA sequence are also part of the
present invention, as well as DNA amplification and detection
methods using said primers and probes.
[0019] Fragments of THAP family members or THAP domains include
fragments encoded by nucleic acids comprising at least 12, 15, 18,
20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 500, or 1000
consecutive nucleotides selected from the group consisting of SEQ
ID NOs: 160-175, or polypeptides comprising at least 8, 10, 12, 15,
20, 25, 30, 40, 50, 100, 150 or 200 consecutive amino acids
selected from the group consisting of SEQ ID NOs: 1-114.
[0020] A further aspect of the invention includes recombinant
vectors comprising any of the nucleic acid sequences described
above, and in particular to recombinant vectors comprising a THAP1
regulatory sequence or a sequence encoding a THAP1 protein, THAP
family member, THAP domain, fragments of THAP family members and
THAP domains, homologues of THAP family members/THAP domains, as
well as to cell hosts and transgenic non human animals comprising
said nucleic acid sequences or recombinant vectors.
[0021] Another aspect of the invention relates to methods for the
screening of substances or molecules that inhibit or increase the
expression of the THAP1 gene or genes encoding THAP family members,
as well as with methods for the screening of substances or
molecules that interact with and/or inhibit or increase the
activity of a THAP1 polypeptide or THAP family polypeptide.
[0022] In accordance with another aspect, the present invention
provides a medicament comprising an effective amount of a THAP
family protein, e.g. THAP1, or a SLC/CCL21-binding fragment
thereof, together with a pharmaceutically acceptable carrier. The
medicaments described herein may be useful for treatment and/or
prophylaxis.
[0023] As related to another aspect the invention is concerned in
particular with the use of a THAP family protein, homologs thereof
and fragments thereof, for example THAP1, or a SLC/CCL21-binding
fragment thereof as an anti-inflammatory agent. The THAP family
protein, for example, THAP1 and fragments thereof will be useful
for the treatment of conditions mediated by SLC/CCL21.
[0024] In a further aspect, the present invention provides a
detection method comprising the steps of providing a SLC/CCL21
chemokine-binding molecule which is a THAP family protein, for
example, THAP1, or an SLC/CCL21-binding fragment thereof,
contacting the SLC/CCL21-binding THAP1 molecule with a sample, and
detecting an interaction of the SLC/CCL21-binding THAP1 molecule
with SLC/CCL21 chemokine in the sample.
[0025] In one example, the invention may be used to detect the
presence of SLC/CCL21 chemokine in a biological sample. The
SLC/CCL21-binding THAP1 molecule may be usefully immobilized on a
solid support, for example as a THAP1/Fc fusion.
[0026] In accordance with another aspect, the present invention
provides a method for inhibiting the activity of SLC/CCL21
chemokine in a sample, which method comprises contacting the sample
with an effective amount of a SLC/CCL21 chemokine-binding molecule
which is a THAP1 protein or a SLC/CCL21-binding fragment
thereof.
[0027] In further aspects the invention provides a purified THAP1
protein or a SLC/CCL21-binding fragment thereof, or a THAP1/Fc
fusion, for use in a method or a medicament as described herein;
and a kit comprising such a purified THAP1 protein or fragment.
[0028] The invention also envisages the use of fragments of the
THAP1 protein, which fragments have SLC/CCL21 chemokine-binding
properties. The fragments may be peptides derived from the protein.
Use of such peptides can be preferable to the use of an entire
protein or a substantial part of a protein, for example because of
the reduced immunogenicity of a peptide compared to a protein. Such
peptides may be prepared by a variety of techniques including
recombinant DNA techniques and synthetic chemical methods.
[0029] It will also be evident that the THAP1 proteins for use in
the invention may be prepared in a variety of ways, in particular
as recombinant proteins in a variety of expression systems. Any
standard systems may be used such as baculovirus expression systems
or mammalian cell line expression systems.
[0030] Other aspects of the invention are described in the
following numbered paragraphs: [0031] 1. A method of identifying a
candidate modulator of apoptosis comprising: [0032] (a) contacting
a THAP-family polypeptide or a biologically active fragment thereof
with a test compound, wherein said THAP-family polypeptide
comprises at least 30% amino acid identity to an amino acid
sequence selected from the group consisting of SEQ ID NOs: 1-114;
and [0033] (b) determining whether said compound selectively
modulates the activity of said polypeptide; wherein a determination
that said test compound selectively modulates the activity of said
polypeptide indicates that said compound is a candidate modulator
of apoptosis. [0034] 2. The method of Paragraph 1, wherein the
THAP-family polypeptide comprises the amino acid sequence of SEQ ID
NO: 3, or a biologically active fragment thereof. [0035] 3. The
method of Paragraph 1, wherein the THAP-family polypeptide
comprises the amino acid sequence of SEQ ID NO: 4, or a
biologically active fragment thereof. [0036] 4. The method of
Paragraph 1, wherein the THAP-family polypeptide comprises the
amino acid sequence of SEQ ID NO: 5, or a biologically active
fragment thereof. [0037] 5. The method of Paragraph 1, wherein the
THAP-family polypeptide comprises the amino acid sequence of SEQ ID
NO: 6, or a biologically active fragment thereof. [0038] 6. The
method of Paragraph 1, wherein the THAP-family polypeptide
comprises the amino acid sequence of SEQ ID NO: 7, or a
biologically active fragment thereof. [0039] 7. The method of
Paragraph 1, wherein the THAP-family polypeptide comprises the
amino acid sequence of SEQ ID NO: 8, or a biologically active
fragment thereof. [0040] 8. The method of Paragraph 1, wherein the
THAP-family polypeptide comprises the amino acid sequence of SEQ ID
NO: 9, or a biologically active fragment thereof. [0041] 9. The
method of Paragraph 1, wherein the THAP-family polypeptide
comprises the amino acid sequence of SEQ ID NO: 10, or a
biologically active fragment thereof. [0042] 10. The method of
Paragraph 1, wherein the THAP-family polypeptide comprises the
amino acid sequence of SEQ ID NO: 11, or a biologically active
fragment thereof. [0043] 11. The method of Paragraph 1, wherein the
THAP-family polypeptide comprises the amino acid sequence of SEQ ID
NO: 12, or a biologically active fragment thereof. [0044] 12. The
method of Paragraph 1, wherein the THAP-family polypeptide
comprises the amino acid sequence of SEQ ID NO: 13, or a
biologically active fragment thereof. [0045] 13. The method of
Paragraph 1, wherein the THAP-family polypeptide comprises the
amino acid sequence of SEQ ID NO: 14, or a biologically active
fragment thereof. [0046] 14. The method of Paragraph 1, wherein the
THAP-family polypeptide comprises the amino acid sequence selected
from the group consisting of SEQ ID NOs: 15-114, and biologically
active fragments thereof. [0047] 15. The method of Paragraph 1,
wherein said biologically active fragment of said THAP-family
protein has at least one biological activity selected from the
group consisting of interaction with a THAP-family target protein,
binding to a nucleic acid sequence, binding to PAR-4, binding to
PML, binding to a polypeptide found in PML-NBs, localization to
PML-NBs, targeting a THAP-family target protein to PML-NBs, and
inducing apoptosis. [0048] 16. The methods of any one of Paragraphs
2-15 wherein said THAP-family polypeptide has at least one
biological activity selected from the group consisting of
interaction with a THAP-family target protein, binding to a nucleic
acid sequence, binding to PAR-4, binding to PML, binding to a
polypeptide found in PML-NBs, localization to PML-NBs, targeting a
THAP-family target protein to PML-NBs, and inducing apoptosis.
[0049] 17. An isolated nucleic acid encoding a polypeptide having
apoptotic activity, said polypeptide consisting essentially of an
amino acid sequence selected from the group consisting of: [0050]
(a) amino acid positions 1-90 of SEQ ID NO: 2, a fragment thereof
having apoptotic activity, or a polypeptide having at least 30%
amino acid identity thereto; [0051] (b) a polypeptide comprising a
THAP-family domain consisting essentially of amino acid positions 1
to 89 of SEQ ID NO: 3, a fragment thereof having apoptotic
activity, or a polypeptide having at least 30% amino acid identity
thereto; [0052] (c) a polypeptide comprising a THAP-family domain
consisting essentially of amino acid positions 1 to 89 of SEQ ID
NO: 4, a fragment thereof having apoptotic activity, or a
polypeptide having at least 30% amino acid identity thereto; [0053]
(d) a polypeptide comprising a THAP-family domain consisting
essentially of amino acid positions 1 to 89 of SEQ ID NO: 5, a
fragment thereof having apoptotic activity, or a polypeptide having
at least 30% amino acid identity thereto; [0054] (e) a polypeptide
comprising a THAP-family domain consisting essentially of amino
acid positions 1 to 90 of SEQ ID NO: 6, a fragment thereof having
apoptotic activity or a polypeptide having at least 30% amino acid
identity thereto; [0055] (f) a polypeptide comprising a THAP-family
domain consisting essentially of amino acid positions 1 to 90 of
SEQ ID NO: 7, a fragment thereof having apoptotic activity, or a
polypeptide having at least 30% amino acid identity thereto; [0056]
(g) a polypeptide comprising a THAP-family domain consisting
essentially of amino acid positions 1 to 90 of SEQ ID NO: 8, a
fragment thereof having apoptotic activity; or a polypeptide having
at least 30% amino acid identity thereto; [0057] (h) a polypeptide
comprising a THAP-family domain consisting essentially of amino
acid positions 1 to 90 of SEQ ID NO: 9, a fragment thereof having
apoptotic activity, or a polypeptide having at least 30% amino acid
identity thereto; [0058] (i) a polypeptide comprising a THAP-family
domain consisting essentially of amino acid positions 1 to 92 of
SEQ ID NO: 10, a fragment thereof having apoptotic activity or a
polypeptide having at least 30% amino acid identity thereto; [0059]
(j) a polypeptide comprising a THAP-family domain consisting
essentially of amino acid positions 1 to 90 of SEQ ID NO: 11, a
fragment thereof having apoptotic activity, or a polypeptide having
at least 30% amino acid identity thereto; [0060] (k) a polypeptide
comprising a THAP-family domain consisting essentially of amino
acid positions 1 to 90 of SEQ ID NO: 12, or a fragment thereof
having apoptotic activity, or a polypeptide having at least 30%
amino acid identity thereto; [0061] (l) a polypeptide comprising a
THAP-family domain consisting essentially of amino acid positions 1
to 90 of SEQ ID NO: 13, a fragment thereof having apoptotic
activity, or a polypeptide having at least 30% amino acid identity
thereto; and [0062] (m) a polypeptide comprising a THAP-family
domain consisting essentially of amino acid positions 1 to 90 of
SEQ ID NO: 14, a fragment thereof having apoptotic activity, or a
polypeptide having at least 30% amino acid identity thereto. [0063]
18. An isolated nucleic acid encoding a THAP-family polypeptide
having apoptotic activity selected from the group consisting of:
[0064] (i) a nucleic acid molecule encoding a polypeptide
comprising the amino acid sequence of a sequence selected from the
group consisting of SEQ ID NOs: 1-114; [0065] (ii) a nucleic acid
molecule comprising the nucleic acid sequence of a sequence
selected from the group consisting of SEQ ID NOs: 160-175 and the
sequences complementary thereto; and [0066] (iii) a nucleic acid
the sequence of which is degenerate as a result of the genetic code
to the sequence of a nucleic acid as defined in (i) and (ii).
[0067] 19. The nucleic acid of Paragraph 18, wherein said nucleic
acid comprises a nucleic acid selected from the group consisting of
SEQ ID NOs. 5, 7, 8 and 11. [0068] 20. The nucleic acid of
Paragraph 18, wherein said nucleic acid comprises a nucleic acid
selected from the group consisting of SEQ ID NOs. 162, 164, 165 and
168. [0069] 21. An isolated nucleic acid encoding a THAP-family
polypeptide having apoptotic activity comprising:
[0070] (i) the nucleic acid sequence of SEQ ID NOs: 1-2 or the
sequence complementary thereto; or
[0071] (ii) a nucleic acid molecule encoding a polypeptide
comprising the amino acid sequence of SEQ ID NOs 1-2; [0072] 22. An
isolated nucleic acid, said nucleic acid comprising a nucleotide
sequence encoding: [0073] i) a polypeptide comprising an amino acid
sequence having at least about 80% identity to a sequence selected
from the group consisting of the polypeptides of SEQ ID NOs: 1-114
and the polypeptides encoded by the nucleic acids of SEQ ID NOs:
160-175 or [0074] ii) a fragment of said polypeptide which
possesses apoptotic activity. [0075] 23. The nucleic acid of
Paragraph of Paragraph 23, wherein said nucleic acid encodes a
polypeptide comprising an amino acid sequence having at least about
80% identity to a sequence selected from the group consisting of
the polypeptides of SEQ ID NOs: 5, 7, 8 and 11 and the polypeptides
encoded by the nucleic acids of SEQ ID NOs: 162, 164, 165 and 168
or a fragment of said polypeptide which possesses apoptotic
activity. [0076] 24. The nucleic acid of Paragraph 23, wherein said
polypeptide comprises an amino acid sequence selected from the
group consisting of the sequences of SEQ ID NOs: 5, 7, 8 and 11 and
the polypeptides encoded by the nucleic acids of SEQ ID NOs: 162,
164, 165 and 168. [0077] 25. The nucleic acid of Paragraph 23,
wherein polypeptide identity is determined using an algorithm
selected from the group consisting of XBLAST with the parameters
score=50 and wordlength=3, Gapped BLAST with the default parameters
of XBLAST, and BLAST with the default parameters of XBLAST. [0078]
26. The nucleic acid of Paragraph 17, wherein said nucleic acid is
operably linked to a promoter. [0079] 27. An expression cassette
comprising the nucleic acid of Paragraph 26. [0080] 28. A host cell
comprising the expression cassette of Paragraph 27. [0081] 29. A
method of making a THAP-family polypeptide, said method comprising
[0082] providing a population of host cells comprising a
recombinant nucleic acid encoding said THAP-family protein of any
one of SEQ ID NOs. 1-114; and [0083] culturing said population of
host cells under conditions conducive to the expression of said
recombinant nucleic acid; [0084] whereby said polypeptide is
produced within said population of host cells. [0085] 30. The
method of Paragraph 29 wherein said providing step comprises
providing a population of host cells comprising a recombinant
nucleic acid encoding said THAP-family protein of any one of SEQ ID
NOs. 5, 7, 8 and 11. [0086] 31. The method of Paragraph 29, further
comprising purifying said polypeptide from said population of
cells. [0087] 32. An isolated THAP polypeptide encoded by the
nucleic acid of any one of SEQ ID Nos. 160-175. [0088] 33. The
polypeptide of Paragraph 32, wherein said polypeptide is encoded by
a nucleic acid selected from the group consisting of SEQ ID NOs. 5,
7, 8, 11, 162, 164, 165 and 168. [0089] 34. The polypeptide of
Paragraph 32, wherein said polypeptide has at least one activity
selected from the group consisting of interaction with a
THAP-family target protein, binding to a nucleic acid sequence,
binding to PAR-4, binding to PML, binding to a polypeptide found in
PML-NBs, localization to PML-NBs, targeting a THAP-family target
protein to PML-NBs, and inducing apoptosis. [0090] 35. An isolated
THAP polypeptide or fragment thereof, said polypeptide comprising
at least 12 contiguous amino acids of a sequence selected from the
group consisting of SEQ ID NOs: 1-114. [0091] 36. The polypeptide
of Paragraph 35, wherein said polypeptide comprises at least 12
contiguous amino acids of a sequence selected from the group
consisting of SEQ ID NOs. 5, 7, 8, and 11. [0092] 37. The
polypeptide of Paragraph 35, wherein said polypeptide has at least
one activity selected from the group consisting of interaction with
a THAP-family target protein, binding to a nucleic acid sequence,
binding to PAR-4, binding to PML, binding to a polypeptide found in
PML-NBs, localization to PML-NBs, targeting a THAP-family target
protein to PML-NBs, and inducing apoptosis. [0093] 38. An isolated
THAP polypeptide or fragment thereof, said polypeptide comprising
an amino acid sequence having at least about 80% amino acid
sequence identity to a sequence selected from the group consisting
of SEQ ID NOs: 1-114 or a fragment thereof, said polypeptide or
fragment thereof having at least one activity selected from the
group consisting of interaction with a THAP-family target protein,
binding to a nucleic acid sequence, binding to PAR-4, binding to
PML, binding to a polypeptide found in PML-NBs, localization to
PML-NBs, targeting a THAP-family target protein to PML-NBs, and
inducing apoptosis. [0094] 39. The polypeptide of Paragraph 38,
wherein said THAP polypeptide or fragment thereof comprises an
amino acid sequence having at least about 80% amino acid sequence
identity to a sequence selected from the group consisting of SEQ ID
NOs: 5, 7, 8 and 11 or a fragment thereof having at least one
activity selected from the group consisting of interaction with a
THAP-family target protein, binding to a nucleic acid sequence,
binding to PAR-4, binding to PML, binding to a polypeptide found in
PML-NBs, localization to PML-NBs, targeting a THAP-family target
protein to PML-NBs, and inducing apoptosis. [0095] 40. The
polypeptide of Paragraph 38, wherein said polypeptide is
selectively bound by an antibody raised against an antigenic
polypeptide, or antigenic fragment thereof, said antigenic
polypeptide comprising the polypeptide of any one of SEQ ID NOs:
1-114. [0096] 41. The polypeptide of Paragraph 38, wherein said
polypeptide is selectively bound by an antibody raised against an
antigenic polypeptide, or antigenic fragment thereof, said
antigenic polypeptide comprising the polypeptide of any one of SEQ
ID NOs: 5, 7, 8 and 11. [0097] 42. The polypeptide of Paragraph 38,
wherein said polypeptide comprises the polypeptide of SEQ ID NOs:
1-114. [0098] 43. The polypeptide of Paragraph 38, wherein said
polypeptide comprises a polypeptide selected from the group
consisting of SEQ ID NOs. 5, 7, 8 and 11. [0099] 44. An antibody
that selectively binds to the polypeptide of Paragraph 38. [0100]
45. An antibody according to Paragraph 44, wherein said antibody is
capable of inhibiting binding of said polypeptide to a THAP-family
target polypeptide. [0101] 46. An antibody according to Paragraph
44, wherein said antibody is capable of inhibiting apoptosis
mediated by said polypeptide. [0102] 47. The polypeptide of
Paragraph 38, wherein identity is determined using an algorithm
selected from the group consisting of XBLAST with the parameters
score=50 and wordlength=3, Gapped BLAST with the default parameters
of XBLAST, and BLAST with the default parameters of XBLAST. [0103]
48. A method of assessing the biological activity of a THAP-family
polypeptide comprising: [0104] (a) providing a THAP-family
polypeptide or a fragment thereof; and [0105] (b) assessing the
ability of the THAP-family polypeptide to induce apoptosis of a
cell. [0106] 49. A method of assessing the biological activity of a
THAP-family polypeptide comprising: [0107] (a) providing a
THAP-family polypeptide or a fragment thereof; and [0108] (b)
assessing the DNA binding activity of the THAP-family polypeptide.
[0109] 50. The method of Paragraphs 48 or 49, wherein step (a)
comprises introducing to a cell a recombinant vector comprising a
nucleic acid encoding a THAP-family polypeptide. [0110] 51. The
method of Paragraphs 49 or 50, wherein the THAP-family polypeptide
comprises a THAP consensus amino acid sequence depicted in SEQ ID
NOs: 1-2, or a fragment thereof having at least one activity
selected from the group consisting of interaction with a
THAP-family target protein, binding to a nucleic acid sequence,
binding to PAR-4, binding to PML, binding to a polypeptide found in
PML-NBs, localization to PML-NBs, targeting a THAP-family target
protein to PML-NBs, and inducing apoptosis. [0111] 52. The method
of Paragraph 49, wherein the THAP-family polypeptide comprises an
amino acid sequence selected from the group of sequences consisting
of SEQ ID NOs: 1-114 or a fragment thereof having at least one
activity selected from the group consisting of interaction with a
THAP-family target protein, binding to a nucleic acid sequence,
binding to PAR-4, binding to PML, binding to a polypeptide found in
PML-NBs, localization to PML-NBs, targeting a THAP-family target
protein to PML-NBs, and inducing apoptosis. [0112] 53. The method
of Paragraph 49, wherein the THAP-family polypeptide comprises a
native THAP-family polypeptide, or a fragment thereof having at
least one activity selected from the group consisting of
interaction with a THAP-family target protein, binding to a nucleic
acid sequence, binding to PAR-4, binding to PML, binding to a
polypeptide found in PML-NBs, localization to PML-NBs, targeting a
THAP-family target protein to PML-NBs, and inducing apoptosis.
[0113] 54. The method of Paragraph 49, wherein the THAP-family
polypeptide comprises a THAP-family polypeptide or a fragment
thereof having at least one activity selected from the group
consisting of interaction with a THAP-family target protein,
binding to a nucleic acid sequence, binding to PAR-4, binding to
PML, binding to a polypeptide found in PML-NBs, localization to
PML-NBs, targeting a THAP-family target protein to PML-NBs, and
inducing apoptosis, wherein said THAP-family polypeptide or
fragment thereof comprises at least one amino acid deletion,
substitution or insertion. [0114] 55. An isolated THAP-family
polypeptide comprising an amino acid sequence of SEQ ID NOs: 1-114,
wherein said polypeptide comprises at least one amino acid
deletion, substitution or insertion with respect to said amino acid
sequence of SEQ ID NOs. 1-114. [0115] 56. A THAP-family polypeptide
comprising an amino acid sequence selected from the group
consisting of SEQ ID NOs: 1-114, wherein said polypeptide comprises
at least one amino acid deletion, substitution or insertion with
respect to said amino acid sequence of one of SEQ ID NOs. 1-114 and
displays a reduced ability to induce apoptosis or bind DNA compared
to the wild-type polypeptide. [0116] 57. A THAP-family polypeptide
comprising an amino acid sequence of SEQ ID NOs: 1-114, wherein
said polypeptide comprises at least one amino acid deletion,
substitution or insertion with respect to said amino acid sequence
of one of SEQ ID NOs. 1-114 and displays a increased ability to
induce apoptosis or bind DNA compared to the wild-type
polypeptide.
[0117] 58. A method of determining whether a THAP-family
polypeptide is expressed within a biological sample, said method
comprising the steps of:
[0118] (a) contacting a biological sample from a subject with:
[0119] a polynucleotide that hybridizes under stringent conditions
to a nucleic acid of SEQ ID NOs: 160-175 or
[0120] a detectable polypeptide that selectively binds to the
polypeptide of SEQ ID NOs: 1-114; and
[0121] (b) detecting the presence or absence of hybridization
between said polynucleotide and an RNA species within said sample,
or the presence or absence of binding of said detectable
polypeptide to a polypeptide within said sample;
[0122] wherein a detection of said hybridization or of said binding
indicates that said THAP-family polypeptide is expressed within
said sample. [0123] 59. The method of Paragraph 58, wherein said
subject suffers from, is suspected of suffering from, or is
susceptible to a cell proliferative disorder. [0124] 60. The method
of Paragraph 59, wherein said cell proliferative disorder is a
disorder related to regulation of apoptosis. [0125] 61. The method
of Paragraph 58, wherein said polynucleotide is a primer, and
wherein said hybridization is detected by detecting the presence of
an amplification product comprising said primer sequence. [0126]
62. The method of Paragraph 58, wherein said detectable polypeptide
is an antibody. [0127] 63. A method of assessing THAP-family
activity in a biological sample, said method comprising the steps
of:
[0128] (a) contacting a nucleic acid molecule comprising a binding
site for a THAP-family polypeptide with: [0129] (i) a biological
sample from a subject or [0130] (ii) a THAP-family polypeptide
isolated from a biological sample from a subject, the polypeptide
comprising the amino acid sequences of one of SEQ ID NOs: 1-114;
and
[0131] (b) assessing the binding between said nucleic acid molecule
and a THAP-family polypeptide
[0132] wherein a detection of decreased binding compared to a
reference THAP-family nucleic acid binding level indicates that
said sample comprises a deficiency in THAP-family activity. [0133]
64. A method of determining whether a mammal has an elevated or
reduced level of THAP-family expression, said method comprising the
steps of: [0134] (a) providing a biological sample from said
mammal; and [0135] (b) comparing the amount of a THAP-family
polypeptide of SEQ ID NOs: 1-114 or of a THAP-family RNA species
encoding a polypeptide of SEQ ID NOs: 1-114 within said biological
sample with a level detected in or expected from a control sample;
[0136] wherein an increased amount of said THAP-family polypeptide
or said THAP-family RNA species within said biological sample
compared to said level detected in or expected from said control
sample indicates that said mammal has an elevated level of
THAP-family expression, and wherein a decreased amount of said
THAP-family polypeptide or said THAP-family RNA species within said
biological sample compared to said level detected in or expected
from said control sample indicates that said mammal has a reduced
level of THAP-family expression. [0137] 65. The method of Paragraph
64, wherein said mammal suffers from, is suspected of suffering
from, or is susceptible to a cell proliferative disorder. [0138]
66. A method of identifying a candidate inhibitor of a THAP-family
polypeptide, a candidate inhibitor of apoptosis, or a candidate
compound for the treatment of a cell proliferative disorder, said
method comprising:
[0139] (a) contacting a THAP-family polypeptide according to SEQ ID
NOs: 1-114 or a fragment comprising a contiguous span of at least 6
contiguous amino acids of a polypeptide according to SEQ ID NOs:
1-114 with a test compound; and
[0140] (b) determining whether said compound selectively binds to
said polypeptide;
[0141] wherein a determination that said compound selectively binds
to said polypeptide indicates that said compound is a candidate
inhibitor of a THAP-family polypeptide, a candidate inhibitor of
apoptosis, or a candidate compound for the treatment of a cell
proliferative disorder. [0142] 67. A method of identifying a
candidate inhibitor of apoptosis, a candidate compound for the
treatment of a cell proliferative disorder, or a candidate
inhibitor of a THAP-family polypeptide of SEQ ID NOs: 1-114 or a
fragment comprising a contiguous span of at least 6 contiguous
amino acids of a polypeptide according to SEQ ID NOs: 1-114, said
method comprising:
[0143] (a) contacting said THAP-family polypeptide with a test
compound; and
[0144] (b) determining whether said compound selectively inhibits
at least one biological activity selected from the group consisting
of interaction with a THAP-family target protein, binding to a
nucleic acid sequence, binding to PAR-4, binding to PML, binding to
a polypeptide found in PML-NBs, localization to PML-NBs, targeting
a THAP-family target protein to PML-NBs, and inducing
apoptosis;
wherein a determination that said compound selectively inhibits
said at least one biological activity of said polypeptide indicates
that said compound is a candidate inhibitor of a THAP-family
polypeptide, a candidate inhibitor of apoptosis, or a candidate
compound for the treatment of a cell proliferative disorder. [0145]
68. A method of identifying a candidate inhibitor of apoptosis, a
candidate compound for the treatment of a cell proliferative
disorder, or a candidate inhibitor of a THAP-family polypeptide of
SEQ ID NOs: 1-114 or a fragment comprising a contiguous span of at
least 6 contiguous amino acids of a polypeptide according to SEQ ID
NOs: 1-114, said method comprising:
[0146] (a) contacting a cell comprising said THAP-family
polypeptide with a test compound; and
[0147] (b) determining whether said compound selectively inhibits
at least one biological activity selected from the group consisting
of interaction with a THAP-family target protein, binding to a
nucleic acid sequence, binding to PAR-4, binding to PML, binding to
a polypeptide found in PML-NBs, localization to PML-NBs, targeting
a THAP-family target protein to PML-NBs, and inducing
apoptosis;
[0148] wherein a determination that said compound selectively
inhibits said at least one biological activity of said polypeptide
indicates that said compound is a candidate inhibitor of a
THAP-family polypeptide, a candidate inhibitor of apoptosis, or a
candidate compound for the treatment of a cell proliferative
disorder. [0149] 69. The method of Paragraphs 67 or 68, wherein
step (b) comprises assessing apoptotic activity, and wherein a
determination that said compound inhibits apoptosis indicates that
said compound is a candidate inhibitor of said THAP-family
polypeptide. [0150] 70. The method of Paragraph 68 comprising
introducing a nucleic acid comprising the nucleotide sequence
encoding said THAP-family polypeptide according to any one of
Paragraphs 32-43 into said cell. [0151] 71. A polynucleotide
according to any one of Paragraphs 17-25 attached to a solid
support. [0152] 72. An array of polynucleotides comprising at least
one polynucleotide according to Paragraph 71. [0153] 73. An array
according to Paragraph 72, wherein said array is addressable.
[0154] 74. A polynucleotide according to any one of Paragraphs 17
to 25 further comprising a label. [0155] 75. A method of
identifying a candidate activator of a THAP-family polypeptide,
said method comprising:
[0156] a) contacting a THAP-family polypeptide according to SEQ ID
NOs: 1-114 or a fragment comprising a a contiguous span of at least
6 contiguous amino acids of a polypeptide according to SEQ ID NOs:
1-114 with a test compound; and
[0157] b) determining whether said compound selectively binds to
said polypeptide; [0158] wherein a determination that said compound
selectively binds to said polypeptide indicates that said compound
is a candidate activator of said polypeptide. [0159] 76. A method
of identifying a candidate activator of a THAP-family polypeptide
of SEQ ID NOs: 1-114 or a fragment comprising a a contiguous span
of at least 6 contiguous amino acids of a polypeptide according to
SEQ ID NOs: 1-114, said method comprising:
[0160] (a) contacting said polypeptide with a test compound;
and
[0161] (b) determining whether said compound selectively activates
at least one biological activity selected from the group consisting
of interaction with a THAP-family target protein, binding to a
nucleic acid sequence, binding to PAR-4, binding to PML, binding to
a polypeptide found in PML-NBs, localization to PML-NBs, targeting
a THAP-family target protein to PML-NBs, and inducing
apoptosis;
[0162] wherein a determination that said compound selectively
activates said at least one biological activity of said polypeptide
indicates that said compound is a candidate activator of said
polypeptide. [0163] 77. A method of identifying a candidate
activator of a THAP-family polypeptide of SEQ ID NOs: 1-114 or, a
fragment comprising a a contiguous span of at least 6 contiguous
amino acids of a polypeptide according to SEQ ID NOs: 1-114, said
method comprising:
[0164] (a) contacting a cell comprising said THAP-family
polypeptide with a test compound; and
[0165] (b) determining whether said compound selectively activates
at least one biological activity selected from the group consisting
of interaction with a THAP-family target protein, binding to a
nucleic acid sequence, binding to PAR-4, binding to PML, binding to
a polypeptide found in PML-NBs, localization to PML-NBs, targeting
a THAP-family target protein to PML-NBs, and inducing
apoptosis;
[0166] wherein a determination that said compound selectively
activates said at least one biological activity of said polypeptide
indicates that said compound is a candidate activator of said
polypeptide. [0167] 78. The method of Paragraphs 76 or 77, wherein
said determining step comprises assessing apoptotic activity, and
wherein a determination that said compound increases apoptosis
activity indicates that said compound is a candidate activator of
said THAP-family polypeptide. [0168] 79. The method of Paragraph 77
wherein step a) comprises introducing a nucleic acid comprising the
nucleotide sequence encoding said THAP-family polypeptide according
to any one of Paragraphs 17-25 into said cell. [0169] 80. A method
of identifying a candidate modulator of PAR4 activity, said method
comprising:
[0170] (a) providing a PAR4 polypeptide or a fragment thereof;
and
[0171] (b) providing a PML-NB polypeptide, or a polypeptide
associated with PML-NBs, or a fragment thereof; and
[0172] (c) determining whether a test compound selectively
modulates the ability of said PAR4 polypeptide to bind to said
PML-NB polypeptide or polypeptide associated with PML-NBs;
[0173] wherein a determination that said test compound selectively
inhibits the ability of said PAR4 polypeptide to bind to said
PML-NB polypeptide or polypeptide associated with PML-NBs indicates
that said compound is a candidate modulator of PAR4 activity.
[0174] 81. A method of identifying a candidate modulator of PAR4
activity, said method comprising:
[0175] (a) providing a PAR4 polypeptide or a fragment thereof;
and
[0176] (b) determining whether a test compound selectively
modulates the ability of said PAR4 polypeptide to localise in
PML-NBs;
[0177] wherein a determination that said test compound selectively
inhibits the ability of said PAR4 polypeptide to localise in
PML-NBs indicates that said compound is a candidate modulator of
PAR4 activity. [0178] 82. A method of identifying a candidate
inhibitor of THAP-family activity, said method comprising:
[0179] (a) providing a THAP-family polypeptide of SEQ ID NOs: 1-114
or, a fragment comprising a a contiguous span of at least 6
contiguous amino acids of a polypeptide according to SEQ ID NOs:
1-114; and
[0180] (b) providing a THAP-family target polypeptide or a fragment
thereof; and
[0181] (c) determining whether a test compound selectively inhibits
the ability of said THAP-family polypeptide to bind to said
THAP-family target polypeptide;
[0182] wherein a determination that said test compound selectively
inhibits the ability of said THAP-family polypeptide to bind to
said THAP-family target polypeptide indicates that said compound is
a candidate inhibitor of THAP-family activity. [0183] 83. The
method of Paragraph 82, comprising providing a cell comprising:
[0184] (a) a first expression vector comprising a nucleic acid
encoding a THAP-family polypeptide of SEQ ID NOs: 1-114 or, a
fragment comprising a a contiguous span of at least 6 contiguous
amino acids of a polypeptide according to SEQ ID NOs: 1-114; and
[0185] (b) a second expression vector comprising a nucleic acid
encoding a THAP-family target polypeptide, or a fragment thereof.
[0186] 84. The method of Paragraph 82, wherein said THAP-family
activity is apoptosis activity. [0187] 85. The method of Paragraph
82, wherein said THAP-family target protein is PAR-4. [0188] 86.
The method of Paragraph 82, wherein said THAP-family polypeptide is
a THAP-1, THAP-2 or THAP-3 protein and said THAP-family target
protein is PAR-4. [0189] 87. A method of modulating apoptosis in a
cell comprising modulating the activity of a THAP-family protein.
[0190] 88. The method of Paragraph 87, wherein said THAP-family
protein is selected from the group consisting of SEQ ID NOs. 1-114.
[0191] 89. A method of modulating apoptosis in a cell comprising
modulating the recruitment of PAR-4 to a PML nuclear body. [0192]
90. The method of Paragraph 89 wherein modulating the activity of a
THAP-family protein comprises modulating the interaction of a
THAP-family protein and a THAP-family target protein. [0193] 91.
The method of Paragraph 89 wherein modulating the activity of a
THAP-family protein comprises modulating the interaction of a
THAP-family protein and a PAR4 protein. [0194] 92. The method of
Paragraph 91 comprising modulation the interaction between a
THAP-1, THAP-2, or THAP-3 protein and a PAR-4 protein. [0195] 93. A
method of modulating the recruitment of PAR-4 to a PML nuclear body
comprising modulating the interaction of said PAR-4 protein and a
THAP-family protein. [0196] 94. The method of Paragraph 93, wherein
said THAP-family protein is selected from the group consisting of
SEQ ID NOs. 1-114. [0197] 95. A method of modulating angiogenesis
in an individual comprising modulating the activity of a
THAP-family protein in said individual. [0198] 96. The method of
Paragraph 95, wherein said THAP-family protein is selected from the
group consisting of SEQ ID NOs. 1-114. [0199] 97. A method of
preventing cell death in an individual comprising inhibiting the
activity of a THAP-family protein in said individual. [0200] 98.
The method of Paragraph 97, wherein said THAP-family protein is
selected from the group consisting of SEQ ID NOs. 1-114. [0201] 99.
The method according to Paragraph 97, wherein the activity of said
THAP-family protein is inhibited in the CNS. [0202] 100. A method
of inducing angiogenesis in an individual comprising inhibiting the
activity of a THAP-family protein in said individual. [0203] 101.
The method of Paragraph 100, wherein said THAP-family protein is
selected from the group consisting of SEQ ID NOs. 1-114. [0204]
102. A method according to Paragraph 100, wherein the activity of
said THAP-family protein is inhibited in endothelial cells. [0205]
103. A method of inhibiting angiogenesis or treating cancer in an
individual comprising increasing the activity of a THAP-family
protein in said individual. [0206] 104. The method of Paragraph
103, wherein said THAP-family protein is selected from the group
consisting of SEQ ID NOs. 1-114. [0207] 105. A method of treating
inflammation or an inflammatory disorder in an individual
comprising increasing the activity of a THAP-family protein in said
individual. [0208] 106. The method of Paragraph 105, wherein said
THAP-family protein is selected from the group consisting of SEQ ID
NOs. 1-114. [0209] 107. A method according to Paragraphs 103 or
105, wherein the activity of said THAP-family protein is increased
in endothelial cells. [0210] 108. A method of treating cancer in an
individual comprising increasing the activity of a THAP-family
protein in said individual. [0211] 109. The method of Paragraph
108, wherein said THAP-family protein is selected from the group
consisting of SEQ ID NOs. 1-114. [0212] 110. The method of
Paragraph 108, wherein increasing the activity of said THAP family
protein induces apoptosis, inhibits cell division, inhibits
metastatic potential, reduces tumor burden, increases sensitivity
to chemotherapy or radiotherapy, kills a cancer cell, inhibits the
growth of a cancer cell, kills an endothelial cell, inhibits the
growth of an endothelial cell, inhibits angiogenesis, or induces
tumor regression. [0213] 111. A method according to any one of
Paragraphs 87-110, comprising contacting said subject with a
recombinant vector encoding a THAP-family protein according to any
one of Paragraphs 32-43 operably linked to a promoter that
functions in said cell. [0214] 112. The method of Paragraph 111,
wherein said promoter functions in an endothelial cell. [0215] 113.
A viral composition comprising a recombinant viral vector encoding
a THAP-family protein according to Paragraphs 32-43. [0216] 114.
The composition of Paragraph 113, wherein said recombinant viral
vector is an adenoviral, adeno-associated viral, retroviral, herpes
viral, papilloma viral, or hepatitis B viral vector. [0217] 115. A
method of obtaining a nucleic acid sequence which is recognized by
a THAP-family polypeptide comprising contacting a pool of random
nucleic acids with said THAP-family polypeptide or a portion
thereof and isolating a complex comprising said THAP-family
polypeptide and at least one nucleic acid from said pool. [0218]
116. The method of Paragraph 115 wherein said pool of nucleic acids
are labeled. [0219] 117. The method of Paragraph 116 wherein said
complex is isolated by performing a gel shift analysis. [0220] 118.
A method of identifying a nucleic acid sequence which is recognized
by a THAP-family polypeptide comprising: [0221] (a) incubating a
THAP-family polypeptide with a pool of labeled random nucleic
acids; [0222] (b) isolating a complex between said THAP-family
polypeptide and at least one nucleic acid from said pool; [0223]
(c) performing an amplification reaction to amplify the at least
one nucleic acid present in said complex; [0224] (d) incubating
said at least one amplified nucleic acid with said THAP-family
polypeptide; [0225] (e) isolating a complex between said at least
one amplified nucleic acid and said THAP-family polypeptide; [0226]
(f) repeating steps (c), (d) and (e) a plurality of times; [0227]
(g) determining the sequence of said nucleic acid in said complex.
[0228] 119. A method of identifying a compound which inhibits the
ability of a THAP-family polypeptide to bind to a nucleic acid
comprising: incubating a THAP-family polypeptide or a fragment
thereof which recognizes a binding site in a nucleic acid with a
nucleic acid containing said binding site in the presence or
absence of a test compound and determining whether the level of
binding of said THAP-family polypeptide to said nucleic acid in the
presence of said test compound is less than the level of binding in
the absence of said test compound. [0229] 120. A method of
identifying a test compound that modulates THAP-mediated activities
comprising: [0230] contacting a THAP-family polypeptide or a
biologically active fragment thereof with a test compound, wherein
said THAP-family polypeptide comprises an amino acid sequence
having at least 30% amino acid identity to an amino acid sequence
of SEQ ID NO: 1; and [0231] determining whether said test compound
selectively modulates the activity of said THAP-family polypeptide
or biologically active fragment thereof, wherein a determination
that said test compound selectively modulates the activity of said
polypeptide indicates that said test compound is a candidate
modulator of THAP-mediated activities. [0232] 121. The method of
Paragraph 120, wherein the THAP-family polypeptide comprises the
amino acid sequence of SEQ ID NO: 1, or a biologically active
fragment thereof. [0233] 122. The method of Paragraph 120, wherein
the THAP-family polypeptide comprises the amino acid sequence of
SEQ ID NO: 2, or a biologically active fragment thereof. [0234]
123. The method of Paragraph 120, wherein the THAP-family
polypeptide comprises the amino acid sequence of SEQ ID NO: 3, or a
biologically active fragment thereof. [0235] 124. The method of
Paragraph 120, wherein the THAP-family polypeptide comprises the
amino acid sequence of SEQ ID NO: 4, or a biologically active
fragment thereof. [0236] 125. The method of Paragraph 120, wherein
the THAP-family polypeptide comprises the amino acid sequence of
SEQ ID NO: 5, or a biologically active fragment thereof. [0237]
126. The method of Paragraph 120, wherein the THAP-family
polypeptide comprises the amino acid sequence of SEQ ID NO: 6, or a
biologically active fragment thereof. [0238] 127. The method of
Paragraph 120, wherein the THAP-family polypeptide comprises the
amino acid sequence of SEQ ID NO: 7, or a biologically active
fragment thereof. [0239] 128. The method of Paragraph 120, wherein
the THAP-family polypeptide comprises the amino acid sequence of
SEQ ID NO: 8, or a biologically active fragment thereof. [0240]
129. The method of Paragraph 120, wherein the THAP-family
polypeptide comprises the amino acid sequence of SEQ ID NO: 9, or a
biologically active fragment thereof. [0241] 130. The method of
Paragraph 120, wherein the THAP-family polypeptide comprises the
amino acid sequence of SEQ ID NO: 10, or a biologically active
fragment thereof. [0242] 131. The method of Paragraph 120, wherein
the THAP-family polypeptide comprises the amino acid sequence of
SEQ ID NO: 11, or a biologically active fragment thereof. [0243]
132. The method of Paragraph 120, wherein the THAP-family
polypeptide comprises the amino acid sequence of SEQ ID NO: 12, or
a biologically active fragment thereof. [0244] 133. The method of
Paragraph 120, wherein the THAP-family polypeptide comprises the
amino acid sequence of SEQ ID NO: 13, or a biologically active
fragment thereof. [0245] 134. The method of Paragraph 120, wherein
the THAP-family polypeptide comprises the amino acid sequence of
SEQ ID NO: 14 or a biologically active fragments thereof. [0246]
135. The method of Paragraph 120, wherein the THAP-family
polypeptide comprises the amino acid sequence selected from the
group consisting of SEQ ID NOs: 15-114 or a biologically active
fragments thereof. [0247] 136. The method of Paragraph 120, wherein
said THAP-mediated activity is selected from the group consisting
of interaction with a THAP-family target protein, binding to a
nucleic acid, binding to PAR-4, binding to SLC, binding to PML,
binding to a polypeptide found in PML-NBs, localization to PML-NBs,
targeting a THAP-family target protein to PML-NBs, and inducing
apoptosis [0248] 137. The method of Paragraph 136, wherein said
THAP-mediated activity is binding to PAR-4. [0249] 138. The method
of Paragraph 136, wherein said THAP-mediated activity is binding to
SLC. [0250] 139. The method of Paragraph 136, wherein said
THAP-mediated activity is inducing apoptosis. [0251] 140. The
method of Paragraph 136, wherein said nucleic acid comprises a
nucleotide sequence selected from the group consisting of SEQ ID
NOs: 140-159. [0252] 141. The method of Paragraph 120, wherein said
amino acid identity is determined using an algorithm selected from
the group consisting of XBLAST with the parameters, score=50 and
wordlength=3, Gapped BLAST with the default parameters of XBLAST,
and BLAST with the default parameters of XBLAST. [0253] 142. An
isolated or purified THAP domain polypeptide consisting essentially
of an amino acid sequence selected from the group consisting of SEQ
ID NOs: 1-2, amino acids 1-89 of SEQ ID NOs: 3-5, amino acids 1-90
of SEQ ID NOs: 6-9, amino acids 1-92 of SEQ ID NO: 10, amino acids
1-90 of SEQ ID NOs: 11-14 and homologs having at least 30% amino
acid identity to any aforementioned sequence, wherein said
polypeptide binds to a nucleic acid. [0254] 143. The isolated or
purified THAP domain polypeptide of Paragraph 142 consisting
essentially of SEQ ID NO: 1. [0255] 144. The isolated or purified
THAP domain polypeptide of Paragraph 142, wherein said amino acid
identity is determined using an algorithm selected from the group
consisting of XBLAST with the parameters, score=50 and
wordlength=3, Gapped BLAST with the default parameters of XBLAST,
and BLAST with the default parameters of XBLAST. [0256] 145. The
isolated or purified THAP domain polypeptide of Paragraph 142,
wherein said nucleic acid comprises a nucleotide sequence selected
from the group consisting of SEQ ID NOs: 140-159. [0257] 146. An
isolated or purified nucleic acid which encodes the THAP domain
polypeptide of Paragraph 142 or a complement thereof. [0258] 147.
An isolated or purified PAR4-binding domain polypeptide consisting
essentially of an amino acid sequence selected from the group
consisting of amino acids 143-192 of SEQ ID NO: 3, amino acids
132-181 of SEQ ID NO: 4, amino acids 186-234 of SEQ ID NO: 5, SEQ
ID NO: 15 and homologs having at least 30% amino acid identity to
any aforementioned sequence, wherein said polypeptide binds to
PAR4. [0259] 148. The isolated or purified PAR4-binding domain of
Paragraph 147 consisting essentially of SEQ ID NO: 15. [0260] 149.
The isolated or purified PAR4-binding domain of Paragraph 147
consisting essentially of amino acids 143-193 of SEQ ID NO: 3.
[0261] 150. The isolated or purified PAR4-binding domain of
Paragraph 147 consisting essentially of amino acids 132-181 of SEQ
ID NO: 4. [0262] 151. The isolated or purified PAR4-binding domain
of Paragraph 147 consisting essentially of amino acids 186-234 of
SEQ ID NO: 5. [0263] 152. The isolated or purified PAR4-binding
domain polypeptide of Paragraph 147, wherein said amino acid
identity is determined using an algorithm selected from the group
consisting of XBLAST with the parameters, score=50 and
wordlength=3, Gapped BLAST with the default parameters of XBLAST,
and BLAST with the default parameters of XBLAST. [0264] 153. An
isolated or purified nucleic acid which encodes the PAR4-binding
domain polypeptide of Paragraph 147 or a complement thereof. [0265]
154. An isolated or purified SLC-binding domain polypeptide
consisting essentially of an amino acid sequence selected from the
group consisting of amino acids 143-213 of SEQ ID NO: 3 and
homologs thereof having at least 30% amino acid identity, wherein
said polypeptide binds to SLC. [0266] 155. The isolated or purified
SLC-binding domain polypeptide of Paragraph 154, wherein said amino
acid identity is determined using an algorithm selected from the
group consisting of XBLAST with the parameters, score=50 and
wordlength=3, Gapped BLAST with the default parameters of XBLAST,
and BLAST with the default parameters of XBLAST.
[0267] 156. An isolated or purified nucleic acid which encodes the
SLC-binding domain polypeptide of Paragraph 154 or a complement
thereof. [0268] 157. A fusion protein comprising an Fc region of an
immunoglobulin fused to a polypeptide comprising an amino acid
sequence selected from the group consisting of amino acids 143-213
of SEQ ID NO: 3 and homologs thereof having at least 30% amino acid
identity. [0269] 158. An oligomeric THAP protein comprising a
plurality of THAP polypeptides, wherein each THAP polypeptide
comprises an amino acid sequence selected from the group consisting
of amino acid 143-213 of SEQ ID NO: 3 and homologs thereof having
at least 30% amino acid identity. [0270] 159. A medicament
comprising an effective amount of a THAP1 polypeptide or an
SLC-binding fragment thereof, together with a pharmaceutically
acceptable carrier. [0271] 160. An isolated or purified THAP
dimerization domain polypeptide consisting essentially of an amino
acid sequence selected from the group consisting of amino acids 143
and 192 of SEQ ID NO: 3 and homologs thereof having at least 30%
amino acid identity, wherein said polypeptide binds to a
THAP-family polypeptide. [0272] 161. The isolated or purified THAP
dimerization domain polypeptide of Paragraph 160, wherein said
amino acid identity is determined using an algorithm selected from
the group consisting of XBLAST with the parameters, score=50 and
wordlength=3, Gapped BLAST with the default parameters of XBLAST,
and BLAST with the default parameters of XBLAST. [0273] 162. An
isolated or purified nucleic acid which encodes the THAP
dimerization domain polypeptide of Paragraph 160 or a complement
thereof. [0274] 163. An expression vector comprising a promoter
operably linked to a nucleic acid having a nucleotide sequence
selected from the group consisting of SEQ ID NOs: 160-175 and
portions thereof comprising at least 18 consecutive nucleotides.
[0275] 164. The expression vector of Paragraph 163, wherein said
promoter is a promoter which is not operably linked to said nucleic
acid selected from the group consisting of SEQ ID NOs.: 160-175 in
a naturally occurring genome. [0276] 165. A host cell comprising
the expression vector of Paragraph 163. [0277] 166. An expression
vector comprising a promoter operably linked to a nucleic acid
encoding a polypeptide comprising an amino acid sequence selected
from the group consisting of SEQ ID NOs: 1-114 and portions thereof
comprising at least 18 consecutive nucleotides. [0278] 167. The
expression vector of Paragraph 166, wherein said promoter is a
promoter which is not operably linked to said nucleic acid selected
from the group consisting of SEQ ID NOs.: 160-175 in a naturally
occurring genome. [0279] 168. A host cell comprising the expression
vector of Paragraph 166. [0280] 169. A method of identifying a
candidate inhibitor of a THAP-family polypeptide, a candidate
inhibitor of apoptosis, or a candidate compound for the treatment
of a cell proliferative disorder, said method comprising: [0281]
contacting a THAP-family polypeptide comprising an amino acid
sequence selected from the group consisting of SEQ ID NOs: 1-114 or
a fragment comprising a span of at least 6 contiguous amino acids
of a polypeptide comprising an amino acid sequence selected from
the group consisting of SEQ ID NOs: 1-114 with a test compound; and
[0282] determining whether said compound selectively binds to said
polypeptide, wherein a determination that said compound selectively
binds to said polypeptide indicates that said compound is a
candidate inhibitor of a THAP-family polypeptide, a candidate
inhibitor of apoptosis, or a candidate compound for the treatment
of a cell proliferative disorder. [0283] 170. A method of
identifying a candidate inhibitor of apoptosis, a candidate
compound for the treatment of a cell proliferative disorder, or a
candidate inhibitor of a THAP-family polypeptide of SEQ ID NOs:
1-114 or a fragment comprising a span of at least 6 contiguous
amino acids of a polypeptide according to SEQ ID NOs: 1-114, said
method comprising: [0284] contacting said THAP-family polypeptide
with a test compound; and [0285] determining whether said compound
selectively inhibits at least one biological activity selected from
the group consisting of interaction with a THAP-family target
protein, binding to a nucleic acid sequence, binding to PAR-4,
binding to SLC, binding to PML, binding to a polypeptide found in
PML-NBs, localization to PML-NBs, targeting a THAP-family target
protein to PML-NBs, and inducing apoptosis, wherein a determination
that said compound selectively inhibits said at least one
biological activity of said polypeptide indicates that said
compound is a candidate inhibitor of a THAP-family polypeptide, a
candidate inhibitor of apoptosis, or a candidate compound for the
treatment of a cell proliferative disorder. [0286] 171. A method of
identifying a candidate inhibitor of apoptosis, a candidate
compound for the treatment of a cell proliferative disorder, or a
candidate inhibitor of a THAP-family polypeptide of SEQ ID NOs:
1-114 or a fragment comprising a span of at least 6 contiguous
amino acids of a polypeptide according to SEQ ID NOs: 1-114, said
method comprising: [0287] contacting a cell comprising said
THAP-family polypeptide with a test compound; and [0288]
determining whether said compound selectively inhibits at least one
biological activity selected from the group consisting of
interaction with a THAP-family target protein, binding to a nucleic
acid sequence, binding to PAR-4, binding to SLC, binding to PML,
binding to a polypeptide found in PML-NBs, localization to PML-NBs,
targeting a THAP-family target protein to PML-NBs, and inducing
apoptosis, wherein a determination that said compound selectively
inhibits said at least one biological activity of said polypeptide
indicates that said compound is a candidate inhibitor of a
THAP-family polypeptide, a candidate inhibitor of apoptosis, or a
candidate compound for the treatment of a cell proliferative
disorder. [0289] 172. A method of identifying a candidate modulator
of THAP-family activity, said method comprising: [0290] providing a
THAP-family polypeptide of SEQ ID NOs: 1-114 or, a fragment
comprising a span of at least 6 contiguous amino acids of a
polypeptide according to SEQ ID NOs: 1-114; and [0291] providing a
THAP-family target polypeptide or a fragment thereof; and [0292]
determining whether a test compound selectively modulates the
ability of said THAP-family polypeptide to bind to said THAP-family
target polypeptide, wherein a determination that said test compound
selectively modulates the ability of said THAP-family polypeptide
to bind to said THAP-family target polypeptide indicates that said
compound is a candidate modulator of THAP-family activity. [0293]
173. The method of Paragraph 172, wherein said THAP-family
polypeptide is provided by a first expression vector comprising a
nucleic acid encoding a THAP-family polypeptide of SEQ ID NOs:
1-114 or, a fragment comprising a contiguous span of at least 6
contiguous amino acids of a polypeptide according to SEQ ID NOs:
1-114, and wherein said THAP-family target polypeptide is provided
by a second expression vector comprising a nucleic acid encoding a
THAP-family target polypeptide, or a fragment thereof. [0294] 174.
The method of Paragraph 172, wherein said THAP-family activity is
apoptosis activity. [0295] 175. The method of Paragraph 172,
wherein said THAP-family target protein is PAR-4. [0296] 176. The
method of Paragraph 172, wherein said THAP-family polypeptide is a
THAP-1, THAP-2 or THAP-3 protein and said THAP-family target
protein is PAR-4. [0297] 177. The method of Paragraph 172, wherein
said THAP-family target protein is SLC. [0298] 178. A method of
modulating apoptosis in a cell comprising modulating the activity
of a THAP-family protein.
[0299] 179. The method of Paragraph 178, wherein said THAP-family
protein is selected from the group consisting of SEQ ID NOs: 1-114.
[0300] 180. The method of Paragraph 178, wherein modulating the
activity of a THAP-family protein comprises modulating the
interaction of a THAP-family protein and a THAP-family target
protein. [0301] 181. The method of Paragraph 178, wherein
modulating the activity of a THAP-family protein comprises
modulating the interaction of a THAP-family protein and a PAR4
protein. [0302] 182. A method of identifying a candidate activator
of a THAP-family polypeptide, a candidate activator of apoptosis,
or a candidate compound for the treatment of a cell proliferative
disorder, said method comprising: [0303] contacting a THAP-family
polypeptide comprising an amino acid sequence selected from the
group consisting of SEQ ID NOs: 1-98 or a fragment comprising a
span of at least 6 contiguous amino acids of a polypeptide
comprising an amino acid sequence selected from the group
consisting of SEQ ID NOs: 1-98 with a test compound; and [0304]
determining whether said compound selectively binds to said
polypeptide, wherein a determination that said compound selectively
binds to said polypeptide indicates that said compound is a
candidate activator of a THAP-family polypeptide, a candidate
activator of apoptosis, or a candidate compound for the treatment
of a cell proliferative disorder. [0305] 183. A method of
identifying a candidate activator of apoptosis, a candidate
compound for the treatment of a cell proliferative disorder, or a
candidate activator of a THAP-family polypeptide of SEQ ID NOs:
1-98 or a fragment comprising a span of at least 6 contiguous amino
acids of a polypeptide according to SEQ ID NOs: 1-98, said method
comprising: [0306] contacting said THAP-family polypeptide with a
test compound; and [0307] determining whether said compound
selectively activates at least one biological activity selected
from the group consisting of interaction with a THAP-family target
protein, binding to a nucleic acid sequence, binding to PAR-4,
binding to SLC, binding to PML, binding to a polypeptide found in
PML-NBs, localization to PML-NBs, targeting a THAP-family target
protein to PML-NBs, and inducing apoptosis, wherein a determination
that said compound selectively activates said at least one
biological activity of said polypeptide indicates that said
compound is a candidate activator of a THAP-family polypeptide, a
candidate activator of apoptosis, or a candidate compound for the
treatment of a cell proliferative disorder. [0308] 184. A method of
identifying a candidate activator of apoptosis, a candidate
compound for the treatment of a cell proliferative disorder, or a
candidate activator of a THAP-family polypeptide of SEQ ID NOs: 1
to 98 or a fragment comprising a span of at least 6 contiguous
amino acids of a polypeptide according to SEQ ID NOs: 1-98, said
method comprising: [0309] contacting a cell comprising said
THAP-family polypeptide with a test compound; and [0310]
determining whether said compound selectively activates at least
one biological activity selected from the group consisting of
interaction with a THAP-family target protein, binding to a nucleic
acid sequence, binding to PAR-4, binding to SLC, binding to PML,
binding to a polypeptide found in PML-NBs, localization to PML-NBs,
targeting a THAP-family target protein to PML-NBs, and inducing
apoptosis, wherein a determination that said compound selectively
activates said at least one biological activity of said polypeptide
indicates that said compound is a candidate activator of a
THAP-family polypeptide, a candidate activator of apoptosis, or a
candidate compound for the treatment of a cell proliferative
disorder. [0311] 185. A method of ameliorating a condition
associated with the activity of SLC in an individual comprising
administering a polypeptide comprising the SLC binding domain of a
THAP-family protein to said individual. [0312] 186. The method of
Paragraph 185, wherein said polypeptide comprises a fusion protein
comprising an Fc region of an immunoglobulin fused to a polypeptide
comprising an amino acid sequence selected from the group
consisting of amino acids 143-213 of SEQ ID NO: 3 and homologs
thereof having at least 30% amino acid identity. [0313] 187. The
method of Paragraph 185, wherein said polypeptide comprises an
oligomeric THAP protein comprising a plurality of THAP
polypeptides, wherein each THAP polypeptide comprises an amino acid
sequence selected from the group consisting of amino acid 143-213
of SEQ ID NO: 3 and homologs thereof having at least 30% amino acid
identity. [0314] 188. A method of modulating angiogenesis in an
individual comprising modulating the activity of a THAP-family
protein in said individual. [0315] 189. The method of Paragraph
188, wherein said THAP-family protein is selected from the group
consisting of SEQ ID NOs: 1-114. [0316] 190. The method of
Paragraph 188, wherein said modulation is inhibition. [0317] 191.
The method of Paragraph 188, wherein said modulation is induction.
[0318] 192. A method of reducing cell death in an individual
comprising inhibiting the activity of a THAP-family protein in said
individual. [0319] 193. The method of Paragraph 192, wherein said
THAP-family protein is selected from the group consisting of SEQ ID
NOs: 1-114. [0320] 194. The method according to Paragraph 192,
wherein the activity of said THAP-family protein is inhibited in
the CNS. [0321] 195. A method of reducing inflammation or an
inflammatory disorder in an individual comprising modulating the
activity of a THAP-family protein in said individual. [0322] 196.
The method of Paragraph 195, wherein said THAP-family protein is
selected from the group consisting of SEQ ID NOs: 1-114. [0323]
197. A method of reducing the extent of cancer in an individual
comprising modulating the activity of a THAP-family protein in said
individual. [0324] 198. The method of Paragraph 197, wherein said
THAP-family protein is selected from the group consisting of SEQ ID
NOs: 1-114. [0325] 199. The method of Paragraph 197, wherein
increasing the activity of said THAP family protein induces
apoptosis, inhibits cell division, inhibits metastatic potential,
reduces tumor burden, increases sensitivity to chemotherapy or
radiotherapy, kills a cancer cell, inhibits the growth of a cancer
cell, kills an endothelial cell, inhibits the growth of an
endothelial cell, inhibits angiogenesis, or induces tumor
regression.
BRIEF DESCRIPTION OF THE DRAWINGS
[0326] FIG. 1A illustrates an amino acid sequence alignment of
human THAP1 (hTHAP1) (SEQ ID NO: 3) and mouse THAP1 (mTHAP1) (SEQ
ID NO: 99) orthologous polypeptides. Identical amino acid residues
are indicated with an asterisk.
[0327] FIG. 1B depicts the primary structure of the human THAP1
polypeptide. Positions of the THAP domain, the proline-rich region
(PRO) and the bipartite nuclear localization sequence (NLS) are
indicated.
[0328] FIG. 2 depicts the results of a Northern Blot analysis of
THAP1 mRNA expression in 12 human tissues. Each lane contains 2
.mu.g of poly A.sup.+ RNA isolated from the indicated human
tissues. The blot was hybridized, under high-stringency conditions,
with a .sup.32P-labeled THAP1 cDNA probe, and exposed at
-70.degree. C. for 72 hours.
[0329] FIG. 3A illustrates the interaction between THAP1 and PAR4
in a yeast two-hybrid system. In particular, THAP1 binds to
wild-type Par4 (Par4) and the leucine zipper-containing Par4 death
domain (Par4DD) (amino acids 250-342 of PAR4) but not a Par4
deletion mutant lacking the death domain (PAR4A) (amino acids 1-276
of PAR4). A (+) indicates binding whereas a (-) indicated lack of
binding.
[0330] FIG. 3B shows the binding of in vitro translated,
.sup.35S-methionine-labeled THAP1 to a GST-Par4DD polypeptide
fusion. Par4DD was expressed as a GST fusion protein then purified
on an affinity matrix of glutathione sepharose. GST served as
negative control. The input represents 1/10 of the material used in
the binding assay.
[0331] FIG. 4A illustrates the interaction between PAR4 and several
THAP1 deletion mutants both in vitro and in vivo. Each THAP1
deletion mutant was tested for binding to either PAR or PAR4DD in a
yeast two hybrid system (two hybrid bait), to PAR4DD in GST pull
down assays (in vitro) and to myc-Par4DD in primary human
endothelial cells (in vivo). A (+) indicates binding whereas a (-)
indicated lack of binding.
[0332] FIG. 4B shows the binding of several in vitro translated,
.sup.35S-methionine-labeled THAP1 deletion mutants to a GST-Par4DD
polypeptide fusion. Par4DD was expressed as a GST fusion protein
then purified on an affinity matrix of glutathione sepharose. GST
served as negative control. The input represents 1/10 of the
material used in the binding assay.
[0333] FIG. 5A depicts an amino acid sequence alignment of the Par4
binding domain of human THAP1 (SEQ ID NO: 117) and mouse THAP1 (SEQ
ID NO: 116) orthologues with that of mouse ZIP kinase (SEQ ID NO:
115), another Par4 binding partner. An arginine-rich consensus Par4
binding site (SEQ ID NO: 15), derived from this alignment, is also
indicated.
[0334] FIG. 5B shows the primary structure of the THAP1 wild-type
polypeptide and two THAP1 mutants (THAP1.DELTA.(QRCRR) and THAP1
RR/AA). THAP1.DELTA.(QRCRR) is a deletion mutant having a deletion
of amino acids at positions 168-172 of THAP1 (SEQ ID NO: 3) whereas
THAP RR/AA is a mutant having the two arginines located at amino
acid positions 171 and 172 to THAP1 (SEQ ID NO: 3) replaced with
alanines. Results obtained, in yeast two-hybrid system with Par4
and Par4DD baits (two hybrid bait), in GST pull down assays with
GST-Par4DD (in vitro) and in the in vivo interaction test with
myc-Par4DD in primary human endothelial cells (in vivo) are
summarized.
[0335] FIG. 6A is a graph which compares apoptosis levels in cells
transfected with GFP-APSK1, GFP-Par4 or GFP-THAP1 expression
vectors. Apoptosis was quantified by DAPI staining of apoptotic
nuclei, 24 h after serum-withdrawal. Values are the means of three
independent experiments.
[0336] FIG. 6B is a graph which compares apoptosis levels in cells
transfected with GFP-APSK1 or GFP-THAP1 expression vectors.
Apoptosis was quantified by DAPI staining of apoptotic nuclei, 24 h
after addition of TNF .alpha.. Values are the means of three
independent experiments.
[0337] FIG. 7A shows the binding of in vitro translated
.sup.35S-methionine labeled THAP1 (wt) or THAP1.DELTA.THAP
(.DELTA.) to a GST-Par4DD polypeptide fusion. Par4DD was expressed
as a GST fusion protein then purified on an affinity matrix of
glutathione sepharose. GST served as negative control. The input
represents 1/10 of the material used in the binding assay.
[0338] FIG. 7B is a graph which compares the proapoptotic activity
of THAP1 with a THAP1 mutant having its THAP domain (amino acids
1-90 of SEQ ID NO: 3) deleted. The percentage of apoptotic cells in
mouse 3T3 fibroblasts overexpressing GFP-APSK1 (control), GFP-THAP1
(THAP1) or GFP-THAP1.DELTA.THAP (THAP1.DELTA.THAP) was determined
by counting apoptotic nuclei after DAPI staining. Values are the
means of three independent experiments.
[0339] FIG. 8 depicts the primary structure of twelve human THAP
proteins. The THAP domain (colored grey) is located at the
amino-terminus of each of the twelve human THAP proteins. The black
box in THAP1, THAP2 and THAP3 indicates a nuclear localization
sequence, rich in basic residues, that is conserved in the three
proteins. The number of amino-acids in each THAP protein is
indicated; (*) indicates the protein is not full length.
[0340] FIG. 9A depicts an amino acid sequence alignment of the THAP
domain of human THAP1 (hTHAP1, SEQ ID NO: 123) with the DNA binding
domain of drosophila melanogaster P-element transposase
(dmTransposase, SEQ ID NO: 124). Identical residues are boxed in
black and conserved residues in grey. A THAP domain consensus
sequence (SEQ ID NO: 125) is also shown.
[0341] FIG. 9B depicts an amino acid sequence alignment of the THAP
domains of twelve members of the human THAP family (hTHAP1, SEQ ID
NO: 126; hTHAP2, SEQ ID NO: 131; hTHAP3, SEQ ID NO: 127; hTHAP4,
SEQ ID NO: 130; hTHAP5, SEQ ID NO: 128; hTHAP6, SEQ ID NO: 135;
hTHAP7, SEQ ID NO: 133; hTHAP8, SEQ ID NO: 129; hTHAP9, SEQ ID NO:
134; hTHAP10, SEQ ID NO: 137; hTHAP11, SEQ ID NO: 136; hTHAP0, SEQ
ID NO: 132) with the DNA binding domain of Drosophila melanogaster
P-element transposase (dmTransposae, SEQ ID NO: 138). Residues
conserved among at least seven of the thirteen sequences are boxed.
Black boxes indicate identical residues whereas boxes shaded in
grey show similar amino acids. Dashed lines represent gaps
introduced to align sequences. A THAP domain consensus sequence
(SEQ ID NO: 139) is also shown.
[0342] FIG. 9C depicts an amino acid sequence alignment of 95
distinct THAP domain sequences, including hTHAP1 through hTHAP11
and hTHAP0 (SEQ ID NOs: 3-14, listed sequentially beginning from
the top), with 83 THAP domains from other species (SEQ ID NOs:
1-98, listed sequentially beginning at the sequence denoted sTHAP1
and ending at the sequence denoted ceNP.sub.--498747.1), which were
identified by searching GenBank genomic and EST databases with the
human THAP sequences. Residues conserved among at least 50% of the
sequences are boxed. Black boxes indicate identical residues
whereas boxes shaded in grey show similar amino acids. Dashed lines
represent gaps introduced to align sequences. The species are
indicated: Homo sapiens (h); Sus scrofa (s); Bos taurus (b); Mus
musculus (m); Rattus norvegicus (r); Gallus gallus (g); Xenopus
laevi (x); Danio rerio (z); Oryzias latipes (o); Drosophila
melanogaster (dm); Anopheles gambiae (a); Bombyx mori (bm);
Caenorhabditis. elegans (ce). A consensus sequence (SEQ ID NO: 2)
is also shown. Amino acids underlined in the consensus sequence are
residues which are conserved in all 95 THAP sequences.
[0343] FIG. 10A shows an amino acid sequence alignment of the human
THAP1 (SEQ ID NO: 3), THAP2 (SEQ ID NO: 4) and THAP3 (SEQ ID NO: 5)
protein sequences. Residues conserved among at least two of the
three sequences are boxed. Black boxes indicate identical residues
whereas boxes shaded in grey show similar amino acids. Dashed lines
represent gaps introduced to align sequences. Regions corresponding
to the THAP domain, the PAR4-binding domain, and the nuclear
localization signal (NLS) are also indicated.
[0344] FIG. 10B shows the primary structure of human THAP1, THAP2
and THAP3 and results of two-hybrid interactions between each THAP
protein and Par4 or Par4 death domain (Par4DD) in the yeast two
hybrid system.
[0345] FIG. 10C shows the binding of in vitro translated,
.sup.35S-methionine-labeled THAP2 and THAP3 to a GST-Par4DD
polypeptide fusion. Par4DD was expressed as a GST fusion protein
then purified on an affinity matrix of glutathione sepharose. GST
served as negative control. The input represents 1/10 of the
material used in the binding assay.
[0346] FIG. 11A is a graph which compares apoptosis levels in cells
transfected with GFP-APSK1, GFP-THAP2 or GFP-THAP3 expression
vectors. Apoptosis was quantified by DAPI staining of apoptotic
nuclei, 24 h after serum-withdrawal. Values are the means of two
independent representative experiments.
[0347] FIG. 11B is a graph which compares apoptosis levels in cells
transfected with GFP-APSK1, GFP-THAP2 or GFP-THAP3 expression
vectors. Apoptosis was quantified by DAPI staining of apoptotic
nuclei, 24 h after additional of TNF.alpha.. Values are the means
of two independent representative experiments.
[0348] FIG. 12 illustrates the results obtained by screening
several different THAP1 mutants in a yeast two-hybrid system with
SLC/CCL21 bait. The primary structure of each THAP1 deletion mutant
that was tested is shown. The 70 carboxy-terminal residues of THAP1
(amino acids 143-213) are sufficient for binding to chemokine
SLC/CCL21.
[0349] FIG. 13 illustrates the interaction of THAP1 with wild type
SLC/CCL21 and a SLC/CCL21 mutant deleted of the basic
carboxy-terminal extension (SLC/CCL21.DELTA.COOH). The interaction
was analyzed both in yeast two-hybrid system with THAP1 bait and in
vitro using GST-pull down assays with GST-THAP1.
[0350] FIG. 14 depicts micrographs of the primary human endothelial
cells were transfected with the GFP-THAP0, 1, 2, 3, 6, 7, 8, 10, 11
(green fluorescence) expression constructs. To reveal the nuclear
localization of the human THAP proteins, nuclei were counterstained
with DAPI (blue). The bar equals 5 .mu.m.
[0351] FIG. 15A is a threading-derived structural alignment between
the THAP domain of human THAP1 (THAP1) (amino acids 1-81 of SEQ ID
NO: 3) and the thyroid receptor .beta. DNA binding domain (NLLB)
(SEQ ID NO: 121). The color coding is identical to that described
in FIG. 15D.
[0352] FIG. 15B shows a model of the three-dimensional structure of
the THAP domain of human THAP1 based on its homology with the
crystallographic structure of thyroid receptor .beta.. The color
coding is identical to that described in FIG. 15D.
[0353] FIG. 15C shows a model of the three-dimensional structure of
the DNA-binding domain of Drosophila transposase (DmTRP) based on
its homology with the crystallographic structure of the DNA-binding
domain of the glucocorticoid receptor. The color coding is
identical to that described in FIG. 15D.
[0354] FIG. 15D is a threading-derived structural alignment between
the Drosophila melanogaster transposase DNA binding domain (DmTRP)
(SEQ ID NO: 120) and the glucocorticoid receptor DNA binding domain
(GLUA) (SEQ ID NO: 122). In accordance with the sequences and
structures in FIGS. 15A-15C, the color-coding is the following:
brown indicates residues in .alpha.-helices; indigo indicates
residues in .beta.-strands; red denotes the eight conserved Cys
residues in NLLB and GLUA or for the three Cys residues common to
THAP1 and DmTRP; magenta indicates other Cys residues in THAP1 or
DmTRP; cyan denotes the residues involved in the hydrophobic
interactions networks colored in THAP1 or DmTRP.
[0355] FIG. 16A illustrates the results obtained by screening
several different THAP1 mutants in a yeast two-hybrid system with
THAP1 bait. The primary structure of each THAP1 deletion mutant
that was tested is shown. A (+) indicates binding whereas a (-)
indicates no binding.
[0356] FIG. 16B shows the binding of several in vitro translated,
.sup.35S-methionine-labeled THAP1 deletion mutants to a GST-THAP1
polypeptide fusion. Wild-type THAP1 was expressed as a GST fusion
protein then purified on an affinity matrix of glutathione
sepharose. GST served as negative control. The input represents
1/10 of the material used in the binding assay.
[0357] FIG. 17A is an agarose gel showing two distinct THAP1 cDNA
fragments were obtained by RT-PCR. Two distinct THAP1 cDNAs were
.about.400 and 600 nucleotides in length.
[0358] FIG. 17B shows that the 400 nucleotide fragment corresponds
to an alternatively spliced isoform of human THAP1 cDNA, lacking
exon 2 (nucleotides 273-468 of SEQ ID 160).
[0359] FIG. 17C is a Western blot which shows that the second
isoform of human THAP1 (THAP1b) encodes a truncated THAP1 protein
(THAP1 C3) lacking the amino-terminal THAP domain.
[0360] FIG. 18A shows a specific DNA binding site recognized by the
THAP domain of human THAP1. The THAP domain recognizes GGGCAA or
TGGCAA DNA target sequences preferentially organized as direct
repeats with 5 nucleotide spacing (DR-5). The consensus sequence
5'-GGGCAAnnnnnTGGCAA-3' (SEQ ID NO: 149). The DR-5 consensus was
generated by examination of 9 nucleic acids bound by THAP1 (SEQ ID
NO: 140-148, beginning sequentially from the top).
[0361] FIG. 18B shows a second specific DNA binding site recognized
by the THAP domain of human THAP1. The THAP domain recognizes
everted repeats with 11 nucleotide spacing (ER-11) having a
consensus sequence 5'-TTGCCAnnnnnnnnnnnGGGCAA-3' (SEQ ID NO: 159).
The ER-11 consensus was generated by examination of 9 nucleic acids
bound by THAP1 (SEQ ID NO: 150-158, beginning sequentially from the
top).
DETAILED DESCRIPTION OF THE INVENTION
THAP and PAR4 Biological Pathways
[0362] As mentioned above, the inventors have discovered a novel
class of proteins involved in apoptosis. Then, the inventors have
also linked a member of this novel class to another (PAR4)
apoptosis pathway, and further linked both of these pathways to
PML-NBs. Moreover, the inventors have also linked both of these
pathways to endothelial cells, providing a range of novel and
potentially selective therapeutic treatments. In particular, it has
been discovered that THAP1 (THanatos (death)-Associated-Protein-1)
localizes to PML-NBs. Furthermore, two hybrid screening of an HEVEC
cDNA library with the THAP1 bait lead to the identification of a
unique interacting partner, the pro-apoptotic protein PAR4. PAR4 is
also found to accumulate into PML-NBs. Targeting of the THAP-1/PAR4
complex to PML-NBs is mediated by PML. Similarly to PAR4, THAP1 has
a pro-apoptotic activity. This activity includes a novel motif in
the amino-terminal part called THAP domain. Together these results
define a novel PML-NBs pathway for apoptosis that involves the
THAP1/PAR4 pro-apoptotic complex.
THAP-Family Members, and uses Thereof
[0363] The present invention includes polynucleotides encoding a
family of pro-apoptotic polypeptides THAP-0 to THAP11, and uses
thereof for the modulation of apoptosis-related and other
THAP-mediated activities. Included is THAP1, which forms a complex
with the pro-apoptotic protein PAR4 and localizes in discrete
subnuclear domains known as PML nuclear bodies. Additionally,
THAP-family polypeptides can be used to alter or otherwise modulate
bioavailability of SLC/CCL21 (SLC).
[0364] The present invention also includes a novel protein motif,
the THAP domain, which is found in an 89 amino acid domain in the
amino-terminal part of THAP1 and which is involved in THAP1
pro-apoptotic activity. The THAP domain defines a novel family of
proteins, the THAP-family, with at least twelve distinct members in
the human genome (THAP-0 to THAP11), which all contain a THAP
domain in their amino-terminal part. The present invention thus
pertains to nucleic acid molecules, including genomic and in
particular the complete cDNA sequences, encoding members of the
THAP-family, as well as with the corresponding translation
products, nucleic acids encoding THAP domains, homologues thereof,
nucleic acids encoding at least 10, 12, 15, 20, 25, 30, 40, 50,
100, 150 or 200 consecutive amino acids, to the extent that said
span is consistent with the particular SEQ ID NO, of a sequence
selected from the group consisting of SEQ ID NOs: 160-175.
[0365] THAP1 has been identified based on its expression in HEVs,
specialized postcapillary venules found in lymphoid tissues and
nonlymphoid tissues during chronic inflammatory diseases that
support a high level of lymphocyte extravasation from the blood. An
important element in the cloning of the THAP1 cDNA from HEVECs was
the development of protocols for obtaining HEVECs RNA, since HEVECs
are not capable of maintaining their phenotype outside of their
native environment for more than a few hours. A protocol was
developed where total RNA was obtained from HEVECs freshly purified
from human tonsils. Highly purified HEVECs were obtained by a
combination of mechanical and enzymatic procedures, immunomagnetic
depletion and positive selection. Tonsils were minced finely with
scissors on a steel screen, digested with collagenase/dispase
enzyme mix and unwanted contaminating cells were then depleted
using immunomagnetic depletion. HEVECs were then selected by
immunomagnetic positive selection with magnetic beads conjugated to
the HEV-specific antibody MECA-79. From these HEVEC that were 98%
MECA-79-positive, 1 .mu.g of total RNA was used to generate full
length cDNAs for THAP1 cDNA cloning and RT-PCR analysis.
[0366] As used herein, the term "nucleic acids" and "nucleic acid
molecule" is intended to include DNA molecules (e.g., cDNA or
genomic DNA) and RNA molecules (e.g., mRNA) and analogs of the DNA
or RNA generated using nucleotide analogs. The nucleic acid
molecule can be single-stranded or double-stranded, but preferably
is double-stranded DNA. Throughout the present specification, the
expression "nucleotide sequence" may be employed to designate
indifferently a polynucleotide or a nucleic acid. More precisely,
the expression "nucleotide sequence" encompasses the nucleic
material itself and is thus not restricted to the sequence
information (i.e. the succession of letters chosen among the four
base letters) that biochemically characterizes a specific DNA or
RNA molecule. Also, used interchangeably herein are terms "nucleic
acids", "oligonucleotides", and "polynucleotides".
[0367] An "isolated" nucleic acid molecule is one which is
separated from other nucleic acid molecules which are present in
the natural source of the nucleic acid. Preferably, an "isolated"
nucleic acid is free of sequences which naturally flank the nucleic
acid (i.e., sequences located at the 5' and 3' ends of the nucleic
acid) in the genomic DNA of the organism from which the nucleic
acid is derived. For example, in various embodiments, the isolated
THAP-family nucleic acid molecule can contain less than about 5 kb,
4 kb, 3 kb, 2 kb, 1 kb, 0.5 kb or 0.1 kb of nucleotide sequences
which naturally flank the nucleic acid molecule in genomic DNA of
the cell from which the nucleic acid is derived. Moreover, an
"isolated" nucleic acid molecule, such as a cDNA molecule, can be
substantially free of other cellular material, or culture medium
when produced by recombinant techniques, or substantially free of
chemical precursors or other chemicals when chemically synthesized.
A nucleic acid molecule of the present invention, e.g., a nucleic
acid molecule having the nucleotide sequence of SEQ ID NOs:
160-175, a portion thereof, can be isolated using standard
molecular biology techniques and the sequence information provided
herein. Using all or a portion of the nucleic acid sequence of SEQ
ID NOs: 160-175, as a hybridization probe, THAP-family nucleic acid
molecules can be isolated using standard hybridization and cloning
techniques (e.g., as described in Sambrook, J., Fritsh, E. F., and
Maniatis, T. Molecular Cloning. A Laboratory Manual. 2nd, ed., Cold
Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold
Spring Harbor, N.Y., 1989).
[0368] Moreover, a nucleic acid molecule encompassing all or a
portion of e.g. SEQ ID NOs: 160-175, can be isolated by the
polymerase chain reaction (PCR) using synthetic oligonucleotide
primers designed based upon the sequence of SEQ ID NOs:
160-175.
[0369] A nucleic acid of the invention can be amplified using cDNA,
mRNA or alternatively, genomic DNA, as a template and appropriate
oligonucleotide primers according to standard PCR amplification
techniques. The nucleic acid so amplified can be cloned into an
appropriate vector and characterized by DNA sequence analysis.
Furthermore, oligonucleotides corresponding to THAP-family
nucleotide sequences can be prepared by standard synthetic
techniques, e.g., using an automated DNA synthesizer.
[0370] As used herein, the term "hybridizes to" is intended to
describe conditions for moderate stringency or high stringency
hybridization, preferably where the hybridization and washing
conditions permit nucleotide sequences at least 60% homologous to
each other to remain hybridized to each other. Preferably, the
conditions are such that sequences at least about 70%, more
preferably at least about 80%, even more preferably at least about
85%, 90%, 95% or 98% homologous to each other typically remain
hybridized to each other. Stringent conditions are known to those
skilled in the art and can be found in Current Protocols in
Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6.
A preferred, non-limiting example of stringent hybridization
conditions are as follows: the hybridization step is realized at
65.degree. C. in the presence of 6.times.SSC buffer,
5.times.Denhardt's solution, 0.5% SDS and 100 .mu.g/ml of salmon
sperm DNA. The hybridization step is followed by four washing
steps: [0371] two washings during 5 min, preferably at 65.degree.
C. in a 2.times.SSC and 0.1% SDS buffer; [0372] one washing during
30 min, preferably at 65.degree. C. in a 2.times.SSC and 0.1% SDS
buffer, [0373] one washing during 10 min, preferably at 65.degree.
C. in a 0.1.times.SSC and 0.1% SDS buffer, these hybridization
conditions being suitable for a nucleic acid molecule of about 20
nucleotides in length. It will be appreciated that the
hybridization conditions described above are to be adapted
according to the length of the desired nucleic acid, following
techniques well known to the one skilled in the art, for example be
adapted according to the teachings disclosed in Hames B. D. and
Higgins S. J. (1985) Nucleic Acid Hybridization: A Practical
Approach. Hames and Higgins Ed., IRL Press, Oxford; and Current
Protocols in Molecular Biolog (supra). Preferably, an isolated
nucleic acid molecule of the invention that hybridizes under
stringent conditions to a sequence of SEQ ID NOs: 160-175
corresponds to a naturally-occurring nucleic acid molecule. As used
herein, a "naturally-occurring" nucleic acid molecule refers to an
RNA or DNA molecule having a nucleotide sequence that occurs in
nature (e.g., encodes a natural protein).
[0374] To determine the percent homology of two amino acid
sequences or of two nucleic acids, the sequences are aligned for
optimal comparison purposes (e.g., gaps can be introduced in the
sequence of a first amino acid or nucleic acid sequence for optimal
alignment with a second amino or nucleic acid sequence and
non-homologous sequences can be disregarded for comparison
purposes). In a preferred embodiment, the length of a reference
sequence aligned for comparison purposes is at least 30%,
preferably at least 40%, more preferably at least 50%, even more
preferably at least 60%, and even more preferably at least 70%,
80%, 90% or 95% of the length of the reference sequence (e.g., when
aligning a second sequence to e.g. a THAP-1 amino acid sequence of
SEQ ID NO: 3 having 213 amino acid residues, at least 50,
preferably at least 100, more preferably at least 200, amino acid
residues are aligned or when aligning a second sequence to the
THAP-1 cDNA sequence of SEQ ID NO: 160 having 2173 nucleotides or
nucleotides 202-835 which encode the amino acids of the THAP1
protein, preferably at least 100, preferably at least 200, more
preferably at least 300, even more preferably at least 400, and
even more preferably at least 500, 600, at least 700, at least 800,
at least 900, at least 1000, at least 1200, at least 1400, at least
1600, at least 1800, or at least 2000 nucleotides are aligned. The
amino acid residues or nucleotides at corresponding amino acid
positions or nucleotide positions are then compared. When a
position in the first sequence is occupied by the same amino acid
residue or nucleotide as the corresponding position in the second
sequence, then the molecules are homologous at that position (i.e.,
as used herein amino acid or nucleic acid "identity" is equivalent
to amino acid or nucleic acid "homology"). The percent homology
between the two sequences is a function of the number of identical
positions shared by the sequences (i.e., % homology=number (#) of
identical positions/total number (#) of positions 100).
[0375] The comparison of sequences and determination of percent
homology between two sequences can be accomplished using a
mathematical algorithm. A preferred, non-limiting example of a
mathematical algorithm utilized for the comparison of sequences is
the algorithm of Karlin and Altschul (1990) Proc. Natl. Acad. Sci.
USA 87:2264-68, modified as in Karlin and Altschul (1993) Proc.
Natl. Acad. Sci. USA 90:5873-77, the disclosures of which are
incorporated herein by reference in their entireties. Such an
algorithm is incorporated into the NBLAST and XBLAST programs
(version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10.
BLAST nucleotide searches can be performed with the NBLAST program,
score=100, wordlength=12 to obtain nucleotide sequences homologous
to THAP-family nucleic acid molecules of the invention. BLAST
protein searches can be performed with the XBLAST program,
score=50, wordlength=3 to obtain amino acid sequences homologous to
THAP-family protein molecules of the invention. To obtain gapped
alignments for comparison purposes, Gapped BLAST can be utilized as
described in Altschul et al., (1997) Nucleic Acids Research
25(17):3389-3402. When utilizing BLAST and Gapped BLAST programs,
the default parameters of the respective programs (e.g., XBLAST and
NBLAST) can be used (see, www.ncbi.nlm.nih.gov, the disclosures of
which are incorporated herein by reference in their entireties).
Another preferred, non-limiting example of a mathematical algorithm
utilized for the comparison of sequences is the algorithm of Myers
and Miller, CABIOS (1989), the disclosures of which are
incorporated herein by reference in their entireties. Such an
algorithm is incorporated into the ALIGN program (version 2.0)
which is part of the GCG sequence alignment software package. When
utilizing the ALIGN program for comparing amino acid sequences, a
PAM120 weight residue table, a gap length penalty of 12, and a gap
penalty of 4 can be used.
[0376] The term "polypeptide" refers to a polymer of amino acids
without regard to the length of the polymer; thus, peptides,
oligopeptides, and proteins are included within the definition of
polypeptide. This term also does not specify or exclude
post-expression modifications of polypeptides, for example,
polypeptides which include the covalent attachment of glycosyl
groups, acetyl groups, phosphate groups, lipid groups and the like
are expressly encompassed by the term polypeptide. Also included
within the definition are polypeptides which contain one or more
analogs of an amino acid (including, for example, non-naturally
occurring amino acids, amino acids which only occur naturally in an
unrelated biological system, modified amino acids from mammalian
systems etc.), polypeptides with substituted linkages, as well as
other modifications known in the art, both naturally occurring and
non-naturally occurring.
[0377] An "isolated" or "purified" protein or biologically active
portion thereof is substantially free of cellular material or other
contaminating proteins from the cell or tissue source from which
the THAP family or THAP domain polypeptide, or a biologically
active fragment or homologue thereof protein is derived, or
substantially free from chemical precursors or other chemicals when
chemically synthesized. The language "substantially free of
cellular material" includes preparations of a protein according to
the invention (e.g. THAP family or THAP domain polypeptide, or a
biologically active fragment or homologue thereof) in which the
protein is separated from cellular components of the cells from
which it is isolated or recombinantly produced. In one embodiment,
the language "substantially free of cellular material" includes
preparations of a protein according to the invention having less
than about 30% (by dry weight) of protein other than the
THAP-family protein (also referred to herein as a "contaminating
protein"), more preferably less than about 20% of protein other
than the protein according to the invention, still more preferably
less than about 10% of protein other than the protein according to
the invention, and most preferably less than about 5% of protein
other than the protein according to the invention. When the protein
according to the invention or biologically active portion thereof
is recombinantly produced, it is also preferably substantially free
of culture medium, i.e., culture medium represents less than about
20%, more preferably less than about 10%, and most preferably less
than about 5% of the volume of the protein preparation.
[0378] The language "substantially free of chemical precursors or
other chemicals" includes preparations of THAP family or THAP
domain polypeptide, or a biologically active fragment or homologue
thereof in which the protein is separated from chemical precursors
or other chemicals which are involved in the synthesis of the
protein. In one embodiment, the language "substantially free of
chemical precursors or other chemicals" includes preparations of a
THAP-family protein having less than about 30% (by dry weight) of
chemical precursors or non-THAP-family chemicals, more preferably
less than about 20% chemical precursors or non-THAP-family or
THAP-domain chemicals, still more preferably less than about 10%
chemical precursors or non-THAP-family or THAP-domain chemicals,
and most preferably less than about 5% chemical precursors or
non-THAP-family or THAP-domain chemicals.
[0379] The term "recombinant polypeptide" is used herein to refer
to polypeptides that have been artificially designed and which
comprise at least two polypeptide sequences that are not found as
contiguous polypeptide sequences in their initial natural
environment, or to refer to polypeptides which have been expressed
from a recombinant polynucleotide.
[0380] Accordingly, another aspect of the invention pertains to
anti-THAP-family or THAP-domain antibodies. The term "antibody" as
used herein refers to immunoglobulin molecules and immunologically
active portions of immunoglobulin molecules, i.e., molecules that
contain an antigen binding site which specifically binds
(immunoreacts with) an antigen, such as a THAP family or THAP
domain polypeptide, or a biologically active fragment or homologue
thereof. Examples of immunologically active portions of
immunoglobulin molecules include F(ab) and F(ab').sub.2 fragments
which can be generated by treating the antibody with an enzyme such
as pepsin. The invention provides polyclonal and monoclonal
antibodies that bind a THAP family or THAP domain polypeptide, or a
biologically active fragment or homologue thereof. The term "mono
clonal antibody" or "mono clonal antibody composition", as used
herein, refers to a population of antibody molecules that contain
only one species of an antigen binding site capable of
immunoreacting with a particular epitope of a THAP-family or THAP
domain polypeptide. A monoclonal antibody composition thus
typically displays a single binding affinity for a particular
THAP-family or THAP domain protein with which it immunoreacts.
PAR4
[0381] As mentioned above, Prostate apoptosis response-4 (PAR4) is
a 38 kDa protein initially identified as the product of a gene
specifically upregulated in prostate tumor cells undergoing
apoptosis (for reviews see Rangnekar, 1998; Mattson et al., 1999).
The PAR4 nucleic acid and amino acid sequences, see Johnstone et
al, Mol. Cell. Biol. 16 (12), 6945-6956 (1996); and Genbank
accession no. U63809 (SEQ ID NO: 118).
[0382] As used interchangeably herein, a "PAR4 activity",
"biological activity of a PAR4" or "functional activity of a PAR4",
refers to an activity exerted by a PAR4 protein, polypeptide or
nucleic acid molecule as determined in vivo, or in vitro, according
to standard techniques. In one embodiment, a PAR4 activity is a
direct activity, such as an association with a PAR4-target molecule
or most preferably apoptosis induction activity, or inhibition of
cell proliferation or cell cycle. As used herein, a "target
molecule" is a molecule with which a PAR4 protein binds or
interacts in nature, such that PAR4-mediated function is achieved.
An example of a PAR4 target molecule is a THAP-family protein such
as THAP1 or THAP2, or a PML-NBs protein. A PAR4 target molecule can
be a PAR4 protein or polypeptide or a non-PAR4 molecule. For
example, a PAR4 target molecule can be a non-PAR4 protein molecule.
Alternatively, a PAR4 activity is an indirect activity, such as an
activity mediated by interaction of the PAR4 protein with a PAR4
target molecule such that the target molecule modulates a
downstream cellular activity (e.g., interaction of a PAR4 molecule
with a PAR4 target molecule can modulate the activity of that
target molecule on an intracellular signaling pathway).
[0383] Binding or interaction with a PAR4 target molecule (such as
THAP1/PAR4 described herein) or with other targets can be detected
for example using a two hybrid-based assay in yeast to find drugs
that disrupt interaction of the PAR4 bait with the target (e.g.
PAR4) prey, or an in vitro interaction assay with recombinant PAR4
and target proteins (e.g. THAP1 and PAR4).
SLC/CCL21 (SLC)
Biological Roles of SLC
[0384] The signals which mediate T-cell infiltration during T-cell
auto-immune diseases are poorly understood. SLC/CCL21 (SEQ ID NO:
119) is highly potent and highly specific for attracting T-cell
migration. It was initially thought to be expressed only in
secondary lymphoid organs, directing naive T-cells to areas of
antigen presentation. However, using immunohistology it was found
that expression of CCL21 was highly induced in endothelial cells of
T-cell auto-immune infiltrative skin diseases (Christopherson et
al. (2002) Blood electronic publication prior to printed
publication). No other T-cell chemokine was consistently induced in
these T cell skin diseases. The receptor for CCL21, CCR7, was also
found to be highly expressed on the infiltrating T-cells, the
majority of which expressed the memory CD45Ro phenotype. Inflamed
venules endothelial cells expressing SLC/CCL21 in T cell
infiltrative autoimmune skin diseases may therefore play a key role
in the regulation of T-cell migration into these tissues.
[0385] There are a number of other autoimmune diseases where
induced expression of SLC/CCL21 in endothelial cells may cause
abnormal recruitment of T-cells from the circulation to sites of
pathologic inflammation. For instance, chemokine SLC/CCL21 appears
to be important for aberrant T-cell infiltration in experimental
autoimmune encephalomyelitis (EAE), an animal model for multiple
sclerosis (Alt et al. (2002) Eur J Immunol 32:2133-44). Migration
of autoaggressive T cells across the blood-brain barrier (BBB) is
critically involved in the initiation of EAE. The direct
involvement of chemokines in this process was suggested by the
observation that G-protein-mediated signaling is required to
promote adhesion strengthening of encephalitogenic T cells on BBB
endothelium in vivo. A search for chemokines present at the BBB, by
in situ hybridizations and immunohistochemistry revealed expression
of the lymphoid chemokines CCL19/ELC and CCL21/SLC in venules
surrounded by inflammatory cells (Alt et al. (2002) Eur J Immunol
32:2133-44). Their expression was paralleled by the presence of
their common receptor CCR7 in inflammatory cells in brain and
spinal cord sections of mice afflicted with EAE. Encephalitogenic T
cells showed surface expression of CCR7 and specifically chemotaxed
towards both CCL19 or CCL21 in a concentration dependent and
pertussis toxin-sensitive manner comparable to naive lymphocytes in
vitro. Binding assays on frozen sections of EAE brains demonstrated
a functional involvement of CCL19 and CCL21 in adhesion
strengthening of encephalitogenic T lymphocytes to inflamed venules
in the brain (Alt et al. (2002) Eur J Immunol 32:2133-44). Taken
together these data suggested that the lymphoid chemokines CCL19
and CCL21 besides regulating lymphocyte homing to secondary
lymphoid tissue are involved in T lymphocyte migration into the
immunoprivileged central nervous system during immunosurveillance
and chronic inflammation.
[0386] Other diseases where induced expression of SLC/CCL21 in
venular endothelial cells has been observed include rheumatoid
arthritis (Page et al. (2002) J Immunol 168:5333-5341) and
experimental autoimmune diabetes (Hjelmstrom et al. (2000) Am J
Path 156:1133-1138). Therefore, chemokine SLC/CCL21 may be an
important pharmacological target in T-cell auto-immune diseases.
Inhibitors of SLC/CCL21 may be effective agents at treating these T
cell infiltrative diseases by interfering with the abnormal
recruitment of T cells, from the circulation to sites of pathologic
inflammation, by endothelial cells expressing SLC/CCL21. The
reduction in T cell migration into involved tissue would reduce the
T-cell inflicted damage seen in those diseases.
[0387] Ectopic lymphoid tissue formation is a feature of many
chronic inflammatory diseases, including rheumatoid arthritis,
inflammatory bowel diseases (Crohn's disease, ulcerative colitis),
autoimmune diabetes, chronic inflammatory skin diseases (lichen
panus, psoriasis, . . . ), Hashimoto's thyroiditis, Sjogren's
syndrome, gastric lymphomas and chronic inflammatory liver disease
(Girard and Springer (1995) Immunol today 16:449-457; Takemura et
al. (2001) J Immunol 167:1072-1080; Grant et al. (2002) Am Pathol
2002 160:1445-55; Yoneyama et al. (2001) J Exp Med 193:35-49).
[0388] Ectopic expression of SLC/CCL21 has been shown to induce
lymphoid neogenesis, both in mice and in human inflammatory
diseases. In mice, transgenic expression of SLC/CCL21 in the
pancreas (Fan et al. (2000) J Immunol 164:3955-3959; Chen et al.
(2002) J Immunol 168:1001-1008; Luther et al. (2002) J Immunol
169:424-433), a non-lymphoid tissue, has been found to be
sufficient for the development and organization of ectopic lymphoid
tissue through differential recruitment of T and B lymphocytes and
induction of high endothelial venules, specialized blood vessels
for lymphocyte migration (Girard and Springer (1995) Immunol today
16:449-457). In humans, hepatic expression of SLC/CCL21 has been
shown to promote the development of high endothelial venules and
portal-associated lymphoid tissue in chronic inflammatory liver
disease (Grant et al. (2002) Am J Pathol 2002 160:1445-55; Yoneyama
et al. (2001) J Exp Med 193:35-49). The chronic inflammatory liver
disease primary sclerosing cholangitis (PSC) is associated with
portal inflammation and the development of neolymphoid tissue in
the liver. More than 70% of patients with PSC have a history of
inflammatory bowel disease and strong induction of SLC/CCL21 on
CD34(+) vascular endothelium in portal associated lymphoid tissue
in PSC has been reported (Grant et al. (2002) Am J Pathol 2002
160:1445-55). In contrast, CCL21 is absent from LYVE-1(+) lymphatic
vessel endothelium. Intrahepatic lymphocytes in PSC include a
population of CCR7(+) T cells only half of which express CD45RA and
which respond to CCL21 in migration assays. The expression of CCL21
in association with mucosal address in cell adhesion molecule-1 in
portal tracts in PSC may promote the recruitment and retention of
CCR7(+) mucosal lymphocytes leading to the establishment of chronic
portal inflammation and the expanded portal-associated lymphoid
tissue. These findings are supported by studies in an animal model
of chronic hepatic inflammation, that have shown that
anti-SLC/CCL21 antibodies prevent the development of high
endothelial venules and portal-associated lymphoid tissue (Yoneyama
et al. (2001) J Exp Med 193:35-49).
[0389] Induction of chemokine SLC/CCL21 at a site of inflammation
could convert the lesion from an acute to a chronic state with
corresponding development of ectopic lymphoid tissue. Blocking
chemokine SLC/CCL21 activity in chronic inflammatory diseases may
therefore have significant therapeutic value.
[0390] As used herein, "SLC/CCL21" and "SLC" are synonymous.
THAP-Family Members Comprising a THAP Domain
[0391] Based on the elucidation of a biological activity of the
THAP1 protein in apoptosis as described herein, the inventors have
identified and further characterized a novel protein motif,
referred to herein as THAP domain. The THAP domain has been
identified by the present inventors in several other polypeptides,
as further described herein. Knowledge of the structure and
function of the THAP domain allows the performing of screening
assays that can be used in the preparation or screening of
medicaments capable of modulating interaction with a
THAP-family-target molecule, modulating cell cycle and cell
proliferation, inducing apoptosis or enhancing or participating in
the induction of apoptosis.
[0392] As used interchangeably herein, a THAP-family protein or
polypeptide, or a THAP-family member refers to any polypeptide
having a THAP domain as described herein. As mentioned, the
inventors have provided several specific THAP-family members. Thus,
as referred to herein, a THAP-family protein or polypeptide, or a
THAP-family member, includes but is not limited to a THAP-0, THAP1,
THAP-2, THAP-3, THAP-4, THAP-5, THAP-6, THAP-7, THAP-8, THAP-9,
THAP10 or a THAP11 polypeptide.
[0393] As used interchangeably herein, a "THAP-family activity",
"biological activity of a THAP-family member" or "functional
activity of a THAP-family member", refers to an activity exerted by
a THAP family or THAP domain polypeptide or nucleic acid molecule,
or a biologically active fragment or homologue thereof comprising a
THAP as determined in vivo, or in vitro, according to standard
techniques. In one embodiment, a THAP-family activity is a direct
activity, such as an association with a THAP-family-target molecule
or most preferably apoptosis induction activity, or inhibition of
cell proliferation or cell cycle. As used herein, a "THAP-family
target molecule" is a molecule with which a THAP-family protein
binds or interacts in nature, such that a THAP family-mediated
function is achieved. For example, a THAP family target molecule
can be another THAP-family protein or polypeptide which is
substantially identical or which shares structural similarity (e.g.
forming a dimer or multimer). In another example, a THAP family
target molecule can be a non-THAP family comprising protein
molecule, or a non-self molecule such as for example a Death Domain
receptor. Binding or interaction with a THAP family target molecule
(such as THAP1/PAR4 described herein) or with other targets can be
detected for example using a two hybrid-based assay in yeast to
find drugs that disrupt interaction of the THAP family bait with
the target (e.g. PAR4) prey, or an in vitro interaction assay with
recombinant THAP family and target proteins (e.g. THAP1 and PAR4).
In yet another example, a THAP family target molecule can be a
nucleic acid molecule. For instance, a THAP family target molecule
can be DNA.
[0394] Alternatively, a THAP-family activity may be an indirect
activity, such as an activity mediated by interaction of the
THAP-family protein with a THAP-family target molecule such that
the target molecule modulates a downstream cellular activity (e.g.,
interaction of a THAP-family molecule with a THAP-family target
molecule can modulate the activity of that target molecule on an
intracellular signaling pathway).
[0395] THAP-family activity is not limited to the induction of
apoptotic activity, but may also involve enhancing apoptotic
activity. As death domains may mediate protein-protein
interactions, including interactions with other death domains,
THAP-family activity may involve transducing a cytocidal
signal.
[0396] Assays to detect apoptosis are well known. In a preferred
example, an assay is based on serum-withdrawal induced apoptosis in
a 3T3 cell line with tetracycline-regulated expression of a THAP
family member comprising a THAP domain. Other non-limiting examples
are also described.
[0397] In one example, a THAP family or THAP domain polypeptide, or
a biologically active fragment or homologue thereof can be the
minimum region of a polypeptide that is necessary and sufficient
for the generation of cytotoxic death signals. Exemplary assays for
apoptosis activity are further provided herein.
[0398] In specific embodiments, PAR4 is a preferred THAP1 and/or
THAP2 target molecule. In another aspect, a THAP1 target molecule
is a PML-NB protein.
[0399] In further aspects, THAP-domain or a THAP-family polypeptide
comprises a DNA binding domain.
[0400] In other aspects, a THAP-family activity is detected by
assessing any of the following activities: (1) mediating apoptosis
or cell proliferation when expressed in or introduced into a cell,
most preferably inducing or enhancing apoptosis, and/or most
preferably reducing cell proliferation; (2) mediating apoptosis or
cell proliferation of an endothelial cell; (3) mediating apoptosis
or cell proliferation of a hyperproliferative cell; (4) mediating
apoptosis or cell proliferation of a CNS cell, preferably a
neuronal or glial cell; (5) an activity determined in an animal
selected from the group consisting of mediating, preferably
inhibiting angiogenesis, mediating, preferably inhibiting
inflammation, inhibition of metastatic potential of cancerous
tissue, reduction of tumor burden, increase in sensitivity to
chemotherapy or radiotherapy, killing a cancer cell, inhibition of
the growth of a cancer cell, or induction of tumor regression; or
(6) interaction with a THAP family target molecule or THAP domain
target molecule, preferably interaction with a protein or a nucleic
acid. Detecting THAP-family activity may also comprise detecting
any suitable therapeutic endpoint discussed herein in the section
titled "Methods of Treatment". THAP-family activity may be assessed
either in vitro (cell or non-cell based) or in vivo depending on
the assay type and format.
[0401] A THAP domain has been identified in the N-terminal region
of the THAP1 protein, from about amino acid 1 to about amino acid
89 of SEQ ID NO: 3 based on sequence analysis and functional
assays. A THAP domain has also been identified in THAP2 to THAP0 of
SEQ ID NOs: 4-14. However, it will be appreciated that a functional
THAP domain may be only a small portion of the protein, about 10
amino acids to about 15 amino acids, or from about 20 amino acids
to about 25 amino acids, or from about 30 amino acids to about 35
amino acids, or from about 40 amino acids to about 45 amino acids,
or from about 50 amino acids to about 55 amino acids, or from about
60 amino acids to about 70 amino acids, or from about 80 amino
acids to about 90 amino acids, or about 100 amino acids in length.
Alternatively, THAP domain or THAP family polypeptide activity, as
defined above, may require a larger portion of the native protein
than may be defined by protein-protein interaction, DNA binding,
cell assays or by sequence alignment. A portion of a THAP
domain-containing polypeptide from about 110 amino acids to about
115 amino acids, or from about 120 amino acids to 130 amino acids,
or from about 140 amino acids to about 150 amino acids, or from
about 160 amino acids to about 170 amino acids, or from about 180
amino acids to about 190 amino acids, or from about 200 amino acids
to about 250 amino acids, or from about 300 amino acids to about
350 amino acids, or from about 400 amino acids to about 450 amino
acids, or from about 500 amino acids to about 600 amino acids, to
the extent that said length is consistent with the SEQ ID No, or
the full length protein, for example any full length protein in SEQ
ID NOs: 1-114, may be required for function.
[0402] As discussed, the invention includes a novel protein domain,
including several examples of THAP-family members. The invention
thus encompasses a THAP-family member comprising a polypeptide
having at least a THAP domain sequence in the protein or
corresponding nucleic acid molecule, preferably a THAP domain
sequence corresponding to SEQ ID NOs: 1-2. A THAP-family member may
comprise an amino acid sequence of at least about 25, 30, 35, 40,
45, 50, 60, 70, 80 to 90 amino acid residues in length, of which at
least about 50-80%, preferably at least about 60-70%, more
preferably at least about 65%, 75% or 90% of the amino acid
residues are identical or similar amino acids--to the THAP
consensus domain SEQ ID NOs: 1-2.
[0403] Identity or similarity may be determined using any desired
algorithm, including the algorithms and parameters for determining
homology which are described herein.
[0404] Optionally, a THAP-domain-containing THAP-family polypeptide
comprises a nuclear localization sequence (NLS). As used herein,
the term nuclear localization sequence refers to an amino sequence
allowing the THAP-family polypeptide to be localized or transported
to the cell nucleus. A nuclear localization sequence generally
comprises at least about 10, preferably about 13, preferably about
16, more preferably about 19, and even more preferably about 21,
23, 25, 30, 35 or 40 amino acid residues. Alternatively, a
THAP-family polypeptide may comprise a deletion of part or the
entire NLS or a substitution or insertion in a NLS sequence, such
that the modified THAP-family polypeptide is not localized or
transported to the cell nucleus.
[0405] Isolated proteins of the present invention, preferably THAP
family or THAP domain polypeptides, or a biologically active
fragments or homologues thereof, have an amino acid sequence
sufficiently homologous to the consensus amino acid sequence of SEQ
ID NOs: 1-2. As used herein, the term "sufficiently homologous"
refers to a first amino acid or nucleotide sequence which contains
a sufficient or minimum number of identical or equivalent (e.g., an
amino acid residue which has a similar side chain) amino acid
residues or nucleotides to a second amino acid or nucleotide
sequence such that the first and second amino acid or nucleotide
sequences share common structural domains or motifs and/or a common
functional activity. For example, amino acid or nucleotide
sequences which share common structural domains have at least about
30-40% identity, preferably at least about 40-50% identity, more
preferably at least about 50-60%, and even more preferably at least
about 60-70%, 70-80%, 80%, 90%, 95%, 97%, 98%, 99% or 99.8%
identity across the amino acid sequences of the domains and contain
at least one and preferably two structural domains or motifs, are
defined herein as sufficiently homologous. Furthermore, amino acid
or nucleotide sequences which share at least about 30%, preferably
at least about 40%, more preferably at least about 60%, 70%, 80%,
90%, 95%, 97%, 98%, 99% or 99.8% identity and share a common
functional activity are defined herein as sufficiently
homologous.
[0406] It be appreciated that the invention encompasses any of the
THAP-family polypeptides, as well as fragment thereof, nucleic
acids complementary thereto and nucleic acids capable of
hybridizing thereto under stringent conditions.
THAP-0 to THAP11
[0407] As mentioned, the inventors have identified several
THAP-family members, including THAP-0, THAP1, THAP-2, THAP-3,
THAP-4, THAP-5, THAP-6, THAP-7, THAP-8, THAP-9, THAP10 and
THAP11.
THAP1 Nucleic Acids
[0408] The human THAP1 coding sequence, which is approximately 639
nucleotides in length shown in SEQ ID NO: 160, encodes a protein
which is approximately 213 amino acid residues in length. One
aspect of the invention pertains to purified or isolated nucleic
acid molecules that encode THAP1 proteins or biologically active
portions thereof as further described herein, as well as nucleic
acid fragments thereof. Said nucleic acids may be used for example
in therapeutic methods and drug screening assays as further
described herein.
[0409] The human THAP1 gene is localized at chromosomes 8, 18,
11.
[0410] The THAP1 protein comprises a THAP domain at amino acids
1-89, the role of which in apoptosis is further demonstrated
herein. The THAP1 protein comprises an interferon gamma homology
motif at amino acids 136-169 of human THAP1
(NYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQR) (SEQ ID NO: 178), exhibiting
41% identity in a 34 residue overlap with human interferon gamma
(amino acids 98-131). PML-NBs are closely linked to IFNgamma, and
many PML-NB components are induced by IFNgamma, with IFNgamma
responsive elements in the promoters of the corresponding genes.
The THAP1 protein also includes a nuclear localization sequence at
amino acids 146-165 of human THAP1 (RKRIHQLEQQVEKLRKKLKT) (SEQ ID
NO: 179). This sequence is responsible for localization of THAP1 in
the nucleus. As demonstrated in the examples provided herein,
deletion mutants of THAP1 lacking this sequence are no longer
localized in the cell nucleus. The THAP1 protein further comprises
a PAR4 binding motif (LE(X).sub.14 QRXRRQXR(X).sub.11QR/KE) (SEQ ID
NO: 180). The core of this motif has been defined experimentally by
site directed mutagenesis and by comparison with mouse ZIP/DAP-like
kinase (another PAR4 binding partner) it overlaps amino acids
168-175 of human THAP1 but the motif may also include a few
residues upstream and downstream.
[0411] ESTs corresponding to THAP1 have been identified, and may be
specifically included or excluded from the nucleic acids of the
invention. The ESTs, as indicated below by accession number,
provide evidence for tissue distribution for THAP1 as follows:
AL582975 (B cells from Burkitt lymphoma); BG708372 (Hypothalamus);
BG563619 (liver); BG497522 (adenocarcinoma); BG616699 (liver);
BE932253 (head_neck); AL530396 (neuroblastoma cells).
[0412] An object of the invention is a purified, isolated, or
recombinant nucleic acid comprising the nucleotide sequence of SEQ
ID NO: 160, complementary sequences thereto, and fragments thereof.
The invention also pertains to a purified or isolated nucleic acid
comprising a polynucleotide having at least 95% nucleotide identity
with a polynucleotide of SEQ ID NO: 160, advantageously 99%
nucleotide identity, preferably 99.5% nucleotide identity and most
preferably 99.8% nucleotide identity with a polynucleotide of SEQ
ID NO: 160, or a sequence complementary thereto or a biologically
active fragment thereof. Another object of the invention relates to
purified, isolated or recombinant nucleic acids comprising a
polynucleotide that hybridizes, under the stringent hybridization
conditions defined herein, with a polynucleotide of SEQ ID NO: 160,
or a sequence complementary thereto or a variant thereof or a
biologically active fragment thereof. In further embodiments,
nucleic acids of the invention include isolated, purified, or
recombinant polynucleotides comprising a contiguous span of at
least 12, 15, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150,
200, 500, or 1000 nucleotides of SEQ ID NO: 160, or the complements
thereof.
[0413] Also encompassed is a purified, isolated, or recombinant
nucleic acid polynucleotide encoding a THAP1 polypeptide of the
invention, as further described herein.
[0414] In another preferred aspect, the invention pertains to
purified or isolated nucleic acid molecules that encode a portion
or variant of a THAP1 protein, wherein the portion or variant
displays a THAP1 activity of the invention. Preferably said portion
or variant is a portion or variant of a naturally occurring
full-length THAP1 protein. In one example, the invention provides a
polynucleotide comprising, consisting essentially of, or consisting
of a contiguous span of at least 12, 15, 18, 20, 25, 30, 35, 40,
50, 60, 70, 80, 90, 100, 150, 200, 500, or 1000 nucleotides of SEQ
ID NO: 160, wherein said nucleic acid encodes a THAP1 portion or
variant having a THAP1 activity described herein. In other
embodiments, the invention relates to a polynucleotide encoding a
THAP1 portion consisting of 8-20, 20-50, 50-70, 60-100, 100-150,
150-200, 200-205 or 205-212 amino acids of SEQ ID NO: 3, or a
variant thereof, wherein said THAP1 portion displays a THAP1
activity described herein.
[0415] The sequence of SEQ ID NO: 160 corresponds to the human
THAP1 cDNA. This cDNA comprises sequences encoding the human THAP1
protein (i.e., "the coding region", from nucleotides 202 to 840, as
well as 5' untranslated sequences (nucleotides 1-201) and 3'
untranslated sequences (nucleotides 841 to 2173).
[0416] Also encompassed by the THAP1 nucleic acids of the invention
are nucleic acid molecules which are complementary to THAP1 nucleic
acids described herein. Preferably, a complementary nucleic acid is
sufficiently complementary to the nucleotide sequence shown in SEQ
ID NO: 160, such that it can hybridize to the nucleotide sequence
shown in SEQ ID NO: 160, thereby forming a stable duplex.
[0417] Another object of the invention is a purified, isolated, or
recombinant nucleic acid encoding a THAP1 polypeptide comprising,
consisting essentially of, or consisting of the amino acid sequence
of SEQ ID NO: 3, or fragments thereof, wherein the isolated nucleic
acid molecule encodes one or more motifs selected from the group
consisting of a THAP domain, a THAP1 target binding region, a
nuclear localization signal and a interferon gamma homology motif.
Preferably said THAP1 target binding region is a PAR4 binding
region or a DNA binding region. For example, the purified, isolated
or recombinant nucleic acid may comprise a genomic DNA or fragment
thereof which encodes the polypeptide of SEQ ID NO: 3 or a fragment
thereof or a cDNA consisting of, consisting essentially of, or
comprising the sequence of SEQ ID NO: 160 or fragments thereof,
wherein the isolated nucleic acid molecule encodes one or more
motifs selected from the group consisting of a THAP domain, a
THAP1-target binding region, a nuclear localization signal and a
interferon gamma homology motif Any combination of said motifs may
also be specified. Preferably said THAP1 target binding region is a
PAR4 binding region or a DNA binding region. Particularly preferred
nucleic acids of the invention include isolated, purified, or
recombinant THAP1 nucleic acids comprising, consisting essentially
of, or consisting of a contiguous span of at least 12, 15, 18, 20,
25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200 or 300
nucleotides of a sequence selected from the group consisting of
nucleotide positions ranges consisting of 607 to 708, 637 to 696
and 703 to 747 of SEQ ID NO: 160. In preferred embodiments, a THAP1
nucleic acid encodes a THAP1 polypeptide comprising at least two
THAP1 functional domains, such as for example a THAP domain and a
PAR4 binding region.
[0418] In further preferred embodiments, a THAP1 nucleic acid
comprises a nucleotide sequence encoding a THAP domain having the
consensus amino acid sequence of the formula of SEQ ID NOs: 1-2. A
THAP1 nucleic acid may also encode a THAP domain wherein at least
about 95%, 90%, 85%, 50-80%, preferably at least about 60-70%, more
preferably at least about 65% of the amino acid residues are
identical or similar amino acids--to the THAP domain consensus
sequence (SEQ ID NOs: 1-2). The present invention also embodies
isolated, purified, and recombinant polynucleotides which encode a
polypeptide comprising a contiguous span of at least 6 amino acids,
preferably at least 8 or 10 amino acids, more preferably at least
15, 25, 30, 35, 40, 45, 50, 60, 70, 80 or 90 amino acids according
to the formula of SEQ ID NO: 1-2.
[0419] The nucleotide sequence determined from the cloning of the
THAP1 gene allows for the generation of probes and primers designed
for use in identifying and/or cloning other THAP1 family members
(e.g. sharing the novel functional domains), as well as THAP1
homologues from other species.
[0420] A nucleic acid fragment encoding a "biologically active
portion of a THAP1 protein" can be prepared by isolating a portion
of the nucleotide sequence of SEQ ID NO: 160, which encodes a
polypeptide having a THAP1 biological activity (the biological
activities of the THAP1 proteins described herein), expressing the
encoded portion of the THAP1 protein (e.g., by recombinant
expression in vitro or in vivo) and assessing the activity of the
encoded portion of the THAP1 protein.
[0421] The invention further encompasses nucleic acid molecules
that differ from the THAP1 nucleotide sequences of the invention
due to degeneracy of the genetic code and encode the same THAP1
proteins and fragment of the invention.
[0422] In addition to the THAP1 nucleotide sequences described
above, it will be appreciated by those skilled in the art that DNA
sequence polymorphisms that lead to changes in the amino acid
sequences of the THAP1 proteins may exist within a population
(e.g., the human population). Such genetic polymorphism may exist
among individuals within a population due to natural allelic
variation. Such natural allelic variations can typically result in
1-5% variance in the nucleotide sequence of a THAP1 gene.
[0423] Nucleic acid molecules corresponding to natural allelic
variants and homologues of the THAP1 nucleic acids of the invention
can be isolated based on their homology to the THAP1 nucleic acids
disclosed herein using the cDNAs disclosed herein, or a portion
thereof, as a hybridization probe according to standard
hybridization techniques under stringent hybridization
conditions.
[0424] Probes based on the THAP1 nucleotide sequences can be used
to detect transcripts or genomic sequences encoding the same or
homologous proteins. In preferred embodiments, the probe further
comprises a label group attached thereto, e.g., the label group can
be a radioisotope, a fluorescent compound, an enzyme, or an enzyme
co-factor. Such probes can be used as a part of a diagnostic test
kit for identifying cells or tissue which misexpress a THAP1
protein, such as by measuring a level of a THAP1-encoding nucleic
acid in a sample of cells from a subject e.g., detecting THAP1 mRNA
levels or determining whether a genomic THAP1 gene has been mutated
or deleted.
THAP1 Polypeptides
[0425] The term "THAP1 polypeptides" is used herein to embrace all
of the proteins and polypeptides of the present invention. Also
forming part of the invention are polypeptides encoded by the
polynucleotides of the invention, as well as fusion polypeptides
comprising such polypeptides. The invention embodies THAP1 proteins
from humans, including isolated or purified THAP1 proteins
consisting of, consisting essentially of, or comprising the
sequence of SEQ ID NO: 3.
[0426] The invention concerns the polypeptide encoded by a
nucleotide sequence of SEQ ID NO: 160, a complementary sequence
thereof or a fragment thereto.
[0427] The present invention embodies isolated, purified, and
recombinant polypeptides comprising a contiguous span of at least 6
amino acids, preferably at least 8 to 10 amino acids, more
preferably at least 12, 15, 20, 25, 30, 40, 50, or 100 amino acids
of SEQ ID NO: 3. In other preferred embodiments the contiguous
stretch of amino acids comprises the site of a mutation or
functional mutation, including a deletion, addition, swap or
truncation of the amino acids in the THAP1 protein sequence. The
invention also concerns the polypeptide encoded by the THAP1
nucleotide sequences of the invention, or a complementary sequence
thereof or a fragment thereof.
[0428] One aspect of the invention pertains to isolated THAP1
proteins, and biologically active portions thereof, as well as
polypeptide fragments suitable for use as immunogens to raise
anti-THAP1 antibodies. In one embodiment, native THAP1 proteins can
be isolated from cells or tissue sources by an appropriate
purification scheme using standard protein purification techniques.
In another embodiment, THAP1 proteins are produced by recombinant
DNA techniques. Alternative to recombinant expression, a THAP1
protein or polypeptide can be synthesized chemically using standard
peptide synthesis techniques.
[0429] Typically, biologically active portions comprise a domain or
motif with at least one activity of the THAP1 protein. The present
invention also embodies isolated, purified, and recombinant
portions or fragments of one THAP1 polypeptide comprising a
contiguous span of at least 6 amino acids, preferably at least 8 to
10 amino acids, more preferably at least 12, 15, 20, 25, 30, 40,
50, 100 or 200 amino acids of SEQ ID NO: 3. Also encompassed are
THAP1 polypeptide which comprise between 10 and 20, between 20 and
50, between 30 and 60, between 50 and 100, or between 100 and 200
amino acids of SEQ ID NO: 3. In other preferred embodiments the
contiguous stretch of amino acids comprises the site of a mutation
or functional mutation, including a deletion, addition, swap or
truncation of the amino acids in the THAP1 protein sequence.
[0430] A biologically active THAP1 protein may, for example,
comprise at least 1, 2, 3, 5, 10, 20 or 30 amino acid changes from
the sequence of SEQ ID NO: 3, or may encode a biologically active
THAP1 protein comprising at least 1%, 2%, 3%, 5%, 8%, 10% or 15%
changes in amino acids from the sequence of SEQ ID NO: 3.
[0431] In a preferred embodiment, the THAP1 protein comprises,
consists essentially of, or consists of a THAP domain at amino acid
positions 1 to 89 shown in SEQ ID NO: 3, or fragments or variants
thereof. In other aspects, a THAP1 polypeptide comprises a
THAP1-target binding region, a nuclear localization signal and/or a
Interferon Gamma Homology Motif Preferably a THAP1 target binding
region is a PAR4 binding region or a DNA binding region. The
invention also concerns the polypeptide encoded by the THAP1
nucleotide sequences of the invention, or a complementary sequence
thereof or a fragment thereof. The present invention thus also
embodies isolated, purified, and recombinant polypeptides
comprising, consisting essentially of or consisting of a contiguous
span of at least 6 amino acids, preferably at least 8 to 10 amino
acids, more preferably at least 12, 15, 20, 25, 30, 40, 50, 70, 80,
90 or 100 amino acids of an amino acid sequence selected from the
group consisting of positions 1 to 90, 136 to 169, 146 to 165 and
168 to 175 of SEQ ID NO: 3. In another aspect, a THAP1 polypeptide
may encode a THAP domain wherein at least about 95%, 90%, 85%,
50-80%, preferably at least about 60-70%, more preferably at least
about 65% of the amino acid residues are identical or similar amino
acids--to the THAP domain consensus sequence (SEQ ID NOs: 1-2).
Also encompassed by the present invention are isolated, purified,
nucleic acids encoding a THAP1 polypeptide comprising, consisting
essentially of, or consisting of a THAP domain at amino acid
positions 1 to 90 shown in SEQ ID NO: 3, or fragments or variants
thereof.
[0432] In other embodiments, the THAP1 protein is substantially
homologous to the sequences of SEQ ID NO: 3, and retains the
functional activity of the THAP1 protein, yet differs in amino acid
sequence due to natural allelic variation or mutagenesis, as
described further herein. Accordingly, in another embodiment, the
THAP1 protein is a protein which comprises an amino acid sequence
shares more than about 60% but less than 100% homology with the
amino acid sequence of SEQ ID NO: 3 and retains the functional
activity of the THAP1 proteins of SEQ ID NO: 3, respectively.
Preferably, the protein is at least about 30%, 40%, 50%, 60%, 70%,
80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or 99.8% homologous to SEQ
ID NO: 3, but is not identical to SEQ ID NO: 3. Preferably the
THAP1 is less than identical (e.g. 100% identity) to a naturally
occurring THAP1. Percent homology can be determined as further
detailed above.
THAP-2 to THAP11 and THAP-0 Nucleic Acids
[0433] As mentioned, the invention provides several members of the
THAP-family. THAP-2, THAP-3, THAP-4, THAP-5, THAP-6, THAP-7,
THAP-8, THAP-9, THAP10, THAP11 and THAP-0 are described herein. The
human and mouse nucleotide sequences corresponding to the human
cDNA sequences are listed in SEQ ID NOs: 161-171; and the human
amino acid sequences are listed respectively in SEQ ID NOs: 4-14.
Also encompassed by the invention are orthologs of said THAP-family
sequences, including mouse, rat, pig and other orthologs, the amino
acid sequences of which are listed in SEQ ID NOs: 16-114 and the
cDNA sequences are listed in SEQ ID NOs: 172-175.
[0434] THAP-2
[0435] The human THAP-2 cDNA, which is approximately 1302
nucleotides in length shown in SEQ ID NO: 161, encodes a protein
which is approximately 228 amino acid residues in length, shown in
SEQ ID NO: 4. One aspect of the invention pertains to purified or
isolated nucleic acid molecules that encode THAP-2 proteins or
biologically active portions thereof as further described herein,
as well as nucleic acid fragments thereof. Said nucleic acids may
be used for example in therapeutic methods and drug screening
assays as further described herein. The human THAP-2 gene is
localized at chromosomes 12 and 3. The THAP-2 protein comprises a
THAP domain at amino acids 1 to 89. Analysis of expressed sequences
(accession numbers indicated, which may be specifically included or
excluded from the nucleic acids of the invention) in databases
suggests that THAP-2 is expressed as follows: BG677995 (squamous
cell carcinoma); AV718199 (hypothalamus); BI600215 (hypothalamus);
AI208780 (Soares_testis_NHT); BE566995 (carcinoma cell line);
AI660418 (thymus pooled)
[0436] THAP-3
[0437] The human THAP-3 cDNA which is approximately 1995
nucleotides in length shown in SEQ ID NO: 162. The THAP-3 gene
encodes a protein which is approximately 239 amino acid residues in
length, shown in SEQ ID NO: 5. One aspect of the invention pertains
to purified or isolated nucleic acid molecules that encode THAP-3
proteins or biologically active portions thereof as further
described herein, as well as nucleic acid fragments thereof. Said
nucleic acids may be used for example in therapeutic methods and
drug screening assays as further described herein. The human THAP-3
gene is localized at chromosome 1. The THAP-3 protein comprises a
THAP domain at amino acids 1 to 89. Analysis of expressed sequences
(accession numbers indicated, which may be specifically included or
excluded from the nucleic acids of the invention) in databases
suggests that THAP-3 is expressed as follows: BG700517
(hippocampus); BI460812 (testis); BG707197 (hypothalamus); AW960428
(-); BG437177 (large cell carcinoma); BE962820 (adenocarcinoma);
BE548411 (cervical carcinoma cell line); AL522189 (neuroblastoma
cells); BE545497 (cervical carcinoma cell line); BE280538
(choriocarcinoma); B1086954 (cervix); BE744363 (adenocarcinoma cell
line); and BI549151 (hippocampus).
[0438] THAP-4
[0439] The human THAP-4-cDNA, shown as a sequence having 1999
nucleotides in length shown in SEQ ID NO: 163, encodes a protein
which is approximately 577 amino acid residues in length, shown in
SEQ ID NO: 6. One aspect of the invention pertains to purified or
isolated nucleic acid molecules that encode THAP-4 proteins or
biologically active portions thereof as further described herein,
as well as nucleic acid fragments thereof. Said nucleic acids may
be used for example in therapeutic methods and drug screening
assays as further described herein. The THAP-4 protein comprises a
THAP domain at amino acids 1 to 90. Analysis of expressed sequences
(accession numbers indicated, which may be specifically included or
excluded from the nucleic acids of the invention) in databases
suggests that THAP-4 is expressed as follows: AL544881 (placenta);
BE384014 (melanotic melanoma); AL517205 (neuroblastoma cells);
BG394703 (retinoblastoma); BG472327 (retinoblastoma); BI196071
(neuroblastoma); BE255202 (retinoblastoma); BI017349 (lung_tumor);
BF972153 (leiomyosarcoma cell line); BG116061 (duodenal
adenocarcinoma cell line); AL530558 (neuroblastoma cells); AL520036
(neuroblastoma cells); AL559902 (B cells from Burkitt lymphoma);
AL534539 (Fetal brain); BF686560 (leiomyosarcoma cell line);
BF345413 (anaplastic oligodendroglioma with 1p/19q loss); BG117228
(adenocarcinoma cell line); BG490646 (large cell carcinoma); and
BF769104 (epid_tumor).
[0440] THAP-5
[0441] The human THAP-5 cDNA, shown as a sequence having 1034
nucleotides in length shown in SEQ ID NO: 164, encodes a protein
which is approximately 239 amino acid residues in length, shown in
SEQ ID NO: 7. One aspect of the invention pertains to purified or
isolated nucleic acid molecules that encode THAP-5 proteins or
biologically active portions thereof as further described herein,
as well as nucleic acid fragments thereof. Said nucleic acids may
be used for example in therapeutic methods and drug screening
assays as further described herein. The human THAP-5 gene is
localized at chromosome 7. The THAP-5 protein comprises a THAP
domain at amino acids 1 to 90. Analysis of expressed sequences
(accession numbers indicated, which may be specifically included or
excluded from the nucleic acids of the invention) in databases
suggests that THAP-5 is expressed as follows: BG575430 (mammary
adenocarcinoma cell line); BI545812 (hippocampus); BI560073
(testis); BG530461 (embryonal carcinoma); BF244164 (glioblastoma);
BI461364 (testis); AW407519 (germinal center B cells); BF103690
(embryonal carcinoma); and BF939577 (kidney).
[0442] THAP-6
[0443] The human THAP-6cDNA, shown as a sequence having 2291
nucleotides in length shown in SEQ ID NO: 165, encodes a protein
which is approximately 222 amino acid residues in length, shown in
SEQ ID NO: 8. One aspect of the invention pertains to purified or
isolated nucleic acid molecules that encode THAP-6 proteins or
biologically active portions thereof as further described herein,
as well as nucleic acid fragments thereof. Said nucleic acids may
be used for example in therapeutic methods and drug screening
assays as further described herein. The human THAP-6 gene is
localized at chromosome 4. The THAP-6 protein comprises a THAP
domain at amino acids 1 to 90. Analysis of expressed sequences
(accession numbers indicated, which may be specifically included or
excluded from the nucleic acids of the invention) in databases
suggests that THAP-6 is expressed as follows: AV684783
(hepatocellular carcinoma); AV698391 (hepatocellular carcinoma);
BI560555 (testis); AV688768 (hepatocellular carcinoma); AV692405
(hepatocellular carcinoma); and AV696360 (hepatocellular
carcinoma).
[0444] THAP-7
[0445] The human THAP-7 cDNA, shown as a sequence having 1242
nucleotides in length shown in SEQ ID NO: 166, encodes a protein
which is approximately 309 amino acid residues in length, shown in
SEQ ID NO: 9. One aspect of the invention pertains to purified or
isolated nucleic acid molecules that encode THAP-7 proteins or
biologically active portions thereof as further described herein,
as well as nucleic acid fragments thereof. Said nucleic acids may
be used for example in therapeutic methods and drug screening
assays as further described herein. The human THAP-7 gene is
localized at chromosome 22q11.2. The THAP-7 protein comprises a
THAP domain at amino acids 1 to 90. Analysis of expressed sequences
(accession numbers indicated, which may be specifically included or
excluded from the nucleic acids of the invention) in databases
suggests that THAP-7 is expressed as follows: BI193682 (epithelioid
carcinoma cell line); BE253146 (retinoblastoma); BE622113
(melanotic melanoma); BE740360 (adenocarcinoma cell line); BE513955
(Burkitt lymphoma); AL049117 (testis); BF952983 (nervous_normal);
AW975614 (-); BE273270 (renal cell adenocarcinoma); BE738428
(glioblastoma); BE388215 (endometrium adenocarcinoma cell line);
BF762401 (colon_est); and BG329264 (retinoblastoma).
[0446] THAP-8
[0447] The human THAP-8 cDNA, shown as a sequence having 1383
nucleotides in length shown in SEQ ID NO: 167, encodes a protein
which is approximately 274 amino acid residues in length, shown in
SEQ ID NO: 10. One aspect of the invention pertains to purified or
isolated nucleic acid molecules that encode THAP-8 proteins or
biologically active portions thereof as further described herein,
as well as nucleic acid fragments thereof. Said nucleic acids may
be used for example in therapeutic methods and drug screening
assays as further described herein. The human THAP-8 gene is
localized at chromosome 19. The THAP-8 protein comprises a THAP
domain at amino acids 1 to 92. Analysis of expressed sequences
(accession numbers indicated, which may be specifically included or
excluded from the nucleic acids of the invention) in databases
suggests that THAP-8 is expressed as follows: BG703645
(hippocampus); BF026346 (melanotic melanoma); BE728495 (melanotic
melanoma); BG334298 (melanotic melanoma); and BE390697 (endometrium
adenocarcinoma cell line).
[0448] THAP-9
[0449] The human THAP-9 cDNA, shown as a sequence having 693
nucleotides in length shown in SEQ ID NO: 168, encodes a protein
which is approximately 231 amino acid residues in length, shown in
SEQ ID NO: 11. One aspect of the invention pertains to purified or
isolated nucleic acid molecules that encode THAP-9 proteins or
biologically active portions thereof as further described herein,
as well as nucleic acid fragments thereof. Said nucleic acids may
be used for example in therapeutic methods and drug screening
assays as further described herein. The THAP-9 protein comprises a
THAP domain at amino acids 1 to 92. Analysis of expressed sequences
(accession numbers indicated, which may be specifically included or
excluded from the nucleic acids of the invention) in databases
suggests that THAP-9 is expressed as follows: AA333595 (Embryo 8
weeks).
[0450] THAP10
[0451] The human THAP10 cDNA, shown as a sequence having 771
nucleotides in length shown in SEQ ID NO: 169, encodes a protein
which is approximately 257 amino acid residues in length, shown in
SEQ ID NO: 12. One aspect of the invention pertains to purified or
isolated nucleic acid molecules that encode THAP10 proteins or
biologically active portions thereof as further described herein,
as well as nucleic acid fragments thereof. Said nucleic acids may
be used for example in therapeutic methods and drug screening
assays as further described herein. The human THAP10 gene is
localized at chromosome 15. The THAP10 protein comprises a THAP
domain at amino acids 1 to 90. Analysis of expressed sequences
(accession numbers indicated, which may be specifically included or
excluded from the nucleic acids of the invention) in databases
suggests that THAP10 is expressed as follows: AL526710
(neuroblastoma cells); AV725499 (Hypothalamus); AW966404 (-);
AW296810 (lung); and AL557817 (T cells from T cell leukemia).
[0452] THAP11
[0453] The human THAP1 cDNA, shown as a sequence having 942
nucleotides in length shown in SEQ ID NO: 170, encodes a protein
which is approximately 314 amino acid residues in length, shown in
SEQ ID NO: 13. One aspect of the invention pertains to purified or
isolated nucleic acid molecules that encode THAP11 proteins or
biologically active portions thereof as further described herein,
as well as nucleic acid fragments thereof. Said nucleic acids may
be used for example in therapeutic methods and drug screening
assays as further described herein. The human THAP11 gene is
localized at chromosome 16. The THAP11 protein comprises a THAP
domain at amino acids 1 to 90. Analysis of expressed sequences
(accession numbers indicated, which may be specifically included or
excluded from the nucleic acids of the invention) in databases
suggests that THAP11 is expressed as follows: AU142300
(retinoblastoma); BI261822 (lymphoma cell line); BG423102 (renal
cell adenocarcinoma); and BG423864 (kidney).
[0454] THAP-0
[0455] The human THAP-0 cDNA, shown as a sequence having 2283
nucleotides in length shown in SEQ ID NO: 171, encodes a protein
which is approximately 761 amino acid residues in length, shown in
SEQ ID NO: 14. One aspect of the invention pertains to purified or
isolated nucleic acid molecules that encode THAP-0 proteins or
biologically active portions thereof as further described herein,
as well as nucleic acid fragments thereof. Said nucleic acids may
be used for example in therapeutic methods and drug screening
assays as further described herein. The human THAP-0 gene is
localized at chromosome 11. The THAP-0 protein comprises a THAP
domain at amino acids 1 to 90. Analysis of expressed sequences
(accession numbers indicated, which may be specifically included or
excluded from the nucleic acids of the invention) in databases
suggests that THAP-0 is expressed as follows: BE713222 (head_neck);
BE161184 (head_neck); AL119452 (amygdala); AU129709
(teratocarcinoma); AW965460 (-); AW965460(-); AW958065 (-); and
BE886885 (leiomyosarcoma).
[0456] An object of the invention is a purified, isolated, or
recombinant nucleic acid comprising the nucleotide sequence of SEQ
ID NOs: 161-171, 173-175 or complementary sequences thereto, and
fragments thereof. The invention also pertains to a purified or
isolated nucleic acid comprising a polynucleotide having at least
95% nucleotide identity with a polynucleotide of SEQ ID NOs:
161-171 or 173-175, advantageously 99% nucleotide identity,
preferably 99.5% nucleotide identity and most preferably 99.8%
nucleotide identity with a polynucleotide of SEQ ID NOs: 161-171,
173-175 or a sequence complementary thereto or a biologically
active fragment thereof. Another object of the invention relates to
purified, isolated or recombinant nucleic acids comprising a
polynucleotide that hybridizes, under the stringent hybridization
conditions defined herein, with a polynucleotide of SEQ ID NOs:
161-171, 173-175 or a sequence complementary thereto or a variant
thereof or a biologically active fragment thereof. In further
embodiments, nucleic acids of the invention include isolated,
purified, or recombinant polynucleotides comprising a contiguous
span of at least 12, 15, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80,
90, 100, 150, 200, 500, or 1000 nucleotides of a sequence selected
from the group consisting of SEQ ID NOs: 161-171, 173-175 or the
complements thereof.
[0457] Also encompassed is a purified, isolated, or recombinant
nucleic acid polynucleotide encoding a THAP-2 to THAP11 or THAP-0
polypeptide of the invention, as further described herein.
[0458] In another preferred aspect, the invention pertains to
purified or isolated nucleic acid molecules that encode a portion
or variant of a THAP-2 to THAP11 or THAP-0 protein, wherein the
portion or variant displays a THAP-2 to THAP11 or THAP-0 activity
of the invention. Preferably said portion or variant is a portion
or variant of a naturally occurring full-length THAP-2 to THAP11 or
THAP-0 protein. In one example, the invention provides a
polynucleotide comprising, consisting essentially of, or consisting
of a contiguous span of at least 12, 15, 18, 20, 25, 30, 35, 40,
50, 60, 70, 80, 90, 100, 150, 200, 500, or 1000 nucleotides, to the
extent that the length of said span is consistent with the length
of the SEQ ID NO, of a sequence selected from the group consisting
of SEQ ID NOs: 161-171, 173-175, wherein said nucleic acid encodes
a THAP-2 to THAP11 or THAP-0 portion or variant having a THAP-2 to
THAP11 or THAP-0 activity described herein. In other embodiment,
the invention relates to a polynucleotide encoding a THAP-2 to
THAP11 or THAP-0 portion consisting of 8-20, 20-50, 50-70, 60-100,
100-150, 150-200, 200-250 or 250-350 amino acids, to the extent
that the length of said portion is consistent with the length of
the SEQ ID NO: of a sequence selected from the group consisting of
SEQ ID NOs: 4-14, 17-21, 23-40, 42-56, 58-98, 100-114 or a variant
thereof, wherein said THAP-2 to THAP11 or THAP-0 portion displays a
THAP-2 to THAP11 or THAP-0 activity described herein.
[0459] A THAP-2 to THAP11 or THAP-0 variant nucleic acid may, for
example, encode a biologically active THAP-2 to THAP11 or THAP-0
protein comprising at least 1, 2, 3, 5, 10, 20 or 30 amino acid
changes from the respective sequence selected from the group
consisting of SEQ ID NO: 4-14, 17-21, 23-40, 42-56, 58-98 and
100-114 or may encode a biologically active THAP-2 to THAP11 or
THAP-0 protein comprising at least 1%, 2%, 3%, 5%, 8%, 10% or 15%
changes in amino acids from the respective sequence of SEQ ID NOs:
4-14, 17-21, 23-40, 42-56, 58-98 and 100-114.
[0460] The sequences of SEQ ID NOs: 4-14 correspond to the human
THAP-2 to THAP11 and THAP-0 DNAs respectively. SEQ ID NOs: 17-21,
23-40, 42-56, 58-98, 100-114 correspond to mouse, rat, pig and
other orthologs.
[0461] Also encompassed by the THAP-2 to THAP11 and THAP-0 nucleic
acids of the invention are nucleic acid molecules which are
complementary to THAP-2 to THAP11 or THAP-0 nucleic acids described
herein. Preferably, a complementary nucleic acid is sufficiently
complementary to the nucleotide respective sequence shown in SEQ ID
NOs: 161-171 and 173-175 such that it can hybridize to said
nucleotide sequence shown in SEQ ID NOs: 161-171 and 173-175,
thereby forming a stable duplex.
[0462] Another object of the invention is a purified, isolated, or
recombinant nucleic acid encoding a THAP-2 to THAP11 or THAP-0
polypeptide comprising, consisting essentially of, or consisting of
an amino acid sequence selected from the group consisting of SEQ ID
NOs: 4-14, 17-21, 23-40, 42-56, 58-98, 100-114 or fragments
thereof, wherein the isolated nucleic acid molecule encodes a THAP
domain or a THAP-2 to THAP11 or THAP-0 target binding region.
Preferably said target binding region is a protein binding region,
preferably a PAR-4 binding region, or preferably said target
binding region is a DNA binding region. For example, the purified,
isolated or recombinant nucleic acid may comprise a genomic DNA or
fragment thereof which encodes a polypeptide having a sequence
selected from the group consisting of SEQ ID NOs: 4-14, 17-21,
23-40, 42-56, 58-98, 100-114 or a fragment thereof. The purified,
isolated or recombinant nucleic acid may alternatively comprise a
cDNA consisting of, consisting essentially of, or comprising a
sequence selected from the group consisting of SEQ ID NOs: 4-14,
17-21, 23-40, 42-56, 58-98, 100-114 or fragments thereof, wherein
the isolated nucleic acid molecule encodes a THAP domain or a
THAP-2 to THAP11 or THAP-0 target binding region. In preferred
embodiments, a THAP-2 to THAP11 or THAP-0 nucleic acid encodes a
THAP-2 to THAP11 or THAP-0 polypeptide comprising at least two
THAP-2 to THAP11 or THAP-0 functional domains, such as for example
a THAP domain and a THAP-2 to THAP11 or THAP-0 target binding
region.
[0463] Particularly preferred nucleic acids of the invention
include isolated, purified, or recombinant THAP-2 to THAP11 or
THAP-0 nucleic acids comprising, consisting essentially of, or
consisting of a contiguous span of at least 12, 15, 18, 20, 25, 30,
35, 40, 50, 60, 70, 80, 90, 100, 150, 200 or 250 nucleotides of a
sequence selected from the group consisting of nucleotide positions
coding for the relevant amino acids as given in the SEQ ID NO:
161-171 and 173-175.
[0464] In further preferred embodiments, a THAP-2 to THAP11 or
THAP-0 nucleic acid comprises a nucleotide sequence encoding a THAP
domain having the consensus amino acid sequence of the formula of
SEQ ID NOs: 1-2. A THAP-2 to THAP11 or THAP-0 nucleic acid may also
encode a THAP domain wherein at least about 95%, 90%, 85%, 50-80%,
preferably at least about 60-70%, more preferably at least about
65% of the amino acid residues are identical or similar amino
acids--to the THAP consensus domain (SEQ ID NOs: 1-2). The present
invention also embodies isolated, purified, and recombinant
polynucleotides which encode a polypeptide comprising a contiguous
span of at least 6 amino acids, preferably at least 8 or 10 amino
acids, more preferably at least 15, 25, 30, 35, 40, 45, 50, 60, 70,
80 or 90 amino acids of SEQ ID NOs: 1-2.
[0465] The nucleotide sequence determined from the cloning of the
THAP-2 to THAP11 or THAP-0 genes allows for the generation of
probes and primers designed for use in identifying and/or cloning
other THAP family members, particularly sequences related to THAP-2
to THAP11 or THAP-0 (e.g. sharing the novel functional domains), as
well as THAP-2 to THAP11 or THAP-0 homologues from other
species.
[0466] A nucleic acid fragment encoding a biologically active
portion of a THAP-2 to THAP11 or THAP-0 protein can be prepared by
isolating a portion of a nucleotide sequence selected from the
group consisting of SEQ ID NOs: 161-171 and 173-175, which encodes
a polypeptide having a THAP-2 to THAP11 or THAP-0 biological
activity (the biological activities of the THAP-family proteins
described herein), expressing the encoded portion of the THAP-2 to
THAP11 or THAP-0 protein (e.g., by recombinant expression in vitro
or in vivo) and assessing the activity of the encoded portion of
the THAP-2 to THAP11 or THAP-0 protein.
[0467] The invention further encompasses nucleic acid molecules
that differ from the THAP-2 to THAP11 or THAP-0 nucleotide
sequences of the invention due to degeneracy of the genetic code
and encode the same THAP-2 to THAP11 or THAP-0 protein, or fragment
thereof, of the invention.
[0468] In addition to the THAP-2 to THAP11 or THAP-0 nucleotide
sequences described above, it will be appreciated by those skilled
in the art that DNA sequence polymorphisms that lead to changes in
the amino acid sequences of the respective THAP-2 to THAP11 or
THAP-0 protein may exist within a population (e.g., the human
population). Such genetic polymorphism may exist among individuals
within a population due to natural allelic variation. Such natural
allelic variations can typically result in 1-5% variance in the
nucleotide sequence of a particular THAP-2 to THAP11 or THAP-0
gene.
[0469] Nucleic acid molecules corresponding to natural allelic
variants and homologues of the THAP-2 to THAP11 or THAP-0 nucleic
acids of the invention can be isolated based on their homology to
the THAP-2 to THAP11 or THAP-0 nucleic acids disclosed herein using
the cDNAs disclosed herein, or a portion thereof, as a
hybridization probe according to standard hybridization techniques
under stringent hybridization conditions.
[0470] Probes based on the THAP-2 to THAP11 or THAP-0 nucleotide
sequences can be used to detect transcripts or genomic sequences
encoding the same or homologous proteins. In preferred embodiments,
the probe further comprises a label group attached thereto, e.g.,
the label group can be a radioisotope, a fluorescent compound, an
enzyme, or an enzyme co-factor. Such probes can be used as a part
of a diagnostic test kit for identifying cells or tissue which
misexpress a THAP-2 to THAP11 or THAP-0 protein, such as by
measuring a level of a THAP-2 to THAP11 or THAP-0-encoding nucleic
acid in a sample of cells from a subject e.g., detecting THAP-2 to
THAP11 or THAP-0 mRNA levels or determining whether a genomic
THAP-2 to THAP11 or THAP-0 gene has been mutated or deleted.
THAP-2 to THAP11 and THAP-0 Polypeptides
[0471] The term "THAP-2 to THAP11 or THAP-0 polypeptides" is used
herein to embrace all of the proteins and polypeptides of the
present invention relating to THAP-2, THAP-3, THAP-4, THAP-5,
THAP-6, THAP-7, THAP-8, THAP-9, THAP10, THAP11 and THAP-0. Also
forming part of the invention are polypeptides encoded by the
polynucleotides of the invention, as well as fusion polypeptides
comprising such polypeptides. The invention embodies THAP-2 to
THAP11 or THAP-0 proteins from humans, including isolated or
purified THAP-2 to THAP11 or THAP-0 proteins consisting of,
consisting essentially of, or comprising a sequence selected from
the group consisting of SEQ ID NOs: 4-14, 17-21, 23-40, 42-56,
58-98 and 100-114.
[0472] The invention concerns the polypeptide encoded by a
nucleotide sequence selected from the group consisting of SEQ ID
NOs: 161-171, 172-175 and a complementary sequence thereof and a
fragment thereof.
[0473] The present invention embodies isolated, purified, and
recombinant polypeptides comprising a contiguous span of at least 6
amino acids, preferably at least 8 to 10 amino acids, more
preferably at least 12, 15, 20, 25, 30, 40, 50, 100, 150, 200, 300
or 500 amino acids, to the extent that said span is consistent with
the particular SEQ ID NO: of a sequence selected from the group
consisting of SEQ ID NOs: 4-14, 17-21, 23-40, 42-56, 58-98 and
100-114. In other preferred embodiments the contiguous stretch of
amino acids comprises the site of a mutation or functional
mutation, including a deletion, addition, swap or truncation of the
amino acids in the THAP-2 to THAP11 or THAP-0 protein sequence.
[0474] One aspect of the invention pertains to isolated THAP-2 to
THAP11 and THAP-0 proteins, and biologically active portions
thereof, as well as polypeptide fragments suitable for use as
immunogens to raise anti-THAP-2 to THAP11 or THAP-0 antibodies. In
one embodiment, native THAP-2 to THAP11 or THAP-0 proteins can be
isolated from cells or tissue sources by an appropriate
purification scheme using standard protein purification techniques.
In another embodiment, THAP-2 to THAP11 or THAP-0 proteins are
produced by recombinant DNA techniques. Alternative to recombinant
expression, a THAP-2 to THAP11 or THAP-0 protein or polypeptide can
be synthesized chemically using standard peptide synthesis
techniques.
[0475] Biologically active portions of a THAP-2 to THAP11 or THAP-0
protein include peptides comprising amino acid sequences
sufficiently homologous to or derived from the amino acid sequence
of the THAP-2 to THAP11 or THAP-0 protein, e.g., an amino acid
sequence shown in SEQ ID NOs: 4-14, 17-21, 23-40, 42-56, 58-98 or
100-114, which include less amino acids than the respective full
length THAP-2 to THAP11 or THAP-0 protein, and exhibit at least one
activity of the THAP-2 to THAP11 or THAP-0 protein. The present
invention also embodies isolated, purified, and recombinant
portions or fragments of a THAP-2 to THAP11 or THAP-0 polypeptide
comprising a contiguous span of at least 6 amino acids, preferably
at least 8 to 10 amino acids, more preferably at least 12, 15, 20,
25, 30, 40, 50, 100, 150, 200, 300 or 500 amino acids, to the
extent that said span is consistent with the particular SEQ ID NO,
of a sequence selected from the group consisting of SEQ ID NOs:
4-14, 17-21, 23-40, 42-56, 58-98 and 100-114. Also encompassed are
THAP-2 to THAP11 or THAP-0 polypeptides which comprise between 10
and 20, between 20 and 50, between 30 and 60, between 50 and 100,
or between 100 and 200 amino acids of a sequence selected from the
group consisting of SEQ ID NOs: 4-14, 17-21, 23-40, 42-56, 58-98
and 100-114. In other preferred embodiments the contiguous stretch
of amino acids comprises the site of a mutation or functional
mutation, including a deletion, addition, swap or truncation of the
amino acids in the THAP-2 to THAP11 or THAP-0 protein sequence.
[0476] A biologically active THAP-2 to THAP11 or THAP-0 protein
may, for example, comprise at least 1, 2, 3, 5, 10, 20 or 30 amino
acid changes from the sequence of SEQ ID NOs: 4-14, 17-21, 23-40,
42-56, 58-98 or 100-114, or may encode a biologically active THAP-2
to THAP11 or THAP-0 protein comprising at least 1%, 2%, 3%, 5%, 8%,
10% or 15% changes in amino acids from the sequence of SEQ ID NOs:
4-14, 17-21, 23-40, 42-56, 58-98 or 100-114.
[0477] In a preferred embodiment, the THAP-2 protein comprises,
consists essentially of, or consists of a THAP-2 THAP domain,
preferably having the amino acid sequence of amino acid positions 1
to 89 shown in SEQ ID NO: 4, or fragments or variants thereof. The
invention also concerns the polypeptide encoded by the THAP-2
nucleotide sequences of the invention, or a complementary sequence
thereof or a fragment thereof. The present invention thus also
embodies isolated, purified, and recombinant polypeptides
comprising, consisting essentially of or consisting of a contiguous
span of at least 6 amino acids, preferably at least 8 to 10 amino
acids, more preferably at least 12, 15, 20, 25, 30, 40, 50, 70, 80
or 89 amino acids of a sequence comprising amino acid positions 1
to 89 of SEQ ID NO: 4. In another aspect, a THAP-2 polypeptide may
comprise a THAP domain wherein at least about 95%, 90%, 85%,
50-80%, preferably at least about 60-70%, more preferably at least
about 65% of the amino acid residues are identical or similar amino
acids--to the THAP domain consensus domain (SEQ ID NOs: 1-2). Also
encompassed by the present invention are isolated, purified,
nucleic acids encoding a THAP-2 polypeptide comprising, consisting
essentially of, or consisting of a THAP domain at amino acid
positions 1 to 89 shown in SEQ ID NO: 4, or fragments or variants
thereof. Preferably, said THAP-2 polypeptide comprises a PAR-4
binding domain and/or a DNA binding domain.
[0478] In a preferred embodiment, the THAP-3 protein comprises,
consists essentially of, or consists of a THAP-3 THAP domain,
preferably having the amino acid sequence of amino acid positions 1
to 89 shown in SEQ ID NO: 5, or fragments or variants thereof. The
invention also concerns the polypeptide encoded by the THAP-3
nucleotide sequences of the invention, or a complementary sequence
thereof or a fragment thereof. The present invention thus also
embodies isolated, purified, and recombinant polypeptides
comprising, consisting essentially of or consisting of a contiguous
span of at least 6 amino acids, preferably at least 8 to 10 amino
acids, more preferably at least 12, 15, 20, 25, 30, 40, 50, 70, 80
or 89 amino acids of a sequence comprising amino acid positions 1
to 89 of SEQ ID NO: 5. In another aspect, a THAP-3 polypeptide may
comprise a THAP domain wherein at least about 95%, 90%, 85%,
50-80%, preferably at least about 60-70%, more preferably at least
about 65% of the amino acid residues are identical or similar amino
acids--to the THAP domain consensus domain (SEQ ID NOs: 1-2). Also
encompassed by the present invention are isolated, purified,
nucleic acids encoding a THAP-3 polypeptide comprising, consisting
essentially of, or consisting of a THAP domain at amino acid
positions 1 to 89 shown in SEQ ID NO: 5, or fragments or variants
thereof. Preferably, said THAP-3 polypeptide comprises a PAR-4
binding domain and/or a DNA binding domain.
[0479] In a preferred embodiment, the THAP-4 protein comprises,
consists essentially of, or consists of a THAP-4 THAP domain,
preferably having the amino acid sequence of amino acid positions 1
to 90 shown in SEQ ID NO: 6, or fragments or variants thereof. The
invention also concerns the polypeptide encoded by the THAP-4
nucleotide sequences of the invention, or a complementary sequence
thereof or a fragment thereof. The present invention thus also
embodies isolated, purified, and recombinant polypeptides
comprising, consisting essentially of or consisting of a contiguous
span of at least 6 amino acids, preferably at least 8 to 10 amino
acids, more preferably at least 12, 15, 20, 25, 30, 40, 50, 70, 80
or 90 amino acids of a sequence comprising amino acid positions 1
to 90 of SEQ ID NO: 6. In another aspect, a THAP-4 polypeptide may
comprise a THAP domain wherein at least about 95%, 90%, 85%,
50-80%, preferably at least about 60-70%, more preferably at least
about 65% of the amino acid residues are identical or similar amino
acids--to the THAP domain consensus domain (SEQ ID NOs: 1-2). Also
encompassed by the present invention are isolated, purified,
nucleic acids encoding a THAP-4 polypeptide comprising, consisting
essentially of, or consisting of a THAP domain at amino acid
positions 1 to 90 shown in SEQ ID NO: 6, or fragments or variants
thereof.
[0480] In a preferred embodiment, the THAP-5 protein comprises,
consists essentially of, or consists of a THAP-5 THAP domain,
preferably having the amino acid sequence of amino acid positions 1
to 90 shown in SEQ ID NO: 7, or fragments or variants thereof. The
invention also concerns the polypeptide encoded by the THAP-5
nucleotide sequences of the invention, or a complementary sequence
thereof or a fragment thereof. The present invention thus also
embodies isolated, purified, and recombinant polypeptides
comprising, consisting essentially of or consisting of a contiguous
span of at least 6 amino acids, preferably at least 8 to 10 amino
acids, more preferably at least 12, 15, 20, 25, 30, 40, 50, 70, 80
or 90 amino acids of a sequence comprising amino acid positions 1
to 90 of SEQ ID NO: 7. In another aspect, a THAP-5 polypeptide may
comprise a THAP domain wherein at least about 95%, 90%, 85%,
50-80%, preferably at least about 60-70%, more preferably at least
about 65% of the amino acid residues are identical or similar amino
acids--to the THAP domain consensus domain (SEQ ID NOs: 1-2). Also
encompassed by the present invention are isolated, purified,
nucleic acids encoding a THAP-5 polypeptide comprising, consisting
essentially of, or consisting of a THAP domain at amino acid
positions 1 to 90 shown in SEQ ID NO: 7, or fragments or variants
thereof.
[0481] In a preferred embodiment, the THAP-6 protein comprises,
consists essentially of, or consists of a THAP-6 THAP domain,
preferably having the amino acid sequence of amino acid positions 1
to 90 shown in SEQ ID NO: 8, or fragments or variants thereof. The
invention also concerns the polypeptide encoded by the THAP-6
nucleotide sequences of the invention, or a complementary sequence
thereof or a fragment thereof. The present invention thus also
embodies isolated, purified, and recombinant polypeptides
comprising, consisting essentially of or consisting of a contiguous
span of at least 6 amino acids, preferably at least 8 to 10 amino
acids, more preferably at least 12, 15, 20, 25, 30, 40, 50, 70, 80
or 90 amino acids of a sequence comprising amino acid positions 1
to 90 of SEQ ID NO: 8. In another aspect, a THAP-6 polypeptide may
comprise a THAP domain wherein at least about 95%, 90%, 85%,
50-80%, preferably at least about 60-70%, more preferably at least
about 65% of the amino acid residues are identical or similar amino
acids--to the THAP domain consensus domain (SEQ ID NOs: 1-2). Also
encompassed by the present invention are isolated, purified,
nucleic acids encoding a THAP-6 polypeptide comprising, consisting
essentially of, or consisting of a THAP domain at amino acid
positions 1 to 90 shown in SEQ ID NO: 8, or fragments or variants
thereof.
[0482] In a preferred embodiment, the THAP-7 protein comprises,
consists essentially of, or consists of a THAP-7 THAP domain,
preferably having the amino acid sequence of amino acid positions 1
to 90 shown in SEQ ID NO: 9, or fragments or variants thereof. The
invention also concerns the polypeptide encoded by the THAP-7
nucleotide sequences of the invention, or a complementary sequence
thereof or a fragment thereof. The present invention thus also
embodies isolated, purified, and recombinant polypeptides
comprising, consisting essentially of or consisting of a contiguous
span of at least 6 amino acids, preferably at least 8 to 10 amino
acids, more preferably at least 12, 15, 20, 25, 30, 40, 50, 70, 80
or 90 amino acids of a sequence comprising amino acid positions 1
to 90 of SEQ ID NO: 9. In another aspect, a THAP-7 polypeptide may
comprise a THAP domain wherein at least about 95%, 90%, 85%,
50-80%, preferably at least about 60-70%, more preferably at least
about 65% of the amino acid residues are identical or similar amino
acids--to the THAP domain consensus domain (SEQ ID NOs: 1-2). Also
encompassed by the present invention are isolated, purified,
nucleic acids encoding a THAP-7 polypeptide comprising, consisting
essentially of, or consisting of a THAP domain at amino acid
positions 1 to 90 shown in SEQ ID NO: 9, or fragments or variants
thereof.
[0483] In a preferred embodiment, the THAP-8 protein comprises,
consists essentially of, or consists of a THAP-8 THAP domain,
preferably having the amino acid sequence of amino acid positions 1
to 92 shown in SEQ ID NO: 10, or fragments or variants thereof. The
invention also concerns the polypeptide encoded by the THAP-8
nucleotide sequences of the invention, or a complementary sequence
thereof or a fragment thereof. The present invention thus also
embodies isolated, purified, and recombinant polypeptides
comprising, consisting essentially of or consisting of a contiguous
span of at least 6 amino acids, preferably at least 8 to 10 amino
acids, more preferably at least 12, 15, 20, 25, 30, 40, 50, 70, 80
or 90 amino acids of a sequence comprising amino acid positions 1
to 92 of SEQ ID NO: 10. In another aspect, a THAP-8 polypeptide may
comprise a THAP domain wherein at least about 95%, 90%, 85%,
50-80%, preferably at least about 60-70%, more preferably at least
about 65% of the amino acid residues are identical or similar amino
acids--to the THAP domain consensus domain (SEQ ID NOs: 1-2). Also
encompassed by the present invention are isolated, purified,
nucleic acids encoding a THAP-8 polypeptide comprising, consisting
essentially of, or consisting of a THAP domain at amino acid
positions 1 to 92 shown in SEQ ID NO: 10, or fragments or variants
thereof.
[0484] In a preferred embodiment, the THAP-9 protein comprises,
consists essentially of, or consists of a THAP-9 THAP domain,
preferably having the amino acid sequence of amino acid positions 1
to 92 shown in SEQ ID NO: 11, or fragments or variants thereof. The
invention also concerns the polypeptide encoded by the THAP-9
nucleotide sequences of the invention, or a complementary sequence
thereof or a fragment thereof. The present invention thus also
embodies isolated, purified, and recombinant polypeptides
comprising, consisting essentially of or consisting of a contiguous
span of at least 6 amino acids, preferably at least 8 to 10 amino
acids, more preferably at least 12, 15, 20, 25, 30, 40, 50, 70, 80
or 90 amino acids of a sequence comprising amino acid positions 1
to 92 of SEQ ID NO: 11. In another aspect, a THAP-9 polypeptide may
comprise a THAP domain wherein at least about 95%, 90%, 85%,
50-80%, preferably at least about 60-70%, more preferably at least
about 65% of the amino acid residues are identical or similar amino
acids--to the THAP domain consensus domain (SEQ ID NOs: 1-2). Also
encompassed by the present invention are isolated, purified,
nucleic acids encoding a THAP-9 polypeptide comprising, consisting
essentially of, or consisting of a THAP domain at amino acid
positions 1 to 92 shown in SEQ ID NO: 11, or fragments or variants
thereof.
[0485] In a preferred embodiment, the THAP10 protein comprises,
consists essentially of, or consists of a THAP10 THAP domain,
preferably having the amino acid sequence of amino acid positions 1
to 90 shown in SEQ ID NO: 12, or fragments or variants thereof. The
invention also concerns the polypeptide encoded by the THAP10
nucleotide sequences of the invention, or a complementary sequence
thereof or a fragment thereof. The present invention thus also
embodies isolated, purified, and recombinant polypeptides
comprising, consisting essentially of or consisting of a contiguous
span of at least 6 amino acids, preferably at least 8 to 10 amino
acids, more preferably at least 12, 15, 20, 25, 30, 40, 50, 70, 80
or 90 amino acids of a sequence comprising amino acid positions 1
to 90 of SEQ ID NO: 12. In another aspect, a THAP10 polypeptide may
comprise a THAP domain wherein at least about 95%, 90%, 85%,
50-80%, preferably at least about 60-70%, more preferably at least
about 65% of the amino acid residues are identical or similar amino
acids--to the THAP domain consensus domain (SEQ ID NOs: 1-2). Also
encompassed by the present invention are isolated, purified,
nucleic acids encoding a THAP10 polypeptide comprising, consisting
essentially of, or consisting of a THAP domain at amino acid
positions 1 to 90 shown in SEQ ID NO: 12, or fragments or variants
thereof.
[0486] In a preferred embodiment, the THAP11 protein comprises,
consists essentially of, or consists of a THAP11 THAP domain,
preferably having the amino acid sequence of amino acid positions 1
to 90 shown in SEQ ID NO: 13, or fragments or variants thereof. The
invention also concerns the polypeptide encoded by the THAP11
nucleotide sequences of the invention, or a complementary sequence
thereof or a fragment thereof. The present invention thus also
embodies isolated, purified, and recombinant polypeptides
comprising, consisting essentially of or consisting of a contiguous
span of at least 6 amino acids, preferably at least 8 to 10 amino
acids, more preferably at least 12, 15, 20, 25, 30, 40, 50, 70, 80
or 90 amino acids of a sequence comprising amino acid positions 1
to 90 of SEQ ID NO: 13. In another aspect, a THAP11 polypeptide may
comprise a THAP domain wherein at least about 95%, 90%, 85%,
50-80%, preferably at least about 60-70%, more preferably at least
about 65% of the amino acid residues are identical or similar amino
acids--to the THAP domain consensus domain (SEQ ID NOs: 1-2). Also
encompassed by the present invention are isolated, purified,
nucleic acids encoding a THAP11 polypeptide comprising, consisting
essentially of, or consisting of a THAP domain at amino acid
positions 1 to 90 shown in SEQ ID NO: 13, or fragments or variants
thereof.
[0487] In a preferred embodiment, the THAP-0 protein comprises,
consists essentially of, or consists of a THAP-0 THAP domain,
preferably having the amino acid sequence of amino acid positions 1
to 90 shown in SEQ ID NO: 14, or fragments or variants thereof. The
invention also concerns the polypeptide encoded by the THAP-0
nucleotide sequences of the invention, or a complementary sequence
thereof or a fragment thereof. The present invention thus also
embodies isolated, purified, and recombinant polypeptides
comprising, consisting essentially of or consisting of a contiguous
span of at least 6 amino acids, preferably at least 8 to 10 amino
acids, more preferably at least 12, 15, 20, 25, 30, 40, 50, 70, 80
or 90 amino acids of a sequence comprising amino acid positions 1
to 90 of SEQ ID NO: 14. In another aspect, a THAP-0 polypeptide may
comprise a THAP domain wherein at least about 95%, 90%, 85%,
50-80%, preferably at least about 60-70%, more preferably at least
about 65% of the amino acid residues are identical or similar amino
acids--to the THAP domain consensus domain (SEQ ID NOs: 1-2). Also
encompassed by the present invention are isolated, purified,
nucleic acids encoding a THAP-0 polypeptide comprising, consisting
essentially of, or consisting of a THAP domain at amino acid
positions 1 to 90 shown in SEQ ID NO: 14, or fragments or variants
thereof.
[0488] In other embodiments, the THAP-2 to THAP11 or THAP-0 protein
is substantially homologous to the sequences of SEQ ID NOs: 4-14,
17-21, 23-40, 42-56, 58-98 or 100-114 and retains the functional
activity of the THAP-2 to THAP11 or THAP-0 protein, yet differs in
amino acid sequence due to natural allelic variation or
mutagenesis, as described further herein. Accordingly, in another
embodiment, the THAP-2 to THAP11 or THAP-0 protein is a protein
which comprises an amino acid sequence that shares more than about
60% but less than 100% homology with the amino acid sequence of SEQ
ID NOs: 4-14, 17-21, 23-40, 42-56, 58-98 or 100-114 and retains the
functional activity of the THAP-2 to THAP11 or THAP-0 proteins of
SEQ ID NOs: 4-14, 17-21, 23-40, 42-56, 58-98 or 100-114,
respectively. Preferably, the protein is at least about 30%, 40%,
50%, 60%, 70%, 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or 99.8%
homologous to SEQ ID NOs: 4-14, 17-21, 23-40, 42-56, 58-98 or
100-114, but is not identical to SEQ ID NOs: 4-14, 17-21, 23-40,
42-56, 58-98 or 100-114. Preferably the THAP-2 to THAP11 or THAP-0
is less than identical (e.g. 100% identity) to a naturally
occurring THAP-2 to THAP11 or THAP-0. Percent homology can be
determined as further detailed above.
Assessing Polypeptides, Methods for Obtaining Variant Nucleic Acids
and Polypeptides
[0489] It will be appreciated that by characterizing the function
of THAP-family polypeptides, the invention further provides methods
of testing the activity of, or obtaining, functional fragments and
variants of THAP-family and THAP domain nucleotide sequences
involving providing a variant or modified THAP-family or THAP
domain nucleic acid and assessing whether a polypeptide encoded
thereby displays a THAP-family activity of the invention.
Encompassed is thus a method of assessing the function of a
THAP-family or THAP domain polypeptide comprising: (a) providing a
THAP family or THAP domain polypeptide, or a biologically active
fragment or homologue thereof; and (b) testing said THAP family or
THAP domain polypeptide, or a biologically active fragment or
homologue thereof for a THAP-family activity. Any suitable format
may be used, including cell free, cell-based and in vivo formats.
For example, said assay may comprise expressing a THAP-family or
THAP domain nucleic acid in a host cell, and observing THAP-family
activity in said cell. In another example, a THAP family or THAP
domain polypeptide, or a biologically active fragment or homologue
thereof is introduced to a cell, and a THAP-family activity is
observed. THAP-family activity may be any activity as described
herein, including. (1) mediating apoptosis or cell proliferation
when expressed or introduced into a cell, most preferably inducing
or enhancing apoptosis, and/or most preferably reducing cell
proliferation; (2) mediating apoptosis or cell proliferation of an
endothelial cell; (3) mediating apoptosis or cell proliferation of
a hyperproliferative cell; (4) mediating apoptosis or cell
proliferation of a CNS cell, preferably a neuronal or glial cell;
or (5) an activity determined in an animal selected from the group
consisting of mediating, preferably inhibiting angiogenesis,
mediating, preferably inhibiting inflammation, inhibition of
metastatic potential of cancerous tissue, reduction of tumor
burden, increase in sensitivity to chemotherapy or radiotherapy,
killing a cancer cell, inhibition of the growth of a cancer cell,
or induction of tumor regression.
[0490] In addition to naturally-occurring allelic variants of the
THAP-family or THAP domain sequences that may exist in the
population, the skilled artisan will appreciate that changes can be
introduced by mutation into the nucleotide sequences of SEQ ID NOs:
160-171, thereby leading to changes in the amino acid sequence of
the encoded THAP-family or THAP domain proteins, with or without
altering the functional ability of the THAP-family or THAP domain
proteins.
[0491] Several types of variants are contemplated including 1) one
in which one or more of the amino acid residues are substituted
with a conserved or non-conserved amino acid residue and such
substituted amino acid residue may or may not be one encoded by the
genetic code, or 2) one in which one or more of the amino acid
residues includes a substituent group, or 3) one in which the
mutated THAP-family or THAP domain polypeptide is fused with
another compound, such as a compound to increase the half-life of
the polypeptide (for example, polyethylene glycol), or 4) one in
which the additional amino acids are fused to the mutated
THAP-family or THAP domain polypeptide, such as a leader or
secretory sequence or a sequence which is employed for purification
of the mutated THAP-family or THAP domain polypeptide or a
preprotein sequence. Such variants are deemed to be within the
scope of those skilled in the art.
[0492] For example, nucleotide substitutions leading to amino acid
substitutions can be made in the sequences of SEQ ID NOs: 160-175
that do not substantially change the biological activity of the
protein. An amino acid residue-can be altered from the wild-type
sequence encoding a THAP family or THAP domain polypeptide, or a
biologically active fragment or homologue thereof without altering
the biological activity. In general, amino acid residues that are
conserved among the THAP-family of THAP domain-containing proteins
of the present invention, are predicted to be less amenable to
alteration. Furthermore, additional conserved amino acid residues
may be amino acids that are conserved between the THAP-family
proteins of the present invention.
[0493] In one aspect, the invention pertains to nucleic acid
molecules encoding THAP family or THAP domain polypeptides, or
biologically active fragments or homologues thereof that contain
changes in amino acid residues that are not essential for activity.
Such THAP-family proteins differ in amino acid sequence from SEQ ID
NOs: 1-114 yet retain biological activity. In one embodiment, the
isolated nucleic acid molecule comprises a nucleotide sequence
encoding a protein, wherein the protein comprises an amino acid
sequence at least about 60% homologous to an amino acid sequence
selected from the group consisting of SEQ ID NOs: 1-114.
Preferably, the protein encoded by the nucleic acid molecule is at
least about 65-70% homologous to an amino acid sequence selected
from the group consisting of SEQ ID NOs: 1-114, more preferably
sharing at least about 75-80% identity with an amino acid sequence
selected from the group consisting of SEQ ID NOs: 1-114, even more
preferably sharing at least about 85%, 90%, 92%, 95%, 97%, 98%, 99%
or 99.8% identity with an amino acid sequence selected from the
group consisting of SEQ ID NOs: 1-114.
[0494] In another aspect, the invention pertains to nucleic acid
molecules encoding THAP-family proteins that contain changes in
amino acid residues that result in increased biological activity,
or a modified biological activity. In another aspect, the invention
pertains to nucleic acid molecules encoding THAP-family proteins
that contain changes in amino acid residues that are essential for
a THAP-family activity. Such THAP-family proteins differ in amino
acid sequence from SEQ ID NOs: 1-114 and display reduced or
essentially lack one or more THAP-family biological activities. The
invention also encompasses a THAP family or THAP domain
polypeptide, or a biologically active fragment or homologue thereof
which may be useful as dominant negative mutant of a THAP family or
THAP domain polypeptide.
[0495] An isolated nucleic acid molecule encoding a THAP family or
THAP domain polypeptide, or a biologically active fragment or
homologue thereof homologous to a protein of any one of SEQ ID NOs:
1-114 can be created by introducing one or more nucleotide
substitutions, additions or deletions into the nucleotide sequence
of SEQ ID NOs: 1-114 such that one or more amino acid
substitutions, additions or deletions are introduced into the
encoded protein. Mutations can be introduced into any of SEQ ID
NOs: 1-114, by standard techniques, such as site-directed
mutagenesis and PCR-mediated mutagenesis. For example, conservative
amino acid substitutions may be made at one or more predicted
non-essential amino acid residues. A "conservative amino acid
substitution" is one in which the amino acid residue is replaced
with an amino acid residue having a similar side chain. Families of
amino acid residues having similar side chains have been defined in
the art. These families include amino acids with basic side chains
(e.g., lysine, arginine, histidine), acidic side chains (e.g.,
aspartic acid, glutamic acid), uncharged polar side chains (e.g.,
glycine, asparagine, glutamine, serine, threonine, tyrosine,
cysteine), nonpolar side chains (e.g., alanine, valine, leucine,
isoleucine, proline, phenylalanine, methionine, tryptophan),
beta-branched side chains (e.g., threonine, valine, isoleucine) and
aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan,
histidine). Thus, a predicted nonessential amino acid residue in a
THAP family or THAP domain polypeptide, or a biologically active
fragment or homologue thereof may be replaced with another amino
acid residue from the same side chain family. Alternatively, in
another embodiment, mutations can be introduced randomly along all
or part of a THAP-family or THAP domain coding sequence, such as by
saturation mutagenesis, and the resultant mutants can be screened
for THAP-family biological activity to identify mutants that retain
activity. Following mutagenesis of one of SEQ ID NOs: 1-114, the
encoded protein can be expressed recombinantly and the activity of
the protein can be determined.
[0496] In a preferred embodiment, a mutant THAP family or THAP
domain polypeptide, or a biologically active fragment or homologue
thereof encoded by a THAP family or THAP domain polypeptide, or a
biologically active fragment or homologue thereof of THAP domain
nucleic acid of the invention can be assayed for a THAP-family
activity in any suitable assay, examples of which are provided
herein.
[0497] The invention also provides THAP-family or THAP domain
chimeric or fusion proteins. As used herein, a THAP-family or THAP
domain "chimeric protein" or "fusion protein" comprises a
THAP-family or THAP domain polypeptide of the invention operatively
linked, preferably fused in frame, to a non-THAP-family or non-THAP
domain polypeptide. In a preferred embodiment, a THAP-family or
THAP domain fusion protein comprises at least one biologically
active portion of a THAP-family or THAP domain protein. In another
preferred embodiment, a THAP-family fusion protein comprises at
least two biologically active portions of a THAP-family protein.
For example, in one embodiment, the fusion protein is a
GST-THAP-family fusion protein in which the THAP-family sequences
are fused to the C-terminus of the GST sequences. Such fusion
proteins can facilitate the purification of recombinant THAP-family
polypeptides. In another embodiment, the fusion protein is a
THAP-family protein containing a heterologous signal sequence at
its N-terminus, such as for example to allow for a desired cellular
localization in a certain host cell.
[0498] The THAP-family or THAP domain fusion proteins of the
invention can be incorporated into pharmaceutical compositions and
administered to a subject in vivo. Moreover, the THAP-family-fusion
or THAP domain proteins of the invention can be used as immunogens
to produce anti-THAP-family or anti or THAP domain antibodies in a
subject, to purify THAP-family or THAP domain ligands and in
screening assays to identify molecules which inhibit the
interaction of THAP-family or THAP domain with a THAP-family or
THAP domain target molecule.
[0499] Furthermore, isolated peptidyl portions of the subject
THAP-family or THAP domain proteins can also be obtained by
screening peptides recombinantly produced from the corresponding
fragment of the nucleic acid encoding such peptides. In addition,
fragments can be chemically synthesized using techniques known in
the art such as conventional Merrifield solid phase f-Moc or t-Boc
chemistry. For example, a THAP-family or THAP domain protein of the
present invention may be arbitrarily divided into fragments of
desired length with no overlap of the fragments, or preferably
divided into overlapping fragments of a desired length. The
fragments can be produced (recombinantly or by chemical synthesis)
and tested to identify those peptidyl fragments which can function
as either agonists or antagonists of a THAP-family protein
activity, such as by microinjection assays or in vitro protein
binding assays. In an illustrative embodiment, peptidyl portions of
a THAP-family protein, such as a THAP domain or a THAP-family
target binding region (e.g. PAR4 in the case of THAP1, THAP-2 and
THAP-3), can be tested for THAP-family activity by expression as
thioredoxin fusion proteins, each of which contains a discrete
fragment of the THAP-family protein (see, for example, U.S. Pat.
Nos. 5,270,181 and 5,292,646; and PCT publication WO94/02502, the
disclosures of which are incorporated herein by reference).
[0500] The present invention also pertains to variants of the
THAP-family or THAP domain proteins which function as either
THAP-family or THAP domain mimetics or as THAP-family or THAP
domain inhibitors. Variants of the THAP-family or THAP domain
proteins can be generated by mutagenesis, e.g., discrete point
mutation or truncation of a THAP-family or THAP domain protein. An
agonist of a THAP-family or THAP domain protein can retain
substantially the same, or a subset, of the biological activities
of the naturally occurring form of a THAP-family or THAP domain
protein. An antagonist of a THAP-family or THAP domain protein can
inhibit one or more of the activities of the naturally occurring
form of the THAP-family or THAP domain protein by, for example,
competitively inhibiting the association of a THAP-family or THAP
domain protein with a THAP-family target molecule. Thus, specific
biological effects can be elicited by treatment with a variant of
limited function. In one embodiment, variants of a THAP-family or
THAP domain protein which function as either THAP-family or THAP
domain agonists (mimetics) or as THAP-family or THAP domain
antagonists can be identified by screening combinatorial libraries
of mutants, e.g., truncation mutants, of a THAP-family or THAP
domain protein for THAP-family or THAP domain protein agonist or
antagonist activity. In one embodiment, a variegated library of
THAP-family variants is generated by combinatorial mutagenesis at
the nucleic acid level and is encoded by a variegated gene library.
A variegated library of THAP-family variants can be produced by,
for example, enzymatically ligating a mixture of synthetic
oligonucleotides into gene sequences such that a degenerate set of
potential THAP-family sequences is expressible as individual
polypeptides, or alternatively, as a set of larger fusion proteins
(e.g., for phage display) containing the set of THAP-family
sequences therein. There are a variety of methods which can be used
to produce libraries of potential THAP-family variants from a
degenerate oligonucleotide sequence. Chemical synthesis of a
degenerate gene sequence can be performed in an automatic DNA
synthesizer, and the synthetic gene then ligated into an
appropriate expression vector. Use of a degenerate set of genes
allows for the provision, in one mixture, of all of the sequences
encoding the desired set of potential THAP-family sequences.
[0501] In addition, libraries of fragments of a THAP-family or THAP
domain protein coding sequence can be used to generate a variegated
population of THAP-family or THAP domain fragments for screening
and subsequent selection of variants of a THAP-family or THAP
domain protein. In one embodiment, a library of coding sequence
fragments can be generated by treating a double stranded PCR
fragment of a THAP-family coding sequence with a nuclease under
conditions wherein nicking occurs only about once per molecule,
denaturing the double stranded DNA, renaturing the DNA to form
double stranded DNA which can include sense/antisense pairs from
different nicked products, removing single stranded portions from
reformed duplexes by treatment with S1 nuclease, and ligating the
resulting fragment library into an expression vector. By this
method, an expression library can be derived which encodes
N-terminal, C-terminal and internal fragments of various sizes of
the THAP-family protein.
[0502] Modified THAP-family or THAP domain proteins can be used for
such purposes as enhancing therapeutic or prophylactic efficacy, or
stability (e.g., ex vivo shelf life and resistance to proteolytic
degradation in vivo). Such modified peptides, when designed to
retain at least one activity of the naturally occurring form of the
protein, are considered functional equivalents of the THAP-family
or THAP domain protein described in more detail herein. Such
modified peptide can be produced, for instance, by amino acid
substitution, deletion, or addition.
[0503] Whether a change in the amino acid sequence of a peptide
results in a functional THAP-family or THAP domain homolog (e.g.
functional in the sense that it acts to mimic or antagonize the
wild-type form) can be readily determined by assessing the ability
of the variant peptide to produce a response in cells in a fashion
similar to the wild-type THAP-family or THAP domain protein or
competitively inhibit such a response. Peptides in which more than
one replacement has taken place can readily be tested in the same
manner.
[0504] This invention further contemplates a method of generating
sets of combinatorial mutants of the presently disclosed
THAP-family or THAP domain proteins, as well as truncation and
fragmentation mutants, and is especially useful for identifying
potential variant sequences which are functional in binding to a
THAP-family or THAP domain-target protein but differ from a
wild-type form of the protein by, for example, efficacy, potency
and/or intracellular half-life. One purpose for screening such
combinatorial libraries is, for example, to isolate novel
THAP-family or THAP domain homologs which function as either an
agonist or an antagonist of the biological activities of the
wild-type protein, or alternatively, possess novel activities all
together. For example, mutagenesis can give rise to THAP-family
homologs which have intracellular half-lives dramatically different
than the corresponding wild-type protein. The altered protein can
be rendered either more stable or less stable to proteolytic
degradation or other cellular process which result in destruction
of, or otherwise inactivation of, a THAP-family protein. Such
THAP-family homologs, and the genes which encode them, can be
utilized to alter the envelope of expression for a particular
recombinant THAP-family protein by modulating the half-life of the
recombinant protein. For instance, a short half-life can give rise
to more transient biological effects associated with a particular
recombinant THAP-family protein and, when part of an inducible
expression system, can allow tighter control of recombinant protein
levels within a cell. As above, such proteins, and particularly
their recombinant nucleic acid constructs, can be used in gene
therapy protocols.
[0505] In an illustrative embodiment of this method, the amino acid
sequences for a population of THAP-family homologs or other related
proteins are aligned, preferably to promote the highest homology
possible. Such a population of variants can include, for example,
THAP-family homologs from one or more species, or THAP-family
homologs from the same species but which differ due to mutation.
Amino acids which appear at each position of the aligned sequences
are selected to create a degenerate set of combinatorial sequences.
There are many ways by which the library of potential THAP-family
homologs can be generated from a degenerate oligonucleotide
sequence. Chemical synthesis of a degenerate gene sequence can be
carried out in an automatic DNA synthesizer, and the synthetic
genes then be ligated into an appropriate gene for expression. The
purpose of a degenerate set of genes is to provide, in one mixture,
all of the sequences encoding the desired set of potential
THAP-family sequences. The synthesis of degenerate oligonucleotides
is well known in the art (see for example. Narang, S A (1983)
Tetrahedron 393; Itakura et al. (1981) Recombinant DNA, Proc 3rd
Cleveland Sympos. Macromolecules, ed. AG Walton, Amsterdam:
Elsevier pp. 273-289; Itakura et al. (1984) Annu. Rev. Biochem.
53:323; Itakura et al. (1984) Science 198:1056; Ike et al. (1983)
Nucleic Acid Res. 11:477. Such techniques have been employed in the
directed evolution of other proteins (see, for example, Scott et
al. (1990) Science 249:386-390; Roberts et al. (1992) PNAS
89:2429-2433; Devlin et al. (1990) Science 249: 404-406; Cwirla et
al. (1990) PNAS 87: 6378-6382; as well as U.S. Pat. Nos. 5,223,409,
5,198,346, and 5,096,815). The disclosures of the above references
are incorporated herein by reference in their entireties.
[0506] Alternatively, other forms of mutagenesis can be utilized to
generate a combinatorial library, particularly where no other
naturally occurring homologs have yet been sequenced. For example,
THAP-family homologs (both agonist and antagonist forms) can be
generated and isolated from a library by screening using, for
example, alanine scanning mutagenesis and the like (Ruf et al.
(1994) Biochemistry 33:1565-1572; Wang et al. (1994) J. Biol. Chem.
269:3095-3099; Balint et al. (1993) Gene 137:109-118; Grodberg et
al. (1993) Eur. J. Biochem. 218:597-601; Nagashima et al. (1993) J.
Biol. Chem. 268:2888-2892; Lowman et al. (1991) Biochemistry
30:10832-10838; and Cunningham et al. (1989) Science
244:1081-1085), by linker scanning mutagenesis (Gustin et al.
(1993) Virology 193:653-660; Brown et al. (1992) Mol. Cell Biol.
12:2644 2652; McKnight et al. (1982) Science 232:316); by
saturation mutagenesis (Meyers et al. (1986) Science 232:613); by
PCR mutagenesis (Leung et al. (1989) Method Cell Mol Biol 1:1-19);
or by random mutagenesis (Miller et al. (1992) A Short Course in
Bacterial Genetics, CSHL Press, Cold Spring Harbor, N.Y.; and
Greener et al. (1994) Strategies in Mol Biol 7:32-34, the
disclosures of which are incorporated herein by reference in their
entireties).
[0507] A wide range of techniques are known in the art for
screening gene products of combinatorial libraries made by point
mutations, as well as for screening cDNA libraries for gene
products having a certain property. Such techniques will be
generally adaptable for rapid screening of the gene libraries
generated by the combinatorial mutagenesis of THAP-family proteins.
The most widely used techniques for screening large gene libraries
typically comprises cloning the gene library into replicable
expression vectors, transforming appropriate cells with the
resulting library of vectors, and expressing the combinatorial
genes under conditions in which detection of a desired activity
facilitates relatively easy isolation of the vector encoding the
gene whose product was detected.
[0508] Each of the illustrative assays described below are amenable
to high through-put analysis as necessary to screen large numbers
of degenerate THAP-family or THAP domain sequences created by
combinatorial mutagenesis techniques. In one screening assay, the
candidate gene products are displayed on the surface of a cell or
viral particle, and the ability of particular cells or viral
particles to bind a THAP-family target molecule (protein or DNA)
via this gene product is detected in a "panning assay". For
instance, the gene library can be cloned into the gene for a
surface membrane protein of a bacterial cell, and the resulting
fusion protein detected by panning (Ladner et al., WO 88/06630;
Fuchs et al. (1991) BiolTechnology 9:1370-1371, and Goward et al.
(1992) TIBS18:136 140). In a similar fashion, fluorescently labeled
THAP-family target can be used to score for potentially functional
THAP-family homologs. Cells can be visually inspected and separated
under a fluorescence microscope, or, where the morphology of the
cell permits, separated by a fluorescence-activated cell
sorter.
[0509] In an alternate embodiment, the gene library is expressed as
a fusion protein on the surface of a viral particle. For instance,
in the filamentous phage system, foreign peptide sequences can be
expressed on the surface of infectious phage, thereby conferring
two significant benefits. First, since these phage can be applied
to affinity matrices at very high concentrations, a large number of
phage can be screened at one time. Second, since each infectious
phage displays the combinatorial gene product on its surface, if a
particular phage is recovered from an affinity matrix in low yield,
the phage can be amplified by another round of infection. The group
of almost identical E. coli filamentous phages M13, fd, and fl are
most often used in phage display libraries, as either of the phage
gI11 or gVIII coat proteins can be used to generate fusion proteins
without disrupting the ultimate packaging of the viral particle
(Ladner et al. PCT publication WO 90/02909; Garrard et al., PCT
publication WO 92/09690; Marks et al. (1992) J. Biol. Chem.
267:16007-16010; Griffiths et al. (1993) EMBO J. 12:725-734;
Clackson et al. (1991) Nature 352:624-628; and Barbas et al. (1992)
PNAS 89:4457 4461, the disclosures of which are incorporated herein
by reference in their entireties). In an illustrative embodiment,
the recombinant phage antibody system (RPAS, Pharmacia Catalog
number 27-9400-01) can be easily modified for use in expressing
THAP-family combinatorial libraries, and the THAP-family phage
library can be panned on immobilized THAP family target molecule
(glutathione immobilized THAP-family target-GST fusion proteins or
immobilized DNA). Successive rounds of phage amplification and
panning can greatly enrich for THAP-family homologs which retain an
ability to bind a THAP-family target and which can subsequently be
screened further for biological activities in automated assays, in
order to distinguish between agonists and antagonists.
[0510] The invention also provides for identification and reduction
to functional minimal size of the THAP-family domains, particularly
a THAP domain of the subject THAP-family to generate mimetics, e.g.
peptide or non-peptide agents, which are able to disrupt binding of
a polypeptide of the present invention with a THAP-family target
molecule (protein or DNA). Thus, such mutagenic techniques as
described above are also useful to map the determinants of
THAP-family proteins which participate in protein-protein or
protein-DNA interactions involved in, for example, binding to a
THAP-family or THAP domain target protein or DNA. To illustrate,
the critical residues of a THAP-family protein which are involved
in molecular recognition of the THAP-family target can be
determined and used to generate THAP-family target-13P-derived
peptidomimetics that competitively inhibit binding of the
THAP-family protein to the THAP-family target. By employing, for
example, scanning mutagenesis to map the amino acid residues of a
particular THAP-family protein involved in binding a THAP-family
target, peptidomimetic compounds can be generated which mimic those
residues in binding to a THAP-family target, and which, by
inhibiting binding of the THAP-family protein to the THAP-family
target molecule, can interfere with the function of a THAP-family
protein in transcriptional regulation of one or more genes. For
instance, non hydrolyzable peptide analogs of such residues can be
generated using retro-inverse peptides (e.g., see U.S. Pat. Nos.
5,116,947 and 5,219,089; and Pallai et al. (1983) Int J Pept
Protein Res 21:84-92), benzodiazepine (e.g., see Freidinger et al.
in Peptides: Chemistry and Biology, G. R. Marshall ed., ESCOM
Publisher: Leiden, Netherlands, 1988), azepine (e.g., see Huffman
et al. in Peptides.--Chemistry and Biology, G. R. Marshall ed.,
ESCOM Publisher: Leiden, Netherlands, 1988), substituted gamma
lactam rings (Garvey et al. in Peptides: Chemistry and Biology, G.
R. Marshall ed., ESCOM Publisher: Leiden, Netherlands, 1988),
keto-methylene pseudopeptides (Ewenson et al. (1986) J Med Chem
29:295; and Ewenson et al. in Peptides: Structure and Function
(Proceedings of the 9th American Peptide Symposium) Pierce Chemical
Co. Rockland, Ill., 1985), P-turn dipeptide cores (Nagai et al.
(1985) Tetrahedron Left 26:647; and Sato et al. (1986) J Chem Soc
Perkin Trans 1: 123 1), and P-aminoalcohols (Gordon et al. (1985)
Biochem Biophys Res Commun 126:419; and Dann et al. (1986) Biochem
Biophys Res Commun 134:71, the disclosures of which are
incorporated herein by reference in their entireties).
[0511] An isolated THAP-family or THAP domain protein, or a portion
or fragment thereof, can be used as an immunogen to generate
antibodies that bind THAP-family or THAP domain proteins using
standard techniques for polyclonal and monoclonal antibody
preparation. A full-length THAP-family protein can be used or,
alternatively, the invention provides antigenic peptide fragments
of THAP-family or THAP domain proteins for use as immunogens. Any
fragment of the THAP-family or THAP domain protein which contains
at least one antigenic determinant may be used to generate
antibodies. The antigenic peptide of a THAP-family or THAP domain
protein comprises at least 8 amino acid residues of an amino acid
sequence selected from the group consisting of SEQ ID NOs: 1-114
and encompasses an epitope of a THAP-family or THAP domain protein
such that an antibody raised against the peptide forms a specific
immune complex with a THAP-family or THAP domain protein.
Preferably, the antigenic peptide comprises at least 10 amino acid
residues, more preferably at least 15 amino acid residues, even
more preferably at least 20 amino acid residues, and most
preferably at least 30 amino acid residues.
[0512] Preferred epitopes encompassed by the antigenic peptide are
regions of a THAP-family or THAP domain protein that are located on
the surface of the protein, e.g., hydrophilic regions.
[0513] A THAP-family or THAP domain protein immunogen typically is
used to prepare antibodies by immunizing a suitable subject, (e.g.,
rabbit, goat, mouse or other mammal) with the immunogen. An
appropriate immunogenic preparation can contain, for example,
recombinantly expressed THAP-family or THAP domain protein or a
chemically synthesized THAP-family or THAP domain polypeptide. The
preparation can further include an adjuvant, such as Freund's
complete or incomplete adjuvant, or similar immunostimulatory
agent. Immunization of a suitable subject with an immunogenic
THAP-family or THAP domain protein preparation induces a polyclonal
anti-THAP-family or THAP domain protein antibody response.
[0514] The invention concerns antibody compositions, either
polyclonal or monoclonal, capable of selectively binding, or
selectively bind to an epitope-containing a polypeptide comprising
a contiguous span of at least 6 amino acids, preferably at least 8
to 10 amino acids, more preferably at least 12, 15, 20, 25, 30, 40,
50, 100, or more than 100 amino acids of an amino acid sequence
selected from the group consisting of amino acid positions 1 to
approximately 90 of SEQ ID NOs: 1-114. The invention also concerns
a purified or isolated antibody capable of specifically binding to
a mutated THAP-family or THAP domain protein or to a fragment or
variant thereof comprising an epitope of the mutated THAP-family or
THAP domain protein.
Oligomeric Forms of THAP1
[0515] Certain embodiments of the present invention encompass THAP1
polypeptides in the form of oligomers, such as dimers, trimers, or
higher oligomers. Oligomers may be formed by disulfide bonds
between cysteine residues on different THAP1 polypeptides, for
example. In other embodiments, oligomers comprise from two to four
THAP1 polypeptides joined by covalent or non-covalent interactions
between peptide moieties fused to the THAP1 polypeptides. Such
peptide moieties may be peptide linkers (spacers), or peptides that
have the property of promoting oligomerization. Leucine zippers and
certain polypeptides derived from antibodies are among the peptides
that can promote oligomerization of THAP1 polypeptides attached
thereto. DNA sequences encoding THAP1 oligomers, or fusion proteins
that are components of such oligomers, are provided herein.
[0516] In one embodiment of the invention, oligomeric THAP1 may
comprise two or more THAP1 polypeptides joined through peptide
linkers. Examples include those peptide linkers described in U.S.
Pat. No. 5,073,627, the disclosure of which is incorporated herein
by reference in its entirety. Fusion proteins comprising multiple
THAP1 polypeptides separated by peptide linkers may be produced
using conventional recombinant DNA technology.
[0517] Another method for preparing THAP1 oligomers involves use of
a leucine zipper. Leucine zipper domains are peptides that promote
oligomerization of the proteins in which they are found. Leucine
zippers were originally identified in several DNA-binding proteins
(Landschulz et al., Science 240:1759, 1988), and have since been
found in a variety of different proteins. Among the known leucine
zippers are naturally occurring peptides and derivatives thereof
that dimerize or trimerize. Examples of leucine zipper domains
suitable for producing THAP1 oligomers are those described
International Publication WO 94/10308, the disclosure of which is
incorporated herein by reference in its entirety. Recombinant
fusion proteins comprising a THAP1 polypeptide fused to a peptide
that dimerizes or trimerizes in solution are expressed in suitable
host cells, and the resulting soluble oligomeric THAP1 is recovered
from the culture supernatant.
[0518] In some embodiments of the invention, a THAP1 dimer is
created by fusing THAP1 to an Fc region polypeptide derived from an
antibody, in a manner that does not substantially affect the
binding of THAP1 to the chemokine SLC/CCL21. Preparation of fusion
proteins comprising heterologous polypeptides fused to various
portions of antibody-derived polypeptides (including Fc region) has
been described, e.g., by Ashkenazi et al. (1991) PNAS 88:10535,
Byrn et al. (1990) Nature 344:667, and Hollenbaugh and Aruffo
"Construction of Immunoglobulin Fusion Proteins", in Current
Protocols in Immunology, Supp. 4, pages 10.19.1-10.19-11, 1992, the
disclosures of which are incorporated herein by reference in their
entireties. The THAP1/Fc fusion proteins are allowed to assemble
much like antibody molecules, whereupon interchain disulfide bonds
form between Fc polypeptides, yielding divalent THAP1. Similar
fusion proteins of TNF receptors and Fc (see for example Moreland
et al. (1997) N. Engl. J. Med. 337(3): 141-147; van der Poll et al.
(1997) Blood 89(10):3727-3734; and Ammann et al. (1997) J. Clin.
Invest. 99(7):1699-1703) have been used successfully for treating
rheumatoid arthritis. Soluble derivatives have also been made of
cell surface glycoproteins in the immunoglobulin gene superfamily
consisting of an extracellular domain of the cell surface
glycoprotein fused to an immunoglobulin constant (Fc) region (see
e.g., Capon, D. J. et al. (1989) Nature 337:525-531 and Capon U.S.
Pat. Nos. 5,116,964 and 5,428,130 [CD4-IgG1 constructs]; Linsley,
P. S. et al. (1991) J. Exp. Med. 173:721-730 [a CD28-IgG1 construct
and a B7-1-IgG1 construct]; and Linsley, P. S. et al. (1991) J.
Exp. Med. 174:561-569 and U.S. Pat. No. 5,434,131 [a CTLA4-IgG1],
the disclosures of which are incorporated herein by reference in
their entirety). Such fusion proteins have proven useful for
modulating receptor-ligand interactions.
[0519] Some embodiments relate to THAP-immunoglobulin fusion
proteins and THAP SLC-binding domain fusions with immunoglobulin
molecules or fragments thereof. Such fusions can be produced using
standard methods, for example, by creating an expression vector
encoding the SLC/CCL21 chemokine-binding protein THAP1 fused to the
antibody polypeptide and inserting the vector into a suitable host
cell. One suitable Fc polypeptide is the native Fc region
polypeptide derived from a human IgG1, which is described in
International Publication WO 93/10151, the disclosure of which is
incorporated herein by reference in its entirety. Another useful Fc
polypeptide is the Fc mutein described in U.S. Pat. No. 5,457,035,
the disclosure of which is incorporated herein by reference in its
entirety. The amino acid sequence of the mutein is identical to
that of the native Fc sequence presented in International
Publication WO 93/10151, the disclosure of which is incorporated
herein by reference in its entirety, except that amino acid 19 has
been changed from Leu to Ala, amino acid 20 has been changed from
Leu to Glu, and amino acid 22 has been changed from Gly to Ala.
This mutein Fc exhibits reduced affinity for immunoglobulin
receptors.
[0520] SLC-binding fragments of human THAP1, rather than the full
protein, can also be employed in methods of the invention.
Fragments may be less immunogenic than the corresponding
full-length proteins. The ability of a fragment to bind chemokine
SLC can be determined using a standard assay. Fragments can be
prepared by any of a number of conventional methods. For example, a
desired DNA sequence can be synthesized chemically or produced by
restriction endonuclease digestion of a full length cloned DNA
sequence and isolated by electrophoresis on agarose gels. Linkers
containing restriction endonuclease cleavage sites can be employed
to insert the desired DNA fragment into an expression vector, or
the fragment can be digested at naturally-present cleavage sites.
The polymerase chain reaction (PCR) can also be employed to isolate
a DNA sequence encoding a desired protein fragment.
Oligonucleotides that define the termini of the desired fragment
are used as 5' and 3' primers in the PCR procedure. Additionally,
known mutagenesis techniques can be used to insert a stop codon at
a desired point, e.g., immediately downstream of the codon for the
last amino acid of the desired fragment.
[0521] In other embodiments, THAP1 or a biologically active
fragment thereof, for example, an SLC-binding domain of THAP1 may
be substituted for the variable portion of an antibody heavy or
light chain. If fusion proteins are made with both heavy and light
chains of an antibody, it is possible to form a THAP1 oligomer with
at least two, at least three, at least four, at least five, at
least six, at least seven, at least eight, at least nine, or more
than nine THAP1 polypeptides.
[0522] In some embodiments of the present invention, THAP-SLC
binding can be provided to decrease the biological availability of
SLC or otherwise disrupt the activity of SLC. For example,
THAP-family polypeptides, SLC-binding domains of THAP-family
polypeptides, THAP oligomers, and SLC-binding
domain-THAP1-immunoglobulin fusion proteins of the invention can be
used to interact with SLC thereby preventing it from performing its
normal biological role. In some embodiments, the entire THAP1
polypeptide (SEQ ID NO: 3) can be used to bind to SLC. In other
embodiments, fragments of THAP1, such as the SLC-binding domain of
the THAP1 (amino acids 143-213 of SEQ ID NO: 3) can used to bind to
SLC. Such fragments can be from at least 8, at least 10, at least
12, at least 15, at least 20, at least 25, at least 30, at least
35, at least 40, at least 45, at least 50, at least 55, at least
60, at least 65, at least 70, at least 80, at least 90, at least
100, at least 110, at least 120, at least 130, at least 140, at
least 150, at least 160, at least 170, at least 180, at least 190,
at least 200, at least 210 or at least 213 consecutive amino acids
of SEQ ID NO: 3. In some embodiments, fragments can be from at
least 8, at least 10, at least 12, at least 15, at least 20, at
least 25, at least 30, at least 35, at least 40, at least 45, at
least 50, at least 55, at least 60, at least 65 or at least 70
consecutive amino acids of (amino acids 143-213 of SEQ ID NO: 3).
THAP-family polypeptides that may be capable of binding SLC, for
example THAP2-11 and THAP0 or biologically active fragments thereof
can also be used to bind to SLC so as to decrease its biological
availability or otherwise disrupt the activity of this
chemokine.
[0523] In some embodiments, a plurality of THAP-family proteins,
such as a fusion of two or more THAP1 proteins or fragments thereof
which comprise an SLC-binding domain (amino acids 143-213 of SEQ ID
NO: 3) can be used to bind SLC. For example, oligomers comprising
THAP1 fragments of a size of at least 8, at least 10, at least 12,
at least 15, at least 20, at least 25, at least 30, at least 35, at
least 40, at least 45, at least 50, at least 55, at least 60, at
least 65 or at least 70 consecutive amino acids of SEQ ID NO: 3
(amino acids 143-213) can be generated. Amino acid fragments which
make up the THAP oligomer may be of the same or different lengths.
In some embodiments, the entire THAP1 protein or biologically
active portions thereof may be fused together to form an oligomer
capable of binding to SLC. THAP-family polypeptides that may be
capable of binding SLC, for example THAP2-11 and THAP0, the
THAP-family polypeptides of SEQ ID NOs: 16-114 or biologically
active fragments thereof can also be used to create oligomers which
bind to SLC so as to decrease its biological availability or
otherwise disrupt the activity of this chemokine.
[0524] According to another embodiment of the present invention,
THAP-family proteins, such as THAP1 or portion of THAP1 which
comprise an SLC binding domain (amino acids 143-213 of SEQ ID NO:
3), may be fused to an immunoglobulin or portion thereof. The
portion may be an entire immunoglobulin, such as IgG, IgM, IgA or
IgE. Additionally, portions of immunoglobulins, such as an Fc
domain of the immunoglobulin, can be fused to a THAP-family
polypeptide, such as THAP1, fragments thereof or oligomers thereof.
Fragments of THAP1 can be, for example, at least 8, at least 10, at
least 12, at least 15, at least 20, at least 25, at least 30, at
least 35, at least 40, at least 45, at least 50, at least 55, at
least 60, at least 65 or at least 70 consecutive amino acids of SEQ
ID NO: 3 (amino acids 143-213). In some embodiments, THAP-family
polypeptides that may be capable of binding SLC, for example
THAP2-11 and THAP0, the THAP-family polypeptides of SEQ ID NOs:
16-114 or biologically active fragments thereof can also be used to
form immunoglobulin fusion that bind to SLC so as to decrease its
biological availability or otherwise disrupt the activity of this
chemokine.
[0525] In accordance with another aspect of the invention,
THAP-family polypeptides, SLC-binding domains of THAP-family
polypeptides, THAP oligomers, and SLC-binding
domain-THAP1-immunoglobulin fusion proteins of the invention can be
incorporated into pharmaceutical compositions. Such pharmaceutical
compositions can be used to decrease the bioavailability and
functionality of SLC. For example, THAP-family polypeptides,
SLC-binding domains of THAP-family polypeptides, THAP oligomers,
and SLC-binding domain-THAP1-immunoglobulin fusion proteins of the
present invention can be administered to a subject to inhibit an
interaction between SLC and its receptor, such as CCR7, on the
surface of cells, to thereby suppress SLC-mediated responses. The
inhibition of chemokine SLC may be useful therapeutically for both
the treatment of inflammatory or proliferative disorders, as well
as modulating (e.g., promoting or inhibiting) cell differentiation,
cell proliferation, and/or cell death.
[0526] In an additional embodiment of the present invention, the
THAP-family polypeptides, SLC-binding domains of THAP-family
polypeptides, THAP oligomers, and SLC-binding
domain-THAP1-immunoglobulin fusion proteins of the present
invention can be used to detect the presence of SLC in a biological
sample and in screening assays to identify molecules which inhibit
the interaction of THAP1 with SLC. Such screening assays are
similar to those described below for PAR4-THAP interactions.
[0527] Certain aspects of the present invention related to a method
of identifying a test compound that modulates THAP-mediated
activities. In some cases the THAP-mediated activity is
SLC-binding. Test compounds which affect THAP-SLC binding can be
identified using a screening method wherein a THAP-family
polypeptide or a biologically active fragment thereof is contacted
with a test compound. In some embodiments, the THAP-family
polypeptide comprises an amino acid sequence having at least 30%
amino acid identity to an amino acid sequence of SEQ ID NO: 1 or
SEQ ID NO: 2. Whether the test compound modulates the binding of
SLC with a THAP-family polypeptide, such as THAP1 (SEQ ID NO: 3),
is determined by determining whether the test compound modulates
the activity of the THAP-family polypeptide or biologically active
fragment thereof. Biologically active fragments of a THAP-family
polypeptide may be at least 5, at least 8, at least 10, at least
12, at least 15, at least 18, at least 20, at least 25, at least
30, at least 35, at least 40, at least 45, at least 50, at least
60, at least 70, at least 80, at least 90, at least 100, at least
110, at least 120, at least 130, at least 140, at least 150, at
least 160, at least 170, at least 180, at least 190, at least 200,
at least 210, at least 220 or at least more than 220 amino acids in
length. A determination that the test compound modulates the
activity of said polypeptide indicates that the test compound is a
candidate modulator of THAP-mediated activities.
[0528] Although THAP-family polypeptides, SLC-binding domains of
THAP-family polypeptides, THAP oligomers, and SLC-binding
domain-THAP1-immunoglobulin fusion proteins can be used for the
above-mentioned SLC interactions, it will be appreciated that
homologs of THAP-family polypeptides, SLC-binding domains of
THAP-family polypeptides, THAP oligomers, and SLC-binding
domain-THAP1-immunoglobulin fusion proteins can be used in place of
THAP-family polypeptides, SLC-binding domains of THAP-family
polypeptides, THAP oligomers, and SLC-binding
domain-THAP1-immunoglobulin fusion proteins. For example, homologs
having at least about 30-40% identity, preferably at least about
40-50% identity, more preferably at least about 50-60%, and even
more preferably at least about 60-70%, 70-80%, 80%, 90%, 95%, 97%,
98%, 99% or 99.8% identity across the amino acid sequences of SEQ
ID NOs: 1-114 or portions thereof can be used.
Primers and Probes
[0529] Primers and probes of the invention can be prepared by any
suitable method, including, for example, cloning and restriction of
appropriate sequences and direct chemical synthesis by a method
such as the phosphodiester method of Narang S A et al (Methods
Enzymol 1979; 68:90-98), the phosphodiester method of Brown E L et
al (Methods Enzymol 1979; 68:109-151), the diethylphosphoramidite
method of Beaucage et al (Tetrahedron Lett 1981, 22: 1859-1862) and
the solid support method described in EP 0 707 592, the disclosures
of which are incorporated herein by reference in their
entireties.
[0530] Detection probes are generally nucleic acid sequences or
uncharged nucleic acid analogs such as, for example peptide nucleic
acids which are disclosed in International Patent Application WO
92/20702, morpholino analogs which are described in U.S. Pat. Nos.
5,185,444; 5,034,506 and 5,142,047. If desired, the probe may be
rendered "non-extendable" in that additional dNTPs cannot be added
to the probe. In and of themselves analogs usually are
non-extendable and nucleic acid probes can be rendered
non-extendable by modifying the 3' end of the probe such that the
hydroxyl group is no longer capable of participating in elongation.
For example, the 3' end of the probe can be functionalized with the
capture or detection label to thereby consume or otherwise block
the hydroxyl group.
[0531] Any of the polynucleotides of the present invention can be
labeled, if desired, by incorporating any label known in the art to
be detectable by spectroscopic, photochemical, biochemical,
immunochemical, or chemical means. For example, useful labels
include radioactive substances (including, .sup.32P, .sup.35S,
.sup.3H, .sup.125I), fluorescent dyes (including,
5-bromodesoxyuridin, fluorescein, acetylaminofluorene, digoxigenin)
or biotin. Preferably, polynucleotides are labeled at their 3' and
5' ends. Examples of non-radioactive labeling of nucleic acid
fragments are described in (Urdea et al. (Nucleic Acids Research.
11:4937-4957, 1988) or Sanchez-Pescador et al. (J. Clin. Microbiol.
26(10):1934-1938, 1988). In addition, the probes according to the
present invention may have structural characteristics such that
they allow the signal amplification, such structural
characteristics being, for example, branched DNA probes as those
described by Urdea et al (Nucleic Acids Symp. Ser. 24:197-200,
1991) or in the European patent No. EP 0 225 807 (Chiron).
[0532] A label can also be used to capture the primer, so as to
facilitate the immobilization of either the primer or a primer
extension product, such as amplified DNA, on a solid support. A
capture label is attached to the primers or probes and can be a
specific binding member which forms a binding pair with the solid's
phase reagent's specific binding member (e.g. biotin and
streptavidin). Therefore depending upon the type of label carried
by a polynucleotide or a probe, it may be employed to capture or to
detect the target DNA. Further, it will be understood that the
polynucleotides, primers or probes provided herein, may,
themselves, serve as the capture label. For example, in the case
where a solid phase reagent's binding member is a nucleic acid
sequence, it may be selected such that it binds a complementary
portion of a primer or probe to thereby immobilize the primer or
probe to the solid phase. In cases where a polynucleotide probe
itself serves as the binding member, those skilled in the art will
recognize that the probe will contain a sequence or "tail" that is
not complementary to the target. In the case where a polynucleotide
primer itself serves as the capture label, at least a portion of
the primer will be free to hybridize with a nucleic acid on a solid
phase. DNA labeling techniques are well known to the skilled
technician.
[0533] The probes of the present invention are useful for a number
of purposes. They can be notably used in Southern hybridization to
genomic DNA. The probes can also be used to detect PCR
amplification products. They may also be used to detect mismatches
in a THAP-family gene or mRNA using other techniques.
[0534] Any of the nucleic acids, polynucleotides, primers and
probes of the present invention can be conveniently immobilized on
a solid support. Solid supports are known to those skilled in the
art and include the walls of wells of a reaction tray, test tubes,
polystyrene beads, magnetic beads, nitrocellulose strips,
membranes, microparticles such as latex particles, sheep (or other
animal) red blood cells, duracytes and others. The solid support is
not critical and can be selected by one skilled in the art. Thus,
latex particles, microparticles, magnetic or non-magnetic beads,
membranes, plastic tubes, walls of microtiter wells, glass or
silicon chips, sheep (or other suitable animal's) red blood cells
and duracytes are all suitable examples. Suitable methods for
immobilizing nucleic acids on solid phases include ionic,
hydrophobic, covalent interactions and the like. A solid support,
as used herein, refers to any material which is insoluble, or can
be made insoluble by a subsequent reaction. The solid support can
be chosen for its intrinsic ability to attract and immobilize the
capture reagent. Alternatively, the solid phase can retain an
additional receptor which has the ability to attract and immobilize
the capture reagent. The additional receptor can include a charged
substance that is oppositely charged with respect to the capture
reagent itself or to a charged substance conjugated to the capture
reagent. As yet another alternative, the receptor molecule can be
any specific binding member which is immobilized upon (attached to)
the solid support and which has the ability to immobilize the
capture reagent through a specific binding reaction. The receptor
molecule enables the indirect binding of the capture reagent to a
solid support material before the performance of the assay or
during the performance of the assay. The solid phase thus can be a
plastic, derivatized plastic, magnetic or non-magnetic metal, glass
or silicon surface of a test tube, microtiter well, sheet, bead,
microparticle, chip, sheep (or other suitable animal's) red blood
cells, duracytes and other configurations known to those of
ordinary skill in the art. The nucleic acids, polynucleotides,
primers and probes of the invention can be attached to or
immobilized on a solid support individually or in groups of at
least 2, 5, 8, 10, 12, 15, 20, or 25 distinct polynucleotides of
the invention to a single solid support. In addition,
polynucleotides other than those of the invention may be attached
to the same solid support as one or more polynucleotides of the
invention.
[0535] Any polynucleotide provided herein may be attached in
overlapping areas or at random locations on a solid support.
Alternatively the polynucleotides of the invention may be attached
in an ordered array wherein each polynucleotide is attached to a
distinct region of the solid support which does not overlap with
the attachment site of any other polynucleotide. Preferably, such
an ordered array of polynucleotides is designed to be "addressable"
where the distinct locations are recorded and can be accessed as
part of an assay procedure. Addressable polynucleotide arrays
typically comprise a plurality of different oligonucleotide probes
that are coupled to a surface of a substrate in different known
locations. The knowledge of the precise location of each
polynucleotides location makes these "addressable" arrays
particularly useful in hybridization assays. Any addressable array
technology known in the art can be employed with the
polynucleotides of the invention. One particular embodiment of
these polynucleotide arrays is known as the Genechips, and has been
generally described in U.S. Pat. No. 5,143,854; PCT publications WO
90/15070 and 92/10092, the disclosures of which are incorporated
herein by reference in their entireties.
Recombinant Expression Vectors and Host Cells
[0536] Another aspect of the invention pertains to vectors,
preferably expression vectors, containing a nucleic acid encoding a
THAP family or THAP domain polypeptide, or a biologically active
fragment or homologue thereof.
[0537] Vectors may have particular use in the preparation of a
recombinant protein of the invention, or for use in gene therapy.
Gene therapy presents a means to deliver a THAP family or THAP
domain polypeptide, or a biologically active fragment or homologue
thereof to a subject in order to regulate apoptosis for treatment
of a disorder.
[0538] As used herein, the term "vector" refers to a nucleic acid
molecule capable of transporting another nucleic acid to which it
has been linked. One type of vector is a "plasmid", which refers to
a circular double stranded DNA loop into which additional DNA
segments can be ligated. Another type of vector is a viral vector,
wherein additional DNA segments can be ligated into the viral
genome. Certain vectors are capable of autonomous replication in a
host cell into which they are introduced (e.g., bacterial vectors
having a bacterial origin of replication and episomal mammalian
vectors). Other vectors (e.g., non-episomal mammalian vectors) are
integrated into the genome of a host cell upon introduction into
the host cell, and thereby are replicated along with the host
genome. Moreover, certain vectors are capable of directing the
expression of genes to which they are operatively linked. Such
vectors are referred to herein as "expression vectors". In general,
expression vectors of utility in recombinant DNA techniques are
often in the form of plasmids. In the present specification,
"plasmid" and "vector" can be used interchangeably as the plasmid
is the most commonly used form of vector. However, the invention is
intended to include such other forms of expression vectors, such as
viral vectors (e.g., replication defective retroviruses,
adenoviruses and adeno-associated viruses), which serve equivalent
functions.
[0539] The recombinant expression vectors of the invention comprise
a THAP-family or THAP domain nucleic acid of the invention in a
form suitable for expression of the nucleic acid in a host cell,
which means that the recombinant expression vectors include one or
more regulatory sequences, selected on the basis of the host cells
to be used for expression, which is operatively linked to the
nucleic acid sequence to be expressed. Within a recombinant
expression vector, "operably linked" is intended to mean that the
nucleotide sequence of interest is linked to the regulatory
sequence(s) in a manner which allows for expression of the
nucleotide sequence (e.g., in an in vitro transcription/translation
system or in a host cell when the vector is introduced into the
host cell). The term "regulatory sequence" is intended to include
promoters, enhancers and other expression control elements (e.g.,
polyadenylation signals). Such regulatory sequences are described,
for example, in Goeddel; Gene Expression Technology: Methods in
Enzymology 185, Academic Press, San Diego, Calif. (1990), the
disclosure of which is incorporated herein by reference in its
entirety. Regulatory sequences include those which direct
constitutive expression of a nucleotide sequence in many types of
host cell and those which direct expression of the nucleotide
sequence only in certain host cells (e.g., tissue-specific
regulatory sequences). It will be appreciated by those skilled in
the art that the design of the expression vector can depend on such
factors as the choice of the host cell to be transformed, the level
of expression of protein desired, etc. The expression vectors of
the invention can be introduced into host cells to thereby produce
proteins or peptides, including fusion proteins or peptides,
encoded by nucleic acids as described herein (e.g., THAP-family
proteins, mutant forms of THAP-family proteins, fusion proteins, or
fragments of any of the preceding proteins, etc.).
[0540] The recombinant expression vectors of the invention can be
designed for expression of a THAP family or THAP domain
polypeptide, or a biologically active fragment or homologue thereof
in prokaryotic or eukaryotic cells. For example, THAP-family or
THAP domain proteins can be expressed in bacterial cells such as E.
coli, insect cells (using baculovirus expression vectors) yeast
cells, or mammalian cells. Suitable host cells are discussed
further in Goeddel, Gene Expression Technology: Methods in
Enzymology 185, Academic Press, San Diego, Calif. (1990), the
disclosure of which is incorporated herein by reference in its
entirety. Alternatively, the recombinant expression vector can be
transcribed and translated in vitro, for example using T7 promoter
regulatory sequences and T7 polymerase.
[0541] Expression of proteins in prokaryotes is most often carried
out in E. coli with vectors containing constitutive or inducible
promoters directing the expression of either fusion or non-fusion
proteins. Fusion vectors add a number of amino acids to a protein
encoded therein, usually to the amino terminus of the recombinant
protein. Such fusion vectors typically serve three purposes: 1) to
increase expression of recombinant protein; 2) to increase the
solubility of the recombinant protein; and 3) to aid in the
purification of the recombinant protein by acting as a ligand in
affinity purification. Often, in fusion expression vectors, a
proteolytic cleavage site is introduced at the junction of the
fusion moiety and the recombinant protein to enable separation of
the recombinant protein from the fusion moiety subsequent to
purification of the fusion protein. Such enzymes, and their cognate
recognition sequences, include Factor Xa, thrombin and
enterokinase. Typical fusion expression vectors include pGEX
(Pharmacia Biotech Inc; Smith, D. B. and Johnson, K. S. (1988) Gene
67:31-40), pMAL (New England Biolabs, Beverly, Mass.) and pRIT5
(Pharmacia, Piscataway, N.J.), the disclosures of which are
incorporated herein by reference in their entireties, which fuse
glutathione S-transferase (GST), maltose E binding protein, or
protein A, respectively, to the target recombinant protein.
[0542] Purified fusion proteins can be utilized in THAP-family
activity assays, (e.g., direct assays or competitive assays
described in detail below), or to generate antibodies specific for
THAP-family or THAP domain proteins, for example. In a preferred
embodiment, a THAP-family or THAP domain fusion protein expressed
in a retroviral expression vector of the present invention can be
utilized to infect bone marrow cells which are subsequently
transplanted into irradiated recipients. The pathology of the
subject recipient is then examined after sufficient time has passed
(e.g. six (6) weeks).
[0543] Examples of suitable inducible non-fusion E. coli expression
vectors include pTrc (Amann et al., (1988) Gene 69:301-315) and pET
11d (Studier et al., Gene Expression Technology Methods in
Enzymology 185, Academic Press, San Diego, Calif. (1990) 60-89),
the disclosures of which are incorporated herein by reference in
their entireties. Target gene expression from the pTrc vector
relies on host RNA polymerase transcription from a hybrid trp-lac
fusion promoter. Target gene expression from the pET 11d vector
relies on transcription from a T7 gn10-lac fusion promoter mediated
by a coexpressed viral RNA polymerase (T7 gn 1). This viral
polymerase is supplied by host strains BL21 (DE3) or HMS174(DE3)
from a resident prophage harboring a T7 gn1 gene under the
transcriptional control of the lacUV 5 promoter.
[0544] One strategy to maximize recombinant protein expression in
E. coli is to express the protein in a host bacteria with an
impaired capacity to proteolytically cleave the recombinant protein
(Gottesman, S., Gene Expression Technology: Methods in Enzymology
185, Academic Press, San Diego, Calif. (1990) 119-128, the
disclosure of which is incorporated herein by reference in its
entirety). Another strategy is to alter the nucleic acid sequence
of the nucleic acid to be inserted into an expression vector so
that the individual codons for each amino acid are those
preferentially utilized in E. coli (Wada et al., (1992) Nucleic
Acids Res. 20:2111-2118, the disclosure of which is incorporated
herein by reference in its entirety). Such alteration of nucleic
acid sequences of the invention can be carried out by standard DNA
synthesis techniques.
[0545] In another embodiment, the THAP-family expression vector is
a yeast expression vector. Examples of vectors for expression in
yeast S. cerivisae include pYepSec 1 (Baldari, et al., (1987) Embo
J. 6:229-234), pMFa (Kurjan and Herskowitz, (1982) Cell
30:933-943), pJRY88 (Schultz et al., (1987) Gene 54:113-123), pYES2
(Invitrogen Corporation, San Diego, Calif.), and picZ (InVitrogen
Corp, San Diego, Calif.), the disclosures of which are incorporated
herein by reference in their entireties.
[0546] Alternatively, THAP-family or THAP domain proteins can be
expressed in insect cells using baculovirus expression vectors.
Baculovirus vectors available for expression of proteins in
cultured insect cells (e.g., Sf9 cells) include the pAc series
(Smith et al. (1983) Mol. Cell Biol. 3:2156-2165) and the pVL
series (Lucklow and Summers (1989) Virology 170:31-39), the
disclosures of which are incorporated herein by reference in their
entireties. In particularly preferred embodiments, THAP-family
proteins are expressed according to Karniski et al, Am. J. Physiol.
(1998) 275: F79-87, the disclosure of which is incorporated herein
by reference in its entirety.
[0547] In yet another embodiment, a nucleic acid of the invention
is expressed in mammalian cells using a mammalian expression
vector. Examples of mammalian expression vectors include pCDM8
(Seed, B. (1987) Nature 329:840) and pMT2PC (Kaufman et al. (1987)
EMBO J. 6:187-195), the disclosures of which are incorporated
herein by reference in their entireties. When used in mammalian
cells, the expression vector's control functions are often provided
by viral regulatory elements. For example, commonly used promoters
are derived from polyoma, Adenovirus 2, cytomegalovirus and Simian
Virus 40. For other suitable expression systems for both
prokaryotic and eukaryotic cells see chapters 16 and 17 of
Sambrook, J., Fritsh, E. F., and Maniatis, T. Molecular Cloning: A
Laboratory Manual. 2nd, ed., Cold Spring Harbor Laboratory, Cold
Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989, the
disclosure of which is incorporated herein by reference in its
entirety. In another embodiment, the recombinant mammalian
expression vector is capable of directing expression of the nucleic
acid preferentially in a particular cell type (e.g.,
tissue-specific regulatory elements are used to express the nucleic
acid). Tissue-specific regulatory elements are known in the art,
and are further described below.
[0548] The invention further provides a recombinant expression
vector comprising a DNA molecule of the invention cloned into the
expression vector in an antisense orientation. That is, the DNA
molecule is operatively linked to a regulatory sequence in a manner
which allows for expression (by transcription of the DNA molecule)
of an RNA molecule which is antisense to THAP-family mRNA.
Regulatory sequences operatively linked to a nucleic acid cloned in
the antisense orientation can be chosen which direct the continuous
expression of the antisense RNA molecule in a variety of cell
types, for instance viral promoters and/or enhancers, or regulatory
sequences can be chosen which direct constitutive, tissue specific
or cell type specific expression of antisense RNA. The antisense
expression vector can be in the form of a recombinant plasmid,
phagemid or attenuated virus in which antisense nucleic acids are
produced under the control of a high efficiency regulatory region,
the activity of which can be determined by the cell type into which
the vector is introduced. For a discussion of the regulation of
gene expression using antisense genes see Weintraub, H. et al.,
Antisense RNA as a molecular tool for genetic analysis,
Reviews--Trends in Genetics, Vol. 1(1) 1986, the disclosure of
which is incorporated herein by reference in its entirety.
[0549] Another aspect of the invention pertains to host cells into
which a recombinant expression vector of the invention has been
introduced. The terms "host cell" and "recombinant host cell" are
used interchangeably herein. It is understood that such term refer
not only to the particular subject cell but to the progeny or
potential progeny of such a cell. Because certain modifications may
occur in succeeding generations due to either mutation or
environmental influences, such progeny may not, in fact, be
identical to the parent cell, but are still included within the
scope of the term as used herein.
[0550] A host cell can be any prokaryotic or eukaryotic cell. For
example, a THAP-family protein can be expressed in bacterial cells
such as E. coli, insect cells, yeast or mammalian cells (such as
Chinese hamster ovary cells (CHO) or COS cells or human cells).
Other suitable host cells are known to those skilled in the art,
including mouse 3T3 cells as further described in the Examples.
[0551] Vector DNA can be introduced into prokaryotic or eukaryotic
cells via conventional transformation or transfection techniques.
As used herein, the terms "transformation" and "transfection" are
intended to refer to a variety of art-recognized techniques for
introducing foreign nucleic acid (e.g., DNA) into a host cell,
including calcium phosphate or calcium chloride co-precipitation,
DEAE-dextran-mediated transfection, lipofection, or
electroporation. Suitable methods for transforming or transfecting
host cells can be found in Sambrook, et al. (Molecular Cloning: A
Laboratory Manual. 2nd, ed., Cold Spring Harbor Laboratory, Cold
Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989, the
disclosure of which is incorporated herein by reference in its
entirety), and other laboratory manuals.
[0552] For stable transfection of mammalian cells, it is known
that, depending upon the expression vector and transfection
technique used, only a small fraction of cells may integrate the
foreign DNA into their genome. In order to identify and select
these integrants, a gene that encodes a selectable marker (e.g.,
resistance to antibiotics) is generally introduced into the host
cells along with the gene of interest. Preferred selectable markers
include those which confer resistance to drugs, such as G418,
hygromycin and methotrexate. Nucleic acid encoding a selectable
marker can be introduced into a host cell on the same vector as
that encoding a THAP-family protein or can be introduced on a
separate vector. Cells stably transfected with the introduced
nucleic acid can be identified by drug selection (e.g., cells that
have incorporated the selectable marker gene will survive, while
the other cells die).
[0553] A host cell of the invention, such as a prokaryotic or
eukaryotic host cell in culture, can be used to produce (i.e.,
express) a THAP-family protein. Accordingly, the invention further
provides methods for producing a THAP-family protein using the host
cells of the invention. In one embodiment, the method comprises
culturing the host cell of invention (into which a recombinant
expression vector encoding a THAP-family protein has been
introduced) in a suitable medium such that a THAP-family protein is
produced. In another embodiment, the method further comprises
isolating a THAP-family protein from the medium or the host
cell.
[0554] In another embodiment, the invention encompasses a method
comprising: providing a cell capable of expressing a THAP family or
THAP domain polypeptide, or a biologically active fragment or
homologue thereof, culturing said cell in a suitable medium such
that a THAP-family or THAP domain protein is produced, and
isolating or purifying the THAP-family or THAP domain protein from
the medium or cell.
[0555] The host cells of the invention can also be used to produce
nonhuman transgenic animals, such as for the study of disorders in
which THAP family proteins are implicated. For example, in one
embodiment, a host cell of the invention is a fertilized oocyte or
an embryonic stem cell into which THAP-family- or THAP
domain-coding sequences have been introduced. Such host cells can
then be used to create non-human transgenic animals in which
exogenous THAP-family or THAP domain sequences have been introduced
into their genome or homologous recombinant animals in which
endogenous THAP-family or THAP domain sequences have been altered.
Such animals are useful for studying the function and/or activity
of a THAP-family or THAP domain polypeptide or fragment thereof and
for identifying and/or evaluating modulators of a THAP-family or
THAP domain activity. As used herein, a "transgenic animal" is a
non-human animal, preferably a mammal, more preferably a rodent
such as a rat or mouse, in which one or more of the cells of the
animal includes a transgene. Other examples of transgenic animals
include non-human primates, sheep, dogs, cows, goats, chickens,
amphibians, etc. A transgene is exogenous DNA which is integrated
into the genome of a cell from which a transgenic animal develops
and which remains in the genome of the mature animal, thereby
directing the expression of an encoded gene product in one or more
cell types or tissues of the transgenic animal. As used herein, a
"homologous recombinant animal" is a non-human animal, preferably a
mammal, more preferably a mouse, in which an endogenous THAP-family
or THAP domain gene has been altered by homologous recombination
between the endogenous gene and an exogenous DNA molecule
introduced into a cell of the animal, e.g., an embryonic cell of
the animal, prior to development of the animal. Methods for
generating transgenic animals via embryo manipulation and
microinjection, particularly animals such as mice, have become
conventional in the art and are described, for example, in U.S.
Pat. Nos. 4,736,866 and 4,870,009, both by Leder et al., U.S. Pat.
No. 4,873,191 by Wagner et al. and in Hogan, B., Manipulating the
Mouse Embryo, (Cold Spring Harbor Laboratory Press, Cold Spring
Harbor, N.Y., 1986, the disclosures of which are incorporated
herein by reference in their entireties).
Gene Therapy Vectors
[0556] Preferred vectors for administration to a subject can be
constructed according to well known methods. Vectors will comprise
regulatory elements (e.g. promoter, enhancer, etc) capable of
directing the expression of the nucleic acid in the targeted cell.
Thus, where a human cell is targeted, it is preferable to position
the nucleic acid coding region adjacent to and under the control of
a promoter that is capable of being expressed in a human cell.
[0557] In various embodiments, the human cytornegalovirus (CMV)
immediate early gene promoter, the SV40 early promoter, the Rous
sarcoma virus long terminal repeat, P actin, rat insulin promoter
and glyceraldehyde-3-phosphate dehydrogenase can be used to obtain
high-level expression of the coding sequence of interest. The use
of other viral or mammalian cellular or bacterial phage promoters
which are well-known in the art to achieve expression of a coding
sequence of interest is contemplated as well, provided that the
levels of expression are sufficient for a given purpose. By
employing a promoter with well-known properties, the level and
pattern of expression of the protein of interest following
transfection or transformation can be optimized.
[0558] Selection of a promoter that is regulated in response to
specific physiologic or synthetic signals can permit inducible
expression of the gene product. For example in the case where
expression of a transgene, or transgenes when a multicistronic
vector is utilized, is toxic to the cells in which the vector is
produced in, it may be desirable to prohibit or reduce expression
of one or more of the transgenes. Several inducible promoter
systems are available for production of viral vectors where the
transgene product may be toxic.
[0559] The ecdysone system (Invitrogen, Carlsbad, Calif.) is one
such system. This system is designed to allow regulated expression
of a gene of interest in mammalian cells. It consists of a tightly
regulated expression mechanism that allows virtually no basal level
expression of the transgene, but over 200-fold inducibility. The
system is based on the heterodimeric ecdysone receptor of
Drosophila, and when ecdysone or an analog such as muristerone A
binds to the receptor, the receptor activates a promoter to turn on
expression of the downstream transgene high levels of mRNA
transcripts are attained. In this system, both monomers of the
heterodimeric receptor are constitutively expressed from one
vector, whereas the ecdysone-responsive promoter which drives
expression of the gene of interest is on another plasmid.
Engineering of this type of system into the gene transfer vector of
interest would therefore be useful. Cotransfection of plasmids
containing the gene of interest and the receptor monomers in the
producer cell line would then allow for the production of the gene
transfer vector without expression of a potentially toxic
transgene. At the appropriate time, expression of the transgene
could be activated with ecdysone or muristeron A. Another inducible
system that would be useful is the Tet-Off or Tet On system
(Clontech, Palo Alto, Calif.) originally developed by Gossen and
Bujard (Gossen and Bujard, 1992; Gossen et al, 1995). This system
also allows high levels of gene expression to be regulated in
response to tetracycline or tetracycline derivatives such as
doxycycline. In the Tet-On system, gene expression is turned on in
the presence of doxycycline, whereas in the Tet-Off system, gene
expression is turned on in the absence of doxycycline. These
systems are based on two regulatory elements derived from the
tetracycline resistance operon of E. coli. The tetracycline
operator sequence to which the tetracycline repressor binds, and
the tetracycline repressor protein. The gene of interest is cloned
into a plasmid behind a promoter that has tetracycline-responsive
elements present in it. A second plasmid contains a regulatory
element called the tetracycline-controlled transactivator, which is
composed, in the Tet Off system, of the VP16 domain from the herpes
simplex virus and the wild-type tetracycline repressor.
[0560] Thus in the absence of doxycycline, transcription is
constitutively on. In the Tet-On.TM. system, the tetracycline
repressor is not wild-type and in the presence of doxycycline
activates transcription. For gene therapy vector production, the
Tet Off system would be preferable so that the producer cells could
be grown in the presence of tetracycline or doxycycline and prevent
expression of a potentially toxic transgene, but when the vector is
introduced to the patient, the gene expression would be
constitutively on.
[0561] In some circumstances, it may be desirable to regulate
expression of a transgene in a gene therapy vector. For example,
different viral promoters with varying strengths of activity may be
utilized depending on the level of expression desired. In mammalian
cells, the CMV immediate early promoter if often used to provide
strong transcriptional activation. Modified versions of the CMV
promoter that are less potent have also been used when reduced
levels of expression of the transgene are desired. When expression
of a transgene in hematopoetic_cells is desired, retroviral
promoters such as the LTRs from MLV or MMTV are often used. Other
viral promoters that may be used depending on the desired effect
include SV40, RSV LTR, HIV-1 and HfV-2 LTR, adenovirus promoters
such as from the EIA, E2A, or MLP region, AAV LTR, cauliflower
mosaic virus, HSV-TK, and avian sarcoma virus.
[0562] Similarly tissue specific promoters may be used to effect
transcription in specific tissues or cells so as to reduce
potential toxicity or undesirable effects to non-targeted tissues.
For example, promoters such as the PSA, probasin, prostatic acid
phosphatase or prostate-specific glandular kallikrein (hK2) may be
used to target gene expression in the prostate. Similarly,
promoters as follows may be used to target gene expression in other
tissues.
[0563] Tissue specific promoters include in (a) pancreas: insulin,
elastin, amylase, pdr-I, pdx-I, glucokinase; (b) liver: albumin
PEPCK, HBV enhancer, alpha fetoprotein, apolipoprotein C, alpha-I
antitrypsin, vitellogenin, NF-AB, Transthyretin; (c) skeletal
muscle: myosin H chain, muscle creatine kinase, dystrophin, calpain
p94, skeletal alpha-actin, fast troponin 1; (d) skin: keratin K6,
keratin KI; (e) lung: CFTR, human cytokeratin IS (K 18), pulmonary
surfactant proteins A, B and C, CC-10, Pi; (f) smooth muscle: sm22
alpha, SM-alpha-actin; (g) endothelium: endothelin-I, E-selectin,
von Willebrand factor, TIE (Korhonen et al., 1995), KDR/flk-I; (h)
melanocytes: tyrosinase; (i) adipose tissue: lipoprotein lipase
(Zechner et al., 1988), adipsin (Spiegelman et al., 1989),
acetyl-CoA carboxylase (Pape and Kim, 1989), glycerophosphate
dehydrogenase (Dani et al., 1989), adipocyte P2 (Hunt et al.,
1986); and (j) blood: P-globin.
[0564] In certain indications, it may be desirable to activate
transcription at specific times after administration of the gene
therapy vector. This may be done with such promoters as those that
are hormone or cytokine regulatable. For example in gene therapy
applications where the indication is in a gonadal tissue where
specific steroids are produced or routed to, use of androgen or
estrogen regulated promoters may be advantageous. Such promoters
that are hormone regulatable include MMTV, MT-1, ecdysone and
RuBisco. Other hormone regulated promoters such as those responsive
to thyroid, pituitary and adrenal hormones are expected to be
useful in the present invention. Cytokine and inflammatory protein
responsive promoters that could be used include K and T Kininogen
(Kageyama et al., 1987), c-fos, TNF-alpha, C-reactive protein
(Arcone et al., 1988), haptoglobin (Oliviero et al., 1987), serum
amyloid A2, C/EBP alpha, IL-1, IL-6 (Poli and Cortese, 1989),
Complement C3 (Wilson et al., 1990), IL-8, alpha-I acid
glycoprotein (Prowse and Baumann, 1988), alpha-I antitypsin,
lipoprotein lipase (Zechner et al., 1988), angiotensinogen (Ron et
al., 1991), fibrinogen, c-jun (inducible by phorbol esters, TNF
alpha, UV radiation, retinoic acid, and hydrogen peroxide),
collagenase (induced by phorbol esters and retinoic acid),
metallothionein (heavy metal and glucocorticoid inducible),
Stromelysin (inducible by phorbol ester, interleukin-1 and EGF),
alpha-2 macroglobulin and alpha-I antichymotrypsin.
[0565] It is envisioned that cell cycle regulatable promoters may
be useful in the present invention. For example, in a bi-cistronic
gene therapy vector, use of a strong CMV promoter to drive
expression of a first gene such as p16 that arrests cells in the G1
phase could be followed by expression of a second gene such as p53
under the control of a promoter that is active in the G1 phase of
the cell cycle, thus providing a "second hit" that would push the
cell into apoptosis. Other promoters such as those of various
cyclins, PCNA, galectin-3, E2FI, p53 and BRCAI could be used.
[0566] Tumor specific promoters such as osteocalcin,
hypoxia-responsive element (HRE), NIAGE-4, CEA, alpha-fetoprotein,
GRP78/BiP and tyrosinase also may be used to regulate gene
expression in tumor cells. Other promoters that could be used
according to the present invention include Lac-regulatable,
chemotherapy inducible (e.g. MDR), and heat (hyperthermia)
inducible promoters, Radiation-inducible (e.g., EGR (Joki et al.,
1995)), Alpha-inhibin, RNA pol III tRNA met and other amino acid
promoters, U1 snRNA (Bartlett et al., 1996), MC-1, PGK, -actin and
alpha-globin. Many other promoters that may be useful are listed in
Walther and Stein (1996), the disclosure of which is incorporated
herein by reference.
[0567] It is envisioned that any of the above promoters alone or in
combination with another may be useful according to the present
invention depending on the action desired.
[0568] In addition, this list of promoters should not be considered
to be exhaustive or limiting, those of skill in the art will know
of other promoters that may be used in conjunction with the
THAP-family and THAP domain nucleic acids and methods disclosed
herein.
Enhancers
[0569] Enhancers are genetic elements that increase transcription
from a promoter located at a distant position on the same molecule
of DNA. Enhancers are organized much like promoters. That is, they
are composed of many individual elements, each of which binds to
one or more transcriptional proteins. The basic distinction between
enhancers and promoters is operational. An enhancer region as a
whole must be able to stimulate transcription at a distance; this
need not be true of a promoter region or its component elements. On
the other hand, a promoter must have one or more elements that
direct initiation of RNA synthesis at a particular site and in a
particular orientation, whereas enhancers lack these specificities.
Promoters and enhancers are often overlapping and contiguous, often
seeming to have a very similar modular organization.
[0570] Below is a list of promoters additional to the tissue
specific promoters listed above, cellular promoters/enhancers and
inducible promoters/enhancers that could be used in combination
with the nucleic acid encoding a gene of interest in an expression
construct (list of enhancers, and Table 1). Additionally, any
promoter/enhancer combination (as per the Eukaryotic Promoter Data
Base EPDB) could also be used to drive expression of the gene.
Eukaryotic cells can support cytoplasmic transcription from certain
bacterial promoters if the appropriate bacterial polymerase is
provided, either as part of the delivery complex or as an
additional genetic expression construct.
[0571] Suitable enhancers include: Immunoglobulin Heavy Chain;
Immunoglobulin Light Chain; T-Cell Receptor; HLA DQ (x and DQ beta;
beta-Interferon; Interleukin-2; Interleukin-2 Receptor; MHC Class
II 5; MHC Class II HLA-DRalpha; beta-Actin; Muscle Creatine Kinase;
Prealburnin (Transthyretin); Elastase I; Metallothionein;
Collagenase; Albumin Gene; alpha-Fetoprotein; -Globin; beta-Globin;
e-fos; c-HA-ras; Insulin; Neural Cell Adhesion Molecule (NCAM);
alpha al-Antitrypsin; H2B (TH2B) Histone; Mouse or Type I Collagen;
Glucose-Regulated Proteins (GRP94 and GRP78); Rat Growth Hormone;
Human Serum Amyloid A (SAA); Troponin I (TN 1); Platelet-Derived
Growth Factor; Duchenne Muscular Dystrophy; SV40; Polyoma;
Retroviruses; THAPilloma Virus; Hepatitis B Virus; Human
Immunodeficiency Virus; Cytomegalovirus; and Gibbon Ape Leukemia
Virus.
TABLE-US-00001 TABLE 1 Element Inducer MT 11 Phorbol Ester (TPA)
Heavy metals MMTV (mouse mammary tumor Glucocorticoids virus)
B-Interferon poly(rI)X; poly(rc) Adenovirus 5 E2 Ela c-jun Phorbol
Ester (TPA), H2O2 H202 Collagenase Phorbol Ester (TPA) Stromelysin
Phorbol Ester (TPA), IL-1 SV40 Phorbol Ester (TPA) Murine MX Gene
Interferon, Newcastle Disease Virus GRP78 Gene A23187
oc-2-Macroglobulin IL-6 Vimentin Serum NMC Class I Gene H-2kB
Interferon HSP70 Ela, SV40 Large T Antigen Insulin E Box Glucose
Proliferin Phorbol Ester-TPA Tumor Necrosis Factor FMA Thyroid
Stimulating Hormone alpha Gene Thyroid Hormone
[0572] In preferred embodiments of the invention, the expression
construct comprises a virus or engineered construct derived from a
viral genome. The ability of certain viruses to enter cells via
receptor-mediated endocytosis and to integrate into host cell
genome and express viral genes stably and efficiently have made
them attractive candidates for the transfer of foreign genes into
mammalian cells (Ridgeway, 1988; Nicolas and Rubenstein, 1988;
Baichwal and Sugden, 1986; Temin, 1986, the disclosures of which
are incorporated herein by reference). The first viruses used as
gene vectors were DNA viruses including the papovaviruses (simian
virus 40, bovine papilloma virus, and polyoma) (Ridgeway, 1988;
Baichwal and Sugden, 1986) and adenoviruses (Ridgeway, 1988;
Baichwal and Sugden, 1986). These have a relatively low capacity
for foreign DNA sequences and have a restricted host spectrum.
[0573] Furthermore, their oncogenic potential and cytopathic
effects in permissive cells raise safety concerns. They can
accommodate only up to 8 kB of foreign genetic material but can be
readily introduced in a variety of cell lines and laboratory
animals (Nicolas and Rubenstein, 1988; Temin, 1986).
(iii) Polyadenylation Signals
[0574] Where a cDNA insert is employed, one will typically desire
to include a polyadenylation signal to effect proper
polyadenylation of the gene transcript. The nature of the
polyadenylation signal is not believed to be crucial to the
successful practice of the invention, and any such sequence may be
employed such as human or bovine growth hormone and SV40
polyadenylation signals. Also contemplated as an element of the
expression cassette is a terminator. These elements can serve to
enhance message levels and to minimize read through from the
cassette into other sequences.
Antisense Constructs
[0575] The term "antisense nucleic acid" is intended to refer to
the oligonucleotides complementary to the base sequences of DNA and
RNA. Antisense oligonucleotides, when introduced into a target
cell, specifically bind to their target nucleic acid and interfere
with transcription, RNA processing, transport and/or translation.
Targeting double-stranded (ds) DNA with oligonucleotide leads to
triple-helix formation; targeting RNA will lead to double-helix
formation.
[0576] Antisense constructs may be designed to bind to the promoter
and other control regions, exons, introns or even exon-intron
boundaries of a gene. Antisense RNA constructs, or DNA encoding
such antisense RNAs, may be employed to inhibit gene transcription
or translation or both within a host cell, either in vitro or in
vivo, such as within a host animal, including a human subject.
Nucleic acid sequences comprising complementary nucleotides" are
those which are capable of base-pairing according to the standard
Watson-Crick complementary rules. That is, that the larger purines
will base pair with the smaller pyrimidines to form only
combinations of guanine paired with cytosine (G:C) and adenine
paired with either thymine (A:T), in the case of DNA, or adenine
paired with uracil (A:U) in the case of RNA.
[0577] As used herein, the terms "complementary" or "antisense
sequences" mean nucleic acid sequences that are substantially
complementary over their entire length and have very few base
mismatches. For example, micleic acid sequences of fifteen bases in
length may be termed complementary when they have a complementary
nucleotide at thirteen or fourteen positions with only single or
double mismatches. Naturally, nucleic acid sequences which are
"completely complementary" will be nucleic acid sequences which are
entirely complementary throughout their entire length and have no
base mismatches.
[0578] While all or part of the gene sequence may be employed in
the context of antisense construction, statistically, any sequence
17 bases long should occur only once in the human genome and,
therefore, suffice to specify a unique target sequence.
[0579] Although shorter oligomers are easier to make and increase
in vivo accessibility, numerous other factors are involved in
determining the specificity of hybridization. Both binding affinity
and sequence specificity of an oligonucleotide to its complementary
target increases with increasing length. It is contemplated that
oligonucleotides of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
20 or more base pairs will be used. One can readily determine
whether a given antisense nucleic acid is effective at targeting of
the corresponding host cell gene simply by testing the constructs
in vitro to determine whether the endogenous gene's function is
affected or whether the expression of related genes having
complementary sequences is affected.
[0580] In certain embodiments, one may wish to employ antisense
constructs which include other elements, for example, those which
include C-5 propyne pyrimidines.
[0581] Oligonucleotides which contain C-5 propyne analogues of
uridine and cytidine have been shown to bind RNA with high affinity
and to be potent antisense inhibitors of gene expression (Wagner et
al, 1993).
Ribozyme Constructs
[0582] As an alternative to targeted antisense delivery, targeted
ribozymes may be used. The term "ribozyme" refers to an RNA-based
enzyme capable of targeting and cleaving particular base sequences
in oncogene DNA and RNA. Ribozymes either can be targeted directly
to cells, in the form of RNA oligo-nucleotides incorporating
ribozyme sequences, or introduced into the cell as an expression
construct encoding the desired ribosomal RNA. Ribozymes may be used
and applied in much the same way as described for antisense nucleic
acids.
Methods of Gene Transfer
[0583] In order to mediate the effect of transgene expression in a
cell, it will be necessary to transfer the therapeutic expression
constructs of the present invention into a cell. This section
provides a discussion of methods and compositions of viral
production and viral gene transfer, as well as non-viral gene
transfer methods.
(i) Viral Vector-Mediated Transfer
[0584] The THAP-family gene is incorporated into a viral infectious
particle to mediate gene transfer to a cell. Additional expression
constructs encoding other therapeutic agents as described herein
may also be transferred via viral transduction using infectious
viral particles, for example, by transformation with an adenovirus
vector of the present invention as described herein below.
Alternatively, retroviral or bovine papilloma virus may be
employed, both of which permit permanent transformation of a host
cell with a gene(s) of interest. Thus, in one example, viral
infection of cells is used in order to deliver therapeutically
significant genes to a cell. Typically, the virus simply will be
exposed to the appropriate host cell under physiologic conditions,
permitting uptake of the virus. Though adenovirus is exemplified,
the present methods may be advantageously employed with other viral
or non-viral vectors, as discussed below.
Adenovirus
[0585] Adenovirus is particularly suitable for use as a gene
transfer vector because of its mid-sized DNA genome, ease of
manipulation, high titer, wide target-cell range, and high
infectivity. The roughly 36 kB viral genome is bounded by 100-200
base pair (bp) inverted terminal repeats (ITR), in which are
contained cis acting elements necessary for viral DNA replication
and packaging. The early (E) and late (L) regions of the genome
that contain different transcription units are divided by the onset
of viral DNA replication.
[0586] The E1 region (EIA and EIB) encodes proteins responsible for
the regulation of transcription of the viral genome and a few
cellular genes. The expression of the E2 region (E2A and E2B)
results in the synthesis of the proteins for viral DNA
replication.
[0587] These proteins are involved in DNA replication, late gene
expression, and host cell shut off (Renan, 1990). The products of
the late genes (L I, L2, U, L4 and L5), including the majority of
the viral capsid proteins, are expressed only after significant
processing of a single primary transcript issued by the major late
promoter (MLP). The MLP (located at 16.8 map units) is particularly
efficient during the late phase of infection, and all the mRNAs
issued from this promoter possess a 5' tripartite leader (TL)
sequence which makes them preferred mRNAs for translation.
[0588] In order for adenovirus to be optimized for gene therapy, it
is necessary to maximize the carrying capacity so that large
segments of DNA can be included. It also is very desirable to
reduce the toxicity and immunologic reaction associated with
certain adenoviral products. The two goals are, to an extent,
coterminous in that elimination of adenoviral genes serves both
ends. By practice of the present invention, it is possible achieve
both these goals while retaining the ability to manipulate the
therapeutic constructs with relative case.
[0589] The large displacement of DNA is possible because the cis
elements required for viral DNA replication all are localized in
the inverted terminal repeats (ITR) (100-200 bp) at either end of
the linear viral genome. Plasmids containing ITR's can replicate in
the presence of a non-defective adenovirus (Hay et al., 1984).
Therefore, inclusion of these elements in an adenoviral vector
should permit replication.
[0590] In addition, the packaging signal for viral encapsidation is
localized between 194 385 bp (0.5-1.1 map units) at the left end of
the viral genome (Hearing et al., 1987). This signal mimics the
protein recognition site in bacteriophage k DNA where a specific
sequence close to the left end, but outside the cohesive end
sequence, mediates the binding to proteins that are required for
insertion of the DNA into the head structure. E1 substitution
vectors of Ad have demonstrated that a 450 bp (0-1.25 map units)
fragment at the left end of the viral genome could direct packaging
in 293 cells (Levrero et al., 1991).
[0591] Previously, it has been shown that certain regions of the
adenoviral genome can be incorporated into the genome of mammalian
cells and the genes encoded thereby expressed. These cell lines are
capable of supporting the replication of an adenoviral vector that
is deficient in the adenoviral function encoded by the cell line.
There also have been reports of complementation of replication
deficient adenoviral vectors by "helping" vectors, e.g., wild-type
virus or conditionally defective mutants.
[0592] Replication-deficient adenoviral vectors can be
complemented, in trans, by helper virus. This observation alone
does not permit isolation of the replication-deficient vectors,
however, since the presence of helper virus, needed to provide
replicative functions, would contaminate any preparation. Thus, an
additional element was needed that would add specificity to the
replication and/or packaging of the replication-deficient vector.
That element, as provided for in the present invention, derives
from the packaging function of adenovirus.
[0593] It has been shown that a packaging signal for adenovirus
exists in the left end of the conventional adenovirus map
(Tibbetts, 1977). Later studies showed that a mutant with a
deletion in the EIA (194-358 bp) region of the genome grew poorly
even in a cell line that complemented the early (EIA) function
(Hearing and Shenk, 1983). When a compensating adenoviral DNA
(0-353 bp) was recombined into the right end of the mutant, the
virus was packaged normally. Further mutational analysis identified
a short, repeated, position-dependent element in the left end of
the Ad5 genome. One copy of the repeat was found to be sufficient
for efficient packaging if present at either end of the genome, but
not when moved towards the interior of the Ad5 DNA molecule
(Hearing et al., 1987).
[0594] By using mutated versions of the packaging signal, it is
possible to create helper viruses that are packaged with varying
efficiencies. Typically, the mutations are point mutations or
deletions. When helper viruses with low efficiency packaging are
grown in helper cells, the virus is packaged, albeit at reduced
rates compared to wild-type virus, thereby permitting propagation
of the helper. When these helper viruses are grown in cells along
with virus that contains wild-type packaging signals, however, the
wild-type packaging signals are recognized preferentially over the
mutated versions. Given a limiting amount of packaging factor, the
virus containing the wild-type signals are packaged selectively
when compared to the helpers. If the preference is great enough,
stocks approaching homogeneity should be achieved.
Retrovirus
[0595] The retroviruses are a group of single-stranded RNA viruses
characterized by an ability to convert their RNA to double-stranded
DNA in infected cells by a process of reverse-transcription
(Coffin, 1990). The resulting DNA then stably integrates into
cellular chromosomes as a provirus and directs synthesis of viral
proteins.
[0596] The integration results in the retention of the viral gene
sequences in the recipient cell and its descendants. The retroviral
genome contains three genes--gag, pol and env--that code for capsid
proteins, polymerase enzyme, and envelope components, respectively.
A sequence found upstream from the gag gene, termed T, functions as
a signal for packaging of the genome into virions. Two long
terminal repeat (LTR) sequences are present at the 5' and 3' ends
of the viral genome. These contain strong promoter and enhancer
sequences and also are required for integration in the host cell
genome (Coffin, 1990).
[0597] In order to construct a retroviral vector, a nucleic acid
encoding a promoter is inserted into the viral genome in the place
of certain viral sequences to produce a virus that is
replication-defective. In order to produce virions, a packaging
cell line containing the gag, pol and env genes but without the LTR
and T components is constructed (Mann et al., 1983). When a
recombinant plasmid containing a human cDNA, together with the
retroviral LTR and T sequences is introduced into this cell line
(by calcium phosphate precipitation for example), the T sequence
allows the RNA transcript of the recombinant plasmid to be packaged
into viral particles, which are then secreted into the culture
media (Nicolas and Rubenstein, 1988; Temin, 1986; Mann et al.,
1983, the disclosures of which are incorporated herein by
reference). The media containing the recombinant retroviruses is
collected, optionally concentrated, and used for gene transfer.
Retroviral vectors are able to infect a broad variety of cell
types. However, integration and stable expression of many types of
retroviruses require the division of host cells (Paskind et al.,
1975).
[0598] An approach designed to allow specific targeting of
retrovirus vectors recently was developed based on the chemical
modification of a retrovirus by the chemical addition of galactose
residues to the viral envelope. This modification could permit the
specific infection of cells such as hepatocytes via
asialoglycoprotein receptors, should this be desired.
[0599] A different approach to targeting of recombinant
retroviruses was designed in which biotinylated antibodies against
a retroviral envelope protein and against a specific cell receptor
were used. The antibodies were coupled via the biotin components by
using streptavidin (Roux et al., 1989). Using antibodies against
major histocompatibility complex class I and class II antigens, the
infection of a variety of human cells that bore those surface
antigens was demonstrated with an ecotropic virus in vitro (Roux et
al., 1989).
Adeno-Associated Virus
[0600] AAV utilizes a linear, single-stranded DNA of about 4700
base pairs. Inverted terminal repeats flank the genome. Two genes
are present within the genome, giving rise to a number of distinct
gene products. The first, the cap gene, produces three different
virion proteins (VP), designated VP-1, VP 2 and VP-3.
[0601] The second, the rep gene, encodes four non-structural
proteins (NS). One or more of these rep gene products is
responsible for transactivating AAV transcription.
[0602] The three promoters in AAV are designated by their location,
in map units, in the genome. These are, from left to right, p5, p19
and p40. Transcription gives rise to six transcripts, two initiated
at each of three promoters, with one of each pair being
spliced.
[0603] The splice site, derived from map units 42-46, is the same
for each transcript. The four non-structural proteins apparently
are derived from the longer of the transcripts, and three virion
proteins all arise from the smallest transcript.
[0604] AAV is not associated with any pathologic state in humans.
Interestingly, for efficient replication, AAV requires "helping"
functions from viruses such as herpes simplex virus I and II,
cytornegalovirus, pseudorabies virus and, of course,
adenovirus.
[0605] The best characterized of the helpers is adenovirus, and
many "early" functions for this virus have been shown to assist
with AAV replication. Low level expression of AAV rep proteins is
believed to hold AAV structural expression in check, and helper
virus infection is thought to remove this block.
[0606] The terminal repeats of the AAV vector can be obtained by
restriction endonuclease digestion of AAV or a plasmid such as
p201, which contains a modified AAV genome (Samulski et al, 1987),
or by other methods known to the skilled artisan, including but not
limited to chemical or enzymatic synthesis of the terminal repeats
based upon the published sequence of AAV. The ordinarily skilled
artisan can determine, by well-known methods such as deletion
analysis, the minimum sequence or part of the AAV ITRs which is
required to allow function, i.e., stable and site specific
integration.
[0607] The ordinarily skilled artisan also can determine which
minor modifications of the sequence can be tolerated while
maintaining the ability of the terminal repeats to direct stable,
site-specific integration.
[0608] AAV-based vectors have proven to be safe and effective
vehicles for gene delivery in vitro, and these vectors are being
developed and tested in pre-clinical and clinical stages for a wide
range of applications in potential gene therapy, both ex vivo and
in vivo (Carter and Flotte, 1996; Chattedee et al., 1995; Ferrari
et al., 1996; Fisher et al., 1996; Flotte et al., 1993; Goodman et
al., 1994; Kaplitt et al., 1994; 1996, Kessler et al., 1996;
Koeberl et al., 1997; Mizukami et al., 1996; Xiao et al., 1996, the
disclosures of which are incorporated herein by reference in their
entireties).
[0609] AAV-mediated efficient gene transfer and expression in the
lung has led to clinical trials for the treatment of cystic
fibrosis (Carter and Flotte, 1996; Flotte et al., 1993, the
disclosures of which are incorporated herein by reference).
Similarly, the prospects for treatment of muscular dystrophy by
AAV-mediated gene delivery of the dystrophin gene to skeletal
muscle, of Parkinson's disease by tyrosine hydroxylase gene
delivery to the brain, of hemophilia B by Factor IX gene delivery
to the liver, and potentially of myocardial infarction by vascular
endothelial growth factor gene to the heart, appear promising since
AAV-mediated transgene expression in these organs has recently been
shown to be highly efficient (Fisher et al., 1996; Flotte et al.,
1993; Kaplitt et al., 1994; 1996; Koeberl et al., 1997; McCown et
al., 1996; Ping et al., 1996; and Xiao et al., 1996, the
disclosures of which are incorporated herein by reference in their
entireties.).
Other Viral Vectors
[0610] Other viral vectors may be employed as expression constructs
in the present invention. Vectors derived from viruses such as
vaccinia virus (Ridgeway, 1988; Baichwal and Sugden, 1986; Coupar
et al., 1988) and hepatitus B viruses have also been developed and
are useful in the present invention. They offer several attractive
features for various mammalian cells (Friedmann, 1989; Ridgeway,
1988; Baichwal and Sugden, 1986; Coupar et al., 1988; and Horwich
et al., 1990, the disclosures of which are incorporated herein by
reference in their entireties.).
[0611] With the recent recognition of defective hepatitis B
viruses, new insight was gained into the structure-function
relationship of different viral sequences. In vitro studies showed
that the virus could retain the ability for helper dependent
packaging and reverse transcription despite the deletion of up to
80% of its genome (Horwich et al., 1990). This suggested that large
portions of the genome could be replaced with foreign genetic
material. Chang et al., recently introduced the chloramphenicol
acetyltransferase (CAT) gene into duck hepatitis B virus genome in
the place of the polymerase, surface, and pre-surface coding
sequences. It was cotransfected with wild-type virus into an avian
hepatoma cell line. Culture media containing high titers of the
recombinant virus were used to infect primary duckling hepatocytes.
Stable CAT gene expression was detected for at least 24 days after
transfection (Chang et al., 1991).
[0612] In still further embodiments of the present invention, the
nucleic acids to be delivered are housed within an infective virus
that has been engineered to express a specific binding ligand. The
virus particle will thus bind specifically to the cognate receptors
of the target cell and deliver the contents to the cell. A novel
approach designed to allow specific targeting of retrovirus vectors
was recently developed based on the chemical modification of a
retrovirus by the chemical addition of lactose residues to the
viral envelope. This modification can permit the specific infection
of hepatocytes via asialoglycoprotein receptors.
[0613] Another approach to targeting of recombinant retroviruses
was designed in which biotinylated antibodies against a retroviral
envelope protein and against a specific cell receptor were used.
The antibodies were coupled via the biotin components by using
streptavidin (Roux et al., 1989). Using antibodies against major
histocompatibility complex class I and class II antigens, they
demonstrated the infection of a variety of human cells that bore
those surface antigens with an ecotropic virus in vitro (Roux et
al., 1989).
(ii) Non-Viral Transfer
[0614] DNA constructs of the present invention are generally
delivered to a cell. In certain situations, the nucleic acid to be
transferred is non-infectious, and can be transferred using
non-viral methods.
[0615] Several non-viral methods for the transfer of expression
constructs into cultured mammalian cells are contemplated by the
present invention. These include calcium phosphate precipitation
(Graham and Van Der Eb, 1973; Chen and Okayama, 1987; Rippe et al.,
1990) DEAE-dextran (Gopal, 1985), electroporation (Tur Kaspa et
al., 1986; Potter et al., 1984), direct microinjection (Harland and
Weintraub, 1985), DNA loaded liposomes (Nicolau and Sene, 1982;
Fraley et al., 1979), cell sonication (Fechheimer et al., 1987),
gene bombardment using high velocity microprojectiles (Yang et al.,
1990), and receptor-mediated transfection (Wu and Wu, 1987; Wu and
Wu, 1988), the disclosures of which are incorporated herein by
reference in their entireties.
[0616] Once the construct has been delivered into the cell the
nucleic acid encoding the therapeutic gene may be positioned and
expressed at different sites. In certain embodiments, the nucleic
acid encoding the therapeutic gene may be stably integrated into
the genome of the cell. This integration may be in the cognate
location and orientation via homologous recombination (gene
replacement) or it may be integrated in a random, non-specific
location (gene augmentation). In yet further embodiments, the
nucleic acid may be stably maintained in the cell as a separate,
episomal segment of DNA. Such nucleic acid segments or "episomes"
encode sequences sufficient to permit maintenance and replication
independent of or in synchronization with the host cell cycle.
[0617] How the expression construct is delivered to a cell and
where in the cell the nucleic acid remains is dependent on the type
of expression construct employed.
[0618] In a particular embodiment of the invention, the expression
construct may be entrapped in a liposome. Liposomes are vesicular
structures characterized by a phospholipid bilayer membrane and an
inner aqueous medium. Multilamellar liposomes have multiple lipid
layers separated by aqueous medium. They form spontaneously when
phospholipids are suspended in an excess of aqueous solution. The
lipid components undergo self-rearrangement before the formation of
closed structures and entrap water and dissolved solutes between
the lipid bilayers (Ghosh and Bachhawat, 1991). The addition of DNA
to cationic liposomes causes a topological transition from
liposomes to optically birefringent liquid-crystalline condensed
globules (Radler et al., 1997). These DNA-lipid complexes are
potential non-viral vectors for use in gene therapy.
[0619] Liposome-mediated nucleic acid delivery and expression of
foreign DNA in vitro has been very successful. Using the
P-lactamase gene, Wong et al. (1980) demonstrated the feasibility
of liposome-mediated delivery and expression of foreign DNA in
cultured chick embryo, HeLa, and hepatoma cells. Nicolau et al.
(1987) accomplished successful liposome-mediated gene transfer in
rats after intravenous injection. Also included are various
commercial approaches involving "lipofection" technology.
[0620] In certain embodiments of the invention, the liposome may be
complexed with a hemagglutinating virus (HVJ). This has been shown
to facilitate fusion with the cell membrane and promote cell entry
of liposome-encapsulated DNA (Kaneda et al., 1989).
[0621] In other embodiments, the liposome may be complexed or
employed in conjunction with nuclear nonhistone chromosomal
proteins (HMG-1) (Kato et al., 1991). In yet further embodiments,
the liposome may be complexed or employed in conjunction with both
HVJ and HMG-1. In that such expression constructs have been
successfully employed in transfer and expression of nucleic acid in
vitro and in vivo, then they are applicable for the present
invention.
[0622] Other vector delivery systems which can be employed to
deliver a nucleic acid encoding a therapeutic gene into cells are
receptor-mediated delivery vehicles. These take advantage of the
selective uptake of macromolecules by receptor mediated endocytosis
in almost all eukaryotic cells. Because of the cell type specific
distribution of various receptors, the delivery can be highly
specific (Wu and Wu, 1993).
[0623] Receptor-mediated gene targeting vehicles generally consist
of two components: a cell receptor-specific ligand and a
DNA-binding agent. Several ligands have been used for
receptor-mediated gene transfer. The most extensively characterized
ligands are asialoorosomucoid (ASOR) (Wu and Wu, 1987) and
transferring (Wagner et al., 1990).
[0624] Recently, a synthetic neoglycoprotein, which recognizes the
same receptor as ASOR, has been used as a gene delivery vehicle
(Ferkol et al., 1993; Perales et al., 1994) and epidermal growth
factor (EGF) has also been used to deliver genes to squamous
carcinoma cells (Myers, EPO 0273085).
[0625] In other embodiments, the delivery vehicle may comprise a
ligand and a liposome. For example, Nicolau et al, (1987) employed
lactosyl-ceramide, a galactose terminal asialganglioside,
incorporated into liposomes and observed an increase in the uptake
of the insulin gene by hepatocytes. Thus, it is feasible that a
nucleic acid encoding a therapeutic gene also may be specifically
delivered into a cell type such as prostate, epithelial or tumor
cells, by any number of receptor-ligand systems with or without
liposomes. For example, the human prostate-specific antigen (Watt
et al, 1986) may be used as the receptor for mediated delivery of a
nucleic acid in prostate tissue.
[0626] In another embodiment of the invention, the expression
construct may simply consist of naked recombinant DNA or plasmids.
Transfer of the construct may be performed by any of the methods
mentioned above which physically or chemically permeabilize the
cell membrane. This is applicable particularly for transfer in
vitro, however, it may be applied for in vivo use as well. Dubensky
et al, (1984) successfully injected polyornavirus DNA in the form
of CaP04 precipitates into liver and spleen of adult and newborn
mice demonstrating active viral replication and acute
infection.
[0627] Benvenisty and Neshif (1986) also demonstrated that direct
intraperitoneal injection of CaP04 precipitated plasmids results in
expression of the transfected genes. It is envisioned that DNA
encoding a CAM may also be transferred in a similar manner in vivo
and express CAM.
[0628] Another embodiment of the invention for transferring a naked
DNA expression construct into cells may involve particle
bombardment. This method depends on the ability to accelerate DNA
coated microprojectiles to a high velocity allowing them to pierce
cell membranes and enter cells without killing them (Klein et al,
1987). Several devices for accelerating small particles have been
developed. One such device relies on a high voltage discharge to
generate an electrical cur-rent, which in turn provides the motive
force (Yang et al, 1990). The microprojectiles used have consisted
of biologically inert substances such as tungsten or gold
beads.
Antibodies
[0629] Polyclonal anti-THAP-family or anti-THAP domain antibodies
can be prepared as described above by immunizing a suitable subject
with a THAP-family or THAP domain immunogen. The anti-THAP-family
or anti-THAP domain antibody titer in the immunized subject can be
monitored over time by standard techniques, such as with an enzyme
linked immunosorbent assay (ELISA) using immobilized THAP-family or
THAP domain protein. If desired, the antibody molecules directed
against THAP-family can be isolated from the mammal (e.g., from the
blood) and further purified by well known techniques, such as
protein A chromatography to obtain the IgG fraction. At an
appropriate time after immunization, e.g., when the
anti-THAP-family antibody titers are highest, antibody-producing
cells can be obtained from the subject and used to prepare
monoclonal antibodies by standard techniques, such as those
described in the following references, the disclosures of which are
incorporated herein by reference in their entireties: the hybridoma
technique originally described by Kohler and Milstein (1975) Nature
256:495-497) (see also, Brown et al. (1981) J. Immunol. 127:539-46;
Brown et al. (1980) J. Biol. Chem. 255:4980-83; Yeh et al. (1976)
PNAS 76:2927-31; and Yeh et al. (1982) Int. J. Cancer 29:269-75),
the more recent human B cell hybridoma technique (Kozbor et al.
(1983) Immunol Today 4:72), the EBV-hybridoma technique (Cole et
al. (1985), Monoclonal Antibodies and Cancer Therapy, Alan R. Liss,
Inc., pp. 77-96) or trioma techniques. The technology for producing
monoclonal antibody hybridomas is well known (see generally R. H.
Kenneth, in Monoclonal Antibodies: A New Dimension In Biological
Analyses, Plenum Publishing Corp., New York, N.Y. (1980); E. A.
Lerner (1981) Yale J. Biol. Med., 54:387-402; M. L. Gefter et al.
(1977) Somatic Cell Genet. 3:231-36). Briefly, an immortal cell
line (typically a myeloma) is fused to lymphocytes (typically
splenocytes) from a mammal immunized with a THAP-family immunogen
as described above, and the culture supernatants of the resulting
hybridoma cells are screened to identify a hybridoma producing a
monoclonal antibody that binds THAP-family.
[0630] Any of the many well known protocols used for fusing
lymphocytes and immortalized cell lines can be applied for the
purpose of generating an anti-THAP-family or anti-THAP domain
monoclonal antibody (see, e.g., G. Galfre et al. (1977) Nature
266:55052; Gefter et al. Somatic Cell Genet., cited supra; Lerner,
Yale J. Biol. Med, cited supra; Kenneth, Monoclonal Antibodies,
cited supra), the disclosures of which are incorporated herein by
reference in their entireties. Moreover, the ordinarily skilled
worker will appreciate that there are many variations of such
methods which also would be useful. Typically, the immortal cell
line (e.g., a myeloma cell line) is derived from the same mammalian
species as the lymphocytes. For example, murine hybridomas can be
made by fusing lymphocytes from a mouse immunized with an
immunogenic preparation of the present invention with an
immortalized mouse cell line. Preferred immortal cell lines are
mouse myeloma cell lines that are sensitive to culture medium
containing hypoxanthine, aminopterin and thymidine ("HAT medium").
Any of a number of myeloma cell lines can be used as a fusion
partner according to standard techniques, e.g., the P3-NS1/1-Ag4-1,
P3-x63-Ag8.653 or Sp2/O--Ag14 myeloma lines. These myeloma lines
are available from ATCC. Typically, HAT-sensitive mouse myeloma
cells are fused to mouse splenocytes using polyethylene glycol
("PEG"). Hybridoma cells resulting from the fusion are then
selected using HAT medium, which kills unfused and unproductively
fused myeloma cells (unfused splenocytes die after several days
because they are not transformed). Hybridoma cells producing a
monoclonal antibody of the invention are detected by screening the
hybridoma culture supernatants for antibodies that bind a
THAP-family or THAP domain protein, e.g., using a standard ELISA
assay.
[0631] Alternative to preparing monoclonal antibody-secreting
hybridomas, a monoclonal anti-THAP-family or anti-THAP domain
antibody can be identified and isolated by screening a recombinant
combinatorial immunoglobulin library (e.g., an antibody phage
display library) with THAP-family or THAP domain protein to thereby
isolate immunoglobulin library members that bind THAP-family or
THAP domain proteins. Kits for generating and screening phage
display libraries are commercially available (e.g., the Pharmacia
Recombinant Phage Antibody System, Catalog No. 27-9400-01; and the
Stratagene SurfZAP..TM.. Phage Display Kit, Catalog No. 240612),
the disclosures of which are incorporated herein by reference in
their entireties. Additionally, examples of methods and reagents
particularly amenable for use in generating and screening antibody
display library can be found in, for example, Ladner et al. U.S.
Pat. No. 5,223,409; Kang et al. PCT International Publication No.
WO 92/18619; Dower et al. PCT International Publication No. WO
91/17271; Winter et al. PCT International Publication WO 92/20791;
Markland et al. PCT International Publication No. WO 92/15679;
Breitling et al. PCT International Publication WO 93/01288;
McCafferty et al. PCT International Publication No. WO 92/01047;
Garrard et al. PCT International Publication No. WO 92/09690;
Ladner et al. PCT International Publication No. WO 90/02809; Fuchs
et al. (1991) Bio/Technology 9:1370-1372; Hay et al. (1992) Hum.
Antibod. Hybridomas 3:81-85; Huse et al. (1989) Science
246:1275-1281; Griffiths et al. (1993) EMBO J. 12:725-734; Hawkins
et al. (1992) J. Mol. Biol. 226:889-896; Clarkson et al. (1991)
Nature 352:624-628; Gram et al. (1992) PNAS 89:3576-3580; Garrad et
al. (1991) Bio/Technology 9:1373-1377; Hoogenboom et al. (1991)
Nuc. Acid Res. 19:4133-4137; Barbas et al. (1991) PNAS
88:7978-7982; and McCafferty et al. Nature (1990) 348:552-554, the
disclosures of which are incorporated herein by reference in their
entireties.
[0632] Additionally, recombinant anti-THAP-family or anti-THAP
domain antibodies, such as chimeric and humanized monoclonal
antibodies, comprising both human and non-human portions, which can
be made using standard recombinant DNA techniques, are within the
scope of the invention. Such chimeric and humanized monoclonal
antibodies can be produced by recombinant DNA techniques known in
the art, for example using methods described in Robinson et al.
International Application No. PCT/US86/02269; Akira, et al.
European Patent Application 184,187; Taniguchi, M., European Patent
Application 171496; Morrison et al. European Patent Application
173,494; Neuberger et al. PCT International Publication No. WO
86/01533; Cabilly et al. U.S. Pat. No. 4,816,567; Cabilly et al.
European Patent Application 125,023; Better et al. (1988) Science
240:1041-1043; Liu et al. (1987) PNAS 84:3439-3443; Liu et al.
(1987) J. Immunol. 139:3521-3526; Sun et al. (1987) PNAS
84:214-218; Nishimura et al. (1987) Canc. Res. 47:999-1005; Wood et
al. (1985) Nature 314:446-449; and Shaw et al. (1988) J. Natl.
Cancer Inst. 80:1553-1559); Morrison, S. L. (1985) Science
229:1202-1207; Oi et al. (1986) BioTechniques 4:214; Winter U.S.
Pat. No. 5,225,539; Jones et al. (1986) Nature 321:552-525;
Verhoeyan et al. (1988) Science 239:1534; and Beidler et al. (1988)
J. Immunol. 141:4053-4060, the disclosures of which are
incorporated herein by reference in their entireties.
[0633] An anti-THAP-family of anti-THAP domain antibody (e.g.,
monoclonal antibody) can be used to isolate THAP-family or THAP
domain protein by standard techniques, such as affinity
chromatography or immunoprecipitation. For example, an
anti-THAP-family antibody can facilitate the purification of
natural THAP-family from cells and of recombinantly produced
THAP-family expressed in host cells. Moreover, an anti-THAP-family
antibody can be used to detect THAP-family protein (e.g., in a
cellular lysate or cell supernatant) in order to evaluate the
abundance and pattern of expression of the THAP-family protein.
Anti-THAP-family antibodies can be used diagnostically to monitor
protein levels in tissue as part of a clinical testing procedure,
e.g., to, for example, determine the efficacy of a given treatment
regimen. Detection can be facilitated by coupling (i.e., physically
linking) the antibody to a detectable substance. Examples of
detectable substances include various enzymes, prosthetic groups,
fluorescent materials, luminescent materials, bioluminescent
materials, and radioactive materials. Examples of suitable enzymes
include horseradish peroxidase, alkaline phosphatase,
-galactosidase, or acetylcholinesterase; examples of suitable
prosthetic group complexes include streptavidin/biotin and
avidin/biotin; examples of suitable fluorescent materials include
umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine,
dichlorotriazinylamine fluorescein, dansyl chloride or
phycoerythrin; an example of a luminescent material includes
luminol; examples of bioluminescent materials include luciferase,
luciferin, and aequorin, and examples of suitable radioactive
material include .sup.125I, .sup.131I, .sup.35S or .sup.3H.
Drug Screening Assays
[0634] The invention provides a method (also referred to herein as
a "screening assay") for identifying modulators, i.e., candidate or
test compounds or agents (e.g., preferably small molecules, but
also peptides, peptidomimetics or other drugs) which bind to
THAP-family or THAP domain proteins, have an inhibitory or
activating effect on, for example, THAP-family expression or
preferably THAP-family activity, or have an inhibitory or
activating effect on, for example, the activity of an THAP-family
target molecule. In some embodiments small molecules can be
generated using combinatorial chemistry or can be obtained from a
natural products library. Assays may be cell based, non-cell-based
or in vivo assays. Drug screening assays may be binding assays or
more preferentially functional assays, as further described.
[0635] In general, any suitable activity of a THAP-family protein
can be detected in a drug screening assay, including: (1) mediating
apoptosis or cell proliferation when expressed or introduced into a
cell, most preferably inducing or enhancing apoptosis, and/or most
preferably reducing cell proliferation; (2) mediating apoptosis or
cell proliferation of an endothelial cell; (3) mediating apoptosis
or cell proliferation of a hyperproliferative cell; (4) mediating
apoptosis or cell proliferation of a CNS cell, preferably a
neuronal or glial cell; (5) an activity indicative of a biological
function in an animal selected from the group consisting of
mediating, preferably inhibiting angiogenesis, mediating,
preferably inhibiting inflammation, inhibition of metastatic
potential of cancerous tissue, reduction of tumor burden, increase
in sensitivity to chemotherapy or radiotherapy, killing a cancer
cell, inhibition of the growth of a cancer cell, or induction of
tumor regression; or (6) interaction with a THAP family target
molecule or THAP domain target molecule, preferably interaction
with a protein or a nucleic acid.
[0636] The invention also provides a method (also referred to
herein as a "screening assay") for identifying modulators, i.e.,
candidate or test compounds or agents (e.g., preferably small
molecules, but also peptides, peptidomimetics or other drugs) which
bind to THAP1, PAR4 or PML-NB proteins, and have an inhibitory or
activating effect on PAR4 or THAP1 recruitment or binding to or
association with PML-NBs or interaction, such as binding, of SLC
with a THAP-family polypeptide or a cellular response to SLC which
is mediated by a THAP-family polypeptide.
[0637] In one embodiment, the invention provides assays for
screening candidate or test compounds which are target molecules of
a THAP family or THAP domain polypeptide, or a biologically active
fragment or homologue thereof. In another embodiment, the invention
provides assays for screening candidate or test compounds which
bind to or modulate the activity of a THAP family or THAP domain
polypeptide, or a biologically active fragment or homologue
thereof. The test compounds of the present invention can be
obtained using any of the numerous approaches in combinatorial
library methods known in the art, including: biological libraries;
spatially addressable parallel solid phase or solution phase
libraries; synthetic library methods requiring deconvolution; the
`one-bead one-compound` library method; and synthetic library
methods using affinity chromatography selection. The biological
library approach is used with peptide libraries, while the other
four approaches are applicable to peptide, non-peptide oligomer or
small molecule libraries of compounds (Lam, K. S. (1997) Anticancer
Drug Des. 12:145, the disclosure of which is incorporated herein by
reference in its entirety).
[0638] Examples of methods for the synthesis of molecular libraries
can be found in the art, for example in: DeWitt et al. (1993) Proc.
Natl. Acad. Sci. U.S.A. 90:6909; Erb et al. (1994) Proc. Natl.
Acad. Sci. USA 91:11422; Zuckermann et al. (1994). J. Med. Chem.
37:2678; Cho et al. (1993) Science 261:1303; Carrell et al. (1994)
Angew. Chem. Int. Ed. Engl. 33:2059; Carell et al. (1994) Angew.
Chem. Int. Ed. Engl. 33:2061; and in Gallop et al. (1994) J. Med.
Chem. 37:1233, the disclosures of which are incorporated herein by
reference in their entireties.
[0639] Libraries of compounds may be presented in solution (e.g.,
Houghten (1992) Biotechniques 13:412-421), or on beads (Lam (1991)
Nature 354:82-84), chips (Fodor (1993) Nature 364:555-556),
bacteria (Ladner U.S. Pat. No. 5,223,409), spores (Ladner U.S. Pat.
No. '409), plasmids (Cull et al. (1992) Proc Natl Acad Sci USA
89:1865-1869) or on phage (Scott and Smith (1990) Science
249:386-390); (Devin (1990) Science 249:404-406); (Cwirla et al.
(1990) Proc. Natl. Acad. Sci. 87:6378-6382); (Felici (1991) J. Mol.
Biol. 222:301-310); (Ladner supra.), the disclosures of which are
incorporated herein by reference in their entireties.
[0640] Determining the ability of the test compound to inhibit or
increase THAP-family polypeptide activity can also be accomplished,
for example, by coupling the THAP family or THAP domain
polypeptide, or a biologically active fragment or homologue thereof
with a radioisotope or enzymatic label such that binding of the
THAP family or THAP domain polypeptide, or a biologically active
fragment or homologue thereof to its cognate target molecule can be
determined by detecting the labeled THAP family or THAP domain
polypeptide, or a biologically active fragment or homologue thereof
in a complex. For example, compounds (e.g., THAP family or THAP
domain polypeptide, or a biologically active fragment or homologue
thereof) can be labeled with .sup.125I, .sup.35S, .sup.14C, or
.sup.3H, either directly or indirectly, and the radioisotope
detected by direct counting of radioemmission or by scintillation
counting. Alternatively, compounds can be enzymatically labeled
with, for example, horseradish peroxidase, alkaline phosphatase, or
luciferase, and the enzymatic label detected by determination of
conversion of an appropriate substrate to product. The labeled
molecule is placed in contact with its cognate molecule and the
extent of complex formation is measured. For example, the extent of
complex formation may be measured by immuno precipitating the
complex or by performing gel electrophoresis.
[0641] It is also within the scope of this invention to determine
the ability of a compound (e.g., THAP family or THAP domain
polypeptide, or biologically active fragment or homologue thereof)
to interact with its cognate target molecule without the labeling
of any of the interactants. For example, a microphysiometer can be
used to detect the interaction of a compound with its cognate
target molecule without the labeling of either the compound or the
target molecule. McConnell, H. M. et al. (1992) Science
257:1906-1912, the disclosure of which is incorporated herein by
reference in its entirety. A microphysiometer such as a cytosensor
is an analytical instrument that measures the rate at which a cell
acidifies its environment using a light-addressable potentiometric
sensor (LAPS). Changes in this acidification rate can be used as an
indicator of the interaction between compound and cognate target
molecule.
[0642] In a preferred embodiment, the assay comprises contacting a
cell which expresses a THAP family or THAP domain polypeptide, or
biologically active fragment or homologue thereof, with a
THAP-family or THAP domain protein target molecule to form an assay
mixture, contacting the assay mixture with a test compound, and
determining the ability of the test compound to inhibit or increase
the activity of the THAP family or THAP domain polypeptide, or
biologically active fragment or homologue thereof, wherein
determining the ability of the test compound to inhibit or increase
the activity of the THAP family or THAP domain polypeptide, or
biologically active fragment or homologue thereof, comprises
determining the ability of the test compound to inhibit or increase
a biological activity of the THAP-family polypeptide expressing
cell.
[0643] In another embodiment, the assay comprises contacting a cell
which expresses a THAP family or THAP domain polypeptide, or
biologically active fragment or homologue thereof, with a test
compound, and determining the ability of the test compound to
inhibit or increase the activity of the THAP family or THAP domain
polypeptide, or biologically active fragment or homologue thereof,
wherein determining the ability of the test compound to inhibit or
increase the activity of the THAP family or THAP domain
polypeptide, or biologically active fragment or homologue thereof,
comprises determining the ability of the test compound to inhibit
or increase a biological activity of the THAP-family polypeptide
expressing cell.
[0644] In another preferred embodiment, the assay comprises
contacting a cell which is responsive to a THAP family or THAP
domain polypeptide, or a biologically active fragment or homologue
thereof, with a THAP-family protein or biologically-active portion
thereof, to form an assay mixture, contacting the assay mixture
with a test compound, and determining the ability of the test
compound to modulate the activity of the THAP-family protein or
biologically active portion thereof, wherein determining the
ability of the test compound to modulate the activity of the
THAP-family protein or biologically active portion thereof
comprises determining the ability of the test compound to modulate
a biological activity of the THAP-family polypeptide-responsive
cell (e.g., determining the ability of the test compound to
modulate a THAP-family polypeptide activity.
[0645] In another embodiment, an assay is a cell-based assay
comprising contacting a cell expressing a THAP-family target
molecule (i.e. a molecule with which THAP-family polypeptide
interacts) with a test compound and determining the ability of the
test compound to modulate (e.g. stimulate or inhibit) the activity
of the THAP-family target molecule. Determining the ability of the
test compound to modulate the activity of a THAP-family target
molecule can be accomplished, for example, by determining the
ability of the THAP family or THAP domain polypeptide, or a
biologically active fragment or homologue thereof to bind to or
interact with the THAP-family target molecule.
[0646] Determining the ability of the THAP family or THAP domain
polypeptide, or a biologically active fragment or homologue thereof
to bind to or interact with a THAP-family target molecule can be
accomplished by one of the methods described above for determining
direct binding. In a preferred embodiment, determining the ability
of the THAP family or THAP domain polypeptide, or a biologically
active fragment or homologue thereof to bind to or interact with a
THAP-family target molecule can be accomplished by determining the
activity of the target molecule. For example, the activity of the
target molecule can be determined by contacting the target molecule
with the THAP family or THAP domain polypeptide, or a biologically
active fragment or homologue thereof and measuring induction of a
cellular second messenger of the target (i.e. intracellular
Ca.sup.2+, diacylglycerol, IP.sub.3, etc.), detecting
catalytic/enzymatic activity of the target an appropriate
substrate, detecting the induction of a reporter gene (comprising a
target-responsive regulatory element operatively linked to a
nucleic acid encoding a detectable marker, e.g., luciferase), or
detecting a target-regulated cellular response, for example, signal
transduction or protein:protein interactions.
[0647] In yet another embodiment, an assay of the present invention
is a cell-free assay in which a THAP family or THAP domain
polypeptide, or a biologically active fragment or homologue thereof
is contacted with a test compound and the ability of the test
compound to bind to the THAP family or THAP domain polypeptide, or
a biologically active fragment or homologue thereof is determined.
Binding of the test compound to the THAP family or THAP domain
polypeptide, or a biologically active fragment or homologue thereof
can be determined either directly or indirectly as described above.
In a preferred embodiment, the assay includes contacting the THAP
family or THAP domain polypeptide, or a biologically active
fragment or homologue thereof with a known compound which binds
THAP-family polypeptide (e.g., a THAP-family target molecule) to
form an assay mixture, contacting the assay mixture with a test
compound, and determining the ability of the test compound to
interact with a THAP family or THAP domain polypeptide, or a
biologically active fragment or homologue thereof, wherein
determining the ability of the test compound to interact with a
THAP-family protein comprises determining the ability of the test
compound to preferentially bind to THAP family or THAP domain
polypeptide, or a biologically active fragment or homologue thereof
as compared to the known compound.
[0648] In another embodiment, the assay is a cell-free assay in
which a THAP family or THAP domain polypeptide, or a biologically
active fragment or homologue thereof is contacted with a test
compound and the ability of the test compound to modulate (e.g.,
stimulate or inhibit) the activity of the THAP family or THAP
domain polypeptide, or a biologically active fragment or homologue
thereof is determined. Determining the ability of the test compound
to modulate the activity of a THAP-family protein can be
accomplished, for example, by determining the ability of the THAP
family or THAP domain polypeptide, or a biologically active
fragment or homologue thereof to bind to a THAP-family target
molecule by one of the methods described above for determining
direct binding. Determining the ability of the THAP family or THAP
domain polypeptide, or a biologically active fragment or homologue
thereof to bind to a THAP-family target molecule can also be
accomplished using a technology such as real-time Biomolecular
Interaction Analysis (BIA). Sjolander, S, and Urbaniczky, C. (1991)
Anal. Chem. 63:2338-2345 and Szabo et al. (1995) Curr. Opin.
Struct. Biol. 5:699-705, the disclosures of which are incorporated
herein by reference in their entireties. As used herein, "BIA" is a
technology for studying biospecific interactions in real time,
without labeling any of the interactants (e.g., BIAcore). Changes
in the optical phenomenon of surface plasmon resonance (SPR) can be
used as an indication of real-time reactions between biological
molecules.
[0649] In an alternative embodiment, determining the ability of the
test compound to modulate the activity of a THAP family or THAP
domain polypeptide, or a biologically active fragment or homologue
thereof can be accomplished by determining the ability of the THAP
family or THAP domain polypeptide, or a biologically active
fragment or homologue thereof to further modulate the activity of a
downstream effector (e.g., a growth factor mediated signal
transduction pathway component) of a THAP-family target molecule.
For example, the activity of the effector molecule on an
appropriate target can be determined or the binding of the effector
to an appropriate target can be determined as previously
described.
[0650] In yet another embodiment, the cell-free assay involves
contacting a THAP family or THAP domain polypeptide, or a
biologically active fragment or homologue thereof with a known
compound which binds the THAP-family protein to form an assay
mixture, contacting the assay mixture with a test compound, and
determining the ability of the test compound to interact with the
THAP-family protein, wherein determining the ability of the test
compound to interact with the THAP-family protein comprises
determining the ability of the THAP family or THAP domain
polypeptide, or a biologically active fragment or homologue thereof
to preferentially bind to or modulate the activity of a THAP-family
target molecule.
[0651] The cell-free assays of the present invention are amenable
to use of both soluble and/or membrane-bound forms of isolated
proteins (e.g. THAP family or THAP domain polypeptide, or a
biologically active fragment or homologue thereof or molecules to
which THAP-family targets bind). In the case of cell-free assays in
which a membrane-bound form an isolated protein is used it may be
desirable to utilize a solubilizing agent such that the
membrane-bound form of the isolated protein is maintained in
solution. Examples of such solubilizing agents include non-ionic
detergents such as n-octylglucoside, n-dodecylglucoside,
n-dodecylmaltoside, octanoyl-N-methylglucamide,
decanoyl-N-methylglucamide, Triton.[.TM.. X-100, Triton..TM..
X-114, Thesit..TM..], Isotridecypoly(ethylene glycol
ether).sub.n,3-[(3-cholamidopropyl)dimethylamminio]-1-propane
sulfonate (CHAPS),
3-[(3-cholamidopropyl)dimethylamminio]-2-hydroxy-1-propane
sulfonate (CHAPSO), or N-dodecyl=N,N-dimethyl-3-ammonio-1-propane
sulfonate.
[0652] In more than one embodiment of the above assay methods of
the present invention, it may be desirable to immobilize either
THAP family or THAP domain polypeptide, or a biologically active
fragment or homologue thereof or a target molecule thereof to
facilitate separation of complexed from uncomplexed forms of one or
both of the proteins, as well as to accommodate automation of the
assay. Binding of a test compound to a THAP family or THAP domain
polypeptide, or a biologically active fragment or homologue
thereof, or interaction of a THAP-family protein with a target
molecule in the presence and absence of a candidate compound, can
be accomplished in any vessel suitable for containing the
reactants. Examples of such vessels include microtitre plates, test
tubes, and micro-centrifuge tubes. In one embodiment, a fusion
protein can be provided which adds a domain that allows one or both
of the proteins to be bound to a matrix. For example,
glutathione-S-transferase/THAP-family fusion proteins or
glutathione-S-transferase/target fusion proteins can be adsorbed
onto glutathione sepharose beads (Sigma Chemical, St. Louis, Mo.)
or glutathione derivatized microtitre plates, which are then
combined with the test compound or the test compound and either the
non-adsorbed target protein or THAP-family protein, and the mixture
incubated under conditions conducive to complex formation (e.g., at
physiological conditions for salt and pH). Following incubation,
the beads or microtitre plate wells are washed to remove any
unbound components, the matrix immobilized in the case of beads,
complex determined either directly or indirectly, for example, as
described above. Alternatively, the complexes can be dissociated
from the matrix, and the level of THAP-family polypeptide binding
or activity determined using standard techniques.
[0653] Other techniques for immobilizing proteins on matrices can
also be used in the screening assays of the invention. For example,
either a THAP-family protein or a THAP-family target molecule can
be immobilized utilizing conjugation of biotin and streptavidin.
Biotinylated THAP-family protein or target molecules can be
prepared from biotin-NHS (N-hydroxy-succinimide) using techniques
well known in the art (e.g., biotinylation kit, Pierce Chemicals,
Rockford, Ill.), and immobilized in the wells of
streptavidin-coated 96 well plates (Pierce Chemical).
Alternatively, antibodies reactive with a THAP-family protein or
target molecule but which do not interfere with binding of the
THAP-family protein to its target molecule can be derivatized to
the wells of the plate, and unbound target or THAP-family protein
trapped in the wells by antibody conjugation. Methods for detecting
such complexes, in addition to those described above for the
GST-immobilized complexes, include immunodetection of complexes
using antibodies reactive with the THAP-family protein or target
molecule, as well as enzyme-linked assays which rely on detecting
an enzymatic activity associated with the THAP-family protein or
target molecule.
[0654] In another embodiment, modulators of THAP-family or THAP
domain polypeptides expression are identified in a method wherein a
cell is contacted with a candidate compound and the expression of
THAP-family or THAP domain polypeptides mRNA or protein in the cell
is determined. The level of expression of THAP-family polypeptide
mRNA or protein in the presence of the candidate compound is
compared to the level of expression of THAP-family polypeptide or
THAP domain mRNA or protein in the absence of the candidate
compound. The candidate compound can then be identified as a
modulator of THAP-family polypeptide expression based on this
comparison. For example, when expression of THAP-family polypeptide
or THAP domain mRNA or protein is greater (statistically
significantly greater) in the presence of the candidate compound
than in its absence, the candidate compound is identified as a
stimulator of THAP-family polypeptide or THAP domain mRNA or
protein expression. Alternatively, when expression of THAP-family
polypeptide or THAP domain mRNA or protein is less (statistically
significantly less) in the presence of the candidate compound than
in its absence, the candidate compound is identified as an
inhibitor of THAP-family polypeptide or THAP domain mRNA or protein
expression. The level of THAP-family polypeptide or THAP domain
mRNA or protein expression in the cells can be determined by
methods described herein for detecting THAP-family polypeptide or
THAP domain mRNA or protein.
[0655] In yet another aspect of the invention, the THAP family or
THAP domain polypeptide, or a biologically active fragment or
homologue thereof can be used as "bait proteins" in a two-hybrid
assay or three-hybrid assay using the methods described above for
use in THAP-family polypeptide/PAR4 interactions assays, to
identify other proteins which bind to or interact with THAP-family
polypeptide ("THAP-family-binding proteins" or "THAP-family-bp")
and are involved in THAP-family polypeptide activity. Such
THAP-family- or THAP domain-binding proteins are also likely to be
involved in the propagation of signals by the THAP-family or THAP
domain proteins or THAP-family or THAP domain proteins targets as,
for example, downstream elements of a THAP-family polypeptide- or
THAP domain-mediated signaling pathway. Alternatively, such
THAP-family-binding proteins are likely to be THAP-family
polypeptides inhibitors.
THAP/DNA Binding Assays
[0656] In another embodiment of the invention a method is provided
for identifying compounds which interfere with THAP-family DNA
binding activity, comprising the steps of: contacting a THAP-family
protein or a portion thereof immobilized on a solid support with
both a test compound and DNA fragments, or contacting a DNA
fragment immobilized on a solid support with both a test compound
and a THAP-family protein. The binding between DNA and the
THAP-protein or a portion thereof is detected, wherein a decrease
in DNA binding when compared to DNA binding in the absence of the
test compound indicates that the test compound is an inhibitor of
THAP-family DNA binding activity, and an increase in DNA binding
when compared to DNA binding in the absence of the test compound
indicates that the test compound is an inducer of or restores
THAP-family DNA binding activity. As discussed further, DNA
fragments may be selected to be specific THAP-family protein target
DNA obtained for example as described in Example 28, or may be
non-specific THAP-family target DNA. Methods for detecting
protein-DNA interactios are well known in the art, including most
commonly used electrophoretic mobility shift assays (EMSAs) or by
filter binding (Zabel et al, (1991) J. Biol. Chem., 266:252; and
Okamoto and Beach, (1994) Embo J. 13: 4816). Other assays are
available which are amenable for high throughput detection and
quantification of specific and nonspecific DNA binding (Amersham,
N.J.; and Gal S. et al, 6.sup.th Ann. Conf. Soc. Biomol. Screening,
6-9 Sep. 2000, Vancouver, B.C.).
[0657] In a first aspect, a screening assay involves identifying
compounds which interfere with THAP-family DNA binding activity
without prior knowledge about specific THAP-family binding
sequences. For example, a THAP-family protein is contacted with
both a test compound and a library of oligonucleotides or a sample
of DNA fragments not selected based on specific DNA sequences.
Preferably the THAP-family protein is immobilized on a solid
support (such as an array or a column). Unbound DNA is separated
from DNA which is bound to the THAP-family protein, and the DNA
which is bound to THAP-family protein is detected and can be
quantitated by any means known in the art. For example, the DNA
fragment is labelled with a detectable moiety, such as a
radioactive moiety, a calorimetric moiety or a fluorescent moiety.
Techniques for so labelling DNA are well known in the art.
[0658] The DNA which is bound to the THAP-family protein or a
portion thereof is separated from unbound DNA by
immunoprecipitation with antibodies which are specific for the
THAP-family protein or a portion thereof. Use of two different
monoclonal anti-THAP-family antibodies may result in more complete
immunoprecipitation than either one alone. The amount of DNA which
is in the immunoprecipitate can be quantitated by any means known
in the art. THAP-family proteins or portions thereof which bind to
the DNA can also be detected by gel shift assays (Tan, Cell,
62:367, 1990), nuclease protection assays, or methylase
interference assays.
[0659] It is still another object of the invention to provide
methods for identifying compounds which restore the ability of
mutant THAP-family proteins or portions thereof to bind to DNA
sequences. In one embodiment a method of screening agents for use
in therapy is provided comprising: measuring the amount of binding
of a THAP-family protein or a portion thereof which is encoded by a
mutant gene found in cells of a patient to DNA molecules,
preferably random oligonucleotides or DNA fragments from a nucleic
acid library; measuring the amount of binding of said THAP-family
protein or a portion thereof to said nucleic acid molecules in the
presence of a test substance; and comparing the amount of binding
of the THAP-family protein or a portion thereof in the presence of
said test substance to the amount of binding of the THAP-family
protein in the absence of said test substance, a test substance
which increases the amount of binding being a candidate for use in
therapy.
[0660] In another embodiment of the invention, oligonucleotides can
be isolated which restore to mutant THAP-family proteins or
portions thereof the ability to bind to a consensus binding
sequence or conforming sequences. Mutant THAP-family protein or a
portion thereof and random oligonucleotides are added to a solid
support on which THAP-family-specific DNA fragments are
immobilized. Oligonucleotides which bind to the solid support are
recovered and analyzed. Those whose binding to the solid support is
dependent on the presence of the mutant THAP-family protein are
presumptively binding the support by binding to and restoring the
conformation of the mutant protein.
[0661] If desired, specific binding can be distinguished from
non-specific binding by any means known in the art. For example,
specific binding interactions are stronger than non-specific
binding interactions. Thus the incubation mixture can be subjected
to any agent or condition which destabilizes protein/DNA
interactions such that the specific binding reaction is the
predominant one detected. Alternatively, as taught more
specifically below, a non-specific competitor, such as dI-dC, can
be added to the incubation mixture. If the DNA containing the
specific binding sites is labelled and the competitor is unlabeled,
then the specific binding reactions will be the ones predominantly
detected upon measuring labelled DNA.
[0662] According to another embodiment of the invention, after
incubation of THAP-family protein or a portion thereof with
specific DNA fragments all components of the cell lysate which do
not bind to the DNA fragments are removed. This can be
accomplished, among other ways, by employing DNA fragments which
are attached to an insoluble polymeric support such as agarose,
cellulose and the like. After binding, all non-binding components
can be washed away, leaving THAP-family protein or a portion
thereof bound to the DNA/solid support. The THAP-family protein or
a portion thereof can be quantitated by any means known in the art.
It can be determined using an immunological assay, such as an
ELISA, RIA or Western blotting.
[0663] In another embodiment of the invention a method is provided
for identifying compounds which specifically bind to
THAP-family-specific-DNA sequences, comprising the steps of:
contacting a THAP-family-specific DNA fragment immobilized on a
solid support with both a test compound and wild-type THAP-family
protein or a portion thereof to bind the wild-type THAP-family
protein or a portion thereof to the DNA fragment; determining the
amount of wild-type THAP-family protein which is bound to the DNA
fragment, inhibition of binding of wild-type THAP-family protein by
the test compound with respect to a control lacking the test
compound suggesting binding of the test compound to the
THAP-family-specific DNA binding sequences.
[0664] It is still another object of the invention to provide
methods for identifying compounds which restore the ability of
mutant THAP-family proteins or portions thereof to bind to specific
DNA binding sequences. In one embodiment a method of screening
agents for use in therapy is provided comprising: measuring the
amount of binding of a THAP-family protein or a portion thereof
which is encoded by a mutant gene found in cells of a patient to a
DNA molecule which comprises more than one monomer of a specific
THAP-family target nucleotide sequence; measuring the amount of
binding of said THAP-family protein to said nucleic acid molecule
in the presence of a test substance; and comparing the amount of
binding of the THAP-family protein in the presence of said test
substance to the amount of binding of the THAP-family protein or a
portion thereof in the absence of said test substance, a test
substance which increases the amount of binding being a candidate
for use in therapy.
[0665] In another embodiment of the invention a method is provided
for screening agents for use in therapy comprising: contacting a
transfected cell with a test substance, said transfected cell
containing a THAP-family protein or a portion thereof which is
encoded by a mutant gene found in cells of a patient and a reporter
gene construct comprising a reporter gene which encodes an
assayable product and a sequence which conforms to a THAP-family
DNA binding site, wherein said sequence is upstream from and
adjacent to said reporter gene; and determining whether the amount
of expression of said reporter gene is altered by the test
substance, a test substance which alters the amount of expression
of said reporter gene being a candidate for use in therapy.
[0666] In still another embodiment a method of screening agents for
use in therapy is provided comprising: adding RNA polymerase
ribonucleotides and a THAP-family protein or a portion thereof to a
transcription construct, said transcription construct comprising a
reporter gene which encodes an assayable product and a sequence
which conforms to a THAP-family consensus binding site, said
sequence being upstream from and adjacent to said reporter gene,
said step of adding being effected in the presence and absence of a
test substance; determining whether the amount of transcription of
said reporter gene is altered by the presence of said test
substance, a test substance which alters the amount of
transcription of said reporter gene being a candidate for use in
therapy.
[0667] According to the present invention compounds which have
THAP-family activity are those which specifically complex with a
THAP-family-specific DNA binding site. Oligonucleotides and
oligonucleotide containing nucleotide analogs are also contemplated
among those compounds which are able to complex with a
THAP-family-specific DNA binding site.
Further Assays to Modulate THAP-Family Polypeptide Activity In
Vivo
[0668] It will be appreciated that any suitable assay that allows
detection of THAP-family polypeptide or THAP domain activity can be
used. Examples of assays for testing protein interaction, nucleic
acid binding or modulation of apoptosis in the presence or absence
of a test compound are further described herein. Thus, the
invention encompasses a method of identifying a candidate
THAP-family polypeptide modulator (e.g. activator or inhibitor),
said method comprising:
[0669] a) providing a cell comprising a THAP family or THAP domain
polypeptide, or a biologically active fragment or homolog
thereof;
[0670] b) contacting said cell with a test compound; and
[0671] c) determining whether said compound selectively modulates
(e.g. activates or inhibits) THAP-family polypeptide activity,
preferably pro-apoptotic activity, or THAP family or THAP domain
target binding; wherein a determination that said compound
selectively modulates (e.g. activates or inhibits) the activity of
said polypeptide indicates that said compound is a candidate
modulator (e.g. activator or inhibitor respectively) of said
polypeptide. Preferably, the THAP family or THAP domain target is a
protein or nucleic acid.
[0672] Preferably the cell is a cell which has been transfected
with an recombinant expression vector encoding a THAP family or
THAP domain polypeptide, or a biologically active fragment or
homologue thereof.
[0673] Several examples of assays for the detection of apoptosis
are described herein, in the section titled "Apoptosis assays".
Several examples of assays for the detection of THAP family or THAP
domain target interactions are described herein, including assays
for detection of protein interactions and nucleic acid binding.
[0674] In one example of an assay for apoptosis activity, a high
throughput screening assay for molecules that abrogate or stimulate
THAP-family polypeptide proapoptotic activity is provided based on
serum-withdrawal induced apoptosis in a 3T3 cell line with
tetracycline-regulated expression of a THAP family or THAP domain
polypeptide, or a biologically active fragment or homologue
thereof. Apoptotic cells can be detected by TUNEL labeling in 96-
or 384-wells microplates. A drug screening assay can be carried out
along the lines as described in Example 23. 3T3 cells, which have
previously been used to analyze the pro-apoptotic activity of PAR4
(Diaz-Meco et al, 1996; Berra et al., 1997), can be transfected
with expression vectors encoding a THAP-family or THAP domain
polypeptide allowing the ectopic expression of THAP-family
polypeptide. Then, the apoptotic response to serum withdrawal is
assayed in the presence of a test compound, allowing the
identification of test compounds that either enhance or inhibit the
ability of THAP-family or THAP domain polypeptide to induce
apoptosis. Transfected cells are deprived of serum and cells with
apoptotic nuclei are counted. Apoptotic nuclei can be counted by
DAPI staining and in situ TUNEL assays.
Further THAP-Family Polypeptide/THAP-Target Interaction Assays
[0675] In exemplary methods THAP/THAP target interaction assays are
described in the context of THAP1 and the THAP target Par4.
However, it will be appreciated that assays for screening for
modulators of other THAP family members or THAP domains and other
THAP target molecules may be carried out by substituting these for
THAP1 and Par4 in the methods below. For example, in some
embodiments, modulators which affect the interaction between a
THAP-family polypeptide and SLC are identified.
[0676] As demonstrated in Examples 4, 5, 6, and 7 and FIGS. 3, 4
and 5, the inventors have demonstrated using several experimental
methods that THAP1 interacts with the pro-apoptotic protein Par4.
In particular, it has been shown that THAP1 interacts with Par4
wild type (Par4) and a Par4 death domain (Par4DD) in a yeast
two-hybrid system. Yeast cells were cotransformed with BD7-THAP1
and AD7-Par4, AD7, AD7-Par4DD or AD7-Par4) expression vectors.
Transformants were selected on media lacking histidine and adenine.
Identical results were obtained by cotransformation of AD7-THAP1
with BD7-Par4, BD7, BD7-Par4DD or BD7-Par4).
[0677] The inventors have also demonstrated in vitro binding of
THAP1 to GST-Par4DD. Par4DD was expressed as a GST fusion protein,
purified on glutathione sepharose and employed as an affinity
matrix for binding of in vitro translated .sup.35S-methionine
labeled THAP1. GST served as negative control.
[0678] Furthermore, the inventors have shown that THAP1 interacts
with both Par4DD and SLC in vivo. Myc-Par4DD and GFP-THAP1
expression vectors were cotransfected in primary human endothelial
cells. Myc-Par4DD was stained with monoclonal anti-myc antibody.
Green fluorescence, GFP-THAP1; red fluorescence, Par4DD.
[0679] The invention thus encompasses assays for the identification
of molecules that modulate (stimulate or inhibit) THAP-family
polypeptide/PAR4 binding. In preferred embodiments, the invention
includes assays for the identification of molecules that modulate
(stimulate or inhibit) THAP1/PAR4 binding or THAP1/SLC binding.
[0680] Four examples of high throughput screening assays
include:
[0681] 1) a two hybrid-based assay in yeast to find drugs that
disrupt interaction of the THAP-family bait with the PAR4 or SLC as
prey
[0682] 2) an in vitro interaction assay using recombinant
THAP-family polypeptide and PAR4 or SLC proteins
[0683] 3) a chip-based binding assay using recombinant THAP-family
polypeptide and PAR4 or SLC proteins
[0684] 2) a fluorescence resonance energy transfer (FRET)
cell-based assay using THAP-family polypeptide and PAR4 or SLC
proteins fused with fluorescent proteins
[0685] The invention thus encompasses a method of identifying a
candidate THAP-family polypeptide/PAR4 or SLC interaction
modulator, said method comprising:
[0686] a) providing a THAP family or THAP domain polypeptide, or a
biologically active fragment or homologue thereof and a PAR4 or SLC
polypeptide or fragment thereof;
[0687] b) contacting said THAP family or THAP domain polypeptide
with a test compound; and
[0688] c) determining whether said compound selectively modulates
(e.g. activates or inhibits) THAP-family/PAR4 or SLC interaction
activity.
[0689] Also envisioned is a method comprising:
[0690] a) providing a cell comprising a THAP family or THAP domain
polypeptide, or a biologically active fragment or homologue thereof
and a PAR4 or SLC polypeptide or fragment thereof;
[0691] b) contacting said cell with a test compound; and
[0692] c) determining whether said compound selectively modulates
(e.g. activates or inhibits) THAP-family/PAR4 or SLC interaction
activity.
[0693] In general, any suitable assay for the detection of
protein-protein interaction may be used.
[0694] In one example, a THAP family or THAP domain polypeptide, or
a biologically active fragment or homologue thereof can be used as
a "bait protein" and a PAR4 or SLC protein can be used as a "prey
protein" (or vice-versa) in a two-hybrid assay (see, e.g., U.S.
Pat. No. 5,283,317; Zervos et al. (1993) Cell 72:223-232; Madura et
al. (1993) J. Biol. Chem. 268:12046-12054; Bartel et al. (1993)
Biotechniques 14:920-924; Iwabuchi et al. (1993) Oncogene
8:1693-1696; and Brent WO94/10300, the disclosures of which are
incorporated herein by reference in their entireties). The
two-hybrid system is based on the modular nature of most
transcription factors, which consist of separable DNA-binding and
activation domains. Briefly, the assay utilizes two different DNA
constructs. In one construct, the gene that codes for a THAP family
or THAP domain polypeptide, or a biologically active fragment or
homologue thereof is fused to a gene encoding the DNA binding
domain of a known transcription factor (e.g., GAL-4). In the other
construct, the gene that codes for a THAP family or THAP domain
polypeptide, or a biologically active fragment or homologue thereof
("prey" or "sample") is fused to a gene that codes for the
activation domain of the known transcription factor. If the "bait"
and the "prey" proteins are able to interact, in vivo, forming a
THAP-family polypeptide/PAR4 complex, the DNA-binding and
activation domains of the transcription factor are brought into
close proximity. This proximity allows transcription of a reporter
gene (e.g., LacZ) which is operably linked to a transcriptional
regulatory site responsive to the transcription factor. Expression
of the reporter gene can be detected and cell colonies containing
the functional transcription factor can be isolated and used to
obtain the cloned gene which encodes the protein which interacts
with the THAP-family protein. This assay can thus be carried out in
the presence or absence of a test compound, whereby modulation of
THAP-family polypeptide/PAR4 or SLC interaction can be detected by
lower or lack of transcription of the reported gene.
[0695] In other examples, in vitro THAP-family polypeptide/PAR4 or
SLC interaction assays can be carried out, several examples of
which are further described herein. For example, a recombinant THAP
family or THAP domain polypeptide, or a biologically active
fragment or homologue thereof is contacted with a recombinant PAR4
or SLC protein or biologically active portion thereof, and the
ability of the PAR4 or SLC protein to bind to the THAP-family
protein is determined. Binding of the PAR4 or SLC protein compound
to the THAP-family protein can be determined either directly or
indirectly as described herein. In a preferred embodiment, the
assay includes contacting the THAP family or THAP domain
polypeptide, or a biologically active fragment or homologue thereof
with a PAR4 or SLC protein which binds a THAP-family protein (e.g.,
a THAP-family target molecule) to form an assay mixture, contacting
the assay mixture with a test compound, and determining the ability
of the test compound to interact with a THAP-family protein,
wherein determining the ability of the test compound to interact
with a THAP-family protein comprises determining the ability of the
test compound to preferentially bind to THAP-family or biologically
active portion thereof as compared to the PAR4 or SLC protein. For
example, the step of determining the ability of the test compound
to interact with a THAP-family protein may comprise determining the
ability of the compound to displace Par4 or SLC from a THAP-family
protein/Par4 or SLC complex thereby forming a THAP-family
protein/compound complex. Alternatively, it will be appreciated
that it is also possible to determine the ability of the test
compound to interact with a PAR4 or SLC protein, wherein
determining the ability of the test compound to interact with a
PAR4 or SLC protein comprises determining the ability of the test
compound to preferentially bind to PAR4 or SLC or biologically
active portion thereof as compared to the THAP-family protein. For
example, the step of determining the ability of the test compound
to interact with a THAP-family protein may comprise determining the
ability of the compound to displace Par4 or SLC from a THAP-family
protein/Par4 or SLC complex thereby forming a THAP-family
protein/compound complex.
Assays to Modulate THAP-Family Polypeptide and/or Par4 Trafficking
in the PML Nuclear Bodies (PML NBs)
[0696] As demonstrated in Examples 8 and 9, the inventors have
demonstrated using several experimental methods that THAP1 and Par4
localize in PML NBs.
[0697] The inventors demonstrated that THAP1 is a novel protein
associated with PML-nuclear bodies. Double immunofluorescence
staining showed colocalization of THAP1 with PML-NBs proteins, PML
and Daxx. Primary human endothelial cells were transfected with
GFP-THAP1 expression vector; endogenous PML and Daxx were stained
with monoclonal anti-PML and polyclonal anti-Daxx antibodies,
respectively.
[0698] The inventors also demonstrated that Par4 is a novel
component of PML-NBs that colocalizes with THAP1 in vivo by several
experiments. In one experiments, double immunofluorescence staining
revealed colocalization of Par4 and PML at PML-NBs in primary human
endothelial cells or fibroblasts. Endogenous PAR4 and PML were
stained with polyclonal anti-PAR4 and monoclonal anti-PML
antibodies, respectively. In another experiment, double staining
revealed colocalization of Par4 and THAP1 in cells expressing
ectopic GFP-THAP1. Primary human endothelial cells or fibroblasts
were transfected with GFP-THAP1 expression vector; endogenous Par4
was stained with polyclonal anti-PAR4 antibodies.
[0699] The inventors further demonstrated that PML recruits the
THAP1/Par4 complex to PML-NBs. Triple immunofluorescence staining
showed colocalization of THAP1, Par4 and PML in cells
overexpressing PML and absence of colocalization in cells
expressing ectopic Sp100. Hela cells were cotransfected with
GFP-THAP1 and HA-PML or HA-SP100 expression vectors; HA-PML or
HA-SP100 and endogenous Par4 were stained with monoclonal anti-HA
and polyclonal anti-Par4 antibodies, respectively.
Assays to Modulate THAP Family Protein Trafficking in the PML
Nuclear Bodies
[0700] Provided are assays for the identification of drugs that
modulate (stimulate or inhibit) THAP-family or THAP domain protein,
particularly THAP1, binding to PML-NB proteins or localization to
PML-NBs. In general, any suitable assay for the detection of
protein-protein interaction may be used. Two examples of high
throughput screening assays include 1) a two hybrid-based assay in
yeast to find compounds that disrupt interaction of the THAP1 bait
with the PML-NB protein prey; and 2) in vitro interaction assays
using recombinant THAP1 and PML-NB proteins. Such assays may be
conducted as described above with respect to THAP-family/Par4
assays except that the PML-NB protein is used in place of Par4.
Binding may be detected, for example, between a THAP-family protein
and a PML protein or PML associated protein such as daxx, sp100,
sp140, p53, pRB, CBP, BLM or SUMO-1.
[0701] Other assays for which standard methods are well known
include assays to identify molecules that modulate, generally
inhibit, the colocalization of THAP1 with PML-NBs. Detection can be
carried out using a suitable label, such as an anti-THAP1 antibody,
and an antibody allowing the detection of PML-NB protein.
Assays to Modulate PAR4 Trafficking in the PML Bodies
[0702] Provided are assays for the identification of drugs that
modulate (stimulate or inhibit) PAR4 binding to PML-NB proteins or
localization to PML-NBs. In general, any suitable assay for the
detection of protein-protein interaction may be used. Two examples
of high throughput screening assays include 1) a two hybrid-based
assay in yeast to find compounds that disrupt interaction of the
PAR4 bait with the PML-NB protein prey; and 2) in vitro interaction
assays using recombinant PAR4 and PML-NB proteins. Such assays may
be conducted as described above with respect to THAP-family
polypeptide/Par4 assays except that the PML-NB protein is used in
place of the THAP-family polypeptide. Binding may be detected, for
example, between a Par4 protein and a PML protein or PML associated
protein such as daxx, sp100, sp140, p53, pRB, CBP, BLM or
SUMO-1.
[0703] Other assays for which standard methods are well known
include assays to identify molecules that modulate, generally
inhibit, the colocalization of PAR4 with PML-NBs. Detection can be
carried out using a suitable label, such as an anti-PAR4 antibody,
and an antibody allowing the detection of PML-NB protein.
[0704] This invention further pertains to novel agents identified
by the above-described screening assays and to processes for
producing such agents by use of these assays. Accordingly, in one
embodiment, the present invention includes a compound or agent
obtainable by a method comprising the steps of any one of the
aforementioned screening assays (e.g., cell-based assays or
cell-free assays). For example, in one embodiment, the invention
includes a compound or agent obtainable by a method comprising
contacting a cell which expresses a THAP-family target molecule
with a test compound and determining the ability of the test
compound to bind to, or modulate the activity of, the THAP-family
target molecule. In another embodiment, the invention includes a
compound or agent obtainable by a method comprising contacting a
cell which expresses a THAP-family target molecule with a
THAP-family protein or biologically-active portion thereof, to form
an assay mixture, contacting the assay mixture with a test
compound, and determining the ability of the test compound to
interact with, or modulate the activity of, the THAP-family target
molecule. In another embodiment, the invention includes a compound
or agent obtainable by a method comprising contacting a THAP-family
protein or biologically active portion thereof with a test compound
and determining the ability of the test compound to bind to, or
modulate (e.g., stimulate or inhibit) the activity of, the
THAP-family protein or biologically active portion thereof. In yet
another embodiment, the present invention includes a compound or
agent obtainable by a method comprising contacting a THAP-family
protein or biologically active portion thereof with a known
compound which binds the THAP-family protein to form an assay
mixture, contacting the assay mixture with a test compound, and
determining the ability of the test compound to interact with, or
modulate the activity of the THAP-family protein.
[0705] Accordingly, it is within the scope of this invention to
further use an agent identified as described herein in an
appropriate animal model. For example, an agent identified as
described herein (e.g., a THAP-family or THAP domain modulating
agent, an antisense THAP-family or THAP domain nucleic acid
molecule, a THAP-family- or THAP domain-specific antibody, or a
THAP-family- or THAP domain-binding partner) can be used in an
animal model to determine the efficacy, toxicity, or side effects
of treatment with such an agent. Alternatively, an agent identified
as described herein can be used in an animal model to determine the
mechanism of action of such an agent. Furthermore, this invention
pertains to uses of novel agents identified by the above-described
screening assays for treatments as described herein.
[0706] The present invention also pertains to uses of novel agents
identified by the above-described screening assays for diagnoses,
prognoses, and treatments as described herein. Accordingly, it is
within the scope of the present invention to use such agents in the
design, formulation, synthesis, manufacture, and/or production of a
drug or pharmaceutical composition for use in diagnosis, prognosis,
or treatment, as described herein. For example, in one embodiment,
the present invention includes a method of synthesizing or
producing a drug or pharmaceutical composition by reference to the
structure and/or properties of a compound obtainable by one of the
above-described screening assays. For example, a drug or
pharmaceutical composition can be synthesized based on the
structure and/or properties of a compound obtained by a method in
which a cell which expresses a THAP-family target molecule is
contacted with a test compound and the ability of the test compound
to bind to, or modulate the activity of, the THAP-family target
molecule is determined. In another exemplary embodiment, the
present invention includes a method of synthesizing or producing a
drug or pharmaceutical composition based on the structure and/or
properties of a compound obtainable by a method in which a
THAP-family protein or biologically active portion thereof is
contacted with a test compound and the ability of the test compound
to bind to, or modulate (e.g., stimulate or inhibit) the activity
of, the THAP-family protein or biologically active portion thereof
is determined.
Apoptosis Assays
[0707] It will be appreciated that any suitable apoptosis assay may
be used to assess the apoptotic activity of a THAP family or THAP
domain polypeptide, or a biologically active fragment or homologue
thereof.
[0708] Apoptosis can be recognized by a characteristic pattern of
morphological, biochemical, and molecular changes. Cells going
through apoptosis appear shrunken, and rounded; they also can be
observed to become detached from culture dish. The morphological
changes involve a characteristic pattern of condensation of
chromatin and cytoplasm which can be readily identified by
microscopy. When stained with a DNA-binding dye, e.g., H33258,
apoptotic cells display classic condensed and punctuate nuclei
instead of homogeneous and round nuclei.
[0709] A hallmark of apoptosis is endonucleolysis, a molecular
change in which nuclear DNA is initially degraded at the linker
sections of nucleosomes to give rise to fragments equivalent to
single and multiple nucleosomes. When these DNA fragments are
subjected to gel electrophoresis, they reveal a series of DNA bands
which are positioned approximately equally distant from each other
on the gel. The size difference between the two bands next to each
other is about the length of one nucleosome, i.e., 120 base pairs.
This characteristic display of the DNA bands is called a DNA ladder
and it indicates apoptosis of the cell. Apoptotic cells can be
identified by flow cytometric methods based on measurement of
cellular DNA content, increased sensitivity of DNA to denaturation,
or altered light scattering properties. These methods are well
known in the art and are within the contemplation of the
invention.
[0710] Abnormal DNA breaks which are characteristic of apoptosis
can be detected by any means known in the art. In one preferred
embodiment, DNA breaks are labeled with biotinylated dUTP (b-dUTP).
As described in U.S. Pat. No. 5,897,999, the disclosure of which is
incorporated herein by reference, cells are fixed and incubated in
the presence of biotinylated dUTP with either exogenous terminal
transferase (terminal DNA transferase assay; TdT assay) or DNA
polymerase (nick translation assay; NT assay). The biotinylated
dUTP is incorporated into the chromosome at the places where
abnormal DNA breaks are repaired, and are detected with fluorescein
conjugated to avidin under fluorescence microscopy.
Assessing THAP-Family, THAP Domain and PAR4 Polypeptides
Activity
[0711] For assessing the nucleic acids and polypeptides of the
invention, the apoptosis indicator which is assessed in the
screening method of the invention may be substantially any
indicator of the viability of the cell. By way of example, the
viability indicator may be selected from the group consisting of
cell number, cell refractility, cell fragility, cell size, number
of cellular vacuoles, a stain which distinguishes live cells from
dead cells, methylene blue staining, bud size, bud location,
nuclear morphology, and nuclear staining. Other viability
indicators and combinations of the viability indicators described
herein are known in the art and may be used in the screening method
of the invention.
[0712] Cell death status can be evaluated based on DNA integrity.
Assays for this determination include assaying DNA on an agarose
gel to identify DNA breaking into oligonucleosome ladders and
immunohistochemically detecting the nicked ends of DNA by labeling
the free DNA end with fluorescein or horseradish
peroxidase-conjugated UTP via terminal transferase. Routinely, one
can also examine nuclear morphology by propidium iodide (PI)
staining. All three assays (DNA ladder, end-labelling, and PI
labelling) are gross measurements and good for those cells that are
already dead or at the end stage of dying.
[0713] In a preferred example, an apoptosis assay is based on
serum-withdrawal induced apoptosis in a 3T3 cell line with
tetracycline-regulated expression of a THAP family or THAP domain
polypeptide, or a biologically active fragment or homologue
thereof. Detection of apoptotic cells is accomplished by TUNEL
labeling cells in 96- or 384-well microplates. This example is
further described in Example 23.
[0714] In other aspects, assays may test for the generation of
cytotoxic death signals, anti-viral responses (Tartaglia et al.,
(1993) Cell 74(5):845-531), and/or the activation of acid
sphingomyelinase (Wiegmann et al., (1994) Cell 78(6):1005-15) when
the THAP-family protein is overexpressed or ectopically expressed
in cells. Assaying for modulation of apoptosis can also be carried
out in neuronal cells and lymphocytes for example, where factor
withdrawal is known to induce cell suicide as demonstrated with
neuronal cells requiring nerve growth factor to survive (Martin, D.
P. et al, (1988) J. Cell Biol 106, 829-844) and lymphocytes
depending on a specific lymphokine to live (Kyprianou, N. and
Isaacs, J. T. (1988) Endrocrinology 122:552-562). The above
disclosures are incorporated herein by reference.
THAP-Family or THAP Domain Polypeptide Marker Fusions in Cell
Assays
[0715] In one method, an expression vector encoding the a THAP
family or THAP domain polypeptide, or a biologically active
fragment or homologue thereof can be used to evaluate the ability
of the polypeptides of the invention to induce apoptosis in cells.
If desired, a THAP-family or THAP domain polypeptide may be fused
to a detectable marker in order to facilitate identification of
those cells expressing the a THAP family or THAP domain
polypeptide, or a biologically active fragment or homologue
thereof. For example, a variant of the Aequoria victoria GFP
variant, enhanced green fluorescent protein (EGFP), can be used in
fusion protein production (CLONTECH Laboratories, Inc., 1020 East
Meadow Circle, Palo Alto, Calif. 94303), further described in U.S.
Pat. No. 6,191,269, the disclosure of which is incorporated herein
by reference.
[0716] The THAP-family- or THAP domain polypeptide cDNA sequence is
fused in-frame by insertion of the THAP-family- or THAP domain
polypeptide encoding cDNA into the SalI-BamHI site of plasmid
pEGFP-NI (GenBank Accession # U55762). Cells are transiently
transfected by the method optimal for the cell being tested (either
CaPO.sup.4 or Lipofectin). Expression of a THAP-family or THAP
domain polypeptide and induction of apoptosis is examined using a
fluorescence microscope at 24 hrs and 48 hrs post-transfection.
Apoptosis can be evaluated by the TUNEL method (which involves 3'
end-labeling of cleaved nuclear and/or morphological criteria DNA)
(Cohen et al. (1984) J. Immunol. 132:38-42, the disclosure of which
is incorporated herein by reference). Where the screen uses a
fusion polypeptide comprising a THAP-family or THAP domain
polypeptide and a reporter polypeptide (e.g., EGFP), apoptosis can
be evaluated by detection of nuclear localization of the reporter
polypeptide in fragmented nuclear bodies or apoptotic bodies. For
example, where a THAP-family or THAP domain polypeptide-EGFP fusion
polypeptide is used, distribution of THAP-family or THAP domain
polypeptide EGFP-associated fluorescence in apoptotic cells would
be identical to the distribution of DAPI or Hoechst 33342 dyes,
which are conventionally used to detect the nuclear DNA changes
associated with apoptosis (Cohen et al., supra). A minimum of
approximately 100 cells, which display characteristic EGFP
fluorescence, are evaluated by fluorescence microscopy. Apoptosis
is scored as nuclear fragmentation, marked apoptotic bodies, and
cytoplasmic boiling. The characteristics of nuclear fragmentation
are particularly visible when THAP-family or THAP domain
polypeptide-EGFP condenses in apoptotic bodies.
[0717] The ability of the THAP-family- or THAP domain polypeptides
to undergo nuclear localization and to induce apoptosis can be
tested by transient expression in 293 human kidney cells. If proved
susceptible to THAP-family- or THAP domain-induced apoptosis, 293
cells can serve as a convenient initial screen for those THAP
family or THAP domain polypeptides, or biologically active
fragments or homologues thereof that will likely also induce
apoptosis in other (e.g. endothelial cells or cancer cells). In an
exemplary protocol, 293 cells are transfected with plasmid vectors
expressing THAP-family- or THAP domain-EGFP fusion protein.
Approximately 5*10.sup.6 293 cells in 100 mm dishes were
transfected with 10 g of plasmid DNA using the calcium-phosphate
method. The plasmids used are comprise CMV enhancer/promoter and
THAP-family- or THAP domain-EGFP coding sequence). Apoptosis is
evaluated 24 hrs after transfection by TUNEL and DAPI staining. The
THAP-family- or THAP domain-EGFP vector transfected cells are
evaluated by fluorescence microscopy with observation of typical
nuclear aggregation of the EGFP marker as an indication of
apoptosis. If apoptotic, the distribution of EGFP signal in cells
expressing THAP-family- or THAP domain-EGFP will be identical to
the distribution of DAPI or Hoechst 33342 dyes, which are
conventionally used to detect the nuclear DNA changes associated
with apoptosis (Cohen et al., supra).
[0718] The ability of the THAP family or THAP domain polypeptides,
or biologically active fragments or homologues thereof to induce
apoptosis can also be tested by expression assays in human cancer
cells, for example as available from NCI. Vector type (for example
plasmid or retroviral or sindbis viral) can be selected based on
efficiency in a given cell type. After the period indicated, cells
are evaluated for morphological signs of apoptosis, including
aggregation of THAP-family- or THAP domain-EGFP into nuclear
apoptotic bodies. Cells are counted under a fluorescence microscope
and scored as to the presence or absence of apoptotic signs, or
cells are scored by fluorescent TUNEL assay and counted in a flow
cytometer. Apoptosis is expressed as a percent of cells displaying
typical advanced changes of apoptosis.
[0719] Cells from the NCI panel of tumor cells include from
example: [0720] colon cancer, expression using a retroviral
expression vector, with evaluation of apoptosis at 96 hrs
post-infection (cell lines KM12; HT-29; SW-620; COLO0205; HCT-5;
HCC 2998; HCT-116); [0721] CNS tumors, expression using a
retroviral expression vector, with evaluation of apoptosis at 96
hrs post-infection (cell lines SF-268, astrocytoma; SF-539,
glioblastoma; SNB-19, gliblastoma; SNB-75, astrocytoma; and U251,
glioblastoma; [0722] leukemia cells, expression using a retroviral
expression vector, with evaluation of apoptosis at 96 hrs
post-infection (cell lines CCRF-CEM, acute lymphocytic leukemia
(ALL); K562, acute myelogenous leukemia (AML); MOLT-4, ALL; SR,
immunoblastoma large cell; and RPMI 8226, Myeloblastoma); [0723]
prostate cancer, expression using a retroviral expression vector,
with evaluation of apoptosis at 96 hrs post-infection (PC-3);
[0724] kidney cancer, expression using a retroviral expression
vector, with evaluation of apoptosis at 96 hrs post-infection (cell
lines 768-0; UO-31; TK10; ACHN); [0725] skin cancer, expression
using a retroviral expression vector, with evaluation of apoptosis
at 96 hrs post-infection (Melanoma) (cell lines SKMEL-28; M14;
SKMEL-5; MALME-3); [0726] lung cancer, expression using a
retroviral expression vector, with evaluation of apoptosis at 96
hrs post-infection (cell lines HOP-92; NCI-H460; HOP-62; NCI-H522;
NCI-H23; A549; NCI-H226; EKVX; NCI-H322); [0727] breast cancer,
expression using a retroviral expression vector, with evaluation of
apoptosis at 96 hrs post-infection (cell lines MCF-7; T-47D;
MCF-7/ADR; MDAMB43; MDAMB23; MDA-N; BT-549); [0728] ovary cancer,
expression using either a retroviral expression vector and protocol
or the Sindbis viral expression vector and protocol, with
evaluation of apoptosis at 96 hrs post-infection with retrovirus or
at 24 hrs post-infection with Sindbis viral vectors (cell lines
OVCAR-8; OVCAR-4; IGROV-1; OVCAR-5; OVCAR3; SK-OV-3).
[0729] In a further representative example, the susceptibility of
malignant melanoma cells to apoptosis induced by a THAP family or
THAP domain polypeptide, or a biologically active fragment or
homologue thereof can be tested in several known melanoma cell
types: human melanoma WM 266-4 (ATCC CRL-1676); human malignant
melanoma A-375 (ATCC CRL-1619); human malignant, melanoma A2058
(ATCC CRL-11147); human malignant melanoma SK-MEL-31 (ATCC HTB-73);
human malignant melanoma RPMI-7591 ATCC HTB-66 (metastasis to lymph
node). Primary melanoma isolates can also be tested. In addition,
human chronic myelogenous leukemia K-562 cells (ATCC CCL-243), and
293 human kidney cells (ATCC CRL-1573) (transformed primary
embryonal cell) are tested. Normal human primary dermal fibroblasts
and Rat-1 fibroblasts serve as controls. All melanoma cell lines
are metastatic on the basis of their isolation from metastases or
metastatic nodules. A transient expression strategy is used in
order to evaluate induction of a THAP-family or THAP domain
polypeptide-mediated apoptosis without artifacts associated with
prolonged selection. An expression vector encoding the THAP-family
or THAP domain polypeptide-EGFP fusion protein described below can
be used in order to facilitate identification of those cells
expressing the a THAP-family or THAP domain polypeptide. Cells are
transiently transfected by the method optimal for the cell being
tested (either CaPO.sub.4 or Lipofectin). Expression of a
THAP-family or THAP domain polypeptide and induction of apoptosis
is examined using a fluorescence microscope at 24 hrs and 48 hrs
post-transfection. A minimum of approximately 100 cells, which
display characteristic EGFP fluorescence, are evaluated by
fluorescence microscopy. Apoptosis is scored as nuclear
fragmentation, marked apoptotic bodies, and cytoplasmic boiling.
The characteristics of nuclear fragmentation are particularly
visible when THAP-family or THAP domain polypeptide-EGFP condenses
in apoptotic bodies.
[0730] In a further example, the susceptibility of endothelial
cells to apoptosis induced by a THAP family or THAP domain
polypeptide, or a biologically active fragment or homologue thereof
can be tested in several known endothelial cell types: HUVEC (human
umbilical vein endothelial cells; BioWhittaker-Clonetics, 8830
Biggs Ford Road, Walkersville, Md. 21793-0127, Cat No CC-2519),
HMVEC-L (human microvascular endothelial cells from the lung;
BioWhittaker-Clonetics, 8830 Biggs Ford Road, Walkersville, Md.
21793-0127, Cat No CC-2527), HMVEC-d (human microvascular
endothelial cells from the dermis; BioWhittaker-Clonetics, 8830
Biggs Ford Road, Walkersville, Md. 21793-0127, Cat No CC-2543).
These and other endothelial cell types may be useful as models in
providing an indication of the ability of THAP-family or THAP
domain polypeptides to induce apoptosis in therapeutic strategies
for the regulation of angiogenesis. A transient expression strategy
is used in order to evaluate induction of a THAP-family or THAP
domain polypeptide-mediated apoptosis without artifacts associated
with prolonged selection. An expression vector encoding the a
THAP-family or THAP domain polypeptide-EGFP fusion protein
described below can be used in order to facilitate identification
of those cells expressing the a THAP-family or THAP domain
polypeptide. Cells are transiently transfected by the method
optimal for the cell being tested (either CaPO.sub.4 or
Lipofectin). Expression of a THAP-family or THAP domain polypeptide
and induction of apoptosis is examined using a fluorescence
microscope at 24 hrs and 48 hrs post-transfection. A minimum of
approximately 100 cells, which display characteristic EGFP
fluorescence, are evaluated by fluorescence microscopy. Apoptosis
is scored as nuclear fragmentation, marked apoptotic bodies, and
cytoplasmic boiling. The characteristics of nuclear fragmentation
are particularly visible when THAP-family or THAP domain
polypeptide-EGFP condenses in apoptotic bodies.
[0731] In another example, a transient transfection assay procedure
is similar to that previously described for detecting apoptosis
induced by IL-1-beta-converting enzyme (Miura et al., Cell 75:
653-660 (1993); Kumar et al., Genes Dev. 8: 1613-1626 (1994); Wang
et al., Cell 78: 739-750 (1994); and U.S. Pat. No. 6,221,615, the
disclosures of which are incorporated herein by reference). One day
prior to transfection, cells (for example Rat-1 cells) are plated
in 24 well dishes at 3.5*10.sup.4 cells/well. The following day,
the cells are transfected with a marker plasmid encoding
beta-galactosidase, in combination with an expression plasmid
encoding THAP-family or THAP domain polypeptide, by the
Lipofectamine procedure (Gibco/BRL). At 24 hours post transfection,
cells are fixed and stained with X-Gal to detect beta-galactosidase
expression in cells that received plasmid DNA (Miura et al.,
supra). The number of blue cells is counted by microscopic
examination and scored as either live (flat blue cells) or dead
(round blue cells). The cell killing activity of the THAP-family or
THAP domain polypeptide in this assay is manifested by a large
reduction in the number of blue cells obtained relative to
co-transfection of the beta-gal plasmid with a control expression
vector (i.e., with no THAP-family or THAP domain polypeptide cDNA
insert).
[0732] In yet another example, beta-galactosidase co-transfection
assays can be used for determination of cell death. The assay is
performed as described (Hsu, H. et al, (1995). Cell 81, 495-504;
Hsu, H. et al, (1996a). Cell 84, 299-308; and Hsu, H. et al,
(1996b) Immunity 4, 387-396 and U.S. Pat. No. 6,242,569, the
disclosures of which are incorporated herein by reference).
Transfected cells are stained with X-gal as described in Shu, H. B.
et al, ((1995) J. Cell Sci. 108, 2955-2962, the disclosure of which
is incorporated herein by reference). The number of blue cells from
8 viewing fields of a 35 mm dish is determined by counting. The
average number from one representative experiment is shown.
[0733] Assays for apoptosis can also be carried out by making use
of any suitable biological marker of apoptosis. Several methods are
described as follows.
[0734] In one aspect, fluorocytometric studies of cell death status
can be carried out. Technology used in fluorocytometric studies
employs the identification of cells at three different phases of
the cell cycle: G.sub.1, S. and G.sub.2. This is largely performed
by DNA quantity staining by propidium iodide labelling. Since the
dying cell population contains the same DNA quantity as the living
counterparts at any of the three phases of the cell cycle, there is
no way to distinguish the two cell populations. One can perform
double labelling for a biological marker of apoptosis (e.g.
terminin Tp30, U.S. Pat. No. 5,783,667) positivity and propidium
iodide (PI) staining together. Measurement of the labelling indices
for the biological marker of apoptosis and PI staining can be used
in combination to obtain the exact fractions of those cells in
G.sub.1 that are living and dying. Similar estimations can be made
for the S-phase and G.sub.2 phase cell populations.
[0735] In this assay, the cells are processed for formaldehyde
fixation and extraction with 0.05% Triton. Afterwards, the cell
specimens are incubated with monoclonal antibody to a marker of
apoptosis overnight at room temperature or at 37 C for one hour.
This is followed by further incubation with fluoresceinated goat
antimouse antibody, and subsequent incubation by propidium iodide
staining. The completely processed cell specimens are then
evaluated by fluorocytometric measurement on both fluorescence
(marker of apoptosis) and rhodamine (PI) labelling intensity on a
per cell basis, with the same cell population simultaneously.
[0736] In another aspect, it is possible to assess the inhibitory
effect on cell growth by therapeutic induction of apoptosis. One
routine method to determine whether a particular chemotherapeutic
drug can inhibit cancerous cell growth is to examine cell
population size either in culture, by measuring the reduction in
cell colony size or number, or measuring soft agar colony growth or
in vivo tumor formation in nude mice, which procedures require time
for development of the colonies or tumor to be large enough to be
detectable. Experiments involved in these approaches in general
require large-scale planning and multiple repeats of lengthy
experimental span (at least three weeks). Often these assays do not
take into account the fact that a drug may not be inhibiting cell
growth, but rather killing the cells, a more favorable consequence
needed for chemotherapeutic treatment of cancer. Thus, assays for
the assessment of apoptosis activity can involve using a biological
or biochemical marker specific for quiescent, non-cycling or
non-proliferating cells. For example, a monoclonal antibody can be
used to assess the non-proliferating population of cells in a given
tissue which indirectly gives a measure of the proliferating
component of a tumor or cell mass. This detection can be combined
with a biological or biochemical marker (e.g. antibodies) to detect
the dying cell population pool, providing a powerful and rapid
assessment of the effectiveness of any given drugs in the
containment of cancerous cell growth. Applications can be easily
performed at the immunofluorescence microscopic level with cultured
cells or tissue sections.
[0737] In other aspects, a biological or biochemical marker can be
used to assess pharmacological intervention on inhibition of cell
death frequency in degenerative diseases. For degenerative diseases
such as Alzheimer's or Parkinson's disease, these losses may be due
to the premature activation of the cell death program in neurons.
In osteoporosis, the cell loss may be due to an improper balance
between osteoblast and osteoclast cells, due to the too active
programmed cell death process killing more cells than the bone
tissue can afford. Other related phenomena may also occur in the
wound healing process, tissue transplantation and cell growth in
the glomerus during kidney infection, where the balance between
living and dying cell populations is an essential issue to the
health status of the tissue, and are further described in the
section titled "Methods of treatment". A rapid assessment of dying
cell populations can be made through the immunohistochemical and
biochemical measurements of a biological or biochemical marker of
apoptosis in degenerative tissues. In one example, a biological or
biochemical marker can be used to assess cell death status in
oligodendrocytes associated with Multiple Sclerosis. Positive
staining of monoclonal antibody to a marker of apoptosis (such as
Tp30, U.S. Pat. No. 5,783,667, the disclosure of which is
incorporated herein by reference) occurs in dying cultured human
oligodendrocytes. The programmed cell death event is activated in
these oligodendrocytes by total deprivation of serum, or by
treatment with tumor necrosis factor (TNF).
[0738] In general, a biological or biochemical marker can also be
used to assess cell death status in pharmacological studies in
animal models. Attempting to control either a reduced cell death
rate, in the case of cancer, or an increased cell death rate, in
the case of neurodegeneration, has been recently seen as a new mode
of disease intervention. Numerous approaches via either
intervention with known drugs or gene therapy are in progress,
starting from the base of correcting the altered programmed cell
death process, with the concept on maintaining a balanced cell mass
in any given tissue. For these therapeutic interventions, the
bridge between studies in cultured cells and clinical trials is
animal studies, i.e. success in intervention with animal models, in
either routine laboratory animals or transgenic mice bearing either
knock-out or overexpression phenotypes. Thus, a biological or
biochemical marker of apoptosis, such as an antibody for an
apoptosis-specific protein, is a useful tool for examining
apoptotic death status in terms of change in dying cell numbers
between normal and experimentally manipulated animals. In this
context the invention, as a diagnostic tool for assessing cell
death status, could help to determine the efficacy and potency of a
drug or a gene therapeutic approach.
[0739] As discussed, provided are methods for assessing the
activity of THAP-family members and therapeutic treatment acting on
THAP-family members or related biological pathways. However, in
other aspects, the same methods may be used for assessment of
apoptosis in general, when a THAP-family member is used as a
biological marker of apoptosis. Thus, the invention also provides
diagnostic and assay methods using a THAP-family member as a marker
of cell death or apoptotic activity. Further diagnostic assays are
also provided herein in the section titled `Diagnostic and
prognostic uses`.
Methods of Treatment
[0740] A large body of evidence gathered from experiments carried
out with apoptosis modulating strategies suggests that treatments
acting on apoptosis-inducing or cell proliferation-reducing
proteins may offer new treatment methods for a wide range of
disorders. Methods of treatment according to the invention may act
in a variety of manners, given the novel function provided for a
number of proteins, and the linking of several biological
pathways.
[0741] Provided herein are treatment methods based on the
functionalization of the THAP-family members. THAP family or THAP
domain polypeptides, and biologically active fragments and
homologues thereof, as described further herein may be useful in
modulation of apoptosis or cell proliferation.
[0742] The methods of treatment involve acting on a molecule of the
invention (that is, a THAP family member polypeptide, THAP-family
target, or PAR4 or PAR4 target). Included are methods which involve
modulating THAP-family polypeptide activity, THAP-family target
activity, or PAR4 or PAR4 target activity. This modulation
(increasing or decreasing) of activity can be carried out in a
number of suitable ways, several of which have been described in
the present application.
[0743] For example, methods of treatment may involve modulating a
"THAP-family activity", "biological activity of a THAP-family
member" or "functional activity of a THAP-family member".
Modulating THAP-family activity may involve modulating an
association with a THAP-family-target molecule (for example,
association of THAP1, THAP2 or THAP3 with Par4 or association of
THAP1, THAP2 or THAP3 with a PML-NB protein) or preferably any
other activity selected from the group consisting of: (1) mediating
apoptosis or cell proliferation when expressed or introduced into a
cell, most preferably inducing or enhancing apoptosis, and/or most
preferably reducing cell proliferation; (2) mediating apoptosis or
cell proliferation of an endothelial cell; (3) mediating apoptosis
or cell proliferation of a hyperproliferative cell; (4) mediating
apoptosis or cell proliferation of a CNS cell, preferably a
neuronal or glial cell; or (5) an activity determined in an animal
selected from the group consisting of mediating, preferably
inhibiting angiogenesis, mediating, preferably inhibiting
inflammation, inhibition of metastatic potential of cancerous
tissue, reduction of tumor burden, increase in sensitivity to
chemotherapy or radiotherapy, killing a cancer cell, inhibition of
the growth of a cancer cell, or induction of tumor regression.
Detecting THAP-family activity may also comprise detecting any
suitable therapeutic endpoint associated with a disease condition
discussed herein.
[0744] In another example, methods of treatment may involve
modulating a "PAR4 activity", "biological activity of PAR4" or
"functional activity of PAR4". Modulating PAR4 activity may involve
modulating an association with a PAR4-target molecule (for example
THAP1, THAP2, THAP3 or PML-NB protein) or most preferably PAR4
apoptosis inducing or enhancing (e.g. signal transducing) activity,
or inhibition of cell proliferation or cell cycle.
[0745] Methods of treatment may involve modulating the recruitment,
binding or association of proteins to PML-NBs, or otherwise
modulating PML-NBs activity. The present invention also provides
methods for modulating PAR4 activity, comprising modulating PAR4
interactions with THAP-family proteins, and PAR4 and PML-NBs, as
well as modulating THAP-family activity, comprising modulating for
example THAP1 interactions with PML-NBs. The invention encompasses
inhibiting or increasing the recruitment of THAP1, or PAR4 to
PML-NBs. Preventing the binding of either or both of THAP1 or PAR4
to PML-NBs may increase the bioavailability or THAP1 and/or PAR4,
thus providing a method of increasing THAP1 and/or PAR4 activity.
The invention also encompasses inhibiting or increasing the binding
of a THAP-family protein (such as THAP1) or PAR4 to PML-NBs or to
another protein associated with PML-NBs, such as a protein selected
from the group consisting of daxx, sp100, sp140, p53, pRB, CBP,
BLM, SUMO-1. For example, the invention encompasses modulating PAR4
activity by preventing the binding of THAP1 to PAR4, or by
preventing the recruitment or binding of PAR4 to PML-NBs.
[0746] Therapeutic methods and compositions of the invention may
involve (1) modulating apoptosis or cell proliferation, most
preferably inducing or enhancing apoptosis, and/or most preferably
reducing cell proliferation; (2) modulating apoptosis or cell
proliferation of an endothelial cell (3) modulating apoptosis or
cell proliferation of a hyperproliferative cell; (4) modulating
apoptosis or cell proliferation of a CNS cell, preferably a
neuronal or glial cell; (5) inhibition of metastatic potential of
cancerous tissue, reduction of tumor burden, increase in
sensitivity to chemotherapy or radiotherapy, killing a cancer cell,
inhibition of the growth of a cancer cell, or induction tumor
regression; or (6) interaction with a THAP family target molecule
or THAP domain target molecule, preferably interaction with a
protein or a nucleic acid. Methods may also involve improving a
symptom of or ameliorating a condition as further described
herein.
Antiapoptotic Therapy
[0747] Molecules of the invention (e.g. those obtained using the
screening methods described herein, dominant negative mutants,
antibodies etc.) which inhibit apoptosis are also expected to be
useful in the treatment and/or prevention of disease. Diseases in
which it is desirable to prevent apoptosis include
neurodegenerative diseases such as Alzheimer's disease, Parkinson's
disease, amyotrophic lateral sclerosis, retinitis pigmentosa and
cerebellar degeneration; myelodysplasis such as aplastic anemia;
ischemic diseases such as myocardial infarction and stroke; hepatic
diseases such as alcoholic hepatitis, hepatitis B and hepatitis C;
joint-diseases such as osteoarthritis; atherosclerosis; and etc.
The apoptosis inhibitor of the present invention is especially
preferably used as an agent for prophylaxis or treatment of a
neurodegenerative disease (see also Adams, J. M., Science, 281:1322
(1998).
[0748] Included as inhibitors of apoptosis as described herein are
generally any molecule which inhibits activity of a THAP family or
THAP domain polypeptide, or a biologically active fragment or
homologue thereof, a THAP-family target protein or PAR4
(particularly PAR4/PML-NB protein interactions). THAP-family and
THAP domain polypeptides inhibitors may include for example
antibodies, peptides, dominant negative THAP-family or THAP domain
analogs, small molecules, ribozyme or antisense nucleic acids.
These inhibitors may be particularly advantageous in the treatment
of neurodegenerative disorders. Particularly preferred are
inhibitors which affect binding of THAP-family protein to a
THAP-family target protein, and inhibitors which affect the DNA
binding activity of a THAP-family protein.
[0749] In further preferred aspects the invention provides
inhibitors of THAP-family activity, including but not limited to
molecules which interfere or inhibit interactions of THAP-family
proteins with PAR4, for the treatment of endothelial cell related
disorders and neurodegenerative disorders. Support is found in the
literature, as PAR4 appears to play a key role in neuronal
apoptosis in various neurodegenerative disorders (Guo et al., 1998;
Mattson et al., 2000; Mattson et al., 1999; Mattson et al., 2001).
THAP1, which is expressed in brain and associates with PAR4 may
therefore also play a key role in neuronal apoptosis. Drugs that
inhibit THAP-family and/or inhibit THAP-family/PAR4 complex
formation may lead to the development of novel preventative and
therapeutic strategies for neurodegenerative disorders.
Apoptosis Regulation in Endothelial Cells
[0750] The invention also provides methods of regulating
angiogenesis in a subject which are expected to be useful in the
treatment of cancer, cardiovascular diseases and inflammatory
diseases. An inducer of apoptosis of immortalized cells is expected
to be useful in suppressing tumorigenesis and/or metastasis in
malignant tumors. Examples of malignant tumors include leukemia
(for example, myelocytic leukemia, lymphocytic leukemia such as
Burkitt lymphoma), digestive tract carcinoma, lung carcinoma,
pancreas carcinoma, ovary carcinoma, uterus carcinoma, brain tumor,
malignant melanoma, other carcinomas, and sarcomas. The present
inventors have isolated both THAP1 and PAR4 cDNAs from human
endothelial cells, and both PAR4 and PML are known to be expressed
predominantly in blood vessel endothelial cells (Boghaert et al.,
(1997) Cell Growth Differ 8(8):881-90; Terris B. et al, (1995)
Cancer Res. 55(7):1590-7, 1995, the disclosures of which are
incorporated herein by reference), suggesting that the PML-NBs- and
the newly associated THAP1/PAR4 proapoptotic complex may be a major
regulator of endothelial cell apoptosis in vivo and thus constitute
an attractive therapeutic target for angiogenesis-dependent
diseases. For example, THAP1 and PAR4 pathways may allow selective
treatments that regulate (e.g. stimulate or inhibit)
angiogenesis.
[0751] In a first aspect, the invention provides methods of
inhibiting endothelial cell apoptosis, by administering a THAP1 or
PAR4 inhibitor, or optionally a THAP1/PAR4 interaction inhibitor or
optionally an inhibitor of THAP1 DNA binding activity. As further
described herein, the THAP domain is involved in THAP1
pro-apoptotic activity. Deletion of the THAP domain abrogates the
proapoptotic activity of THAP1 in mouse 3T3 fibroblasts, as shown
in Example 11. Also, as further described herein, deletion of
residues 168-172 or replacement of residues 171-172 abrogates THAP1
binding to PAR4 both in vitro and in vivo and results in lack of
recruitment of PAR4 by THAP1 to PML-NBs. For PAR4, the leucine
zipper domain is required (and is sufficient) for binding to
THAP1.
[0752] Inhibiting endothelial cell apoptosis may improve
angiogenesis and vasculogenesis in patients with ischemia and may
also interfere with focal dysregulated vascular remodeling, the key
mechanism for atherosclerotic disease progression.
[0753] In another aspect, the invention provides methods of
inducing endothelial cell apoptosis, by administering for example a
biologically active THAP family polypeptide such as THAP1, a THAP
domain polypeptide or a PAR4 polypeptide, or a biologically active
fragment or homologue thereof, or a THAP1 or PAR4 stimulator.
Stimulation of endothelial cell apoptosis may prevent or inhibit
angiogenesis and thus limit unwanted neovascularization of tumors
or inflamed tissues (see Dimmeler and Zeiher, Circulation Research,
2000, 87:434-439, the disclosure of which is incorporated herein by
reference).
Angiogenesis
[0754] Angiogenesis is defined in adult organism as the formation
of new blood vessels by a process of sprouting from pre-existing
vessels. This neovascularization involves activation, migration,
and proliferation of endothelial cells and is driven by several
stimuli, among those shear stress. Under normal physiological
conditions, humans or animals undergo angiogenesis only in very
specific restricted situations. For example, angiogenesis is
normally observed in wound healing, fetal and embryonal development
and formation of the corpus luteum, endometrium and placenta.
Molecules of the invention may have endothelial inhibiting or
inducing activity, having the capability to inhibit or induce
angiogenesis in general.
[0755] Both controlled and uncontrolled angiogenesis are thought to
proceed in a similar manner. Endothelial cells and pericytes,
surrounded by a basement membrane, form capillary blood vessels.
Angiogenesis begins with the erosion of the basement membrane by
enzymes released by endothelial cells and leukocytes. The
endothelial cells, which line the lumen of blood vessels, then
protrude through the basement membrane. Angiogenic stimulants
induce the endothelial cells to migrate through the eroded basement
membrane. The migrating cells form a "sprout" off the parent blood
vessel, where the endothelial cells undergo mitosis and
proliferate. The endothelial sprouts merge with each other to form
capillary loops, creating the new blood vessel.
[0756] Persistent, unregulated angiogenesis occurs in a
multiplicity of disease states, tumor metastasis and abnormal
growth by endothelial cells and supports the pathological damage
seen in these conditions. The diverse pathological disease states
in which unregulated angiogenesis is present have been grouped
together as angiogenic dependent or angiogenic associated diseases.
It is thus an object of the present invention to provide methods
and compositions for treating diseases and processes that are
mediated by angiogenesis including, but not limited to, hemangioma,
solid tumors, leukemia, metastasis, telangiectasia psoriasis
scleroderma, pyogenic granuloma, Myocardial angiogenesis, plaque
neovascularization, coronary collaterals, ischemic limb
angiogenesis, corneal diseases, rubeosis, neovascular glaucoma,
diabetic retinopathy, retrolental fibroplasia, arthritis, diabetic
neovascularization, macular degeneration, wound healing, peptic
ulcer, fractures, keloids, vasculogenesis, hematopoiesis,
ovulation, menstruation, and placentation.
(i) Anti-Angiogenic Therapy
[0757] In one aspect the invention provides anti-angiogenic
therapies as potential treatments for a wide variety of diseases,
including cancer, arteriosclerosis, obesity, arthritis, duodenal
ulcers, psoriasis, proliferative skin disorders, cardiovascular
disorders and abnormal ocular neovascularization caused, for
example, by diabetes (Folkman, Nature Medicine 1:27 (1995) and
Folkman, Seminars in Medicine of the Beth Israel Hospital, Boston,
New England Journal of Medicine, 333:1757 (1995)). Anti-angiogenic
therapies are thought to act by inhibiting the formation of new
blood vessels.
[0758] The present invention thus provides methods and compositions
for treating diseases and processes mediated by undesired and
uncontrolled angiogenesis by administering to a human or animal a
composition comprising a substantially purified THAP family or THAP
domain polypeptide, or a biologically active fragment, homologue or
derivative thereof in a dosage sufficient to inhibit angiogenesis,
administering a vector capable of expressing a nucleic acid
encoding a THAP-family or THAP domain protein, or administering any
other inducer of expression or activity of a THAP-family or THAP
domain protein. The present invention is particularly useful for
treating or for repressing the growth of tumors. Administration of
THAP-family or THAP domain nucleic acid, protein or other inducer
to a human or animal with prevascularized metastasized tumors will
prevent the growth or expansion of those tumors. THAP-family
activity may be used in combination with other compositions and
procedures for the treatment of diseases. For example, a tumor may
be treated conventionally with surgery, radiation or chemotherapy
combined with THAP-family or THAP domain protein and then
THAP-family or THAP domain protein may be subsequently administered
to the patient to extend the dormancy of micrometastases and to
stabilize any residual primary tumor.
[0759] In a preferred example, a THAP-family polypeptide activity,
preferably a THAP1 activity is used for the treatment of arthritis,
for example rheumatoid arthritis. Rheumatoid arthritis is
characterized by symmetric, polyarticular inflammation of
synovial-lined joints, and may involve extra articular tissues,
such as the pericardium, lung, and blood vessels.
(ii) Angiogenic Therapy
[0760] In another aspect, the inhibitors of THAP-family protein
activity, particularly THAP1 activity, could be used as an
anti-apoptotic and thus as an angiogenic therapy. Angiogenic
therapies are potential treatments for promoting wound healing and
for stimulating the growth of new blood vessels to by-pass occluded
ones. Thus, pro-angiogenic therapies could potentially augment or
replace by-pass surgeries and balloon angioplasty (PTCA). For
example, with respect to neovascularization to bypass occluded
blood vessels, a "therapeutically effective amount" is a quantity
which results in the formation of new blood vessels which can
transport at least some of the blood which normally would pass
through the blocked vessel.
[0761] The THAP-family protein of the present invention can for
example be used to generate antibodies that can be used as
inhibitors of apoptosis. The antibodies can be either polyclonal
antibodies or monoclonal antibodies. In addition, these antibodies
that specifically bind to the THAP-family protein can be used in
diagnostic methods and kits that are well known to those of
ordinary skill in the art to detect or quantify the THAP-family
protein in a body fluid. Results from these tests can be used to
diagnose or predict the occurrence or recurrence of a cancer and
other angiogenic mediated diseases.
[0762] It will be appreciated that other inhibitors of THAP-family
and THAP domain proteins can also be used in angiogenic therapies,
including for example small molecules, antisense nucleic acids,
dominant negative THAP-family and THAP domain proteins or peptides
identified using the above methods.
[0763] In view of applications in both angiogenic and
antiangiogenic therapies, molecules of the invention may have
endothelial inhibiting or inducing activity, having the capability
to inhibit or induce angiogenesis in general. It will be
appreciated that methods of assessing such capability are known in
the art, including for example assessing antiangiogenic properties
as the ability inhibit the growth of bovine capillary endothelial
cells in culture in the presence of fibroblast growth factor.
[0764] It is to be understood that the present invention is
contemplated to include any derivatives of the THAP family or THAP
domain polypeptides, and biologically active fragments and
homologues thereof that have endothelial inhibitory or apoptotic
activity. The present invention includes full-length THAP-family
and THAP domain proteins, derivatives of the THAP-family and THAP
domain proteins and biologically-active fragments of the
THAP-family and THAP domain proteins. These include proteins with
THAP-family protein activity that have amino acid substitutions or
have sugars or other molecules attached to amino acid functional
groups. The methods also contemplate the use of genes that code for
a THAP-family protein and to proteins that are expressed by those
genes.
[0765] As discussed, several methods are described herein for
delivering a modulator to a subject in need of treatment, including
for example small molecule modulators, nucleic acids including via
gene therapy vectors, and polypeptides including peptide mimetics,
active polypeptides, dominant negative polypeptides and antibodies.
It will be thus be appreciated that modulators of the invention
identified according to the methods in the section titled "Drug
Screening Assays" can be further tested in cell or animal models
for their ability to ameliorate or prevent a condition involving a
THAP-family polypeptide, particularly THAP1, THAP1, THAP2 or
THAP3/PAR4 interactions, THAP-family DNA binding or PAR4/PML-NBs
interactions. Likewise, nucleic acids, polypeptides and vectors
(e.g. viral) can also be assessed in a similar manner.
[0766] An "individual" treated by the methods of this invention is
a vertebrate, particularly a mammal (including model animals of
human disease, farm animals, sport animals, and pets), and
typically a human.
[0767] "Treatment" refers to clinical intervention in an attempt to
alter the natural course of the individual being treated, and may
be performed either for prophylaxis or during the course of
clinical pathology. Desirable effects include preventing occurrence
or recurrence of disease, alleviation of symptoms, diminishment of
any direct or indirect pathological consequences of the disease,
such as hyperresponsiveness, inflammation, or necrosis, lowering
the rate of disease progression, amelioration or palliation of the
disease state, and remission or improved prognosis. The "pathology"
associated with a disease condition is anything that compromises
the well-being, normal physiology, or quality of life of the
affected individual.
[0768] Treatment is performed by administering an effective amount
of a THAP-family polypeptide inhibitor or activator. An "effective
amount" is an amount sufficient to effect a beneficial or desired
clinical result, and can be administered in one or more doses.
[0769] The criteria for assessing response to therapeutic
modalities employing the lipid compositions of this invention are
dictated by the specific condition, measured according to standard
medical procedures appropriate for the condition.
Pharmaceutical Compositions
[0770] Compounds capable of inhibiting THAP-family activity,
preferably small molecules but also including peptides, THAP-family
nucleic acid molecules, THAP-family proteins, and anti-THAP-family
antibodies (also referred to herein as "active compounds") of the
invention can be incorporated into pharmaceutical compositions
suitable for administration. Such compositions typically comprise a
pharmaceutically acceptable carrier. As used herein the language
"pharmaceutically acceptable carrier" is intended to include any
and all solvents, dispersion media, coatings, antibacterial and
antifungal agents, isotonic and absorption delaying agents, and the
like, compatible with pharmaceutical administration. The use of
such media and agents for pharmaceutically active substances is
well known in the art. Except insofar as any conventional media or
agent is incompatible with the active compound, use thereof in the
compositions is contemplated. Supplementary active compounds can
also be incorporated into the compositions.
[0771] A pharmaceutical composition of the invention is formulated
to be compatible with its intended route of administration.
Examples of routes of administration include parenteral, e.g.,
intravenous, intradermal, subcutaneous, oral (e.g., inhalation),
transdermal (topical), transmucosal, and rectal administration.
Solutions or suspensions used for parenteral, intradermal, or
subcutaneous application can include the following components: a
sterile diluent such as water for injection, saline solution, fixed
oils, polyethylene glycols, glycerine, propylene glycol or other
synthetic solvents; antibacterial agents such as benzyl alcohol or
methyl parabens; antioxidants such as ascorbic acid or sodium
bisulfite; chelating agents such as ethylenediaminetetraacetic
acid; buffers such as acetates, citrates or phosphates and agents
for the adjustment of tonicity such as sodium chloride or dextrose.
pH can be adjusted with acids or bases, such as hydrochloric acid
or sodium hydroxide. The parenteral preparation can be enclosed in
ampoules, disposable syringes or multiple dose vials made of glass
or plastic.
[0772] Pharmaceutical compositions suitable for injectable use
include sterile aqueous solutions (where water soluble) or
dispersions and sterile powders for the extemporaneous preparation
of sterile injectable solutions or dispersion. For intravenous
administration, suitable carriers include physiological saline,
bacteriostatic water, Cremophor EL.alpha. (BASF, Parsippany, N.J.)
or phosphate buffered saline (PBS). In all cases, the composition
must be sterile and should be fluid to the extent that easy
syringability exists. It must be stable under the conditions of
manufacture and storage and must be preserved against the
contaminating action of microorganisms such as bacteria and fungi.
The carrier can be a solvent or dispersion medium containing, for
example, water, ethanol, polyol (for example, glycerol, propylene
glycol, and liquid polyethylene glycol, and the like), and suitable
mixtures thereof. The proper fluidity can be maintained, for
example, by the use of a coating such as lecithin, by the
maintenance of the required particle size in the case of dispersion
and by the use of surfactants. Prevention of the action of
microorganisms can be achieved by various antibacterial and
antifungal agents, for example, parabens, chlorobutanol, phenol,
ascorbic acid, thimerosal, and the like. In many cases, it will be
preferable to include isotonic agents, for example, sugars,
polyalcohols such as mannitol, sorbitol, sodium chloride in the
composition. Prolonged absorption of the injectable compositions
can be brought about by including in the composition an agent which
delays absorption, for example, aluminum monostearate and
gelatin.
[0773] Where the active compound is a protein, peptide or
anti-THAP-family antibody, sterile injectable solutions can be
prepared by incorporating the active compound (e.g.,) in the
required amount in an appropriate solvent with one or a combination
of ingredients enumerated above, as required, followed by filtered
sterilization. Generally, dispersions are prepared by incorporating
the active compound into a sterile vehicle which contains a basic
dispersion medium and the required other ingredients from those
enumerated above. In the case of sterile powders for the
preparation of sterile injectable solutions, the preferred methods
of preparation are vacuum drying and freeze-drying which yields a
powder of the active ingredient plus any additional desired
ingredient from a previously sterile-filtered solution thereof.
[0774] Oral compositions generally include an inert diluent or an
edible carrier. They can be enclosed in gelatin capsules or
compressed into tablets. For the purpose of oral therapeutic
administration, the active compound can be incorporated with
excipients and used in the form of tablets, troches, or capsules.
For administration by inhalation, the compounds are delivered in
the form of an aerosol spray from pressured container or dispenser
which contains a suitable propellant, e.g., a gas such as carbon
dioxide, or a nebulizer. Systemic administration can also be by
transmucosal or transdermal means. For transmucosal or transdermal
administration, penetrants appropriate to the barrier to be
permeated are used in the formulation. Such penetrants are
generally known in the art, and include, for example, for
transmucosal administration, detergents, bile salts, and fusidic
acid derivatives. Transmucosal administration can be accomplished
through the use of nasal sprays or suppositories. For transdermal
administration, the active compounds are formulated into ointments,
salves, gels, or creams as generally known in the art. Most
preferably, active compound is delivered to a subject by
intravenous injection.
[0775] In one embodiment, the active compounds are prepared with
carriers that will protect the compound against rapid elimination
from the body, such as a controlled release formulation, including
implants and microencapsulated delivery systems. Biodegradable,
biocompatible polymers can be used, such as ethylene vinyl acetate,
polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and
polylactic acid. Methods for preparation of such formulations will
be apparent to those skilled in the art. The materials can also be
obtained commercially from Alza Corporation and Nova
Pharmaceuticals, Inc. Liposomal suspensions (including liposomes
targeted to infected cells with monoclonal antibodies to viral
antigens) can also be used as pharmaceutically acceptable carriers.
These can be prepared according to methods known to those skilled
in the art, for example, as described in U.S. Pat. No. 4,522,811,
the disclosure of which is incorporated herein by reference in its
entirety.
[0776] It is especially advantageous to formulate oral or
preferably parenteral compositions in dosage unit form for ease of
administration and uniformity of dosage. Dosage unit form as used
herein refers to physically discrete units suited as unitary
dosages for the subject to be treated; each unit containing a
predetermined quantity of active compound calculated to produce the
desired therapeutic effect in association with the required
pharmaceutical carrier. The specification for the dosage unit forms
of the invention are dictated by and directly dependent on the
unique characteristics of the active compound and the particular
therapeutic effect to be achieved, and the limitations inherent in
the art of compounding such an active compound for the treatment of
individuals.
[0777] Toxicity and therapeutic efficacy of such compounds can be
determined by standard pharmaceutical procedures in cell cultures
or experimental animals, e.g., for determining the LD50 (the dose
lethal to 50% of the population) and the ED50 (the dose
therapeutically effective in 50% of the population). The dose ratio
between toxic and therapeutic effects is the therapeutic index and
it can be expressed as the ratio LD50/ED50. Compounds which exhibit
large therapeutic indices are preferred. While compounds that
exhibit toxic side effects may be used, care should be taken to
design a delivery system that targets such compounds to the site of
affected tissue in order to minimize potential damage to uninfected
cells and, thereby, reduce side effects.
[0778] The data obtained from the cell culture assays and animal
studies can be used in formulating a range of dosage for use in
humans. The dosage of such compounds lies preferably within a range
of circulating concentrations that include the ED50 with little or
no toxicity. The dosage may vary within this range depending upon
the dosage form employed and the route of administration utilized.
For any compound used in the method of the invention, the
therapeutically effective dose can be estimated initially from cell
culture assays. A dose may be formulated in animal models to
achieve a circulating plasma concentration range that includes the
IC50 (i.e., the concentration of the test compound which achieves a
half-maximal inhibition of symptoms) as determined in cell culture.
Such information can be used to more accurately determine useful
doses in humans. Levels in plasma may be measured, for example, by
high performance liquid chromatography.
[0779] The pharmaceutical compositions can be included in a
container, pack, or dispenser together with instructions for
administration.
Diagnostic and Prognostic Uses
[0780] The nucleic acid molecules, proteins, protein homologues,
and antibodies described herein can be used in one or more of the
following methods: diagnostic assays, prognostic assays, monitoring
clinical trials, and pharmacogenetics; and in drug screening and
methods of treatment (e.g., therapeutic and prophylactic) as
further described herein.
[0781] The invention provides diagnostic and prognostic assays for
detecting THAP-family members, as further described. Also provided
are diagnostic and prognostic assays for detecting interactions
between THAP-family members and THAP-family target molecules. In a
preferred example, a THAP-family member is THAP1, THAP2 or THAP3
and the THAP-family target is PAR4 or a PML-NB protein.
[0782] The invention also provides diagnostic and prognostic assays
for detecting THAP1 and/or PAR4 localization to or association with
PML-NBs, or association with or binding to a PML-NB-associated
protein, such as daxx, sp100, sp140, p53, pRB, CBP, BLM or SUMO-1.
In a preferred method, the invention provides detecting PAR4
localization to or association with PML-NBs. In a further aspect,
the invention provides detecting THAP-family nucleic acid binding
activity.
[0783] The isolated nucleic acid molecules of the invention can be
used, for example, to detect THAP-family polypeptide mRNA (e.g., in
a biological sample) or a genetic alteration in a THAP-family gene,
and to modulate a THAP-family polypeptide activity, as described
further below. The THAP-family proteins can be used to treat
disorders characterized by insufficient or excessive production of
a THAP-family protein or THAP-family target molecules. In addition,
the THAP-family proteins can be used to screen for naturally
occurring THAP-family target molecules, to screen for drugs or
compounds which modulate, preferably inhibit THAP-family activity,
as well as to treat disorders characterized by insufficient or
excessive production of THAP-family protein or production of
THAP-family protein forms which have decreased or aberrant activity
compared to THAP-family wild type protein. Moreover, the
anti-THAP-family antibodies of the invention can be used to detect
and isolate THAP-family proteins, regulate the bioavailability of
THAP-family proteins, and modulate THAP-family activity.
[0784] Accordingly one embodiment of the present invention involves
a method of use (e.g., a diagnostic assay, prognostic assay, or a
prophylactic/therapeutic method of treatment) wherein a molecule of
the present invention (e.g., a THAP-family protein, THAP-family
nucleic acid, or most preferably a THAP-family inhibitor or
activator) is used, for example, to diagnose, prognose and/or treat
a disease and/or condition in which any of the aforementioned
THAP-family activities is indicated. In another embodiment, the
present invention involves a method of use (e.g., a diagnostic
assay, prognostic assay, or a prophylactic/therapeutic method of
treatment) wherein a molecule of the present invention (e.g., a
THAP-family protein, THAP-family nucleic acid, or a THAP-family
inhibitor or activator) is used, for example, for the diagnosis,
prognosis, and/or treatment of subjects, preferably a human
subject, in which any of the aforementioned activities is
pathologically perturbed. In a preferred embodiment, the methods of
use (e.g., diagnostic assays, prognostic assays, or
prophylactic/therapeutic methods of treatment) involve
administering to a subject, preferably a human subject, a molecule
of the present invention (e.g., a THAP-family protein, THAP-family
nucleic acid, or a THAP-family inhibitor or activator) for the
diagnosis, prognosis, and/or therapeutic treatment. In another
embodiment, the methods of use (e.g., diagnostic assays, prognostic
assays, or prophylactic/therapeutic methods of treatment) involve
administering to a human subject a molecule of the present
invention (e.g., a THAP-family protein, THAP-family nucleic acid,
or a THAP-family inhibitor or activator).
[0785] For example, the invention encompasses a method of
determining whether a THAP-family member is expressed within a
biological sample comprising: a) contacting said biological sample
with: ii) a polynucleotide that hybridizes under stringent
conditions to a THAP-family nucleic acid; or iii) a detectable
polypeptide (e.g. antibody) that selectively binds to a THAP-family
polypeptide; and b) detecting the presence or absence of
hybridization between said polynucleotide and an RNA species within
said sample, or the presence or absence of binding of said
detectable polypeptide to a polypeptide within said sample. A
detection of said hybridization or of said binding indicates that
said THAP-family member is expressed within said sample.
Preferably, the polynucleotide is a primer, and wherein said
hybridization is detected by detecting the presence of an
amplification product comprising said primer sequence, or the
detectable polypeptide is an antibody.
[0786] Also envisioned is a method of determining whether a mammal,
preferably human, has an elevated or reduced level of expression of
a THAP-family member, comprising: a) providing a biological sample
from said mammal; and b) comparing the amount of a THAP-family
polypeptide or of a THAP-family RNA species encoding a THAP-family
polypeptide within said biological sample with a level detected in
or expected from a control sample. An increased amount of said
THAP-family polypeptide or said THAP-family RNA species within said
biological sample compared to said level detected in or expected
from said control sample indicates that said mammal has an elevated
level of THAP-family expression, and a decreased amount of said
THAP-family polypeptide or said THAP-family RNA species within said
biological sample compared to said level detected in or expected
from said control sample indicates that said mammal has a reduced
level of expression of a THAP-family member.
[0787] The present invention also pertains to the field of
predictive medicine in which diagnostic assays, prognostic assays,
and monitoring clinical trials are used for prognostic (predictive)
purposes to thereby treat an individual prophylactically.
Accordingly, one aspect of the present invention relates to
diagnostic assays for determining THAP-family protein and/or
nucleic acid expression as well as THAP-family activity, in the
context of a biological sample (e.g., blood, serum, cells, tissue)
to thereby determine whether an individual is afflicted with a
disease or disorder, or is at risk of developing a disorder,
associated with aberrant THAP-family expression or activity. The
invention also provides for prognostic (or predictive) assays for
determining whether an individual is at risk of developing a
disorder associated with a THAP-family protein, nucleic acid
expression or activity. For example, mutations in a THAP-family
gene can be assayed in a biological sample. Such assays can be used
for prognostic or predictive purpose to thereby prophylactically
treat an individual prior to the onset of a disorder characterized
by or associated with a THAP-family protein, nucleic acid
expression or activity.
[0788] Accordingly, the methods of the present invention are
applicable generally to diseases related to regulation of
apoptosis, including but not limited to disorders characterized by
unwanted cell proliferation or generally aberrant control of
differentiation, for example neoplastic or hyperplastic disorders,
as well as disorders related to proliferation or lack thereof of
endothelial cells, inflammatory disorders and neurodegenerative
disorders.
Diagnostic Assays
[0789] An exemplary method for detecting the presence (quantitative
or not) or absence of a THAP-family protein or nucleic acid in a
biological sample involves obtaining a biological sample from a
test subject and contacting the biological sample with a compound
or an agent capable of detecting a THAP-family protein or nucleic
acid (e.g., mRNA, genomic DNA) that encodes THAP-family protein
such that the presence of the THAP-family protein or nucleic acid
is detected in the biological sample. A preferred agent for
detecting a THAP-family mRNA or genomic DNA is a labeled nucleic
acid probe capable of hybridizing to a THAP-family mRNA or genomic
DNA. The nucleic acid probe can be, for example, a full-length
THAP-family nucleic acid, such as the nucleic acid of SEQ ID NO:
160 such as a nucleic acid of at least 15, 30, 50, 100, 250, 400,
500 or 1000 nucleotides in length and sufficient to specifically
hybridize under stringent conditions to a THAP-family mRNA or
genomic DNA or a portion of a THAP-family nucleic acid. Other
suitable probes for use in the diagnostic assays of the invention
are described herein.
[0790] In preferred embodiments, the subject method can be
characterized by generally comprising detecting, in a tissue sample
of the subject (e.g. a human patient), the presence or absence of a
genetic lesion characterized by at least one of (i) a mutation of a
gene encoding one of the subject THAP-family proteins or (ii) the
mis-expression of a THAP-family gene. To illustrate, such genetic
lesions can be detected by ascertaining the existence of at least
one of (i) a deletion of one or more nucleotides from a THAP-family
gene, (ii) an addition of one or more nucleotides to such a
THAP-family gene, (iii) a substitution of one or more nucleotides
of a THAP-family gene, (iv) a gross chromosomal rearrangement or
amplification of a THAP-family gene, (v) a gross alteration in the
level of a messenger RNA transcript of a THAP-family gene, (vi)
aberrant modification of a THAP-family gene, such as of the
methylation pattern of the genomic DNA, (vii) the presence of a
non-wild type splicing pattern of a messenger RNA transcript of a
THAP-family gene, and (viii) a non-wild type level of a
THAP-family-target protein.
[0791] A preferred agent for detecting a THAP-family protein is an
antibody capable of binding to a THAP-family protein, preferably an
antibody with a detectable label. Antibodies can be polyclonal, or
more preferably, monoclonal. An intact antibody, or a fragment
thereof (e.g., Fab or F(ab').sub.2) can be used. The term
"labeled", with regard to the probe or antibody, is intended to
encompass direct labeling of the probe or antibody by coupling
(i.e., physically linking) a detectable substance to the probe or
antibody, as well as indirect labeling of the probe or antibody by
reactivity with another reagent that is directly labeled. Examples
of indirect labeling include detection of a primary antibody using
a fluorescently labeled secondary antibody and end-labeling of a
DNA probe with biotin such that it can be detected with
fluorescently labeled streptavidin. The term "biological sample" is
intended to include tissues, cells and biological fluids isolated
from a subject, as well as tissues, cells and fluids present within
a subject. That is, the detection method of the invention can be
used to detect a THAP-family mRNA, protein, or genomic DNA in a
biological sample in vitro as well as in vivo. For example, in
vitro techniques for detection of a THAP-family mRNA include
Northern hybridizations and in situ hybridizations. In vitro
techniques for detection of a THAP-family protein include enzyme
linked immunosorbent assays (ELISAs), Western blots,
immunoprecipitations and immunofluorescence. In vitro techniques
for detection of a THAP-family genomic DNA include Southern
hybridizations. Furthermore, in vivo techniques for detection of a
THAP-family protein include introducing into a subject a labeled
anti-THAP-family antibody. For example, the antibody can be labeled
with a radioactive marker whose presence and location in a subject
can be detected by standard imaging techniques.
[0792] In yet another exemplary embodiment, aberrant methylation
patterns of a THAP-family gene can be detected by digesting genomic
DNA from a patient sample with one or more restriction
endonucleases that are sensitive to methylation and for which
recognition sites exist in the THAP-family gene (including in the
flanking and intronic sequences). See, for example, Buiting et al.
(1994) Human Mol Genet 3:893-895. Digested DNA is separated by gel
electrophoresis, and hybridized with probes derived from, for
example, genomic or cDNA sequences. The methylation status of the
THAP-family gene can be determined by comparison of the restriction
pattern generated from the sample DNA with that for a standard of
known methylation.
[0793] Furthermore, gene constructs such as those described herein
can be utilized in diagnostic assays to determine if a cell's
growth or differentiation state is no longer dependent on the
regulatory function of a THAP-family protein, e.g. in determining
the phenotype of a transformed cell. Such knowledge can have both
prognostic and therapeutic benefits. To illustrate, a sample of
cells from the tissue can be obtained from a patient and dispersed
in appropriate cell culture media, a portion of the cells in the
sample can be caused to express a recombinant THAP-family protein
or a THAP-family target protein, e.g. by transfection with a
expression vector described herein, or to increase the expression
or activity of an endogenous THAP-family protein or THAP-family
target protein, and subsequent growth of the cells assessed. The
absence of a change in phenotype of the cells despite expression of
the THAP-family or THAP-family target protein may be indicative of
a lack of dependence on cell regulatory pathways which includes the
THAP-family or THAP-family target protein, e.g. THAP-family- or
THAP-family target-mediated transcription. Depending on the nature
of the tissue of interest, the sample can be in the form of cells
isolated from, for example, a blood sample, an exfoliated cell
sample, a fine needle aspirant sample, or a biopsied tissue sample.
Where the initial sample is a solid mass, the tissue sample can be
minced or otherwise dispersed so that cells can be cultured, as is
known in the art.
[0794] In yet another embodiment, a diagnostic assay is provided
which detects the ability of a THAP-family gene product, e.g.,
isolated from a biopsied cell, to bind to other cellular proteins.
For instance, it will be desirable to detect THAP-family mutants
which, while expressed at appreciable levels in the cell, are
defective at binding a THAP-family target protein (having either
diminished or enhanced binding affinity). Such mutants may arise,
for example, from mutations, e.g., point mutants, which may be
impractical to detect by the diagnostic DNA sequencing techniques
or by the immunoassays described above. The present invention
accordingly further contemplates diagnostic screening assays which
generally comprise cloning one or more THAP-family genes from the
sample cells, and expressing the cloned genes under conditions
which permit detection of an interaction between that recombinant
gene product and a target protein, e.g., for example the THAP1 gene
and a target PAR4 protein or a PML-NB protein. As will be apparent
from the description of the various drug screening assays set forth
below, a wide variety of techniques can be used to determine the
ability of a THAP-family protein to bind to other cellular
components. These techniques can be used to detect mutations in a
THAP-family gene which give rise to mutant proteins with a higher
or lower binding affinity for a THAP-family target protein relative
to the wild-type THAP-family. Conversely, by switching which of the
THAP-family target protein and THAP-family protein is the "bait"
and which is derived from the patient sample, the subject assay can
also be used to detect THAP-family target protein mutants which
have a higher or lower binding affinity for a THAP-family protein
relative to a wild type form of that THAP-family target
protein.
[0795] In an exemplary embodiment, a PAR4 or a PMB-NB protein (e.g.
wild-type) can be provided as an immobilized protein (a "target"),
such as by use of GST fusion proteins and glutathione treated
microtitre plates. A THAP1 gene (a "sample" gene) is amplified from
cells of a patient sample, e.g., by PCR, ligated into an expression
vector, and transformed into an appropriate host cell. The
recombinantly produced THAP1 protein is then contacted with the
immobilized PAR4 or PMB-NB protein, e.g., as a lysate or a
semi-purified preparation, the complex washed, and the amount of
PAR4 or PMB-NB protein/THAP1 complex determined and compared to a
level of wild-type complex formed in a control. Detection can be
by, for instance, an immunoassay using antibodies against the
wild-type form of the THAP1 protein, or by virtue of a label
provided by cloning the sample THAP1 gene into a vector which
provides the protein as a fusion protein including a detectable
tag. For example, a myc epitope can be provided as part of a fusion
protein with the sample THAP1 gene. Such fusion proteins can, in
addition to providing a detectable label, also permit purification
of the sample THAP1 protein from the lysate prior to application to
the immobilized target. In yet another embodiment of the subject
screening assay, the two hybrid assay, described in the appended
examples, can be used to detect mutations in either a THAP-family
gene or THAP-family target gene which alter complex formation
between those two proteins.
[0796] Accordingly, the present invention provides a convenient
method for detecting mutants of THAP-family genes encoding proteins
which are unable to physically interact with a THAP-family target
"bait" protein, which method relies on detecting the reconstitution
of a transcriptional activator in a THAP-family/THAP-family
target-dependent fashion.
[0797] In one embodiment, the biological sample contains protein
molecules from the test subject. Alternatively, the biological
sample can contain mRNA molecules from the test subject or genomic
DNA molecules from the test subject. A preferred biological sample
is a serum sample isolated by conventional means from a subject. In
another embodiment, the methods further involve obtaining a control
biological sample from a control subject, contacting the control
sample with a compound or agent capable of detecting a THAP-family
protein, mRNA, or genomic DNA, such that the presence of a
THAP-family protein, mRNA or genomic DNA is detected in the
biological sample, and comparing the presence of a THAP-family
protein, mRNA or genomic DNA in the control sample with the
presence of a THAP-family protein, mRNA or genomic DNA in the test
sample. The invention also encompasses kits for detecting the
presence of THAP-family protein, mRNA or genomic DNA in a
biological sample. For example, the kit can comprise a labeled
compound or agent capable of detecting a THAP-family protein or
mRNA or genomic DNA in a biological sample; means for determining
the amount of a THAP-family member in the sample; and means for
comparing the amount of THAP-family member in the sample with a
standard. The compound or agent can be packaged in a suitable
container. The kit can further comprise instructions for using the
kit to detect THAP-family protein or nucleic acid.
[0798] In certain embodiments, detection involves the use of a
probe/primer in a polymerase chain reaction (PCR) (see, e.g., U.S.
Pat. Nos. 4,683,195 and 4,683,202, the disclosures of which are
incorporated herein by reference in their entireties), such as
anchor PCR or RACE PCR, or, alternatively, in a ligation chain
reaction (LCR) (see, e.g., Landegren et al. (1988) Science
241:1077-1080; and Nakazawa et al. (1994) PNAS 91:360-364, the
disclosures of which are incorporated herein by reference in their
entireties), the latter of which can be particularly useful for
detecting point mutations in the THAP-family-gene (see Abravaya et
al. (1995) Nucleic Acids Res. 23:675-682, the disclosure of which
is incorporated herein by reference in its entirety). This method
can include the steps of collecting a sample of cells from a
patient, isolating nucleic acid (e.g., genomic, mRNA or both) from
the cells of the sample, contacting the nucleic acid sample with
one or more primers which specifically hybridize to a THAP-family
gene under conditions such that hybridization and amplification of
the THAP-family-gene (if present) occurs, and detecting the
presence or absence of an amplification product, or detecting the
size of the amplification product and comparing the length to a
control sample. It is anticipated that PCR and/or LCR may be
desirable to use as a preliminary amplification step in conjunction
with any of the techniques used for detecting mutations described
herein.
[0799] Genotyping assays for diagnostics generally require the
previous amplification of the DNA region carrying the biallelic
marker of interest. However, ultrasensitive detection methods which
do not require amplification are also available. Methods well-known
to those skilled in the art that can be used to detect biallelic
polymorphisms include methods such as, conventional dot blot
analyzes, single strand conformational polymorphism analysis (SSCP)
described by Orita et al., PNAS 86: 2766-2770 (1989), the
disclosure of which is incorporated herein by reference in its
entirety, denaturing gradient gel electrophoresis (DGGE),
heteroduplex analysis, mismatch cleavage detection, and other
conventional techniques as described in Sheffield et al. (1991),
White et al. (1992), and Grompe et al. (1989 and 1993) (Sheffield,
V. C. et al, Proc. Natl. Acad. Sci. U.S.A. 49:699-706 (1991);
White, M. B. et al., Genomics 12:301-306 (1992); Grompe, M. et al.,
Proc. Natl. Acad. Sci. U.S.A. 86:5855-5892 (1989); and Grompe, M.
Nature Genetics 5:111-117 (1993), the disclosures of which are
incorporated herein by reference in their entireties). Another
method for determining the identity of the nucleotide present at a
particular polymorphic site employs a specialized
exonuclease-resistant nucleotide derivative as described in U.S.
Pat. No. 4,656,127, the disclosure of which is incorporated herein
by reference in its entirety. Further methods are described as
follows.
[0800] The nucleotide present at a polymorphic site can be
determined by sequencing methods. In a preferred embodiment, DNA
samples are subjected to PCR amplification before sequencing as
described above. DNA sequencing methods are described in
"Sequencing Of Amplified Genomic DNA And Identification Of Single
Nucleotide Polymorphisms". Preferably, the amplified DNA is
subjected to automated dideoxy terminator sequencing reactions
using a dye-primer cycle sequencing protocol. Sequence analysis
allows the identification of the base present at the biallelic
marker site.
[0801] In microsequencing methods, the nucleotide at a polymorphic
site in a target DNA is detected by a single nucleotide primer
extension reaction. This method involves appropriate
microsequencing primers which, hybridize just upstream of the
polymorphic base of interest in the target nucleic acid. A
polymerase is used to specifically extend the 3' end of the primer
with one single ddNTP (chain terminator) complementary to the
nucleotide at the polymorphic site. Next the identity of the
incorporated nucleotide is determined in any suitable way.
Typically, microsequencing reactions are carried out using
fluorescent ddNTPs and the extended microsequencing primers are
analyzed by electrophoresis on ABI 377 sequencing machines to
determine the identity of the incorporated nucleotide as described
in EP 412 883, the disclosure of which is incorporated herein by
reference in its entirety. Alternatively capillary electrophoresis
can be used in order to process a higher number of assays
simultaneously. Different approaches can be used for the labeling
and detection of ddNTPs. A homogeneous phase detection method based
on fluorescence resonance energy transfer has been described by
Chen and Kwok (1997) and, Chen and Kwok (Nucleic Acids Research
25:347-353 1997) and Chen et al. (Proc. Natl. Acad. Sci. USA 94/20
10756-10761, 1997), the disclosures of which are incorporated
herein by reference in their entireties). In this method, amplified
genomic DNA fragments containing polymorphic sites are incubated
with a 5'-fluorescein-labeled primer in the presence of allelic
dye-labeled dideoxyribonucleoside triphosphates and a modified Taq
polymerase. The dye-labeled primer is extended one base by the
dye-terminator specific for the allele present on the template. At
the end of the genotyping reaction, the fluorescence intensities of
the two dyes in the reaction mixture are analyzed directly without
separation or purification. All these steps can be performed in the
same tube and the fluorescence changes can be monitored in real
time. Alternatively, the extended primer may be analyzed by
MALDI-TOF Mass Spectrometry. The base at the polymorphic site is
identified by the mass added onto the microsequencing primer (see
Haff and Smirnov, 1997, Genome Research, 7:378-388, 1997, the
disclosure of which is incorporated herein by reference in its
entirety). In another example, Pastinen et al., (Genome Research
7:606-614, 1997), the disclosure of which is incorporated herein by
reference in its entirety) describe a method for multiplex
detection of single nucleotide polymorphism in which the solid
phase minisequencing principle is applied to an oligonucleotide
array format. High-density arrays of DNA probes attached to a solid
support (DNA chips) are further described below.
[0802] Other assays include mismatch detection assays, based on the
specificity of polymerases and ligases. Polymerization reactions
places particularly stringent requirements on correct base pairing
of the 3' end of the amplification primer and the joining of two
oligonucleotides hybridized to a target DNA sequence is quite
sensitive to mismatches close to the ligation site, especially at
the 3' end.
[0803] A preferred method of determining the identity of the
nucleotide present at an allele involves nucleic acid
hybridization. Any hybridization assay may be used including
Southern hybridization, Northern hybridization, dot blot
hybridization and solid-phase hybridization (see Sambrook et al.,
Molecular Cloning--A Laboratory Manual, Second Edition, Cold Spring
Harbor Press, N.Y., 1989), the disclosure of which is incorporated
herein by reference in its entirety). Hybridization refers to the
formation of a duplex structure by two single stranded nucleic
acids due to complementary base pairing. Hybridization can occur
between exactly complementary nucleic acid strands or between
nucleic acid strands that contain minor regions of mismatch.
Specific probes can be designed that hybridize to one form of a
biallelic marker and not to the other and therefore are able to
discriminate between different allelic forms. Allele-specific
probes are often used in pairs, one member of a pair showing
perfect match to a target sequence containing the original allele
and the other showing a perfect match to the target sequence
containing the alternative allele. Hybridization conditions should
be sufficiently stringent that there is a significant difference in
hybridization intensity between alleles, and preferably an
essentially binary response, whereby a probe hybridizes to only one
of the alleles. Stringent, sequence specific hybridization
conditions, under which a probe will hybridize only to the exactly
complementary target sequence are well known in the art (Sambrook
et al., 1989). The detection of hybrid duplexes can be carried out
by a number of methods. Various detection assay formats are well
known which utilize detectable labels bound to either the target or
the probe to enable detection of the hybrid duplexes. Typically,
hybridization duplexes are separated from unhybridized nucleic
acids and the labels bound to the duplexes are then detected.
Further, standard heterogeneous assay formats are suitable for
detecting the hybrids using the labels present on the primers and
probes. (see Landegren U. et al., Genome Research, 8:769-776, 1998,
the disclosure of which is incorporated herein by reference in its
entirety).
[0804] Hybridization assays based on oligonucleotide arrays rely on
the differences in hybridization stability of short
oligonucleotides to perfectly matched and mismatched target
sequence variants. Efficient access to polymorphism information is
obtained through a basic structure comprising high-density arrays
of oligonucleotide probes attached to a solid support (e.g., the
chip) at selected positions. Chips of various formats for use in
detecting biallelic polymorphisms can be produced on a customized
basis by Affymetrix (GeneChip), Hyseq (HyChip and HyGnostics), and
Protogene Laboratories.
[0805] In general, these methods employ arrays of oligonucleotide
probes that are complementary to target nucleic acid sequence
segments from an individual which, target sequences include a
polymorphic marker. EP 785280, the disclosure of which is
incorporated herein by reference in its entirety, describes a
tiling strategy for the detection of single nucleotide
polymorphisms. Briefly, arrays may generally be "tiled" for a large
number of specific polymorphisms, further described in PCT
application No. WO 95/11995, the disclosure of which is
incorporated herein by reference in its entirety. Upon completion
of hybridization with the target sequence and washing of the array,
the array is scanned to determine the position on the array to
which the target sequence hybridizes. The hybridization data from
the scanned array is then analyzed to identify which allele or
alleles of the biallelic marker are present in the sample.
Hybridization and scanning may be carried out as described in PCT
application No. WO 92/10092 and WO 95/11995 and U.S. Pat. No.
5,424,186, the disclosures of which are incorporated herein by
reference in their entireties. Solid supports and polynucleotides
of the present invention attached to solid supports are further
described in "Oligonucleotide Probes And Primers".
[0806] Having generally described this invention, a further
understanding can be obtained by reference to certain specific
examples which are provided herein for purposes of illustration
only, and are not intended to be limiting unless otherwise
specified.
EXAMPLES
Example 1
Isolation of the THAP1 cDNA in a Two-Hybrid Screen with Chemokine
SLC/CCL21
[0807] In an effort to define the function of novel HEVEC proteins
and the cellular pathways involved, we used different baits to
screen a two-hybrid cDNA library generated from microvascular human
HEV endothelial cells (HEVEC). HEVEC were purified from human
tonsils by immunomagnetic selection with monoclonal antibody
MECA-79 as previously described (Girard and Springer (1995)
Immunity 2:113-123). The SMART PCR cDNA library Construction Kit
(Clontech, Palo Alto, Calif., USA) was first used to generate
full-length cDNAs from 1 .mu.g HEVEC total RNA. Oligo-dT-primed
HEVEC cDNA were then digested with SfiI and directionally cloned
into pGAD424-Sfi, a two-hybrid vector generated by inserting a SfiI
linker (5'-GAATTCGGCCATTATGGCCTGCAGGATCCGGCCGCCTCGGCCCAGGATCC-3')
(SEQ ID NO: 181) between EcoRI and BamHI cloning sites of pGAD424
(Clontech). The resulting pGAD424-HEVEC cDNA two-hybrid library
(mean insert size >1 kb, .about.3.times.10.sup.6 independent
clones) was amplified in E. coli. To identify potential protein
partners of chemokine SLC/6Ckine, screening of the two-hybrid HEVEC
cDNA library was performed using as bait a cDNA encoding the mature
form of human SLC/CCL21 (amino acids 24-134, GenBank Accession No:
NP.sub.--002980, SEQ ID NO: 182), amplified by PCR from HEVEC RNA
with primers hSLC.5' (5'-GCGGGATCCGTAGTGATGGAGGGGCTCAGGACTGTTG-3')
(SEQ ID NO: 183) and hSLC.3'
(5'-GCGGGATCCCTATGGCCCTTTAGGGGTCTGTGACC-3') (SEQ ID NO: 184),
digested with BamHI and inserted into the BamHI cloning site of
MATCHMAKER two-hybrid system 2 vector pGBT9 (Clontech). Briefly,
pGBT9-SLC was cotransformed with the pGAD424-HEVEC cDNA library in
yeast strain Y190 (Clontech). 1.5.times.10.sup.7 yeast
transformants were screened and positive protein interactions were
selected by His auxotrophy. The plates were incubated at 30.degree.
C. for 5 days. Plasmid DNA was extracted from positive colonies and
used to verify the specificity of the interaction by
cotransformation in AH109 with pGBT9-SLC or control baits pGBT9,
pGBT9-lamin. Eight independent clones isolated in this two-hybrid
screen were characterized. They were found to correspond to a
unique human cDNA encoding a novel human protein of 213 amino
acids, designated THAP1, that exhibits 93% identity with its mouse
orthologue (FIG. 1A). The only noticeable motifs in the THAP1
predicted protein sequence were a short proline-rich domain in the
middle part and a consensus nuclear localization sequence (NLS) in
the carboxy terminal part (FIG. 1B). Databases searches with the
THAP1 sequence failed to reveal any significant similarity to
previously characterized proteins with the exception of the first
90 amino acids that may define a novel protein motif associated
with apoptosis, hereafter referred to as THAP domain (see FIGS. 1B,
FIGS. 9A-9C, and FIG. 10).
Example 2
Northern Blot
[0808] To determine the tissue distribution of THAP1 mRNA, we
performed Northern blot analysis of 12 different adult human
tissues (FIG. 2). Multiple Human Tissues Northern Blots (CLONTECH)
were hybridized according to manufacturer's instructions. The probe
was a PCR product corresponding to the THAP1 ORF, .sup.32P-labeled
with the Prime-a-Gene Labeling System (PROMEGA). A 2.2-kb mRNA band
was detected in brain, heart, skeletal muscle, kidney, liver, and
placenta. In addition to the major 2.2 kb band, lower molecular
weight bands were detected, that are likely to correspond to
alternative splicing or polyadenylation of the THAP1 pre-mRNA. The
presence of THAP1 mRNAs in many different tissues suggests that
THAP1 has a widespread, although not ubiquitous, tissue
distribution in the human body.
Example 3
Analysis of the Subcellular THAP1 Localization
[0809] To analyze the subcellular localization of the THAP1
protein, the THAP1 cDNA was fused to the coding sequence of GFP
(Green Fluorescent Protein). The full-length coding region of THAP1
was amplified by PCR from HEVEC cDNA with primers 2HMR10
(5'-CCGAATTCAGGATGGTGCAGTCCTGCTCCGCCT-3') (SEQ ID NO: 185) and
2HMR9 (5'-CGCGGATCCTGCTGGTACTTCAACTATTTCAAAGTAGTC-3') (SEQ ID NO:
186), digested with EcoRI and BamHI, and cloned in frame downstream
of the Enhanced Green Fluorescent Protein (EGFP) ORF in pEGFP.C2
vector (Clontech) to generate pEGFP.C2-THAP1. The GFP/THAP1
expression construct was then transfected into human primary
endothelial cells from umbilical vein (HUVEC, PromoCell,
Heidelberg, Germany). HUVEC were grown in complete ECGM medium
(PromoCell, Heidelberg, Germany), plated on coverslips and
transiently transfected in RPMI medium using GeneJammer
transfection reagent according to manufacturer instructions
(Stratagene, La Jolla, Calif., USA). Analysis by fluorescence
microscopy 24 h later revealed that the GFP/THAP 1 fusion protein
localizes exclusively in the nucleus with both a diffuse
distribution and an accumulation into speckles while GFP alone
exhibits only a diffuse staining over the entire cell. To
investigate the identity of the speckled domains with which
GFP/THAP1 associates, we used indirect immunofluorescence
microscopy to examine a possible colocalization of the nuclear dots
containing GFP/THAP1 with known nuclear domains (replication
factories, splicing centers, nuclear bodies).
[0810] Cells transfected with GFP-tagged expression constructs were
allowed to grow for 24 h to 48 h on coverslips. Cells were washed
twice with PBS, fixed for 15 min at room temperature in PBS
containing 3.7% formaldehyde, and washed again with PBS prior to
neutralization with 50 mM NH.sub.4Cl in PBS for 5 min at room
temperature. Following one more PBS wash, cells were permeabilized
5 min at room temperature in PBS containing 0.1% Triton-X100, and
washed again with PBS. Permeabilized cells were then blocked with
PBS-BSA (PBS with 1% bovine serum albumin) for 10' and then
incubated 2 hr at room temperature with the following primary
antibodies diluted in PBS-BSA: rabbit polyclonal antibodies against
human Daxx ( 1/50, M-112, Santa Cruz Biotechnology) or mouse
monoclonal antibodies anti-PML (mouse IgG1, 1/30, mAb PG-M3 from
Dako, Glostrup, Denmark). Cells were then washed three times 5 min
at room temperature in PBS-BSA, and incubated for 1 hr with Cy3
(red fluorescence)-conjugated goat anti-mouse or anti-rabbit IgG (
1/1000, Amersham Pharmacia Biotech) secondary antibodies, diluted
in PBS-BSA. After extensive washing in PBS, samples were air dried
and mounted in Mowiol. Images were collected on a Leica confocal
laser scanning microscope. The GFP (green) and Cy3 (red)
fluorescence signals were recorded sequentially for identical image
fields to avoid cross-talk between the channels.
[0811] This analysis revealed that GFP-THAP1 staining exhibits a
complete overlap with the staining pattern obtained with antibodies
directed against PML. The colocalization of GFP/THAP1 and PML was
observed both in nuclei with few PML-NBs (less than ten) and in
nuclei with a large number of PML-NBs. Indirect immunofluorescence
staining with antibodies directed against Daxx, another well
characterized component of PML-NBs, was performed to confirm the
association of GFP/THAP1 with PML-NBs. We found a complete
colocalization of GFP/THAP1 and Daxx in PML-NBs. Together, these
results reveal that THAP1 is a novel protein associated with
PML-NBs.
Example 4
Identification of Proteins Interacting with THAP1 in Human
HEVECs
Two-Hybrid Assay THAP1 Forms a Complex with the Pro-Apoptotic
Protein PAR4
[0812] To identify potential protein partners of THAP1, screening
of the two-hybrid HEVEC cDNA library was performed using as a bait
the human THAP1 full length cDNA inserted into the MATCHMAKER
two-hybrid system 3 vector pGBKT7 (Clontech). Briefly, the
full-length coding region of THAP1 was amplified by PCR from HEVEC
cDNA with primers 2HMR10 (5'-CCGAATTCAGGATGGTGCAGTCCTGCTCCGCCT-3')
(SEQ ID NO: 187) and 2HMR9
(5'-CGCGGATCCTGCTGGTACTTCAACTATTTCAAAGTAGTC-3') (SEQ ID NO: 188),
digested with EcoRI and BamHI, and cloned in frame downstream of
the Gal4 Binding Domain (Gal4-BD) in pGBKT7 vector to generate
pGBKT7-THAP1. pGBKT7-THAP1 was then cotransformed with the
pGAD424-HEVEC cDNA library in yeast strain AH109 (Clontech).
1.5.times.10.sup.7 yeast transformants were screened and positive
protein interactions were selected by His and Ade double auxotrophy
according to manufacturer's instructions (MATCHMAKER two-hybrid
system 3, Clontech). The plates were incubated at 30.degree. C. for
5 days. Plasmid DNA was extracted from these positive colonies and
used to verify the specificity of the interaction by
cotransformation in AH109 with pGBKT7-THAP1 or control baits
pGBKT7, pGBKT7-lamin and pGBKT7-hevin. Three clones which
specifically interacted with THAP1 were obtained in the screen;
sequencing of these clones revealed three identical library
plasmids that corresponded to a partial cDNA coding for the last
147 amino acids (positions 193-342) of the human pro-apoptotic
protein PAR4 (FIG. 3A). Positive interaction between THAP1 and Par4
was confirmed using full length Par4 bait (pGBKT-Par4) and prey
(pGADT7-Par4). Full-length human Par4 was amplified by PCR from
human thymus cDNA (Clontech), with primers Par4.8
(5'-GCGGAATTCATGGCGACCGGTGGCTACCGGACC-3') (SEQ ID NO: 189) and
Par4.5 (5'-GCGGGATCCCTCTACCTGGTCAGCTGACCCACAAC-3') (SEQ ID NO:
190), digested with EcoRI and BamHI, and cloned in pGBKT7 and
pGADT7 vectors, to generate pGBKT7-Par4 and pGADT7-Par4. Positive
interaction between THAP1 and Par4 was confirmed by
cotransformation of AH109 with pGBKT7-THAP1 and pGADT7-Par4 or
pGBKT7-Par4 and pGADT7-THAP1 and selection of transformants by His
and Ade double auxotrophy according to manufacturer's instructions
(MATCHMAKER two-hybrid system 3, Clontech). To generate
pGADT7-THAP1, the full-length coding region of THAP1 was amplified
by PCR from HEVEC cDNA with primers 2HMR10
(5'-CCGAATTCAGGATGGTGCAGTCCTGCTCCGCCT-3') (SEQ ID NO: 191) and
2HMR9 (5'-CGCGGATCCTGCTGGTACTTCAACTATTTCAAAGTAGTC-3') (SEQ ID NO:
192), digested with EcoRI and BamHI, and cloned in frame downstream
of the Gal-4 Activation Domain (Gal4-AD) in pGADT7 two-hybrid
vector (Clontech).
[0813] We then examined whether the leucine zipper/death domain at
the C-terminus of Par4, previously shown to be involved in Par4
binding to WT-1 and aPKC, was required for the interaction between
THAP1 and Par4. Two Par4 mutants were constructed for that purpose,
Par4.DELTA. and Par4DD. Par4.DELTA. lacks the leucine zipper/death
domain while Par4DD contains this domain. pGBKT7-Par4.DELTA.(amino
acids 1-276) and pGADT7-Par4.DELTA. were constructed by sub-cloning
a EcoRI-BglII fragment from pGADT7-Par4 into the EcoRI and BamHI
sites of pGBKT7 and pGADT7. Par4DD (amino acids 250-342) was
amplified by PCR, using pGBKT7-Par4 as template, with primers
Par4.4 (5'-CGCGAATTCGCCATCATGGGGTTCCCTAGATATAACAGGGATGCAA-3') (SEQ
ID NO: 193) and Par4.5, and cloned into the EcoRI and BamHI sites
of pGBKT7 and pGADT7 to obtain pGBKT7-Par4DD and pGADT7-Par4DD.
Two-hybrid interaction between THAP1 and Par4 mutants was tested by
cotransformation of AH109 with pGBKT7-THAP1 and pGADT7-Par4.DELTA.
or pGADT7-Par4DD and selection of transformants by His and Ade
double auxotrophy according to manufacturer's instructions
(MATCHMAKER two-hybrid system 3, Clontech). We found that the Par4
leucine zipper/death domain (Par4DD) is not only required but also
sufficient for the interaction with THAP1 (FIG. 3A). Similar
results were obtained when two-hybrid experiments were performed in
the opposite orientation using Par4 or Par4 mutants (Par4.DELTA.
and Par4DD) as baits instead of THAP1 (FIG. 3A).
Example 5
In Vitro THAP1/Par4 Interaction Assay
[0814] To confirm the interaction observed in yeast, we performed
in vitro GST pull down assays. Par4DD, expressed as a GST-tagged
fusion protein and immobilized on glutathione sepharose, was
incubated with radiolabeled in vitro translated THAP1. To generate
the GST-Par4DD expression vector, Par4DD (amino acids 250-342) was
amplified by PCR with primers Par4.10
(5'-GCCGGATCCGGGTTCCCTAGATATAACAGGGATGCAA-3') (SEQ ID NO: 194) and
Par4.5, and cloned in frame downstream of the Glutathion
S-Transferase ORF, into the BamHI site of the pGEX-2T prokaryotic
expression vector (Amersham Pharmacia Biotech, Saclay, France).
GST-Par4DD(amino acids 250-342) fusion protein encoded by plasmid
pGEX-2T-Par4DD and control GST protein encoded by plasmid pGEX-2T,
were then expressed in E. Coli DH5.alpha. and purified by affinity
chromatography with glutathione sepharose according to supplier's
instructions (Amersham Pharmacia Biotech). The yield of proteins
used in GST pull-down assays was determined by SDS-Polyarylamide
Gel Electrophoresis (PAGE) and Coomassie blue staining analysis. In
vitro-translated THAP1 was generated with the TNT-coupled
reticulocyte lysate system (Promega, Madison, Wis., USA) using
pGBKT7-THAP1 vector as template. 25 .mu.l of .sup.35S-labelled
wild-type THAP1 was incubated with immobilized GST-Par4 or GST
proteins overnight at 4.degree. C., in the following binding
buffer: 10 mM NaPO4 pH 8.0, 140 mM NaCl, 3 mM MgCl2, 1 mM
dithiothreitol (DTT), 0.05% NP40, and 0.2 mM phenylmethyl sulphonyl
fluoride (PMSF), 1 mM Na Vanadate, 50 mM .beta. Glycerophosphate,
25 .mu.g/ml chimotrypsine, 5 .mu.g/ml aprotinin, 10 .mu.g/ml
Leupeptin. Beads were then washed 5 times in 1 ml binding buffer.
Bound proteins were eluted with 2.times. Laemmli SDS-PAGE sample
buffer, fractionated by 10% SDS-PAGE and visualized by fluorography
using Amplify (Amersham Pharmacia Biotech). As expected, GST/Par4DD
interacted with THAP1 (FIG. 3B). In contrast, THAP1 failed to
interact with GST beads.
Example 6
In Vivo THAP1/Par4 Interaction Assay
[0815] To provide further evidence for a physiological interaction
between THAP1 and Par4 in vivo interactions between THAP1 and PAR4
were investigated. For that purpose, confocal immunofluorescence
microscopy was used to analyze the subcellular localization of
epitope-tagged Par4DD in primary human endothelial cells
transiently cotransfected with pEF-mycPar4DD eukaryotic expression
vector and GFP or GFP-THAP1 expression vectors (pEGFP.C2 and
pEGFP.C2-THAP1, respectively). To generate pEF-mycPar4DD, mycPar4DD
(amino acids 250-342) was amplified by PCR using pGBKT7-Par4DD as
template, with primers myc.BD7
(5'-GCGCTCTAGAGCCATCATGGAGGAGCAGAAGCTGATC-3') (SEQ ID NO: 195) and
Par4.9 (5'-CTTGCGGCCGCCTCTACCTGGTCAGCTGACCCACAAC-3') (SEQ ID NO:
196), and cloned into the XbaI and NotI sites of the pEF-BOS
expression vector (Mizushima and Nagata, Nucleic Acids Research,
18:5322, 1990). Primary human endothelial cells from umbilical vein
(HUVEC, PromoCell, Heidelberg, Germany) were grown in complete ECGM
medium (PromoCell, Heidelberg, Germany), plated on coverslips and
transiently transfected in RPMI medium using GeneJammer
transfection reagent according to manufacturer instructions
(Stratagene, La Jolla, Calif., USA). Cells co-transfected with
pEF-mycPar4DD and GFP-tagged expression constructs were allowed to
grow for 24 h to 48 h on coverslips. Cells were washed twice with
PBS, fixed for 15 min at room temperature in PBS containing 3.7%
formaldehyde, and washed again with PBS prior to neutralization
with 50 mM NH.sub.4Cl in PBS for 5 min at room temperature.
Following one more PBS wash, cells were permeabilized 5 min at room
temperature in PBS containing 0.1% Triton-X100, and washed again
with PBS. Permeabilized cells were then blocked with PBS-BSA (PBS
with 1% bovine serum albumin) for 10' and then incubated 2 hr at
room temperature with mouse monoclonal antibody anti-myc epitope
(mouse IgG1, 1/200, Clontech) diluted in PBS-BSA. Cells were then
washed three times 5 min at room temperature in PBS-BSA, and
incubated for 1 hr with Cy3 (red fluorescence)-conjugated goat
anti-mouse ( 1/1000, Amersham Pharmacia Biotech) secondary
antibodies, diluted in PBS-BSA. After extensive washing in PBS,
samples were air dried and mounted in Mowiol. Images were collected
on a Leica confocal laser scanning microscope. The GFP (green) and
Cy3 (red) fluorescence signals were recorded sequentially for
identical image fields to avoid cross-talk between the
channels.
[0816] In cells transiently co-transfected with pEF-mycPar4DD and
GFP expression vector, ectopically expressed myc-Par4DD was found
to accumulate both in the cytoplasm and the nucleus of the majority
of the cells. In contrast, transient cotransfection of
pEF-mycPar4DD and GFP-THAP1 expression vectors dramatically shifted
myc-Par4DD from a diffuse cytosolic and nuclear localization to a
preferential association with PML-NBs. The effect of GFP-THAP1 on
myc-Par4DD localization was specific since it was not observed with
GFP-APS kinase-1 (APSK-1), a nuclear enzyme unrelated to THAP1 and
apoptosis [Besset et al., Faseb J. 14:345-354, 2000]. This later
result shows that GFP-THAP1 recruits myc-Par4DD at PML-NBs and
provides in vivo evidence for a direct interaction of THAP1 with
the pro-apoptotic protein Par4.
Example 7
Identification of a Novel Arginine-Rich Par4 Binding Motif
[0817] To identify the sequences mediating THAP1 binding to Par4, a
series of THAP1 deletion constructs was generated. Both
amino-terminal (THAP1-C1, -C2, -C3) and carboxy-terminal (THAP1-N1,
-N2, -N3) deletion mutants (FIG. 4A) were amplified by PCR using
plasmid pEGFP.C2-THAP1 as a template and the following primers:
TABLE-US-00002 2HMR12 (SEQ ID NO: 197)
(5'-GCGGAATTCAAAGAAGATCTTCTGGAGCCACAGGAAC-3') and 2HMR9 (SEQ ID NO:
198) (5'-CGCGGATCCTGCTGGTACTTCAACTATTTCAAAGTAGTC-3') for THAP1-C1
(amino acids 90-213); PAPM2 (SEQ ID NO: 199)
(5'-GCGGAATTCATGCCGCCTCTTCAGACCCCTGTTAA-3') and 2HMR9 for THAP1-C2
(amino acids 120-213); PAPM3 (SEQ ID NO: 200)
(5'-GCGGAATTCATGCACCAGCGGAAAAGGATTCATCAG-3') and 2HMR9 for THAP1-C3
(amino acids 143-213); 2HMR10 (SEQ ID NO: 201)
(5'-CCGAATTCAGGATGGTGCAGTCCTGCTCCGCCT-3') and 2HMR17 (SEQ ID NO:
202) (5'-GCGGGATCCCTTGTCATGTGGCTCAGTACAAAGAAATAT-3') for THAP 1-N1
(amino acids 1-90); 2HMR10 and PAPN2 (SEQ ID NO: 203)
(5'-CGGGATCCTGTGCGGTCTTGAGCTTCTTTCTGAG-3') for THAP1-N2 (amino
acids 1-166); and 2HMR10 and PAPN3 (SEQ ID NO: 204)
(5'-GCGGGATCCGTCGTCTTTCTCTTTCTGGAAGTGAAC-3') for THAP1-N3 (amino
acids 1-192).
[0818] The PCR fragments, thus obtained, were digested with EcoRI
and BamHI, and cloned in frame downstream of the Gal4 Binding
Domain (Gal4-BD) in pGBKT7 two-hybrid vector (Clontech) to generate
pGBKT7-THAP1-C1, -C2, -C3, -N1, -N2 or -N3, or downstream of the
Enhanced Green Fluorescent Protein (EGFP) ORF in pEGFP.C2 vector
(Clontech) to generate pEGFP.C2-THAP1-C1, -C2, -C3, -N1, -N2 or
-N3.
[0819] Two-hybrid interaction between THAP1 mutants and Par4DD was
tested by cotransformation of AH109 with pGBKT7-THAP1-C1, -C2, -C3,
-N1, -N2 or -N3 and pGADT7-Par4DD and selection of transformants by
His and Ade double auxotrophy according to manufacturer's
instructions (MATCHMAKER two-hybrid system 3, Clontech). Positive
two-hybrid interaction with Par4DD was observed with mutants
THAP1-C1, -C2, -C3, -and -N3 but not with mutants THAP1-N1 and -N2,
suggesting the Par4 binding site is found between THAP1 residues
143 and 192.
[0820] THAP1 mutants were also tested in the in vitro THAP1/Par4
interaction assay. In vitro-translated THAP1 mutants were generated
with the TNT-coupled reticulocyte lysate system (Promega, Madison,
Wis., USA) using pGBKT7-THAP1-C1, -C2, -C3, -N1, -N2 or -N3 vector
as template. 25 .mu.l of each .sup.35S-labelled THAP1 mutant was
incubated with immobilized GST or GST-Par4 protein overnight at
4.degree. C., in the following binding buffer: 10 mM NaPO4 pH 8.0,
140 mM NaCl, 3 mM MgCl2, 1 mM dithiothreitol (DTT), 0.05% NP40, and
0.2 mM phenylmethyl sulphonyl fluoride (PMSF), 1 mM Na Vanadate, 50
mM .beta. Glycerophosphate, 25 .mu.g/ml chimotrypsine, 5 .mu.g/ml
aprotinin, 10 .mu.g/ml Leupeptin. Beads were then washed 5 times in
1 ml binding buffer. Bound proteins were eluted with 2.times.
Laemmli SDS-PAGE sample buffer, fractionated by 10% SDS-PAGE and
visualized by fluorography using Amplify (Amersham Pharmacia
Biotech). As expected, THAP1-C1, -C2, -C3, -and -N3 interacted with
GST/Par4DD (FIG. 4B). In contrast, THAP1-N1 and -N2 failed to
interact with GST/Par4DD beads.
[0821] Finally, Par4 binding activity of THAP1 mutants was also
analyzed by the in vivo THAP1/Par4 interaction assay as described
in Example 6 using pEF-mycPar4DD and pEGFP.C2-THAP1-C1, -C2, -C3,
-N1, -N2 or -N3 expression vectors.
[0822] Essentially identical results were obtained with the three
THAP1/Par4 interactions assays (FIG. 4A). That is, the Par4 binding
site was found between residues 143 and 192 of human THAP1.
Comparison of this region with the Par4 binding domain of mouse ZIP
kinase, another Par4-interacting protein, revealed the existence of
a conserved arginine rich-sequence motif (SEQ ID NOs: 205, 263 and
15), that may correspond to the Par4 binding site (FIG. 5A).
Mutations in this arginine rich-sequence motif were generated by
site directed mutagenesis. These two novel THAP1 mutants, THAP1
RR/AA (replacement of residues R171A and R172A) and
THAP1.DELTA.QRCRR (deletion of residues 168-172), were generated by
two successive rounds of PCR using pEGFP.C2-THAP1 as template and
primers 2HMR10 and 2HMR9 together with primers
RR/AA-1 (5'-CCGCACAGCAGCGATGCGCTGCTCAAGAACGGCAGCTTG-3') (SEQ ID NO:
206) and
[0823] RR/AA-2 (5'-CAAGCTGCCGTTCTTGAGCAGCGCATCGCTGCTGTGCGG-3') (SEQ
ID NO: 207) for mutant THAP1 RR/AA or primers ARR-1
(5'-GCTCAAGACCGCACAGCAAGAACGGCAGCTTG-3'(SEQ ID NO: 208) and
.DELTA.RR-2 (5'-CAAGCTGCCGTTCTTGCTGTGCGGTCTTGAGC-3') (SEQ ID NO:
209) for mutant THAP1.DELTA.QRCRR. The resulting PCR fragments were
digested with EcoRI and BamHI, and cloned in frame downstream of
the Gal4 Binding Domain (Gal4-BD) in pGBKT7 two-hybrid vector
(Clontech) to generate pGBKT7-THAP1-RR/AA and -.DELTA.(QRCRR), or
downstream of the Enhanced Green Fluorescent Protein (EGFP) ORF in
pEGFP.C2 vector (Clontech) to generate pEGFP.C2-THAP1-RR/AA and
-.DELTA.(QRCRR). THAP1 RR/AA and THAP1.DELTA.QRCRR THAP1 mutants
were then tested in the three THAP1/Par4 interaction assays
(two-hybrid assay, in vitro THAP1/Par4 interaction assay, in vivo
THAP1/Par4 interaction assay) as described above for the THAP1-C1,
-C2, -C3, -N1, -N2 or -N3 mutants. This analysis revealed that the
two mutants were deficient for interaction with Par4 in all three
assays (FIG. 5B), indicating that the novel arginine-rich sequence
motif, we have identified, is a novel Par4 binding motif.
Example 8
PAR4 is a Novel Component of PML-NBs that Colocalizes with THAP1 In
Vivo
[0824] We then wished to determine if PAR4 colocalizes with THAP1
in vivo in order to provide further evidence for a physiological
interaction between THAP1 and PAR4. We first analyzed Par4
subcellular localization in primary human endothelial cells.
Confocal immunofluorescence microscopy using affinity-purified
anti-PAR4 antibodies (Sells et al., 1997; Guo et al; 1998) was
performed on HUVEC endothelial cells fixed with methanol/acetone,
which makes PML-NBs components accessible for antibodies
(Sternsdorf et al., 1997). Cells were fixed in methanol for 5 min
at -20.degree. C., followed by incubation in cold acetone at
-20.degree. C. for 30 sec. Permeabilized cells were then blocked
with PBS-BSA (PBS with 1% bovine serum albumin) for 10' and then
incubated 2 hr at room temperature with rabbit polyclonal
antibodies against human Par4 ( 1/50, R-334, Santa Cruz
Biotechnology, Santa Cruz, Calif., USA) and mouse monoclonal
antibody anti-PML (mouse IgG1, 1/30, mAb PG-M3 from Dako, Glostrup,
Denmark). Cells were then washed three times 5 min at room
temperature in PBS-BSA, and incubated for 1 hr with Cy3 (red
fluorescence)-conjugated goat anti-rabbit IgG ( 1/1000, Amersham
Pharmacia Biotech) and FITC-labeled goat anti-mouse-IgG ( 1/40,
Zymed Laboratories Inc., San Francisco, Calif., USA) secondary
antibodies, diluted in PBS-BSA. After extensive washing in PBS,
samples were air dried and mounted in Mowiol. Images were collected
on a Leica confocal laser scanning microscope. The FITC (green) and
Cy3 (red) fluorescence signals were recorded sequentially for
identical image fields to avoid cross-talk between the channels.
This analysis showed an association of PAR4 immunoreactivity with
nuclear dot-like structures, in addition to diffuse nucleoplasmic
and cytoplasmic staining. Double immunostaining with anti-PML
antibodies, revealed that the PAR4 foci colocalize perfectly with
PML-NBs in cell nuclei. Colocalization of Par4 with GFP-THAP1 in
PML-NBs was analyzed in transfected HUVEC cells expressing ectopic
GFP-THAP1. HUVEC were grown in complete ECGM medium (PromoCell,
Heidelberg, Germany), plated on coverslips and transiently
transfected with GFP/THAP1 expression construct (pEGFP.C2-THAP1) in
RPMI medium using GeneJammer transfection reagent according to
manufacturer instructions (Stratagene, La Jolla, Calif., USA).
Analysis of transfected cells by indirect immunofluorescence
microscopy 24 h later, with anti-Par4 rabbit antibodies, revealed
that all endogenous PAR4 foci colocalize with ectopic GFP-THAP1 in
PML-NBs further confirming the association of the THAP1/PAR4
complex with PML-NBs in vivo.
Example 9
PML Recruits the THAP1/PAR4 Complex to PML-NBs
[0825] Since it has been shown that PML plays a critical role in
the assembly of PML-NBs by recruiting other components, we next
wanted to determine whether PML plays a role in the recruitment of
the THAP1/PAR4 complex to PML-NBs. For this purpose, we made use of
the observation that both endogenous PAR4 and ectopic GFP-THAP1 do
not accumulate in PML-NBs in human Hela cells. Expression vectors
for GFP-THAP1 and HA-PML (or HA-SP100) were cotransfected into
these cells and the localization of endogenous PAR4, GFP-THAP1 and
HA-PML (or HA-SP100) was analyzed by triple staining confocal
microscopy.
[0826] Human Hela cells (ATCC) were grown in Dulbecco's Modified
Eagle's Medium supplemented with 10% Fetal Calf Serum and 1%
Penicillin-streptomycin (all from Life Technologies, Grand Island,
N.Y., USA), plated on coverslips, and transiently transfected with
calcium phosphate method using 2 .mu.g pEGFP.C2-THAP1 and
pcDNA.3-HA-PML3 or pSG5-HA-Sp100 (a gift from Dr Dejean, Institut
Pasteur, Paris, France) plasmid DNA. pcDNA.3-HA-PML3 was
constructed by sub-cloning a BglII-BamHI fragment from
pGADT7-HA-PML3 into the BamHI site of pcDNA3 expression vector
(Invitrogen, San Diego, Calif., USA). To generate pGADT7-HA-PML3,
PML3 ORF was amplified by PCR, using pACT2-PML3 (a gift from Dr De
The, Paris, France) as template, with primers
PML-1 (5'-GCGGGATCCCTAAATTAGAAAGGGGTGGGGGTAGCC-3') (SEQ ID NO: 210)
and
[0827] PML-2 (5'-GCGGAATTCATGGAGCCTGCACCCGCCCGATC-3') (SEQ ID NO:
211), and cloned into the EcoRI and BamHI sites of pGADT7.
[0828] Hela cells transfected with GFP-tagged and HA-tagged
expression constructs were allowed to grow for 24 h to 48 h on
coverslips. Cells were washed twice with PBS, fixed in methanol for
5 min at -20.degree. C., followed by incubation in cold acetone at
-20.degree. C. for 30 sec. Permeabilized cells were then blocked
with PBS-BSA (PBS with 1% bovine serum albumin) for 10' and then
incubated 2 hr at room temperature with the following primary
antibodies diluted in PBS-BSA: rabbit polyclonal antibodies against
human Par4 ( 1/50, R-334, Santa Cruz Biotechnology, Santa Cruz,
Calif., USA) and mouse monoclonal antibody anti-HA tag (mouse IgG1,
1/1000, mAb 16B12 from BabCO, Richmond, Calif., USA). Cells were
then washed three times 5 min at room temperature in PBS-BSA, and
incubated for 1 hr with Cy3 (red fluorescence)-conjugated goat
anti-rabbit IgG ( 1/1000, Amersham Pharmacia Biotech) and Alexa
Fluor-633 (blue fluorescence) goat anti-mouse IgG conjugate (
1/100, Molecular Probes, Eugene, Oreg., USA) secondary antibodies,
diluted in PBS-BSA. After extensive washing in PBS, samples were
air dried and mounted in Mowiol. Images were collected on a Leica
confocal laser scanning microscope. The GFP (green), Cy3 (red) and
Alexa 633 (blue) fluorescence signals were recorded sequentially
for identical image fields to avoid cross-talk between the
channels.
[0829] In Hela cells transfected with HA-PML, endogenous PAR4 and
GFP-THAP1 were recruited to PML-NBs, whereas in cells transfected
with HA-SP100, both PAR4 and GFP-THAP1 exhibited diffuse staining
without accumulation in PML-NBs. These findings indicate that
recruitment of the THAP1/PAR4 complex to PML-NBs depends on PML but
not SP100.
Example 10
THAP1 is an Apoptosis Inducing Polypeptide
THAP1 is a Novel Proapoptotic Factor
[0830] Since PML and PML-NBs have been linked to regulation of cell
death and PAR4 is a well established pro-apoptotic factor, we
examined whether THAP1 can modulate cell survival. Mouse 3T3 cells,
which have previously been used to analyze the pro-apoptotic
activity of PAR4 (Diaz-Meco et al, 1996; Berra et al., 1997), were
transfected with expression vectors for GFP-THAP1, GFP-PAR4 and as
a negative control GFP-APS kinase-1 (APSK-1), a nuclear enzyme
unrelated to THAP1 and apoptosis (Girard et al., 1998; Besset et
al., 2000). We then determined whether ectopic expression of THAP1
enhances the apoptotic response to serum withdrawal. Transfected
cells were deprived of serum for up to twenty four hours and cells
with apoptotic nuclei, as revealed by DAPI staining and in situ
TUNEL assay, were counted.
[0831] Cell death assays: Mouse 3T3-TO fibroblasts were seeded on
coverslips in 12-well plates at 40 to 50% confluency and
transiently transfected with GFP or GFP-fusion protein expression
vectors using Lipofectamine Plus reagent (Life Technologies)
according to supplier's instructions. After 6 h at 37.degree. C.,
the DNA-lipid mixture was removed and the cells were allowed to
recover in complete medium for 24 h. Serum starvation of
transiently transfected cells was induced by changing the medium to
0% serum, and the amount of GFP-positive apoptotic cells was
assessed 24 h after induction of serum starvation. Cells were fixed
in PBS containing 3.7% formaldehyde and permeabilized with 0.1%
Triton-X100 as described under immunofluorescence, and apoptosis
was scored by in situ TUNEL (terminal deoxynucleotidyl
transferase-mediated dUTP nick end labeling) and/or DAPI
(4,6-Diamidino-2-phenylindole) staining of apoptotic nuclei
exhibiting nuclear condensation. The TUNEL reaction was performed
for 1 hr at 37.degree. C. using the in situ cell death detection
kit, TMR red (Roche Diagnostics, Meylan, France). DAPI staining
with a final concentration of 0.2: g/ml was performed for 10 min at
room temperature. At least 100 cells were scored for each
experimental point using a fluorescence microscope.
[0832] Basal levels of apoptosis in the presence of serum ranged
from 1-3%. Twenty four hours after serum withdrawal, apoptosis was
found in 18% of untransfected 3T3 cells and in 3T3 cells
overexpressing GFP-APSK-1. Levels of serum withdrawal induced
apoptosis were significantly increased to about 70% and 65% in
cells overexpressing GFP-PAR4 and GFP-THAP1, respectively (FIG.
6A). These results demonstrate that THAP1, similarly to PAR4, is an
apoptosis inducing polypeptide.
[0833] TNF.alpha.-induced apoptosis assays were performed by
incubating transiently transfected cells in complete medium
containing 30 ng/ml of mTNF.alpha. (R & D, Minneapolis, Minn.,
USA) for 24 h. Apoptosis was scored as described for serum
withdrawal-induced apoptosis. The results are shown in FIG. 6B. As
shown in FIG. 6B, THAP1 induced apoptosis.
Example 11
The THAP Domain is Essential for THAP1 Pro-Apoptotic Activity
[0834] To determine the role of the amino-terminal THAP domain
(amino acids 1 to 89) in the functional activity of THAP1, we
generated a THAP1 mutant that is deleted of the THAP domain
(THAP1.DELTA.THAP). THAP1.DELTA.THAP (amino acids 90-213) was
amplified by PCR, using pEGFP.C2-THAP1 as template, with primers
2HMR12 (5'-GCGGAATTCAAAGAAGATCTTCTGGAGCCACAGGAAC-3') (SEQ ID NO:
212) and 2HMR9 (5'-CGCGGATCCTGCTGGTACTTCAACTATTTCAAAGTAGTC-3') (SEQ
ID NO: 213), digested with EcoRI and BamHI, and cloned in pGBKT7
and pEGFP-C2 vectors, to generate pGBKT7-THAP1.DELTA.THAP and
pEGFP.C2-THAP1.DELTA.THAP expression vectors. The role of the THAP
domain in PML NBs localization, binding to Par4, or pro-apoptotic
activity of THAP1 was then analyzed.
[0835] To analyze the subcellular localization of THAP1.DELTA.THAP,
the GFP/THAP1.DELTA.THAP expression construct was transfected into
human primary endothelial cells from umbilical vein (HUVEC,
PromoCell, Heidelberg, Germany). HUVEC were grown in complete ECGM
medium (PromoCell, Heidelberg, Germany), plated on coverslips and
transiently transfected in RPMI medium using GeneJammer
transfection reagent according to manufacturer instructions
(Stratagene, La Jolla, Calif., USA). Transfected cells were allowed
to grow for 48 h on coverslips. Cells were then washed twice with
PBS, fixed for 15 min at room temperature in PBS containing 3.7%
formaldehyde, and washed again with PBS prior to neutralization
with 50 mM NH.sub.4Cl in PBS for 5 min at room temperature.
Following one more PBS wash, cells were permeabilized 5 min at room
temperature in PBS containing 0.1% Triton-X100, and washed again
with PBS. Permeabilized cells were then blocked with PBS-BSA (PBS
with 1% bovine serum albumin) for 10' and then incubated 2 hr at
room temperature with mouse monoclonal antibody anti-PML (mouse
IgG1, 1/30, mAb PG-M3 from Dako, Glostrup, Denmark) diluted in
PBS-BSA. Cells were then washed three times 5 min at room
temperature in PBS-BSA, and incubated for 1 hr with Cy3 (red
fluorescence)-conjugated goat anti-mouse IgG ( 1/1000, Amersham
Pharmacia Biotech) secondary antibodies, diluted in PBS-BSA. After
extensive washing in PBS, samples were air dried and mounted in
Mowiol. Images were collected on a Leica confocal laser scanning
microscope. The GFP (green) and Cy3 (red) fluorescence signals were
recorded sequentially for identical image fields to avoid
cross-talk between the channels.
[0836] This analysis revealed that GFP-THAP1.DELTA.THAP staining
exhibits a complete overlap with the staining pattern obtained with
antibodies directed against PML, indicating the THAP domain is not
required for THAP1 localization to PML NBs.
[0837] To examine the role of the THAP domain in binding to Par4,
we performed in vitro GST pull down assays. Par4DD, expressed as a
GST-tagged fusion protein and immobilized on glutathione sepharose,
was incubated with radiolabeled in vitro translated
THAP1.DELTA.THAP. In vitro-translated THAP1.DELTA.THAP was
generated with the TNT-coupled reticulocyte lysate system (Promega,
Madison, Wis., USA) using pGBKT7-THAP1.DELTA.THAP vector as
template. 25 .mu.l of .sup.35S-labelled THAP1).DELTA.THAP was
incubated with immobilized GST-Par4 or GST proteins overnight at
4.degree. C., in the following binding buffer: 10 mM NaPO4 pH 8.0,
140 mM NaCl, 3 mM MgCl2, 1 mM dithiothreitol (DTT), 0.05% NP40, and
0.2 mM phenylmethyl sulphonyl fluoride (PMSF), 1 mM Na Vanadate, 50
mM .beta. Glycerophosphate, 25 .mu.g/ml chimotrypsine, 5 .mu.g/ml
aprotinin, 10 .mu.g/ml Leupeptin. Beads were then washed 5 times in
1 ml binding buffer. Bound proteins were eluted with 2.times.
Laemmli SDS-PAGE sample buffer, fractionated by 10% SDS-PAGE and
visualized by fluorography using Amplify (Amersham Pharmacia
Biotech).
[0838] This analysis revealed that THAP1.DELTA.THAP interacts with
GST/Par4DD, indicating that the THAP domain is not involved in
THAP1/Par4 interaction (FIG. 7A).
[0839] To examine the role of the THAP domain in THAP1
pro-apoptotic activity, we performed cell death assays in mouse 3T3
cells. Mouse 3T3-TO fibroblasts were seeded on coverslips in
12-well plates at 40 to 50% confluency and transiently transfected
with GFP-APSK1, GFP-THAP1 or GFP-THAP1.DELTA.THAP fusion proteins
expression vectors using Lipofectamine Plus reagent (Life
Technologies) according to supplier's instructions. After 6 h at
37.degree. C., the DNA-lipid mixture was removed and the cells were
allowed to recover in complete medium for 24 h. Serum starvation of
transiently transfected cells was induced by changing the medium to
0% serum, and the amount of GFP-positive apoptotic cells was
assessed 24 h after induction of serum starvation. Cells were fixed
in PBS containing 3.7% formaldehyde and permeabilized with 0.1%
Triton-X100 as described under immunofluorescence, and apoptosis
was scored by in situ TUNEL (terminal deoxynucleotidyl
transferase-mediated dUTP nick end labeling) and/or DAPI
(4,6-Diamidino-2-phenylindole) staining of apoptotic nuclei
exhibiting nuclear condensation. The TUNEL reaction was performed
for 1 hr at 37.degree. C. using the in situ cell death detection
kit, TMR red (Roche Diagnostics, Meylan, France). DAPI staining
with a final concentration of 0.2 .mu.g/ml was performed for 10 min
at room temperature. At least 100 cells were scored for each
experimental point using a fluorescence microscope.
[0840] Twenty four hours after serum withdrawal, apoptosis was
found in 18% of untransfected 3T3 cells and in 3T3 cells
overexpressing GFP-APSK-1. Levels of serum withdrawal induced
apoptosis were significantly increased to about 70% in cells
overexpressing GFP-THAP1. Deletion of the THAP domain abrogated
most of this effect since serum-withdrawal-induced apoptosis was
reduced to 28% in cells overexpressing GFP-THAP1.DELTA.THAP (FIG.
7B). These results indicate that the THAP domain, although not
required for THAP1 PML-NBs localization and Par4 binding, is
essential for THAP1 pro-apoptotic activity.
Example 12
The THAP Domain Defines a Novel Family of Proteins, the THAP
Family
[0841] To discover novel human proteins homologous to THAP1 and/or
containing THAP domains, GenBank non-redundant, human EST and draft
human genome databases at the National Center for Biotechnology
Information (www.ncbi.nlm.nih.gov) were searched with both the
nucleotide and amino acid sequences of THAP1, using the programs
BLASTN, TBLASTN and BLASTP (Altschul, S. F., Gish, W., Miller, W.,
Myers, E. W. and Lipman, D. J. (1990). Basic local alignment search
tool. J Mol Biol 215: 403-410). This initial step enabled us to
identify 12, distinct human THAP-containing, proteins (hTHAP0 to
hTHAP11; FIG. 8). In the case of the partial length sequences,
assembly of overlapping ESTs together with GENESCAN (Burge, C. and
Karlin, S. (1997). Prediction of complete gene structures in human
genomic DNA. J Mol Biol 268: 78-94) and GENEWISE (Jareborg, N.,
Birney, E. and Durbin, R. (1999). Comparative analysis of noncoding
regions of 77 orthologous mouse and human gene pairs. Genome Res 9:
815-824) gene predictions on the corresponding genomic DNA clones,
was used to define the full length human THAP proteins as well as
their corresponding cDNAs and genes. CLUSTALW (Higgins, D. G.,
Thompson, J. D. and Gibson, T. J. (1996). Using CLUSTAL for
multiple sequence alignments. Methods Enzymol 266: 383-402) was
used to carry out the alignment of the 12 human THAP domains with
the DNA binding domain of Drosophila P-element transposase (Lee, C.
C., Beall, E. L., and Rio, D. C. (1998) Embo J. 17:4166-74), which
was colored using the computer program Boxshade
(www.ch.embnet.org/software/BOX_form.html) (see FIGS. 9A and 9B).
Equivalent approach to the one described above was used in order to
identify the mouse, rat, pig, and various other orthologs of the
human THAP proteins (FIG. 9C). Altogether, the in silico and
experimental approaches led to the discovery of 12 distinct human
members (hTHAP0 to hTHAP11) of the THAP family of pro-apoptotic
factors (FIG. 8).
Example 13
THAP2 and THAP3 Interact with Par-4
[0842] To assess whether THAP2 and THAP3 are able to interact with
Par-4, yeast two hybrid assays using Par-4 wild type bait (FIG.
10B) and in vitro GST pull down assays (FIG. 10C), were performed
as described above (Examples 4 and 5). As shown in FIGS. 10B and
10C, THAP2 and THAP3 are able to interact with Par-4. A sequence
alignment showing the comparison of the THAP domain and the
PAR4-binding domain between THAP1, THAP2 and THAP3 is shown in FIG.
10A.
Example 14
THAP2 and THAP3 are Able to Induce Apoptosis
[0843] Serum-induced Or TNF.alpha. apoptosis analyses were
performed as described above (Example 10) in cells transfected with
GFP-APSK1, GFP-THAP2 or GFP-THAP3 expression vectors. Apoptosis was
quantified by DAPI staining of apoptotic nuclei 24 hours after
serum withdrawal or addition of TNF.alpha.. The results are shown
in FIG. 11A (serum withdrawal) and FIG. 11B (TNF.alpha.). These
results indicate that, THAP-2 and THAP3 induce apoptosis.
Example 15
Identification of the SLC/CCL21 Chemokine-Binding Domain of Human
THAP1
[0844] To identify the SLC/CCL21 chemokine-binding domain of human
THAP1, a series of THAP1 deletion constructs was generated as
described in Example 7.
[0845] Two-hybrid interaction between THAP1 mutants and chemokine
SLC/CCL21 was tested by cotransformation of AH109 with
pGADT7-THAP1-C1, -C2, -C3, -N1, -N2 or -N3 and pGBKT7-SLC/CCL21 and
selection of transformants by His and Ade double auxotrophy
according to manufacturer's instructions (MATCHMAKER two-hybrid
system 3, Clontech). pGBKT7-SLC/CCL21 vector was generated by
subcloning the BamHI SLC/CCL21 fragment from pGBT9-SLC (see example
1) into the unique BamHI cloning site of vector pGBKT7 (Clontech).
Positive two-hybrid interaction with chemokine SLC/CCL21 was
observed with mutants THAP1-C1, -C2, -C3, but not with mutants
THAP1-N1, -N2 and -N3, suggesting that the SLC/CCL21
chemokine-binding domain of human THAP1 is found between THAP1
residues 143 and 213 (FIG. 12).
Example 16
In Vitro THAP1/Chemokine SLC-CCL21 Interaction Assay
[0846] To confirm the interaction observed in yeast two-hybrid
system, we performed in vitro GST pull down assays. THAP1,
expressed as a GST-tagged fusion protein and immobilized on
glutathione sepharose, was incubated with radiolabeled in vitro
translated SLC/CCL21.
[0847] To generate the GST-THAP1 expression vector, the full-length
coding region of THAP1 (amino acids 1-213) was amplified by PCR
from HEVEC cDNA with primers 2HMR8
(5'-CGCGGATCCGTGCAGTCCTGCTCCGCCTACGGC-3') (SEQ ID NO: 214) and
2HMR11 (5'-CCGAATTCTTATGCTGGTACTTCAACTATTTCAAAGTAG-3') (SEQ ID NO:
215), digested with BamHI and EcoRI, and cloned in frame downstream
of the Glutathion S-Transferase ORF, between the BamHI and EcoRI
sites of the pGEX-2T prokaryotic expression vector (Amersham
Pharmacia Biotech, Saclay, France). GST-THAP1 fusion protein
encoded by plasmid pGEX-2T-THAP1 and control GST protein encoded by
plasmid pGEX-2T, were then expressed in E. Coli DH5.alpha. and
purified by affinity chromatography with glutathione sepharose
according to supplier's instructions (Amersham Pharmacia Biotech).
The yield of proteins used in GST pull-down assays was determined
by SDS-Polyarylamide Gel Electrophoresis (PAGE) and Coomassie blue
staining analysis.
[0848] In vitro-translated SLC/CCL21 was generated with the
TNT-coupled reticulocyte lysate system (Promega, Madison, Wis.,
USA) using as template pGBKT7-SLC/CCL21 vector (see Example 15). 25
.mu.l of .sup.35S-labelled wild-type SLC/CCL21 was incubated with
immobilized GST-THAP1 or GST proteins overnight at 4.degree. C., in
the following binding buffer: 10 mM NaPO4 pH 8.0, 140 mM NaCl, 3 mM
MgCl2, 1 mM dithiothreitol (DTT), 0.05% NP40, and 0.2 mM
phenylmethyl sulphonyl fluoride (PMSF), 1 mM Na Vanadate, 50 mM
.beta. Glycerophosphate, 25 .mu.g/ml chimotrypsine, 5 .mu.g/ml
aprotinin, 10 .mu.g/ml Leupeptin. Beads were then washed 5 times in
1 ml binding buffer. Bound proteins were eluted with 2.times.
Laemmli SDS-PAGE sample buffer, fractionated by 10% SDS-PAGE and
visualized by fluorography using Amplify (Amersham Pharmacia
Biotech). As expected, GST/THAP1 interacted with SLC/CCL21 (FIG.
13). In contrast, SLC/CCL21 failed to interact with GST beads.
Example 17
Identification of the THAP1-Binding Domain of Human Chemokine
SLC/CCL21
[0849] To determine the THAP1-binding site on human chemokine
SLC/CCL21, a SLC/CCL21 deletion mutant (SLC/CCL21.DELTA.COOH)
lacking the SLC-specific basic carboxy-terminal extension (amino
acids 102-134; GenBank Accession Number NP.sub.--002980) was
generated. This SLC/CCL21.DELTA.COOH mutant, which retains the CCR7
chemokine receptor binding domain of SLC/CCL21 (amino acids
24-101), was used both in yeast two-hybrid assays with THAP1 bait
and in in vitro GST-pull down assays with GST-THAP1.
[0850] For two-hybrid assays, yeast cells were cotransformed with
BD7-THAP1 and AD7-SLC/CCL21 or AD7-SLC/CCL21.DELTA.COOH expression
vectors. AD7-SLC/CCL21 or AD7-SLC/CCL21.DELTA.COOH expression
vectors were generated by subcloning BamHI fragment (encoding SLC
amino acids 24-134) or BamHI-PstI fragment (encoding SLC amino
acids 24-102) from pGKT7-SLC/CCL21 (see example 15) into pGADT7
expression vector (Clontech). Transformants were selected on media
lacking histidine and adenine. FIG. 13 shows that both the
SLC/CCL21 wild type and the SLC/CCL21.DELTA.COOH deletion mutants
could bind to THAP1. Identical results were obtained by
cotransformation of AD7-THAP1 with BD7-SLC/CCL21 or
BD7-SLC/CCL21.DELTA.COOH.
[0851] GST pull down assays, using in vitro-translated
SLC/CCL21.DELTA.COOH, generated with the TNT-coupled reticulocyte
lysate system (Promega, Madison, Wis., USA) using as template
pGBKT7-SLC/CCL21.DELTA.COOH, were performed as described in Example
16. FIG. 13 shows that both the SLC/CCL21 wild type and the
SLC/CCL21.DELTA.COOH deletion mutants could bind to THAP1.
Example 18
Preparation of THAP1/Fc Fusion Proteins
[0852] This example describes preparation of a fusion protein
comprising THAP1 or the SLC/CCL21 chemokine-binding domain of THAP1
fused to an Fc region polypeptide derived from an antibody. An
expression vector encoding the THAP1/Fc fusion protein is
constructed as follows.
[0853] Briefly, the full length coding region of human THAP1 (SEQ
ID NO: 3; amino acids -1 to 213) or the SLC/CCL21 chemokine-binding
domain of human THAP1 (SEQ ID NO: 3; amino acids -143 to 213) is
amplified by PCR. The oligonucleotides employed as 5' primers in
the PCR contain an additional sequence that adds a Not I
restriction site upstream. The 3' primer includes an additional
sequence that encodes the first two amino acids of an Fc
polypeptide, and a sequence that adds a Bgl II restriction site
downstream of the THAP1 and Fc sequences.
[0854] A recombinant vector containing the human THAP1 cDNA is
employed as the template in the PCR, which is conducted according
to conventional procedures. The amplified DNA is then digested with
Not I and Bgl II, and the desired fragments are purified by
electrophoresis on an agarose gel.
[0855] A DNA fragment encoding the Fc region of a human IgG1
antibody is isolated by digesting a vector containing cloned
Fc-encoding DNA with Bgl II and Not I. Bgl II cleaves at a unique
Bgl II site introduced near the 5' end of the Fc-encoding sequence,
such that the Bgl II site encompasses the codons for amino acids
three and four of the Fc polypeptide. Not I cleaves downstream of
the Fc-encoding sequence. The nucleotide sequence of cDNA encoding
the Fc polypeptide, along with the encoded amino acid sequence, can
be found in International Publication No: WO93/10151, incorporated
herein by reference in its entirety.
[0856] In a three-way ligation, the above-described THAP1 (or
SLC/CCL21 chemokine-binding domain of THAP1)-encoding DNA and
Fc-encoding DNA are inserted into an expression vector that has
been digested with Not I and treated with a phosphatase to minimize
recircularization of any vector DNA without an insert. An example
of a vector which can be used is pDC406 (described in McMahan et
al., EMBO J. 10:2821, 1991), which is a mammalian expression vector
that is also capable of replication in E. coli.
[0857] E. coli cells are then transfected with the ligation
mixture, and the desired recombinant vectors are isolated. The
vectors encode amino acids-1 to 213 of the THAP1 sequence (SEQ ID
NO: 3) or amino acids-143 to 213 of the THAP1 sequence of (SEQ ID
NO: 3), fused to the N-terminus of the Fc polypeptide. The encoded
Fc polypeptide extends from the N-terminal hinge region to the
native C-terminus, i.e., is an essentially full-length antibody Fc
region.
[0858] CV-1/EBNA-1 cells are then transfected with the desired
recombinant isolated from E. coli. CV-1/EBNA-1 cells (ATCC CRL
10478) can be transfected with the recombinant vectors by
conventional procedures. The CVI-EBNA-1 cell line was derived from
the African Green Monkey kidney cell line CV-1 (ATCC CCL 70), as
described by McMahan et al. (1991). EMBO J. 10:2821. The
transfected cells are cultured to allow transient expression of the
THAP1/Fc or SLC/CCL21 chemokine-binding domain of THAP1/Fc fusion
proteins, which are secreted into the culture medium. The secreted
proteins contain the mature form of THAP1 or the SLC/CCL21
chemokine-binding domain of THAP1, fused to the Fc polypeptide. The
THAP1/Fc and SLC/CCL21 chemokine-binding domain of THAP1/Fc fusion
proteins are believed to form dimers, wherein two such fusion
proteins are joined by disulfide bonds that form between the Fc
moieties thereof. The THAP1/Fc and SLC/CCL21 chemokine-binding
domain of THAP1/Fc fusion proteins can be recovered from the
culture medium by affinity chromatography on a Protein A-bearing
chromatography column.
Example 19
The THAP Domain Defines a Family of Nuclear Factors
[0859] To determine the subcellular localization of the different
human THAP proteins, a series of GFP-THAP expression constructs
were transfected into primary human endothelial cells. In agreement
with the possible functions of THAP proteins as DNA-binding
factors, we found that all the human THAP proteins analyzed (THAP0,
1, 2, 3, 6, 7, 8, 10, 11) localize preferentially to the cell
nucleus (FIG. 14). In addition to their diffuse nuclear
localization, some of the THAP proteins also exhibited association
with distinct subnuclear structures: the nucleolus for THAP2 and
THAP3, and punctuate nuclear bodies for THAP7, THAP8 and THAP11.
Indirect immunofluorescence microscopy with anti-PML antibodies
revealed that the THAP8 and THAP11 nuclear bodies colocalize with
PML-NBs. Although the THAP7 nuclear bodies often appeared in close
association with the PML-NBs, they never colocalised.
[0860] Analysis of the subcellular localization of the GFP-THAP
fusion proteins was performed as described above (Example 3). The
GFP-THAP constructs were generated as follows: the human THAP0
coding region was amplified by PCR from Hevec cDNA with primers
THAP0-1 (5'-GCCGAATTCATGCCGAACTTCTGCGCTGCCCCC-3') (SEQ ID NO: 216)
and THAP0-2 (5'-CGCGGATCCTTAGGTTATTTTCCACAGTTTCGGAATTATC-3') (SEQ
ID NO: 217), digested with EcoRI and BamHI, and cloned in the same
sites of the pEGFP-C2 vector, to generate pEGFPC2-THAP0; the coding
region of human THAP2, 3, 7, 6 and 8 were amplified by PCR
respectively from Image clone No: 3606376 with primers THAP2-1
(5'-GCGCTGCAGCAAGCTAAATTTAAATGAAGGTACTCTTGG-3') (SEQ ID NO: 218)
and THAP2-2 (5'-GCGAGATCTGGGAAATGCCGACCAATTGCGCTGCG-3') (SEQ ID NO:
219) digested with BglII and PstI, from Image clone No: 4813302 and
No: 3633743 with primers THAP3-1
(5'-AGAGGATCCTTAGCTCTGCTGCTCTGGCCCAAGTC-3') (SEQ ID NO: 220)
THAP3-2 (5'-AGAGAATTCATGCCGAAGTCGTGCGCGGCCCG-3') (SEQ ID NO: 221)
and primers THAP7-1 (5'-GCGGAATTCATGCCGCGTCACTGCTCCGCCGC-3') (SEQ
ID NO: 222) THAP7-2 (5'-GCGGGATCCTCAGGCCATGCTGCTGCTCAGCTGC-3') (SEQ
ID NO: 223), digested with EcoRI and BamHI, from Image clone No:
757753 with primers THAP6-1
(5'-GCGAGATCTCGATGGTGAAATGCTGCTCCGCCATTGGA-3') (SEQ ID NO: 224) and
THAP6-2 (5'-GCGGGATCCTCATGAAATATAGTCCTGTTCTATGCTCTC-3') (SEQ ID NO:
225) digested with BglII and BamHI, and from Image clone No:
4819178 with primers THAP8-1
(5'-GCGAGATCTCGATGCCCAAGTACTGCAGGGCGCCG-3') (SEQ ID NO: 226) and
THAP8-2 (5'-GCGGAATTCTTATGCACTGGGGATCCGAGTGTCCAGG-3') (SEQ ID NO:
227), digested with BglII and EcoRI and cloned in frame downstream
of the Enhanced Green Fluorescent Protein (EGFP) ORF in pEGFPC2
vector (Clontech) digested with the same enzymes to generate
pEGFPC2-THAP2, -THAP3, -THAP7, -THAP6 and -THAP8; the human THAP10
and THAP11 coding region were amplified by PCR from Hela cDNA
respectively with primers THAP10-1
(5'-GCGGAATTCATGCCGGCCCGTTGTGTGGCCGC-3') (SEQ ID NO: 228) THAP10-2
(5'-GCGGGATCCTTAACATGTTTCTTCTTTCACCTGTACAGC-3') (SEQ ID NO: 229)
digested with EcoRI and BamHI, and with primers THAP11-1
(5'-GCGAGATCTCGATGCCTGGCTTTACGTGCTGCGTGC-3') (SEQ ID NO: 230) and
THAP11-2 (5'-GCGGAATTCTCACATTCCGTGCTTCTTGCGGATGAC-3') (SEQ ID NO:
231), digested with BglII and EcoRI, cloned in the same sites of
the pEGFP-C2 vector, to generate pEGFPC2-THAP10 and -THAP11.
Example 20
The THAP Domain Shares Structural Similarities with the DNA-Binding
Domain of Nuclear Hormone Receptors
[0861] In an effort to model the three-dimensional structure of the
THAP domain, we searched the PDB crystallographic database. As
sequence homology detection is more sensitive and selective when
aided by secondary structure information, structural homologs of
the THAP domain of human THAP1 were searched using the SeqFold
threading program (Olszewski et al. (1999) Theor. Chem. Acc. 101,
57-61) which combines sequence and secondary structure alignment.
The crystallographic structure of the thyroid hormone receptor
.beta. DBD (PDB code: 2NLL) gave the best score of the search and
we used the resulting structural alignment, displayed in FIG. 15A,
to derive a homology-based model of the THAP domain from human
THAP1 (FIG. 15B). Note that the distribution of Cys residues in the
THAP domain does not fully match that of the thyroid hormone
receptor .beta. DBD (FIG. 15A) and hence cannot allow the formation
of the two characteristic `C4-type` Zn-fingers (red color-coding in
FIG. 15A). However, a network of stacking interactions between
aromatic/hydrophobic residues or aliphatic parts of lysine
side-chains ensures the stability of the structure of the THAP
domain (cyan color-coding in FIGS. 15A and 15B). Interestingly the
same threading method applied independently to the Drosophila
P-element transposase DBD identified the crystallographic structure
of the glucocorticoid receptor DBD (PDB code: 1GLU) as giving the
best score. In the same way, we used the resulting structural
alignment, displayed in FIG. 15D, to build a model of the
transposase DBD (FIG. 15C). Note the presence of an hydrophobic
core equivalent to that of the THAP domain (cyan color-coding in
FIGS. 15C and 15D). All the DNA-binding domains of the nuclear
receptors fold into a typical pattern which is mainly based on two
interacting .alpha.-helices, the first one inserting into the
target DNA major groove. Our threading and modeling results
indicate that the THAP domain and the D. melanogaster P-element
transposase DBD likely share a common topology which is similar to
that of the DBD of nuclear receptors.
[0862] Molecular modeling was performed using the InsightII,
SeqFold, Homology and Discover modules from the Accelrys (San
Diego, Calif.) molecular modeling software (version 98), run on a
Silicon Graphics O2 workstation. Optimal secondary structure
prediction of the query protein domains was ensured by the DSC
method within SeqFold. The threading-derived secondary structure
alignments was used as input for homology-modeling, which was
performed according to a previously described protocol (Manival et
al. (2001) Nucleic Acids Res 29:2223-2233). The validity of the
models was checked both by Ramachandran analysis and folding
consistency verification as previously reported (Manival et al.
(2001) Nucleic Acids Res 29:2223-2233).
Example 21
Homodimerization Domain of Human THAP1
[0863] To identify the sequences mediating homodimerization of
THAP1, a series of THAP1 deletion constructs was generated as
described in Example 7.
[0864] Two-hybrid interaction between THAP1 mutants and THAP1 wild
type was tested by cotransformation of AH109 with pGADT7-THAP1-C1,
-C2, -C3, -N1, -N2 or -N3 and pGBKT7-THAP1 wild-type and selection
of transformants by His and Ade double auxotrophy according to
manufacturer's instructions (MATCHMAKER two-hybrid system 3,
Clontech). Positive two-hybrid interaction with THAP1 wild type was
observed with mutants THAP1-C1, -C2, -C3, -and -N3 but not with
mutants THAP1-N1 and -N2, suggesting the THAP1 homodimerization
domain is found between THAP1 residues 143 and 192 (FIG. 16A).
[0865] To confirm the results obtained in yeast, THAP1 mutants were
also tested in in vitro GST pull down assays. Wild type THAP1
expressed as a GST-tagged fusion protein and immobilized on
glutathione sepharose (as described in example 16), was incubated
with radiolabeled in vitro translated THAP1 mutants. In
vitro-translated THAP1 mutants were generated with the TNT-coupled
reticulocyte lysate system (Promega, Madison, Wis., USA) using
pGADT7-THAP1-C1, -C2, -C3, -N1, -N2 or -N3 vector as template. 25
.mu.l of each .sup.35S-labelled THAP1 mutant was incubated with
immobilized GST or GST-THAP1 wild-type protein overnight at
4.degree. C., in the following binding buffer: 10 mM NaPO4 pH 8.0,
140 mM NaCl, 3 mM MgCl2, 1 mM dithiothreitol (DTT), 0.05% NP40, and
0.2 mM phenylmethyl sulphonyl fluoride (PMSF), 1 mM Na Vanadate, 50
mM .beta. Glycerophosphate, 25 .mu.g/ml chimotrypsine, 5 .mu.g/ml
aprotinin, 10 .mu.g/ml Leupeptin. Beads were then washed 5 times in
1 ml binding buffer. Bound proteins were eluted with 2.times.
Laemmli SDS-PAGE sample buffer, fractionated by 10% SDS-PAGE and
visualized by fluorography using Amplify (Amersham Pharmacia
Biotech). As expected, THAP1-C1, -C2, -C3, -and -N3 interacted with
GST/THAP1 (FIG. 16B). In contrast, THAP1-N1 and -N2 failed to
interact with GST/THAP1 beads. Therefore, essentially identical
results were obtained with the two THAP1/THAP1 interactions assays:
the THAP1 homodimerization domain of THAP1 is found between
residues 143 and 192 of human THAP1.
Example 22
Alternatively Spliced Isoform of Human THAP1
[0866] The two distinct THAP1 cDNAs, THAP1a and THAP1b have been
discovered (FIG. 17A). These splice variants, were amplified by PCR
from HEVEC cDNA with primers 2HMR10
(5'-CCGAATTCAGGATGGTGCAGTCCTGCTCCGCCT-3') (SEQ ID NO: 232) and
2HMR9 (5'-CGCGGATCCTGCTGGTACTTCAACTATTTCAAAGTAGTC-3') (SEQ ID NO:
233), digested with EcoRI and BamHI, and cloned in frame upstream
of the Enhanced Green Fluorescent Protein (EGFP) ORF in pEGFP.N3
vector (Clontech) to generate pEGFP.N3-THAP1a and pEGFP-THAP1b. DNA
sequencing revealed that THAP1b cDNA isoform lacks exon 2
(nucleotides 273-468) of the human THAP1 gene (FIG. 17B). This
alternatively spliced isoform of human THAP1 (2 kb mRNA) was also
observed in many other tissues by Northern blot analysis (see FIG.
2). The THAP1a/GFP and THAP1b/GFP expression constructs were then
transfected into COS 7 cells (ATCC) and expression of the fusion
proteins was analyzed by western blotting with anti-GFP antibodies.
The results are shown in FIG. 17C which demonstrates that the
second isoform of human THAP1 (THAP1b) encodes a truncated THAP1
protein (THAP1 C3) lacking a substantial portion of the amino
terminus (amino acids 1-142 of SEQ ID NO:3).
Example 23
High Throughput Screening Assay for Modulators of THAP Family
Polypeptide Pro-Apoptotic Activity
[0867] A high throughput screening assay for molecules that
abrogate or stimulate THAP-family polypeptide proapoptotic activity
was developed, based on serum-withdrawal induced apoptosis in a 3T3
cell line with tetracycline-regulated expression of a THAP family
polypeptide.
[0868] In a preferred example, the THAP1 cDNA with an in-frame myc
tag sequence, was amplified by PCR using pGBKT7-THAP1 as a template
with primers myc.BD7 (5'-GCGCTCTAGAGCCATCATGGAGGAGCAGAAGCTGATC-3')
(SEQ ID NO: 234) and 2HMR15
(5'-GCGCTCTAGATTATGCTGGTACTTCAACTATTTCAAAGTAG-3') (SEQ ID NO: 235),
and cloned downstream of a tetracycline regulated promoter in
plasmid vector pTRE (Clontech, Palo Alto, Calif.), using Xba I
restriction site, to generate plasmid pTRE-mycTHAP1. To establish
3T3-TO-mycTHAP1 stable cell lines, mouse 3T3-TO fibroblasts
(Clontech) were seeded at 40 to 50% confluency and co-transfected
with the pREP4 plasmid (Invitrogen), which contains a hygromycin B
resistance gene, and the mycTHAP1 expression vector (pTRE-mycTHAP1)
at 1:10 ratio, using Lipofectamine Plus reagent (Life Technologies)
according to supplier's instructions. Transfected cells were
selected in medium containing hygromycin B (250 U/ml; Calbiochem)
and tetracycline (2 ug/ml; Sigma). Several resistant colonies were
picked and analyzed for the expression of mycTHAP1 by indirect
immunofluorescence using anti-myc epitope monoclonal antibody
(mouse IgG1, 1/200, Clontech). A stable 3T3-TO cell line expressing
mycTHAP1 (3T3-TO-mycTHAP1) was selected and grown in Dulbecco's
Modified Eagle's Medium supplemented with 10% Fetal Calf Serum, 1%
Penicillin-streptomycin (all from Life Technologies, Grand Island,
N.Y., USA) and tetracycline (2 ug/ml; Sigma). Induction of THAP1
expression into this 3T3-TO-mycTHAP1 cell line was obtained 48 h
after removal of tetracycline in the complete medium.
[0869] A drug screening assay using the 3T3-TO-mycTHAP1 cell line
can be carried out as follows. 3T3-TO-mycTHAP1 cells are plated in
96- or 384-wells microplates and THAP1 expression is induced by
removal of tetracycline in the complete medium. 48 h later, the
apoptotic response to serum withdrawal is assayed in the presence
of a test compound, allowing the identification of test compounds
that either enhance or inhibit the ability of THAP1 polypeptide to
induce apoptosis. Serum starvation of 3T3-TO-mycTHAP1 cells is
induced by changing the medium to 0% serum, and the amount of cells
with apoptotic nuclei is assessed 24 h after induction of serum
starvation by TUNEL labeling in 96- or 384-wells microplates. Cells
are fixed in PBS containing 3.7% formaldehyde and permeabilized
with 0.1% Triton-X100, and apoptosis is scored by in situ TUNEL
(terminal deoxynucleotidyl transferase-mediated dUTP nick end
labeling) staining of apoptotic nuclei for 1 hr at 37.degree. C.
using the in situ cell death detection kit, TMR red (Roche
Diagnostics, Meylan, France). The intensity of TMR red fluorescence
in each well is then quantified to identify test compounds that
modify the fluorescence signal and thus either enhance or inhibit
THAP1 pro-apoptotic activity.
Example 24
High Throughput Two-Hybrid Screening Assay for Drugs that Modulate
THAP-Family Polypeptide/THAP-Family Target Protein Interaction
[0870] To identify drugs that modulate THAP1/Par4 or THAP1/SLC
interactions, a two-hybrid based high throughput screening assay
can be used.
[0871] As described in Example 17, AH109 yeast cells (Clontech)
cotransformed with plasmids pGBKT7-THAP1 and pGADT7-Par4 or
pGADT7-SLC can be grown in 384-well plates in selective media
lacking histidine and adenine, according to manufacturer's
instructions (MATCHMAKER two-hybrid system 3, Clontech).
[0872] Growth of the transformants on media lacking histidine and
adenine is absolutely dependent on the THAP1/Par4 or THAP1/SLC
two-hybrid interaction and drugs that disrupt THAP1/Par4 or
THAP1/SLC binding will therefore inhibit yeast cell growth.
[0873] Small molecules (5 mg ml.sup.-1 in DMSO; Chembridge) are
added by using plastic 384-pin arrays (Genetix). The plates are
incubated for 4 to 5 days at 30.degree. C., and small molecules
which inhibit the growth of yeast cells by disrupting THAP1/Par4 or
THAP1/SLC two-hybrid interaction are selected for further
analysis.
Example 25
High Throughput In Vitro Assay to Identify Inhibitors of
THAP-Family Polypeptide/THAP-Family Protein Target Interaction
[0874] To identify small molecule modulators of THAP function, a
high-throughput screen based on fluorescence polarization (FP) is
used to monitor the displacement of a fluorescently labelled THAP1
protein from a recombinant glutathione-S-transferase (GST)-THAP
binding domain of Par4 (Par4DD) fusion protein or a recombinant
GST-SLC/CCL21 fusion protein.
[0875] Assays are carried out essentially as in Degterev et al,
Nature Cell Biol. 3: 173-182 (2001) and Dandliker et al, Methods
Enzymol. 74: 3-28 (1981). The assay can be calibrated by titrating
a THAP1 peptide labelled with Oregon Green with increasing amounts
of GST-Par4DD or GST-SLC/CCL21 proteins. Binding of the peptide is
accompanied by an increase in polarization (mP,
millipolarization).
[0876] THAP1 and PAR4 polypeptides and GST-fusions can be produced
as previously described. The THAP1 peptide was expressed and
purified using a QIAexpressionist kit (Qiagen) according to the
manufacturer's instructions. Briefly, the entire THAP1 coding
sequence was amplified by PCR using pGBKT7-THAP1 as a template with
primers 2HMR8 (5'-CGCGGATCCGTGCAGTCCTGCTCCGCCTACGGC-3') (SEQ ID NO:
236) and 2HMR9 (5'-CGCGGATCCTGCTGGTACTTCAACTATTTCAAAGTAGTC-3') (SEQ
ID NO: 237), and cloned into the BamHI site of pQE30 vector
(Qiagen). The resulting pQE30-His THAP1 plasmid was transformed in
E. coli strain M15 (Qiagen). 6.times.His-tagged-THAP1 protein was
purified from inclusion bodies on a Ni-Agarose column (Qiagen)
under denaturing conditions, and the eluate was used for in vitro
interaction assays. To produce GST-Par4DD fusion protein, Par4DD
(amino acids 250-342) was amplified by PCR with primers Par4.10
(5'-GCCGGATCCGGGTTCCCTAGATATAACAGGGATGCAA-3') (SEQ ID NO: 238) and
Par4.5 (5'-GCGGGATCCCTCTACCTGGTCAGCTGACCCACAAC-3') (SEQ ID NO:
239), and cloned in frame downstream of the Glutathione
S-Transferase (GST) ORF, into the BamHI site of the pGEX-2T
prokaryotic expression vector (Amersham Pharmacia Biotech, Saclay,
France). Similarly, to produce GST-SLC/CCL21 fusion protein, the
mature form of human SLC/CCL21 (amino acids 24-134) was amplified
by PCR with primers hSLCbam.5'
(5'-GCGGGATCCAGTGATGGAGGGGCTCAGGACTGTTG-3') (SEQ ID NO: 240) and
hSLCbam.3' (5'-GCGGGATCCCTATGGCCCTTTAGGGGTCTGTGACC-3') (SEQ ID NO:
241), digested with BamHI and inserted into the BamHI cloning site
of the pGEX-2T vector. GST-Par4DD (amino acids 250-342) and
GST-SLC/CCL21 (amino acids 24-134) fusion proteins were expressed
in E. Coli DH5.alpha. (supE44, DELTAlacU169 (80lacZdeltaM15),
hsdR17, recA1, endA1, gyrA96, thi1, relA 1) and purified by
affinity chromatography with glutathione sepharose according to
supplier's instructions (Amersham Pharmacia Biotech).
[0877] For screening small molecules, THAP1 peptide is labelled
with succinimidyl Oregon Green (Molecular Probes, Oregon) and
purified by HPLC. 33 nM labelled THAP1 peptide, 2 .mu.M GST-Par4DD
or GST-SLC/CCL21 protein, 0.1% bovine gamma-globulin (Sigma) and 1
mM dithiothreitol mixed with PBS, pH 7.2 (Gibco), are added to
384-well black plates (Lab Systems) with Multidrop (Lab Systems).
Small molecules (5 mg ml.sup.-1 in DMSO; Chembridge) are
transferred by using plastic 384-pin arrays (Genetix). The plates
are incubated for 1-2 hours at 25.degree. C., and FP values are
determined with an Analyst plate reader (LJL Biosystems).
Example 26
High Throughput Chip Assay to Identify Inhibitors of THAP-Family
Polypeptide/THAP-Family Protein Target Interaction
[0878] A chip based binding assay Degterev et al, (2001) Nature
Cell Biol. 3: 173-182 using unlabelled THAP and THAP-family target
protein may be used to identify molecules capable of interfering
with THAP-family and THAP-family target interactions, providing
high sensitivity and avoiding potential interference from label
moieties. In this example, the THAP1 binding domain of Par4 protein
(Par4DD) or SLC/CCL21 is covalently attached to a surface-enhanced
laser desorption/ionization (SELDI) chip, and binding of unlabelled
THAP1 protein to immobilized protein in the presence of a test
compound is monitored by mass spectrometry.
[0879] Recombinant THAP1 protein, GST-Par4DD and GST-SLC/CCL21
fusion proteins are prepared as described in Example 25. Purified
recombinant GST-Par4DD or GST-SLC/CCL21 protein is coupled through
its primary amine to SELDI chip surfaces derivatized with
cabonyldiimidazole (Ciphergen). THAP1 protein is incubated in a
total volume of 1 .mu.l for 12 hours at 4.degree. C. in a
humidified chamber to allow binding to each spot of the SELDI chip,
then washed with alternating high-pH and low-pH buffers (0.1M
sodium acetate containing 0.5M NaCl, followed by 0.01 M HEPES, pH
7.3). The samples are embedded in an alpha-cyano-4-hydroxycinnamic
acid matrix and analyzed for mass by matrix-assisted laser
desorption ionization time-of-flight (MALDI-TOF) mass spectrometry.
Averages of 100 laser shots at a constant setting are collected
over 20 spots in each sample.
Example 27
High Throughput Cell Assay to Identify Inhibitors of THAP-Family
Polypeptide/THAP-Family Protein Target Interaction
[0880] A fluorescence resonance energy transfer (FRET) assay is
carried out between THAP-1 and PAR4 or SLC/CCL21 proteins fused
with fluorescent proteins. Assays can be carried out as in Majhan
et al, Nature Biotechnology 16: 547-552 (1998) and Degterev et al,
Nature Cell Biol. 3: 173-182 (2001).
[0881] THAP-1 protein is fused to cyan fluorescent protein (CFP)
and PAR4 or SLC/CCL21 protein is fused to yellow fluorescent
protein (YFP). Vectors containing THAP-family and THAP-family
target proteins can be constructed essentially as in Majhan et al
(1998). A THAP-1-CFP expression vector is generated by subcloning a
THAP-1 cDNA into the pECFP-N1 vector (Clontech). PAR4-YFP or
SLC/CCL21-CYP expression vectors are generated by subcloning a PAR4
or a SLC/CCL21 cDNA into the pEYFP-N1 vector (Clontech).
[0882] Vectors are cotransfected to HEK-293 cells and cells are
treated with test compounds. HEK-293 cells are transfected with
THAP-1-CFP and PAR4-YFP or SLC/CCL21-YFP expression vectors using
Lipofect AMINE Plus (Gibco) or TransLT-1 (PanVera). 24 hours later
cells are treated with test compounds and incubated for various
time periods, preferably up to 48 hours. Cells are harvested in
PBS, optionally supplemented with test compound, and fluorescence
is determined with a C-60 fluorimeter (PTI) or a Wallac plate
reader. Fluorescence in the samples separately expressing
THAP-1-CFP and PAR4-YFP or SLC/CCL21-YFP is added together and used
to estimate the FRET value in the absence of THAP-1/PAR4 or
THAP1/SLC/CCL21 binding.
[0883] The extent of FRET between CFP and YFP is determined as the
ratio between the fluorescence at 527 nm and that at 475 nm after
excitation at 433 nm. The cotransfection of THAP-1 protein and PAR4
or SLC/CCL21 protein results in an increase of FRET ratio over a
reference FRET ratio of 1.0 (determined using samples expressing
the proteins separately). A change in the FRET ratio upon treatment
with a test compound (over that observed after cotransfection in
the absence of a test compound) indicates a compound capable of
modulating the interaction of the THAP-1 protein and the PAR4 or
the SLC/CCL21 protein.
Example 28
In Vitro Assay to Identify THAP-Family Polypeptide DNA Targets
[0884] DNA binding specificity of THAP1 was determined using a
random oligonucleotide selection method allowing unbiased analysis
of binding sites selected by the THAP domain of the THAP1 protein
from a random pool of possible sites. The method was carried out
essentially as described in Bouvet (2001) Methods Mol Biol.
148:603-10. Also, see Pollack and Treisman (1990) Nuc. Acid Res.
18:6197-6204; Blackwell and Weintraub, (1990) Science 250:
1104-1110; Ko and Engel, (1993) Mol. Cell. Biol. 13:4011-4022;
Merika and Orkin, (1993) Mol. Cell. Biol. 13: 3999-4010; and
Krueger and Morimoto, (1994) Mol. Cell. Biol. 14:7592-7603), the
disclosures of which are incorporated herein by reference in their
entireties.
Recombinant THAP Domain Expression and Purification
[0885] A cDNA fragment encoding the THAP domain of human THAP-1
(amino acids 1-90, SEQ ID NO: 3) was cloned by PCR using as a
template pGADT7-THAP-1 (see Example 4) with the following primers
5'-GCGCATATGGTGCAGTCCTGCTCCGCCTACGGC-3' (SEQ ID NO: 242) and
5'-GCGCTCGAGTTTCTTGTCATGTGGCTCAGTACAAAG-3' (SEQ ID NO: 243). The
PCR product was cloned as a NdeI-XhoI fragment into pET-21c
prokaryotic expression vector (Novagen) in frame with a sequence
encoding a carboxy terminal His tag, to generate pET-21c-THAP.
[0886] For the expression of THAP-His6, pET-21c-THAP was
transformed into Escherichia coli strain BL-21 pLysS. Bacteria were
grown at 37.degree. C. to an optical density at 600 nm of 0.6 and
expression of the protein was induced by adding
isopropyl-.beta.-D-thiogalactoside (Sigma) at a final concentration
of 1 mM and incubation was continued for 4 hours.
[0887] The cells were collected by centrifugation and resuspended
in ice cold of buffer A (50 mM sodium-phosphate pH 7.5, 300 mM
NaCl, 0.1% .beta.-mercaptoethanol, 10 mM Imidazole). Cells were
lysed by sonication and the lysate was cleared by centrifugation at
12000 g for 45 min. The supernatant was loaded onto a Ni-NTA
agarose column (Quiagen) equilibrated in buffer A. After washing
with buffer A and Buffer A with 40 mM Imidazole, the protein was
eluted with buffer B (same as A with 0.05% .beta.-mercaptoethanol
and 250 mM Imidazole).
[0888] Fractions containing THAP-His6 were pooled and applied to a
Superdex 75 gel filtration column equilibrated in Buffer C
(Tris-HCl 50 mM pH 7.5, 150 mM NaCl, 1 mM DTT). Fractions
containing the THAP-His6 protein were pooled, concentrated by
within YM-3 Amicon filter devices and stored at 4.degree. C. or
frozen at -80.degree. C. in buffer C containing 20% glycerol. The
purity of the sample was assessed by SDS-Polyarylamide Gel
Electrophoresis (PAGE) and Coomassie blue staining analysis. The
structural integrity of the protein preparation was checked by ESI
mass spectrometry and Peptide mass mapping using a MALDI-TOF Mass
spectrometer. The protein concentration was determined with
Bradford Protein Assay.
Random Oligonucleotide Selection
[0889] According to the SELEX protocol described in Bouvet (2001)
Methods Mol Biol. 148:603-10, a 62 bp oligonucleotide having
sequences as follows was synthesized:
5'-TGGGCACTATTTATATCAAC-N25-AATGTCGTTGGTGGCCC-3' (SEQ ID NO: 244)
where N is any nucleotide, and primers complementary to each end.
Primer P is: 5'-ACCGCAAGCTTGGGCACTATTTATATCAAC-3' (SEQ ID NO: 245),
and primer R is 5'-GGTCTAGAGGGCCACCAACGCATT-3' (SEQ ID NO: 246).
The 62-mer oligonucleotide is made double stranded by PCR using the
P and R primers generating a 80 bp random pool.
[0890] About 250 ng of THAP-His6 was incubated with Ni-NTA magnetic
beads in NT2 buffer (20 mM Tris-HCl pH 7.5, 100 mM NaCl, 0.05%
NP-40) for 30 min at 4.degree. C. on a roller. The beads were
washed 2 times with 500 .mu.l of NT2 buffer to remove unbound
protein. The immobilized THAP-His6 was incubated with the random
pool of double stranded 80 bp DNA (2 to 5% g) in 100 .mu.l of
Binding buffer (20 mM Tris-HCl pH 7.5, 100 mM NaCl, 0.05% NP-40,
0.5 mM EDTA, 100 .mu.g/ml BSA, and 20 to 50 .mu.g of poly(dI-dC))
for 10 minutes at room temperature. The beads were then washed 6
times with 500 .mu.l of NT2 buffer. The protein/DNA complex were
then subjected to extraction with phenol/chloroform and
precipitation with ethanol using 10 .mu.g of glycogen as a carrier.
About one fifth of the recovered DNA was then amplified by 15 to 20
cycles of PCR and used for the next round of selection. After 8
rounds of selection, the NaCl concentration was progressively
increased to 150 mM.
[0891] After 12 rounds of selection by THAP-His6, pools of
amplified oligonucleotides were digested with Xba I and Hind III
and cloned into pBluescript II KS--(Stratagene) and individual
clones were sequenced using Big Dye terminator Kit (Applied
Biosystem).
[0892] The results of the sequence analysis show that the THAP
domain of human THAP1 is a site-specific DNA binding domain. Two
consensus sequences were deduced from the alignment of two sets of
nucleotide sequences obtained from the above SELEX procedure (each
set containing 9 nucleic acid sequences). In particular, it was
found that the THAP domain recognizes GGGCAA or TGGCAA DNA target
sequences preferentially organized as direct repeats with 5
nucleotide spacing (DR-5 motifs). The consensus sequence being
GGGCAAnnnnnTGGCAA (SEQ ID NO: 149). Additionally, THAP recognizes
everted repeats with 11 nucleotide spacing (ER-11 motifs) having a
consensus sequence of TTGCCAnnnnnnnnnnnGGGCAA (SEQ ID NO: 159).
Although GGGCAA and TGGCAA sequences constitute the preferential
THAP domain DNA binding sites, GGGCAT, GGGCAG and TGGCAG sequences
are also DNA target sequences recognized by the THAP domain.
Example 29
High Throughput In Vitro Assay to Identify Inhibitors of
THAP-Family Polypeptide or THAP-Family Interactions with
Nonspecific DNA Targets
[0893] High throughput assays for the detection and quantification
of THAP1-nonspecific DNA binding is carried out using a
scintillation proximity assay. Materials are available from
Amersham (Piscataway, N.J.) and assays can be carried out according
to Gal S. et al, 6.sup.th Ann. Conf. Soc. Biomol. Screening, 6-9
Sep. 2000, Vancouver, B.C.), the disclosure of which is
incorporated herein by reference in its entirety.
[0894] Random double stranded DNA probes are prepared and labelled
using [.sup.3H]TTP and terminal transferase to a suitable specific
activity (e.g. approx. 420 i/mmol). THAP1 protein or a portion
thereof is prepared and the quantity of THAP1 protein or a portion
thereof is determined via ELISA. For assay development purposes,
electrophoretic mobility shift assays (EMSA) can be carried out to
select suitable assay parameters. For the high throughput assay,
.sup.3H labelled DNA, anti-THAP1 monoclonal antibody and THAP1 in
binding buffer (Hepes, pH7.5; EDTA; DTT; 10 mM ammonium sulfate;
KCl and Tween-20) are combined. The assay is configured in a
standard 96-well plate and incubated at room temperature for 5 to
30 minutes, followed by the addition of 0.5 to 2 mg of PVT protein
A SPA beads in 50-100 .mu.l binding buffer. The radioactivity bound
to the SPA beads is measured using a TopCount.TM. Microplate
Counter (Packard Biosciences, Meriden, Conn.).
Example 30
High Throughput In Vitro Assay to Identify Inhibitors of
THAP-Family Polypeptide or THAP-Family Interactions with Specific
DNA Targets
[0895] High throughput assays for the detection and quantification
of THAP1 specific DNA binding is carried out using a scintillation
proximity assay. Materials are available from Amersham (Piscataway,
N.J.) and assays can be carried out according to Gal S. et al,
6.sup.th Ann. Conf. Soc. Biomol. Screening, 6-9 Sep. 2000,
Vancouver, B.C.).
[0896] THAP1-specific double stranded DNA probes corresponding to
THAP1 DNA binding sequences obtained according to Example 20 are
prepared. The probes are labelled using [.sup.3H]TTP and terminal
transferase to a suitable specific activity (e.g. approx. 420
i/mmol). THAP1 protein or a portion thereof is prepared and the
quantity of THAP1 protein or a portion thereof is determined via
ELISA. For assay development purposes, electrophoretic mobility
shift assays (EMSA) can be carried out to select suitable assay
parameters. For the high throughput assay, .sup.3H labelled DNA,
anti-THAP 1 monoclonal antibody, 11 g non-specific DNA (double or
single stranded poly-dAdT) and THAP1 protein or a portion thereof
in binding buffer (Hepes, pH7.5; EDTA; DTT; 10 mM ammonium sulfate;
KCl and Tween-20) are combined. The assay is configured in a
standard 96-well plate and incubated at room temperature for 5 to
30 minutes, followed by the addition of 0.5 to 2 mg of PVT protein
A SPA beads in 50-100 .mu.l binding buffer. The radioactivity bound
to the SPA beads is measured using a TopCount.TM. Microplate
Counter (Packard Biosciences, Meriden, Conn.).
Example 31
Preparation of Antibody Compositions
[0897] Substantially pure THAP1 protein or a portion thereof is
obtained. The concentration of protein in the final preparation is
adjusted, for example, by concentration on an Amicon filter device,
to the level of a few micrograms per ml. Monoclonal or polyclonal
antibodies to the protein can then be prepared as follows:
Monoclonal Antibody Production by Hybridoma Fusion Monoclonal
antibody to epitopes in the THAP1 protein or a portion thereof can
be prepared from murine hybridomas according to the classical
method of Kohler and Milstein (Nature, 256: 495, 1975) or
derivative methods thereof (see Harlow and Lane, Antibodies A
Laboratory Manual, Cold Spring Harbor Laboratory, pp. 53-242,
1988), the disclosure of which is incorporated herein by reference
in its entirety.
[0898] Briefly, a mouse is repetitively inoculated with a few
micrograms of the THAP1 protein or a portion thereof over a period
of a few weeks. The mouse is then sacrificed, and the antibody
producing cells of the spleen isolated. The spleen cells are fused
by means of polyethylene glycol with mouse myeloma cells, and the
excess unfused cells destroyed by growth of the system on selective
media comprising aminopterin (HAT media). The successfully fused
cells are diluted and aliquots of the dilution placed in wells of a
microtiter plate where growth of the culture is continued.
Antibody-producing clones are identified by detection of antibody
in the supernatant fluid of the wells by immunoassay procedures,
such as ELISA, as originally described by Engvall, E., Meth.
Enzymol. 70: 419 (1980), the disclosure of which is incorporated
herein by reference in its entirety. Selected positive clones can
be expanded and their monoclonal antibody product harvested for
use. Detailed procedures for monoclonal antibody production are
described in Davis, L. et al. Basic Methods in Molecular Biology,
Elsevier, N.Y., Section 21-2, the disclosure of which is
incorporated herein by reference in its entirety.
Polyclonal Antibody Production by Immunization
[0899] Polyclonal antiserum containing antibodies to heterogeneous
epitopes in the THAP1 protein or a portion thereof can be prepared
by immunizing suitable non-human animal with the THAP1 protein or a
portion thereof, which can be unmodified or modified to enhance
immunogenicity. A suitable nonhuman animal, preferably a non-human
mammal, is selected. For example, the animal may be a mouse, rat,
rabbit, goat, or horse. Alternatively, a crude protein preparation
which, has been enriched for THAP1 or a portion thereof can be used
to generate antibodies. Such proteins, fragments or preparations
are introduced into the non-human mammal in the presence of an
appropriate adjuvant (e.g. aluminum hydroxide, RIBI, etc.) which is
known in the art. In addition the protein, fragment or preparation
can be pretreated with an agent which will increase antigenicity,
such agents are known in the art and include, for example,
methylated bovine serum albumin (mBSA), bovine serum albumin (BSA),
Hepatitis B surface antigen, and keyhole limpet hemocyanin (KLH).
Serum from the immunized animal is collected, treated and tested
according to known procedures. If the serum contains polyclonal
antibodies to undesired epitopes, the polyclonal antibodies can be
purified by immunoaffinity chromatography.
[0900] Effective polyclonal antibody production is affected by many
factors related both to the antigen and the host species. Also,
host animals vary in response to site of inoculations and dose,
with both inadequate or excessive doses of antigen resulting in low
titer antisera. Small doses (ng level) of antigen administered at
multiple intradermal sites appears to be most reliable. Techniques
for producing and processing polyclonal antisera are known in the
art, see for example, Mayer and Walker (1987), the disclosure of
which is incorporated herein by reference in its entirety. An
effective immunization protocol for rabbits can be found in
Vaitukaitis, J. et al. J. Clin. Endocrinol. Metab. 33: 988-991
(1971), the disclosure of which is incorporated herein by reference
in its entirety. Booster injections can be given at regular
intervals, and antiserum harvested when antibody titer thereof, as
determined semi-quantitatively, for example, by double
immunodiffusion in agar against known concentrations of the
antigen, begins to fall. See, for example, Ouchterlony, O. et al.,
Chap. 19 in: Handbook of Experimental Immunology D. Wier (ed)
Blackwell (1973). Plateau concentration of antibody is usually in
the range of 0.1 to 0.2 mg/ml of serum (about 12: M). Affinity of
the antisera for the antigen is determined by preparing competitive
binding curves, as described, for example, by Fisher, D., Chap. 42
in: Manual of Clinical Immunology, 2d Ed. (Rose and Friedman, Eds.)
Amer. Soc. For Microbiol., Washington, D.C. (1980).
[0901] Antibody preparations prepared according to either the
monoclonal or the polyclonal protocol are useful in quantitative
immunoassays which determine concentrations of antigen-bearing
substances in biological samples; or they are also used
semi-quantitatively or qualitatively to identify the presence of
antigen in a biological sample. The antibodies may also be used in
therapeutic compositions for killing cells expressing the protein
or reducing the levels of the protein in the body.
REFERENCES
[0902] Numerous literature and patent references have been cited in
the present application. All references cited are incorporated by
reference herein in their entireties.
[0903] For some references, the complete citation is in the body of
the text. For other references the citation in the body of the text
is by author and year, the complete citation being as follows:
[0904] Alcalay, M., Tomassoni, L., Colombo, E., Stoldt, S.,
Grignani, F., Fagioli, M., Szekely, L., Helin, K., and Pelicci, P.
G. (1998). The promyelocytic leukemia gene product (PML) forms
stable complexes with the retinoblastoma protein. Mol Cell Biol 18,
1084-93. [0905] Arcone, et al., Nucl. Acids Res., 16(8): 3195-3207,
1988. [0906] Baichwal and Sugden, In: Gene Transfer, Kucherlapati
R, ed., New York, Plenum Press, pp. 117-148, 1986. [0907] Barradas,
M., Monjas, A., Diaz-Meco, M. T., Serrano, M., and Moscat, J.
(1999). The downregulation of the pro-apoptotic protein Par4 is
critical for Ras-induced survival and tumor progression. Embo J 18,
6362-9. [0908] Bartlett et al., Proc. Nat. Acad. Sci. USA,
93:8852-8857, 1996. [0909] Benvenisty and Neshif, Proc. Nat. Acad.
Sci. USA, 83:9551-9555, 1986. [0910] Berra, E., Municio, M. M.,
Sanz, L., Frutos, S., Diaz-Meco, M. T., and Moscat, J. (1997).
Positioning atypical protein kinase C isoforms in the UV-induced
apoptotic signaling cascade. Mol Cell Biol 17, 4346-54. [0911]
Bloch, D. B., Chiche, J. D., Orth, D., de la Monte, S. M.,
Rosenzweig, A., and Bloch, K. D. (1999). Structural and functional
heterogeneity of nuclear bodies. Mol Cell Biol 19, 4423-30. [0912]
Boghaert E. R. et al, Cell Growth Differ. 1997 August; 8(8):881-90
[0913] Burge, C., Karlin, S. (1997) Prediction of complete gene
structures in human genomic DNA. J. Mol. Biol. 268, 78-94 [0914]
Carter and Flotte, Ann. N.Y. Acad Sci., 770:79-90, 1995. [0915]
Chattedee, et al., Ann. N.Y. Acad Sci., 770:79-90, 1995. [0916]
Chen and Okayama, Mol. Cell Biol., 7:2745-2752, 1987. [0917]
Coffin, In: Virology, ed., New York: Raven Press, pp. 143 7-15 00,
1990. [0918] Coupar et al., Gene, 68:1-10, 1988. [0919] Dani, et
al., J Biol. Chem., 264:10119-10125, 1989. [0920] Diaz-Meco, M. T.,
Municio, M. M., Frutos, S., Sanchez, P., Lozano, J., Sanz, L., and
Moscat, J. (1996). The product of Par4, a gene induced during
apoptosis, interacts selectively with the atypical isoforms of
protein kinase C. Cell 86, 777-86. [0921] Dubensky et al., Proc.
Nat'l Acad. Sci. USA, 81:7529-7533, 1984. [0922] Fechheimer et al.,
Proc. Nat Acad. Sci. USA, 84:8463-8467, 1987. [0923] Felsenstein,
J. 1989. PHYLIP--Phylogeny Inference Package (Version 3.2).
Cladistics 5: 164-166. [0924] Ferkol et al., FASEB J., 7:1081-1091,
1993. [0925] Ferrari et al., J Virol., 70:3227-3234, 1996. [0926]
Fisher et al., J Virol., 70:520-532, 1996. [0927] Flotte et al.,
Proc. Nat'l Acad. Sci. USA, 90:10613-10617, 1993. [0928] Fogal, V.,
Gostissa, M., Sandy, P., Zacchi, P., Sternsdorf, T., Jensen, K.,
Pandolfi, P. P., Will, H., Schneider, C., and Del Sal, G. (2000).
Regulation of p53 activity in nuclear bodies by a specific PML
isoform. Embo J 19, 6185-95. [0929] Fraley et al., Proc. Nat'l
Acad. Sci. USA, 76:3348-3352, 1979. [0930] Friedmann, "Progress
toward human gene therapy," Science, 244:1275-1281, 1989. [0931]
Ghosh and Bachhawat, In: Liver diseases, targeted diagnosis and
therapy using specific receptors and ligands, (Wu G, Wu C ed,), New
York: Marcel Dekker, pp. 87 104, 1991. [0932] Girard, J. P.,
Baekkevold, E. S., Feliu, J., P, B., and Amalric, F. (1999).
Molecular cloning and functional analysis of SUT-1, a sulfate
transporter from human high endothelial venules. Proc Natl Acad Sci
USA 96:12772-12777. [0933] Girard, J. P., Baekkevold, E. S.,
Yamanaka, T., Haraldsen, G., Brandtzaeg, P., and Amalric, F.
(1999). Heterogeneity of endothelial cells: the specialized
phenotype of human high endothelial venules characterized by
suppression subtractive hybridization. Am J Pathol 155:2043-2055.
[0934] Girard, J. P., and Springer, T. A. (1995). Cloning from
purified high endothelial venule cells of hevin, a close relative
of the antiadhesive extracellular matrix protein SPARC. Immunity 2,
113-123. [0935] Goodman et al., Blood, 84:1492-1500, 1994. [0936]
Gopal, Mol. Cell Biol., 5:1188-1190, 1985. [0937] Gossen and
Bujard, Proc. Nat Acad. Sci. USA, 89:5547-5551, 1992. [0938] Gossen
et al., Science, 268:1766-1769, 1995. [0939] Graham and Van Der Eb,
Virology, 52:456-467, 1973. [0940] Guo, Q., Fu, W., Xie, J., Luo,
H., Sells, S. F., Geddes, J. W., Bondada, V., Rangnekar, V. M., and
Mattson, M. P. (1998). Par4 is a mediator of neuronal degeneration
associated with the pathogenesis of Alzheimer disease. Nat Med 4,
957-62. [0941] Hay et al., J Mol. Biol., 175:493-510, 1984. [0942]
Hearing and Shenk, J Mol. Biol. 167:809-822, 1983. [0943] Hearing
et al., J Virol., 67:2555-2558, 1987. [0944] Higgins, D. G.,
Thompson, J. D. and Gibson, T. J. (1996) Using CLUSTAL for multiple
sequence alignments. Methods Enzymol., 266, 383-402. [0945]
Horowitz, Yandell, Park, Canning, Whyte, Buchkovich, Harlow,
Weinberg, Dryja, "Point mutational inactivation of the
retinoblastoma antioncogene," Science 243, 937 940, 1989. [0946]
Hunt et al., Proc. Nat Acad. Sci. USA, 83:3786-3790, 1986. [0947]
Ishov, A. M., Sotnikov, A. G., Negorev, D., Vladimirova, O. V.,
Neff, N., Kamitani, T., Yeh, E. T., Strauss, J. F., 3rd, and Maul,
G. G. (1999). PML is critical for ND10 formation and recruits the
PML-interacting protein daxx to this nuclear structure when
modified by SUMO-1. J Cell Biol 147, 221-34. [0948] Jareborg N,
Birney E, Durbin R. Genome Res. 1999 September; 9(9):815-24. [0949]
Jentsch, S., and Pyrowolakis, G. (2000). Ubiquitin and its kin: how
close are the family ties? Trends Cell Biol 10, 335-42. [0950]
Johnstone, R. W., See, R. H., Sells, S. F., Wang, J., Muthukkumar,
S., Englert, C., Haber, D. A., Licht, J. D., Sugrue, S. P.,
Roberts, T., Rangnekar, V. M., and Shi, Y. (1996). A novel
repressor, Par4, modulates transcription and growth suppression
functions of the Wilms' tumor suppressor WT1. Mol Cell Biol 16,
6945-56. [0951] Joki et al., Human Gene Ther., 6:1507-1513, 1995.
[0952] Kageyama, et al., J Biol. Chem., 262(5):2345-2351, 1987.
[0953] Kaneda et al., Science, 243:375-378, 1989. [0954] Kaplitt et
al., Nat Genet., 8:148-153, 1994. [0955] Kato et al, J Biol. Chem.,
266:3361-3364, 1991. [0956] Kessler et al., Proc. Nat Acad. Sci.
USA, 93:14082-14087, 1996. [0957] Klein et al., Nature, 327:70-73,
1987. [0958] Koeberl et al., Proc. Nat 7 Acad. Sci. USA,
94:1426-1431, 1997. [0959] Korhonen et al., Blood, 86:1828-1835,
1995. [0960] Lallemand-Breitenbach, V., Zhu, J., Puvion, F., Koken,
M., Honore, N., Doubeikovsky, A., Duprez, E., Pandolfi, P. P.,
Puvion, E., Freemont, P., and de The, H. (2001). Role of
Promyelocytic Leukemia (PML) Sumolation in Nuclear Body Formation,
11S Proteasome Recruitment, and As(2)O(3)-induced PML or
PML/Retinoic Acid Receptor alpha Degradation. J Exp Med 193,
1361-72. [0961] LaMorte, V. J., Dyck, J. A., Ochs, R. L., and
Evans, R. M. (1998). Localization of nascent RNA and CREB binding
protein with the PML-containing nuclear body. Proc Natl Acad Sci
USA 95, 4991-6. [0962] Levrero et al., Gene, 10 1: 195-202, 1991.
[0963] Li, H., Leo, C., Zhu, J., Wu, X., O'Neil, J., Park, E. J.,
and Chen, J. D. (2000). Sequestration and inhibition of
Daxx-mediated transcriptional repression by PML. Mol Cell Biol 20,
1784-96. [0964] Mann et al., Cell, 33:153-159, 1983. [0965]
Mattson, M. P., Duan, W., Chan, S. L., and Camandola, S. (1999).
Par4: an emerging pivotal player in neuronal apoptosis and
neurodegenerative disorders. J Mol Neurosci 13, 17-30. [0966] Maul,
G. G., Negorev, D., Bell, P., and Ishov, A. M. (2000). Review:
properties and assembly mechanisms of ND10, PML bodies, or PODs. J
Struct Biol 129, 278-87. [0967] Melchior, F. (2000).
SUMO--nonclassical ubiquitin. Annu Rev Cell Dev Biol 16, 591-626.
[0968] Mizukami et al., Virology, 217:124-130, 1996. [0969] Muller,
S., Matunis, M. J., and Dejean, A. (1998). Conjugation with the
ubiquitin-related modifier SUMO-1 regulates the partitioning of PML
within the nucleus. Embo J 17, 61-70. [0970] McCown et al., Brain
Res., 713:99-107, 1996. [0971] Nicolas and Rubenstein, In: Vectors:
A survey of molecular cloning vectors and their uses, Rodriguez and
Denhardt (eds.), Stoneham: Butterworth, pp. 493-513, 1988. [0972]
Nicolau and Sene, Biochim. Biophys. Acta, 721:185-190, 1982. [0973]
Nicolau et al., Methods Enzymol., 149:157-176, 1987. [0974]
Olivierio, et al., EMBO J. 6(7):1905-1912, 1987. [0975] Page, G.,
Kogel, D., Rangnekar, V., and Scheidtmann, K. H. (1999).
Interaction partners of Dlk/ZIP kinase: co-expression of Dlk/ZIP
kinase and Par4 results in cytoplasmic retention and apoptosis.
Oncogene 18, 7265-73. [0976] Pape and Kim, Mol. Cell. Biol.,
974-982, 1989. [0977] Paskind et al., Virology, 67:242-248, 1975.
[0978] Perales et al., Proc. Nat Acad Sci. 91:4086-4090, 1994.
[0979] Ping et al., Microcirculation, 3:225-228, 1996. [0980] Poli
and Cortese, Proc. Nat'l Acad Sci. USA, 86:8202-8206, 1989. [0981]
Potter et al., Proc. Nat Acad. Sci. USA, 81:7161-7165, 1984. [0982]
Prowse and Baumann, Mol Cell Biol, 8(1):42-51, 1988. [0983]
Quignon, F., De Bels, F., Koken, M., Feunteun, J., Ameisen, J. C.,
and de The, H. (1998). PML induces a novel caspase-independent
death process. Nat Genet 20, 259-65. [0984] Radler et al., Science,
275:810-814, 1997. Rb Protein Inhibits p84N5-induced Apoptosis,
10:3261, October 1999. [0985] Ridgeway, In: Vectors: A survey of
molecular cloning vectors and their uses, Rodriguez R L, Denhardt D
T, ed., Stoneham:Butterworth, pp. 467-492, 1988. [0986] Rippe et
al., Mol. Cell. Biol., 10:689-695, 1990. [0987] Ron et al., Mol.
Cell. Biol., 2887-2895, 1991. [0988] Roux et al., Proc. Nat. Acad.
Sci. USA, 86:9079-9083, 1989. [0989] Ruggero, D., Wang, Z. G., and
Pandolfi, P. P. (2000). The puzzling multiple lives of PML and its
role in the genesis of cancer. Bioessays 22, 827-35. [0990] Sells,
S. F., Han, S. S., Muthukkumar, S., Maddiwar, N., Johnstone, R.,
Boghaert, E., Gillis, D., Liu, G., Nair, P., Monnig, S., Collini,
P., Mattson, M. P., Sukhatme, V. P., Zimmer, S. G., Wood, D. P.,
Jr., McRoberts, J. W., Shi, Y., and Rangnekar, V. M. (1997).
Expression and function of the leucine zipper protein Par4 in
apoptosis. Mol Cell Biol 17, 3823-32. [0991] Speigelman, et al., J.
Biol. Chem., 264(3), 1811-1815, 1989. [0992] Sternsdorf, T.,
Jensen, K., Reich, B., and Will, H. (1999). The nuclear dot protein
sp100, characterization of domains necessary for dimerization,
subcellular localization, and modification by small ubiquitin-like
modifiers. J. Biol Chem 274, 12555-66. [0993] Tartaglia, Ayres,
Wong, and Goeddel, "A novel domain within the 55 kd TNF receptor
signals cell death," Cell 74, 845-853, 1993. [0994] Temin, In: Gene
Transfer, Kucherlapati (ed.), New York: Plenum Press, pp. 149-188,
1986. [0995] Tibbetts Cell, 12:243-249, 1977. [0996] Tur-Kaspa et
al., Mol. Cell. Biol., 6:716-718, 1986. [0997] Wagner et al., Proc.
Nat'l Acad. Sci. 87(9):3410-3414, 1990. [0998] Walther and Stein, J
Mol. Med, 74:3 79-3 92, 1996. [0999] Wang, Z. G., Delva, L.,
Gaboli, M., Rivi, R., Giorgio, M., Cordon-Cardo, C., Grosveld, F.,
and Pandolfi, P. P. (1998). Role of PML in cell growth and the
retinoic acid pathway. Science 279, 1547-51. [1000] Wang, Z. G.,
Ruggero, D., Ronchetti, S., Zhong, S., Gaboli, M., Rivi, R., and
Pandolfi, P. P. (1998). PML is essential for multiple apoptotic
pathways. Nat Genet 20, 266-72. [1001] Watt et al., Proc. Nat'l
Acad. Sci., 83(2): 3166-3170, 1986. [1002] Wilson, et al., Mol.
Cell. Biol., 6181-6191, 1990. [1003] Wong et al., Gene, 10:87-94,
1980. [1004] Wu and Wu, Adv. Drug Delivery Rev., 12:159-167, 1993.
[1005] Wu and Wu, Biochem., 27:887-892, 1988. [1006] Wu and Wu, J
Biol. Chem., 262:4429-4432, 1987. [1007] Xiao et al., J Virol.,
70:8098-8108, 1996. [1008] Yang et al., Proc. Nat Acad. Sci USA,
87:9568-9572, 1990. [1009] Yeh, E. T., Gong, L., and Kamitani, T.
(2000). Ubiquitin-like proteins: new wines in new bottles. Gene
248, 1-14. [1010] Zechner, et al., Mol. Cell. Biol., 23 94-2401,
1988. [1011] Zhong, S., Hu, P., Ye, T. Z., Stan, R., Ellis, N. A.,
and Pandolfi, P. P. (1999). A role for PML and the nuclear body in
genomic stability. Oncogene 18, 7941-7. [1012] Zhong, S., Muller,
S., Ronchetti, S., Freemont, P. S., Dejean, A., and Pandolfi, P. P.
(2000). Role of SUMO-1-modified PML in nuclear body formation.
Blood 95, 2748-52. [1013] Zhong, S., Salomoni, P., and Pandolfi, P.
P. (2000). The transcriptional role of PML and the nuclear body.
Nat Cell Biol 2, E85-90. [1014] Zhong, S., Salomoni, P., Ronchetti,
S., Guo, A., Ruggero, D., and Pandolfi, P. P. (2000). Promyelocytic
leukemia protein (PML) and Daxx participate in a novel nuclear
pathway for apoptosis. J Exp Med 191, 631-40.
Sequence CWU 1
1
263174PRTArtificial SequenceTHAP domain consensus 1Cys Xaa Xaa Xaa
Xaa Cys Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa1 5 10 15Xaa Xaa Xaa
Xaa Xaa Pro Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Trp 20 25 30Xaa Xaa
Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa 35 40 45Xaa
Cys Xaa Xaa His Phe Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa 50 55
60Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Pro65 70281PRTArtificial
SequenceTHAP domain consensus 2Met Pro Xaa Xaa Cys Xaa Xaa Xaa Xaa
Cys Xaa Xaa Xaa Xaa Xaa Xaa1 5 10 15Xaa Xaa Xaa Xaa Xaa Phe His Xaa
Phe Pro Xaa Xaa Xaa Xaa Xaa Xaa 20 25 30Xaa Xaa Xaa Trp Xaa Xaa Xaa
Xaa Xaa Arg Xaa Xaa Xaa Xaa Xaa Xaa 35 40 45Xaa Xaa Xaa Xaa Xaa Cys
Ser Xaa His Phe Xaa Xaa Xaa Xaa Phe Xaa 50 55 60Xaa Xaa Xaa Xaa Xaa
Xaa Xaa Leu Lys Xaa Xaa Ala Val Pro Thr Xaa65 70 75
80Phe3213PRTHomo sapiens 3Met Val Gln Ser Cys Ser Ala Tyr Gly Cys
Lys Asn Arg Tyr Asp Lys1 5 10 15Asp Lys Pro Val Ser Phe His Lys Phe
Pro Leu Thr Arg Pro Ser Leu 20 25 30Cys Lys Glu Trp Glu Ala Ala Val
Arg Arg Lys Asn Phe Lys Pro Thr 35 40 45Lys Tyr Ser Ser Ile Cys Ser
Glu His Phe Thr Pro Asp Cys Phe Lys 50 55 60Arg Glu Cys Asn Asn Lys
Leu Leu Lys Glu Asn Ala Val Pro Thr Ile65 70 75 80Phe Leu Cys Thr
Glu Pro His Asp Lys Lys Glu Asp Leu Leu Glu Pro 85 90 95Gln Glu Gln
Leu Pro Pro Pro Pro Leu Pro Pro Pro Val Ser Gln Val 100 105 110Asp
Ala Ala Ile Gly Leu Leu Met Pro Pro Leu Gln Thr Pro Val Asn 115 120
125Leu Ser Val Phe Cys Asp His Asn Tyr Thr Val Glu Asp Thr Met His
130 135 140Gln Arg Lys Arg Ile His Gln Leu Glu Gln Gln Val Glu Lys
Leu Arg145 150 155 160Lys Lys Leu Lys Thr Ala Gln Gln Arg Cys Arg
Arg Gln Glu Arg Gln 165 170 175Leu Glu Lys Leu Lys Glu Val Val His
Phe Gln Lys Glu Lys Asp Asp 180 185 190Val Ser Glu Arg Gly Tyr Val
Ile Leu Pro Asn Asp Tyr Phe Glu Ile 195 200 205Val Glu Val Pro Ala
2104228PRTHomo sapiens 4Met Pro Thr Asn Cys Ala Ala Ala Gly Cys Ala
Thr Thr Tyr Asn Lys1 5 10 15His Ile Asn Ile Ser Phe His Arg Phe Pro
Leu Asp Pro Lys Arg Arg 20 25 30Lys Glu Trp Val Arg Leu Val Arg Arg
Lys Asn Phe Val Pro Gly Lys 35 40 45His Thr Phe Leu Cys Ser Lys His
Phe Glu Ala Ser Cys Phe Asp Leu 50 55 60Thr Gly Gln Thr Arg Arg Leu
Lys Met Asp Ala Val Pro Thr Ile Phe65 70 75 80Asp Phe Cys Thr His
Ile Lys Ser Met Lys Leu Lys Ser Arg Asn Leu 85 90 95Leu Lys Lys Asn
Asn Ser Cys Ser Pro Ala Gly Pro Ser Asn Leu Lys 100 105 110Ser Asn
Ile Ser Ser Gln Gln Val Leu Leu Glu His Ser Tyr Ala Phe 115 120
125Arg Asn Pro Met Glu Ala Lys Lys Arg Ile Ile Lys Leu Glu Lys Glu
130 135 140Ile Ala Ser Leu Arg Arg Lys Met Lys Thr Cys Leu Gln Lys
Glu Arg145 150 155 160Arg Ala Thr Arg Arg Trp Ile Lys Ala Thr Cys
Leu Val Lys Asn Leu 165 170 175Glu Ala Asn Ser Val Leu Pro Lys Gly
Thr Ser Glu His Met Leu Pro 180 185 190Thr Ala Leu Ser Ser Leu Pro
Leu Glu Asp Phe Lys Ile Leu Glu Gln 195 200 205Asp Gln Gln Asp Lys
Thr Leu Leu Ser Leu Asn Leu Lys Gln Thr Lys 210 215 220Ser Thr Phe
Ile2255239PRTHomo sapiens 5Met Pro Lys Ser Cys Ala Ala Arg Gln Cys
Cys Asn Arg Tyr Ser Ser1 5 10 15Arg Arg Lys Gln Leu Thr Phe His Arg
Phe Pro Phe Ser Arg Pro Glu 20 25 30Leu Leu Lys Glu Trp Val Leu Asn
Ile Gly Arg Gly Asn Phe Lys Pro 35 40 45Lys Gln His Thr Val Ile Cys
Ser Glu His Phe Arg Pro Glu Cys Phe 50 55 60Ser Ala Phe Gly Asn Arg
Lys Asn Leu Lys His Asn Ala Val Pro Thr65 70 75 80Val Phe Ala Phe
Gln Asp Pro Thr Gln Gln Val Arg Glu Asn Thr Asp 85 90 95Pro Ala Ser
Glu Arg Gly Asn Ala Ser Ser Ser Gln Lys Glu Lys Val 100 105 110Leu
Pro Glu Ala Gly Ala Gly Glu Asp Ser Pro Gly Arg Asn Met Asp 115 120
125Thr Ala Leu Glu Glu Leu Gln Leu Pro Pro Asn Ala Glu Gly His Val
130 135 140Lys Gln Val Ser Pro Arg Arg Pro Gln Ala Thr Glu Ala Val
Gly Arg145 150 155 160Pro Thr Gly Pro Ala Gly Leu Arg Arg Thr Pro
Asn Lys Gln Pro Ser 165 170 175Asp His Ser Tyr Ala Leu Leu Asp Leu
Asp Ser Leu Lys Lys Lys Leu 180 185 190Phe Leu Thr Leu Lys Glu Asn
Glu Lys Leu Arg Lys Arg Leu Gln Ala 195 200 205Gln Arg Leu Val Met
Arg Arg Met Ser Ser Arg Leu Arg Ala Cys Lys 210 215 220Gly His Gln
Gly Leu Gln Ala Arg Leu Gly Pro Glu Gln Gln Ser225 230
2356577PRTHomo sapiens 6Met Val Ile Cys Cys Ala Ala Val Asn Cys Ser
Asn Arg Gln Gly Lys1 5 10 15Gly Glu Lys Arg Ala Val Ser Phe His Arg
Phe Pro Leu Lys Asp Ser 20 25 30Lys Arg Leu Ile Gln Trp Leu Lys Ala
Val Gln Arg Asp Asn Trp Thr 35 40 45Pro Thr Lys Tyr Ser Phe Leu Cys
Ser Glu His Phe Thr Lys Asp Ser 50 55 60Phe Ser Lys Arg Leu Glu Asp
Gln His Arg Leu Leu Lys Pro Thr Ala65 70 75 80Val Pro Ser Ile Phe
His Leu Thr Glu Lys Lys Arg Gly Ala Gly Gly 85 90 95His Gly Arg Thr
Arg Arg Lys Asp Ala Ser Lys Ala Thr Gly Gly Val 100 105 110Arg Gly
His Ser Ser Ala Ala Thr Gly Arg Gly Ala Ala Gly Trp Ser 115 120
125Pro Ser Ser Ser Gly Asn Pro Met Ala Lys Pro Glu Ser Arg Arg Leu
130 135 140Lys Gln Ala Ala Leu Gln Gly Glu Ala Thr Pro Arg Ala Ala
Gln Glu145 150 155 160Ala Ala Ser Gln Glu Gln Ala Gln Gln Ala Leu
Glu Arg Thr Pro Gly 165 170 175Asp Gly Leu Ala Thr Met Val Ala Gly
Ser Gln Gly Lys Ala Glu Ala 180 185 190Ser Ala Thr Asp Ala Gly Asp
Glu Ser Ala Thr Ser Ser Ile Glu Gly 195 200 205Gly Val Thr Asp Lys
Ser Gly Ile Ser Met Asp Asp Phe Thr Pro Pro 210 215 220Gly Ser Gly
Ala Cys Lys Phe Ile Gly Ser Leu His Ser Tyr Ser Phe225 230 235
240Ser Ser Lys His Thr Arg Glu Arg Pro Ser Val Pro Arg Glu Pro Ile
245 250 255Asp Arg Lys Arg Leu Lys Lys Asp Val Glu Pro Ser Cys Ser
Gly Ser 260 265 270Ser Leu Gly Pro Asp Lys Gly Leu Ala Gln Ser Pro
Pro Ser Ser Ser 275 280 285Leu Thr Ala Thr Pro Gln Lys Pro Ser Gln
Ser Pro Ser Ala Pro Pro 290 295 300Ala Asp Val Thr Pro Lys Pro Ala
Thr Glu Ala Val Gln Ser Glu His305 310 315 320Ser Asp Ala Ser Pro
Met Ser Ile Asn Glu Val Ile Leu Ser Ala Ser 325 330 335Gly Ala Cys
Lys Leu Ile Asp Ser Leu His Ser Tyr Cys Phe Ser Ser 340 345 350Arg
Gln Asn Lys Ser Gln Val Cys Cys Leu Arg Glu Gln Val Glu Lys 355 360
365Lys Asn Gly Glu Leu Lys Ser Leu Arg Gln Arg Val Ser Arg Ser Asp
370 375 380Ser Gln Val Arg Lys Leu Gln Glu Lys Leu Asp Glu Leu Arg
Arg Val385 390 395 400Ser Val Pro Tyr Pro Ser Ser Leu Leu Ser Pro
Ser Arg Glu Pro Pro 405 410 415Lys Met Asn Pro Val Val Glu Pro Leu
Ser Trp Met Leu Gly Thr Trp 420 425 430Leu Ser Asp Pro Pro Gly Ala
Gly Thr Tyr Pro Thr Leu Gln Pro Phe 435 440 445Gln Tyr Leu Glu Glu
Val His Ile Ser His Val Gly Gln Pro Met Leu 450 455 460Asn Phe Ser
Phe Asn Ser Phe His Pro Asp Thr Arg Lys Pro Met His465 470 475
480Arg Glu Cys Gly Phe Ile Arg Leu Lys Pro Asp Thr Asn Lys Val Ala
485 490 495Phe Val Ser Ala Gln Asn Thr Gly Val Val Glu Val Glu Glu
Gly Glu 500 505 510Val Asn Gly Gln Glu Leu Cys Ile Ala Ser His Ser
Ile Ala Arg Ile 515 520 525Ser Phe Ala Lys Glu Pro His Val Glu Gln
Ile Thr Arg Lys Phe Arg 530 535 540Leu Asn Ser Glu Gly Lys Leu Glu
Gln Thr Val Ser Met Ala Thr Thr545 550 555 560Thr Gln Pro Met Thr
Gln His Leu His Val Thr Tyr Lys Lys Val Thr 565 570
575Pro7395PRTHomo sapiens 7Met Pro Arg Tyr Cys Ala Ala Ile Cys Cys
Lys Asn Arg Arg Gly Arg1 5 10 15Asn Asn Lys Asp Arg Lys Leu Ser Phe
Tyr Pro Phe Pro Leu His Asp 20 25 30Lys Glu Arg Leu Glu Lys Trp Leu
Lys Asn Met Lys Arg Asp Ser Trp 35 40 45Val Pro Ser Lys Tyr Gln Phe
Leu Cys Ser Asp His Phe Thr Pro Asp 50 55 60Ser Leu Asp Ile Arg Trp
Gly Ile Arg Tyr Leu Lys Gln Thr Ala Val65 70 75 80Pro Thr Ile Phe
Ser Leu Pro Glu Asp Asn Gln Gly Lys Asp Pro Ser 85 90 95Lys Lys Lys
Ser Gln Lys Lys Asn Leu Glu Asp Glu Lys Glu Val Cys 100 105 110Pro
Lys Ala Lys Ser Glu Glu Ser Phe Val Leu Asn Glu Thr Lys Lys 115 120
125Asn Ile Val Asn Thr Asp Val Pro His Gln His Pro Glu Leu Leu His
130 135 140Ser Ser Ser Leu Val Lys Pro Pro Ala Pro Lys Thr Gly Ser
Ile Gln145 150 155 160Asn Asn Met Leu Thr Leu Asn Leu Val Lys Gln
His Thr Gly Lys Pro 165 170 175Glu Ser Thr Leu Glu Thr Ser Val Asn
Gln Asp Thr Gly Arg Gly Gly 180 185 190Phe His Thr Cys Phe Glu Asn
Leu Asn Ser Thr Thr Ile Thr Leu Thr 195 200 205Thr Ser Asn Ser Glu
Ser Ile His Gln Ser Leu Glu Thr Gln Glu Val 210 215 220Leu Glu Val
Thr Thr Ser His Leu Ala Asn Pro Asn Phe Thr Ser Asn225 230 235
240Ser Met Glu Ile Lys Ser Ala Gln Glu Asn Pro Phe Leu Phe Ser Thr
245 250 255Ile Asn Gln Thr Val Glu Glu Leu Asn Thr Asn Lys Glu Ser
Val Ile 260 265 270Ala Ile Phe Val Pro Ala Glu Asn Ser Lys Pro Ser
Val Asn Ser Phe 275 280 285Ile Ser Ala Gln Lys Glu Thr Thr Glu Met
Glu Asp Thr Asp Ile Glu 290 295 300Asp Ser Leu Tyr Lys Asp Val Asp
Tyr Gly Thr Glu Val Leu Gln Ile305 310 315 320Glu His Ser Tyr Cys
Arg Gln Asp Ile Asn Lys Glu His Leu Trp Gln 325 330 335Lys Val Ser
Lys Leu His Ser Lys Ile Thr Leu Leu Glu Leu Lys Glu 340 345 350Gln
Gln Thr Leu Gly Arg Leu Lys Ser Leu Glu Ala Leu Ile Arg Gln 355 360
365Leu Lys Gln Glu Asn Trp Leu Ser Glu Glu Asn Val Lys Ile Ile Glu
370 375 380Asn His Phe Thr Thr Tyr Glu Val Thr Met Ile385 390
3958222PRTHomo sapiens 8Met Val Lys Cys Cys Ser Ala Ile Gly Cys Ala
Ser Arg Cys Leu Pro1 5 10 15Asn Ser Lys Leu Lys Gly Leu Thr Phe His
Val Phe Pro Thr Asp Glu 20 25 30Asn Ile Lys Arg Lys Trp Val Leu Ala
Met Lys Arg Leu Asp Val Asn 35 40 45Ala Ala Gly Ile Trp Glu Pro Lys
Lys Gly Asp Val Leu Cys Ser Arg 50 55 60His Phe Lys Lys Thr Asp Phe
Asp Arg Ser Ala Pro Asn Ile Lys Leu65 70 75 80Lys Pro Gly Val Ile
Pro Ser Ile Phe Asp Ser Pro Tyr His Leu Gln 85 90 95Gly Lys Arg Glu
Lys Leu His Cys Arg Lys Asn Phe Thr Leu Lys Thr 100 105 110Val Pro
Ala Thr Asn Tyr Asn His His Leu Val Gly Ala Ser Ser Cys 115 120
125Ile Glu Glu Phe Gln Ser Gln Phe Ile Phe Glu His Ser Tyr Ser Val
130 135 140Met Asp Ser Pro Lys Lys Leu Lys His Lys Leu Asp His Val
Ile Gly145 150 155 160Glu Leu Glu Asp Thr Lys Glu Ser Leu Arg Asn
Val Leu Asp Arg Glu 165 170 175Lys Arg Phe Gln Lys Ser Leu Arg Lys
Thr Ile Arg Glu Leu Lys Asp 180 185 190Glu Cys Leu Ile Ser Gln Glu
Thr Ala Asn Arg Leu Asp Thr Phe Cys 195 200 205Trp Asp Cys Cys Gln
Glu Ser Ile Glu Gln Asp Tyr Ile Ser 210 215 2209309PRTHomo sapiens
9Met Pro Arg His Cys Ser Ala Ala Gly Cys Cys Thr Arg Asp Thr Arg1 5
10 15Glu Thr Arg Asn Arg Gly Ile Ser Phe His Arg Leu Pro Lys Lys
Asp 20 25 30Asn Pro Arg Arg Gly Leu Trp Leu Ala Asn Cys Gln Arg Leu
Asp Pro 35 40 45Ser Gly Gln Gly Leu Trp Asp Pro Ala Ser Glu Tyr Ile
Tyr Phe Cys 50 55 60Ser Lys His Phe Glu Glu Asp Cys Phe Glu Leu Val
Gly Ile Ser Gly65 70 75 80Tyr His Arg Leu Lys Glu Gly Ala Val Pro
Thr Ile Phe Glu Ser Phe 85 90 95Ser Lys Leu Arg Arg Thr Thr Lys Thr
Lys Gly His Ser Tyr Pro Pro 100 105 110Gly Pro Pro Glu Val Ser Arg
Leu Arg Arg Cys Arg Lys Arg Cys Ser 115 120 125Glu Gly Arg Gly Pro
Thr Thr Pro Phe Ser Pro Pro Pro Pro Ala Asp 130 135 140Val Thr Cys
Phe Pro Val Glu Glu Ala Ser Ala Pro Ala Thr Leu Pro145 150 155
160Ala Ser Pro Ala Gly Arg Leu Glu Pro Gly Leu Ser Ser Pro Phe Ser
165 170 175Asp Leu Leu Gly Pro Leu Gly Ala Gln Ala Asp Glu Ala Gly
Cys Ser 180 185 190Ala Gln Pro Ser Pro Glu Arg Gln Pro Ser Pro Leu
Glu Pro Arg Pro 195 200 205Val Ser Pro Ser Ala Tyr Met Leu Arg Leu
Pro Pro Pro Ala Gly Ala 210 215 220Tyr Ile Gln Asn Glu His Ser Tyr
Gln Val Gly Ser Ala Leu Leu Trp225 230 235 240Lys Arg Arg Ala Glu
Ala Ala Leu Asp Ala Leu Asp Lys Ala Gln Arg 245 250 255Gln Leu Gln
Ala Cys Lys Arg Arg Glu Gln Arg Leu Arg Leu Arg Leu 260 265 270Thr
Lys Leu Gln Gln Glu Arg Ala Arg Glu Lys Arg Ala Gln Ala Asp 275 280
285Ala Arg Gln Thr Leu Lys Glu His Val Gln Asp Phe Ala Met Gln Leu
290 295 300Ser Ser Ser Met Ala30510274PRTHomo sapiens 10Met Pro Lys
Tyr Cys Arg Ala Pro Asn Cys Ser Asn Thr Ala Gly Arg1 5 10 15Leu Gly
Ala Asp Asn Arg Pro Val Ser Phe Tyr Lys Phe Pro Leu Lys 20 25 30Asp
Gly Pro Arg Leu Gln Ala Trp Leu Gln His Met Gly Cys Glu His 35 40
45Trp Val Pro Ser Cys His Gln His Leu Cys Ser Glu His Phe Thr Pro
50 55 60Ser Cys Phe Gln Trp Arg Trp Gly Val Arg Tyr Leu Arg Pro Asp
Ala65 70 75 80Val Pro Ser Ile Phe Ser Arg Gly Pro Pro Ala Lys Ser
Gln Arg Arg 85 90 95Thr Arg Ser Thr Gln Lys Pro Val Ser Pro Pro Pro
Pro Leu Gln Lys 100 105
110Asn Thr Pro Leu Pro Gln Ser Pro Ala Ile Pro Val Ser Gly Pro Val
115 120 125Arg Leu Val Val Leu Gly Pro Thr Ser Gly Ser Pro Lys Thr
Val Ala 130 135 140Thr Met Leu Leu Thr Pro Leu Ala Pro Ala Pro Thr
Pro Glu Arg Ser145 150 155 160Gln Pro Glu Val Pro Ala Gln Gln Ala
Gln Thr Gly Leu Gly Pro Val 165 170 175Leu Gly Ala Leu Gln Arg Arg
Val Arg Arg Leu Gln Arg Cys Gln Glu 180 185 190Arg His Gln Ala Gln
Leu Gln Ala Leu Glu Arg Leu Ala Gln Gln Leu 195 200 205His Gly Glu
Ser Leu Leu Ala Arg Ala Arg Arg Gly Leu Gln Arg Leu 210 215 220Thr
Thr Ala Gln Thr Leu Gly Pro Glu Glu Ser Gln Thr Phe Thr Ile225 230
235 240Ile Cys Gly Gly Pro Asp Ile Ala Met Val Leu Ala Gln Asp Pro
Ala 245 250 255Pro Ala Thr Val Asp Ala Lys Pro Glu Leu Leu Asp Thr
Arg Ile Pro 260 265 270Ser Ala11903PRTHomo sapiens 11Met Thr Arg
Ser Cys Ser Ala Val Gly Cys Ser Thr Arg Asp Thr Val1 5 10 15Leu Ser
Arg Glu Arg Gly Leu Ser Phe His Gln Phe Pro Thr Asp Thr 20 25 30Ile
Gln Arg Ser Lys Trp Ile Arg Ala Val Asn Arg Val Asp Pro Arg 35 40
45Ser Lys Lys Ile Trp Ile Pro Gly Pro Gly Ala Ile Leu Cys Ser Lys
50 55 60His Phe Gln Glu Ser Asp Phe Glu Ser Tyr Gly Ile Arg Arg Lys
Leu65 70 75 80Lys Lys Gly Ala Val Pro Ser Val Ser Leu Tyr Lys Ile
Pro Gln Gly 85 90 95Val His Leu Lys Gly Lys Ala Arg Gln Lys Ile Leu
Lys Gln Pro Leu 100 105 110Pro Asp Asn Ser Gln Glu Val Ala Thr Glu
Asp His Asn Tyr Ser Leu 115 120 125Lys Thr Pro Leu Thr Ile Gly Ala
Glu Lys Leu Ala Glu Val Gln Gln 130 135 140Met Leu Gln Val Ser Lys
Lys Arg Leu Ile Ser Val Lys Asn Tyr Arg145 150 155 160Met Ile Lys
Lys Arg Lys Gly Leu Arg Leu Ile Asp Ala Leu Val Glu 165 170 175Glu
Lys Leu Leu Ser Glu Glu Thr Glu Cys Leu Leu Arg Ala Gln Phe 180 185
190Ser Asp Phe Lys Trp Glu Leu Tyr Asn Trp Arg Glu Thr Asp Glu Tyr
195 200 205Ser Ala Glu Met Lys Gln Phe Ala Cys Thr Leu Tyr Leu Cys
Ser Ser 210 215 220Lys Val Tyr Asp Tyr Val Arg Lys Ile Leu Lys Leu
Pro His Ser Ser225 230 235 240Ile Leu Arg Thr Trp Leu Ser Lys Cys
Gln Pro Ser Pro Gly Phe Asn 245 250 255Ser Asn Ile Phe Ser Phe Leu
Gln Arg Arg Val Glu Asn Gly Asp Gln 260 265 270Leu Tyr Gln Tyr Cys
Ser Leu Leu Ile Lys Ser Ile Pro Leu Lys Gln 275 280 285Gln Leu Gln
Trp Asp Pro Ser Ser His Ser Leu Gln Gly Phe Met Asp 290 295 300Phe
Gly Leu Gly Lys Leu Asp Ala Asp Glu Thr Pro Leu Ala Ser Glu305 310
315 320Thr Val Leu Leu Met Ala Val Gly Ile Phe Gly His Trp Arg Thr
Pro 325 330 335Leu Gly Tyr Phe Phe Val Asn Arg Ala Ser Gly Tyr Leu
Gln Ala Gln 340 345 350Leu Leu Arg Leu Thr Ile Gly Lys Leu Ser Asp
Ile Gly Ile Thr Val 355 360 365Leu Ala Val Thr Ser Asp Ala Thr Ala
His Ser Val Gln Met Ala Lys 370 375 380Ala Leu Gly Ile His Ile Asp
Gly Asp Asp Met Lys Cys Thr Phe Gln385 390 395 400His Pro Ser Ser
Ser Ser Gln Gln Ile Ala Tyr Phe Phe Asp Ser Cys 405 410 415His Leu
Leu Arg Leu Ile Arg Asn Ala Phe Gln Asn Phe Gln Ser Ile 420 425
430Gln Phe Ile Asn Gly Ile Ala His Trp Gln His Leu Val Glu Leu Val
435 440 445Ala Leu Glu Glu Gln Glu Leu Ser Asn Met Glu Arg Ile Pro
Ser Thr 450 455 460Leu Ala Asn Leu Lys Asn His Val Leu Lys Val Asn
Ser Ala Thr Gln465 470 475 480Leu Phe Ser Glu Ser Val Ala Ser Ala
Leu Glu Tyr Leu Leu Ser Leu 485 490 495Asp Leu Pro Pro Phe Gln Asn
Cys Ile Gly Thr Ile His Phe Leu Arg 500 505 510Leu Ile Asn Asn Leu
Phe Asp Ile Phe Asn Ser Arg Asn Cys Tyr Gly 515 520 525Lys Gly Leu
Lys Gly Pro Leu Leu Pro Glu Thr Tyr Ser Lys Ile Asn 530 535 540His
Val Leu Ile Glu Ala Lys Thr Ile Phe Val Thr Leu Ser Asp Thr545 550
555 560Ser Asn Asn Gln Ile Ile Lys Gly Lys Gln Lys Leu Gly Phe Leu
Gly 565 570 575Phe Leu Leu Asn Ala Glu Ser Leu Lys Trp Leu Tyr Gln
Asn Tyr Val 580 585 590Phe Pro Lys Val Met Pro Phe Pro Tyr Leu Leu
Thr Tyr Lys Phe Ser 595 600 605His Asp His Leu Glu Leu Phe Leu Lys
Met Leu Arg Gln Val Leu Val 610 615 620Thr Ser Ser Ser Pro Thr Cys
Met Ala Phe Gln Lys Ala Tyr Tyr Asn625 630 635 640Leu Glu Thr Arg
Tyr Lys Phe Gln Asp Glu Val Phe Leu Ser Lys Val 645 650 655Ser Ile
Phe Asp Ile Ser Ile Ala Arg Arg Lys Asp Leu Ala Leu Trp 660 665
670Thr Val Gln Arg Gln Tyr Gly Val Ser Val Thr Lys Thr Val Phe His
675 680 685Glu Glu Gly Ile Cys Gln Asp Trp Ser His Cys Ser Leu Ser
Glu Ala 690 695 700Leu Leu Asp Leu Ser Asp His Arg Arg Asn Leu Ile
Cys Tyr Ala Gly705 710 715 720Tyr Val Ala Asn Lys Leu Ser Ala Leu
Leu Thr Cys Glu Asp Cys Ile 725 730 735 Thr Ala Leu Tyr Ala Ser Asp
Leu Lys Ala Ser Lys Ile Gly Ser Leu 740 745 750Leu Phe Val Lys Lys
Lys Asn Gly Leu His Phe Pro Ser Glu Ser Leu 755 760 765Cys Arg Val
Ile Asn Ile Cys Glu Arg Val Val Arg Thr His Ser Arg 770 775 780Met
Ala Ile Phe Glu Leu Val Ser Lys Gln Arg Glu Leu Tyr Leu Gln785 790
795 800Gln Lys Ile Leu Cys Glu Leu Ser Gly His Ile Asp Leu Phe Val
Asp 805 810 815Val Asn Lys His Leu Phe Asp Gly Glu Val Cys Ala Ile
Asn His Phe 820 825 830Val Lys Leu Leu Lys Asp Ile Ile Ile Cys Phe
Leu Asn Ile Arg Ala 835 840 845Lys Asn Val Ala Gln Asn Pro Leu Lys
His His Ser Glu Arg Thr Asp 850 855 860Met Lys Thr Leu Ser Arg Lys
His Trp Ser Pro Val Gln Asp Tyr Lys865 870 875 880Cys Ser Ser Phe
Ala Asn Thr Ser Ser Lys Phe Arg His Leu Leu Ser 885 890 895Asn Asp
Gly Tyr Pro Phe Lys 90012257PRTHomo sapiens 12Met Pro Ala Arg Cys
Val Ala Ala His Cys Gly Asn Thr Thr Lys Ser1 5 10 15Gly Lys Ser Leu
Phe Arg Phe Pro Lys Asp Arg Ala Val Arg Leu Leu 20 25 30Trp Asp Arg
Phe Val Arg Gly Cys Arg Ala Asp Trp Tyr Gly Gly Asn 35 40 45Asp Arg
Ser Val Ile Cys Ser Asp His Phe Ala Pro Ala Cys Phe Asp 50 55 60Val
Ser Ser Val Ile Gln Lys Asn Leu Arg Phe Ser Gln Arg Leu Arg65 70 75
80Leu Val Ala Gly Ala Val Pro Thr Leu His Arg Val Pro Ala Pro Ala
85 90 95Pro Lys Arg Gly Glu Glu Gly Asp Gln Ala Gly Arg Leu Asp Thr
Arg 100 105 110Gly Glu Leu Gln Ala Ala Arg His Ser Glu Ala Ala Pro
Gly Pro Val 115 120 125Ser Cys Thr Arg Pro Arg Ala Gly Lys Gln Ala
Ala Ala Ser Gln Ile 130 135 140Thr Cys Glu Asn Glu Leu Val Gln Thr
Gln Pro His Ala Asp Asn Pro145 150 155 160Ser Asn Thr Val Thr Ser
Val Pro Thr His Cys Glu Glu Gly Pro Val 165 170 175His Lys Ser Thr
Gln Ile Ser Leu Lys Arg Pro Arg His Arg Ser Val 180 185 190Gly Ile
Gln Ala Lys Val Lys Ala Phe Gly Lys Arg Leu Cys Asn Ala 195 200
205Thr Thr Gln Thr Glu Glu Leu Trp Ser Arg Thr Ser Ser Leu Phe Asp
210 215 220Ile Tyr Ser Ser Asp Ser Glu Thr Asp Thr Asp Trp Asp Ile
Lys Ser225 230 235 240Glu Gln Ser Asp Leu Ser Tyr Met Ala Val Gln
Val Lys Glu Glu Thr 245 250 255Cys13314PRTHomo sapiens 13Met Pro
Gly Phe Thr Cys Cys Val Pro Gly Cys Tyr Asn Asn Ser His1 5 10 15Arg
Asp Lys Ala Leu His Phe Tyr Thr Phe Pro Lys Asp Ala Glu Leu 20 25
30Arg Arg Leu Trp Leu Lys Asn Val Ser Arg Ala Gly Val Ser Gly Cys
35 40 45Phe Ser Thr Phe Gln Pro Thr Thr Gly His Arg Leu Cys Ser Val
His 50 55 60Phe Gln Gly Gly Arg Lys Thr Tyr Thr Val Arg Val Pro Thr
Ile Phe65 70 75 80Pro Leu Arg Gly Val Asn Glu Arg Lys Val Ala Arg
Arg Pro Ala Gly 85 90 95Ala Ala Ala Ala Arg Arg Arg Gln Gln Gln Gln
Gln Gln Gln Gln Gln 100 105 110Gln Gln Gln Gln Gln Gln Gln Gln Gln
Gln Gln Gln Gln Gln Gln Gln 115 120 125Gln Gln Gln Gln Ser Ser Pro
Ser Ala Ser Thr Ala Gln Thr Ala Gln 130 135 140Leu Gln Pro Asn Leu
Val Ser Ala Ser Ala Ala Val Leu Leu Thr Leu145 150 155 160Gln Ala
Thr Val Asp Ser Ser Gln Ala Pro Gly Ser Val Gln Pro Ala 165 170
175Pro Ile Thr Pro Thr Gly Glu Asp Val Lys Pro Ile Asp Leu Thr Val
180 185 190Gln Val Glu Phe Ala Ala Ala Glu Gly Ala Ala Ala Ala Ala
Ala Ala 195 200 205Ser Glu Leu Gln Ala Ala Thr Ala Gly Leu Glu Ala
Ala Glu Cys Pro 210 215 220Met Gly Pro Gln Leu Val Val Val Gly Glu
Glu Gly Phe Pro Asp Thr225 230 235 240Gly Ser Asp His Ser Tyr Ser
Leu Ser Ser Gly Thr Thr Glu Glu Glu 245 250 255Leu Leu Arg Lys Leu
Asn Glu Gln Arg Asp Ile Leu Ala Leu Met Glu 260 265 270Val Lys Met
Lys Glu Met Lys Gly Ser Ile Arg His Leu Arg Leu Thr 275 280 285Glu
Ala Lys Leu Arg Glu Glu Leu Arg Glu Lys Asp Arg Leu Leu Ala 290 295
300Met Ala Val Ile Arg Lys Lys His Gly Met305 31014761PRTHomo
sapiens 14Met Pro Asn Phe Cys Ala Ala Pro Asn Cys Thr Arg Lys Ser
Thr Gln1 5 10 15Ser Asp Leu Ala Phe Phe Arg Phe Pro Arg Asp Pro Ala
Arg Cys Gln 20 25 30Lys Trp Val Glu Asn Cys Arg Arg Ala Asp Leu Glu
Asp Lys Thr Pro 35 40 45Asp Gln Leu Asn Lys His Tyr Arg Leu Cys Ala
Lys His Phe Glu Thr 50 55 60Ser Met Ile Cys Arg Thr Ser Pro Tyr Arg
Thr Val Leu Arg Asp Asn65 70 75 80Ala Ile Pro Thr Ile Phe Asp Leu
Thr Ser His Leu Asn Asn Pro His 85 90 95Ser Arg His Arg Lys Arg Ile
Lys Glu Leu Ser Glu Asp Glu Ile Arg 100 105 110Thr Leu Lys Gln Lys
Lys Ile Asp Glu Thr Ser Glu Gln Glu Gln Lys 115 120 125His Lys Glu
Thr Asn Asn Ser Asn Ala Gln Asn Pro Ser Glu Glu Glu 130 135 140Gly
Glu Gly Gln Asp Glu Asp Ile Leu Pro Leu Thr Leu Glu Glu Lys145 150
155 160Glu Asn Lys Glu Tyr Leu Lys Ser Leu Phe Glu Ile Leu Ile Leu
Met 165 170 175Gly Lys Gln Asn Ile Pro Leu Asp Gly His Glu Ala Asp
Glu Ile Pro 180 185 190Glu Gly Leu Phe Thr Pro Asp Asn Phe Gln Ala
Leu Leu Glu Cys Arg 195 200 205Ile Asn Ser Gly Glu Glu Val Leu Arg
Lys Arg Phe Glu Thr Thr Ala 210 215 220Val Asn Thr Leu Phe Cys Ser
Lys Thr Gln Gln Arg Gln Met Leu Glu225 230 235 240Ile Cys Glu Ser
Cys Ile Arg Glu Glu Thr Leu Arg Glu Val Arg Asp 245 250 255Ser His
Phe Phe Ser Ile Ile Thr Asp Asp Val Val Asp Ile Ala Gly 260 265
270Glu Glu His Leu Pro Val Leu Val Arg Phe Val Asp Glu Ser His Asn
275 280 285Leu Arg Glu Glu Phe Ile Gly Phe Leu Pro Tyr Glu Ala Asp
Ala Glu 290 295 300Ile Leu Ala Val Lys Phe His Thr Met Ile Thr Glu
Lys Trp Gly Leu305 310 315 320Asn Met Glu Tyr Cys Arg Gly Gln Ala
Tyr Ile Val Ser Ser Gly Phe 325 330 335Ser Ser Lys Met Lys Val Val
Ala Ser Arg Leu Leu Glu Lys Tyr Pro 340 345 350Gln Ala Ile Tyr Thr
Leu Cys Ser Ser Cys Ala Leu Asn Met Trp Leu 355 360 365Ala Lys Ser
Val Pro Val Met Gly Val Ser Val Ala Leu Gly Thr Ile 370 375 380Glu
Glu Val Cys Ser Phe Phe His Arg Ser Pro Gln Leu Leu Leu Glu385 390
395 400Leu Asp Asn Val Ile Ser Val Leu Phe Gln Asn Ser Lys Glu Arg
Gly 405 410 415Lys Glu Leu Lys Glu Ile Cys His Ser Gln Trp Thr Gly
Arg His Asp 420 425 430Ala Phe Glu Ile Leu Val Glu Leu Leu Gln Ala
Leu Val Leu Cys Leu 435 440 445Asp Gly Ile Asn Ser Asp Thr Asn Ile
Arg Trp Asn Asn Tyr Ile Ala 450 455 460Gly Arg Ala Phe Val Leu Cys
Ser Ala Val Ser Asp Phe Asp Phe Ile465 470 475 480Val Thr Ile Val
Val Leu Lys Asn Val Leu Ser Phe Thr Arg Ala Phe 485 490 495Gly Lys
Asn Leu Gln Gly Gln Thr Ser Asp Val Phe Phe Ala Ala Gly 500 505
510Ser Leu Thr Ala Val Leu His Ser Leu Asn Glu Val Met Glu Asn Ile
515 520 525Glu Val Tyr His Glu Phe Trp Phe Glu Glu Ala Thr Asn Leu
Ala Thr 530 535 540Lys Leu Asp Ile Gln Met Lys Leu Pro Gly Lys Phe
Arg Arg Ala His545 550 555 560Gln Gly Asn Leu Glu Ser Gln Leu Thr
Ser Glu Ser Tyr Tyr Lys Glu 565 570 575Thr Leu Ser Val Pro Thr Val
Glu His Ile Ile Gln Glu Leu Lys Asp 580 585 590Ile Phe Ser Glu Gln
His Leu Lys Ala Leu Lys Cys Leu Ser Leu Val 595 600 605Pro Ser Val
Met Gly Gln Leu Lys Phe Asn Thr Ser Glu Glu His His 610 615 620Ala
Asp Met Tyr Arg Ser Asp Leu Pro Asn Pro Asp Thr Leu Ser Ala625 630
635 640Glu Leu His Cys Trp Arg Ile Lys Trp Lys His Arg Gly Lys Asp
Ile 645 650 655Glu Leu Pro Ser Thr Ile Tyr Glu Ala Leu His Leu Pro
Asp Ile Lys 660 665 670Phe Phe Pro Asn Val Tyr Ala Leu Leu Lys Val
Leu Cys Ile Leu Pro 675 680 685Val Met Lys Val Glu Asn Glu Arg Tyr
Glu Asn Gly Arg Lys Arg Leu 690 695 700Lys Ala Tyr Leu Arg Asn Thr
Leu Thr Asp Gln Arg Ser Ser Asn Leu705 710 715 720Ala Leu Leu Asn
Ile Asn Phe Asp Ile Lys His Asp Leu Asp Leu Met 725 730 735Val Asp
Thr Tyr Ile Lys Leu Tyr Thr Ser Lys Ser Glu Leu Pro Thr 740 745
750Asp Asn Ser Glu Thr Val Glu Asn Thr 755 7601538PRTArtificial
SequenceConsensus sequence for PAR4 binding domain of THAP 15Leu
Glu Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa1 5 10
15Gln Arg Xaa Arg Arg Gln Xaa Arg Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa
20 25 30Xaa Xaa Xaa Gln Xaa Glu 351673PRTSus scrofa 16Met Val Gln
Ser Cys Ser Ala Tyr Gly Cys Lys Asn Arg Tyr Asp Lys1 5 10 15Asp
Lys Pro Val Ser Phe His Lys Phe Pro Leu Thr Arg Pro Ser Leu 20 25
30Cys Lys Lys Trp Glu Ala Ala Val Arg Arg Lys Asn Phe Lys Pro Thr
35 40 45Lys Tyr Ser Ser Ile Cys Ser Glu His Phe Thr Pro Asp Cys Phe
Lys 50 55 60Arg Glu Cys Asn Asn Lys Leu Leu Lys65 701799PRTSus
scrofa 17Met Val Lys Cys Cys Ser Ala Ile Gly Cys Ala Ser Arg Cys
Leu Pro1 5 10 15Asn Ser Lys Leu Lys Gly Leu Thr Phe His Val Phe Pro
Thr Asp Glu 20 25 30Lys Val Lys Arg Lys Trp Val Leu Ala Met Lys Arg
Leu Asp Val Asn 35 40 45Ala Ala Gly Met Trp Glu Pro Lys Lys Gly Asp
Val Leu Cys Ser Arg 50 55 60His Phe Lys Lys Thr Asp Phe Asp Arg Thr
Thr Pro Asn Ile Lys Leu65 70 75 80Lys Pro Gly Val Ile Pro Ser Ile
Phe Asp Ser Pro Ser His Leu Thr 85 90 95Gly Glu Glu18103PRTSus
scrofa 18Met Pro Arg His Cys Ser Ala Ala Gly Cys Cys Thr Arg Asp
Thr Arg1 5 10 15Glu Thr Arg Asn Arg Gly Ile Ser Phe His Arg Leu Pro
Lys Lys Asp 20 25 30Asn Pro Arg Arg Gly Leu Trp Leu Ala Asn Cys Gln
Arg Leu Asp Pro 35 40 45Ser Gly Gln Gly Leu Trp Asp Pro Ala Ser Glu
Tyr Ile Tyr Phe Cys 50 55 60Ser Lys His Phe Glu Glu Asn Cys Phe Glu
Leu Val Gly Ile Ser Gly65 70 75 80Tyr His Arg Leu Lys Glu Gly Ala
Val Pro Thr Ile Phe Glu Ser Phe 85 90 95Ser Lys Leu Arg Arg Thr Ala
1001999PRTSus scrofa 19Met Thr Arg Ser Cys Ser Ala Val Gly Cys Ser
Thr Arg Asp Thr Val1 5 10 15Leu Ser Arg Glu Arg Gly Leu Ser Phe His
Gln Phe Pro Thr Asp Thr 20 25 30Ile Gln Arg Ser Gln Trp Ile Arg Ala
Val Asn Arg Met Asp Pro Arg 35 40 45Ser Lys Lys Ile Trp Ile Pro Gly
Pro Gly Ala Met Leu Cys Ser Lys 50 55 60His Phe Gln Glu Ser Asp Phe
Glu Ser Tyr Gly Ile Arg Arg Lys Leu65 70 75 80Lys Lys Gly Ala Val
Pro Ser Val Ser Leu Tyr Lys Val Leu Gln Gly 85 90 95Ala His
Leu2092PRTBos taurus 20Met Pro Lys Ser Cys Ala Ala Arg Gln Cys Cys
Asn Arg Tyr Ser Asn1 5 10 15Arg Arg Lys Gln Leu Thr Phe His Arg Phe
Pro Phe Ser Arg Pro Glu 20 25 30Leu Leu Lys Glu Trp Val Leu Asn Ile
Gly Arg Gly Asp Phe Glu Pro 35 40 45Lys Gln His Thr Val Ile Cys Ser
Glu His Phe Arg Pro Glu Cys Phe 50 55 60Ser Ala Phe Gly Asn Arg Lys
Asn Leu Lys His Asn Ala Val Pro Thr65 70 75 80Val Phe Ala Phe Gln
Gly Pro Pro Gln Leu Val Arg 85 902175PRTBos taurus 21Arg Leu Pro
Lys Lys Asp Asn Pro Arg Arg Gly Leu Trp Leu Ala Asn1 5 10 15Cys Gln
Arg Leu Asp Pro Ser Gly Gln Gly Leu Trp Asp Pro Ala Ser 20 25 30Glu
Tyr Ile Tyr Phe Cys Ser Lys His Phe Glu Glu Asn Cys Phe Glu 35 40
45Leu Val Gly Ile Ser Gly Tyr His Arg Leu Lys Glu Gly Ala Val Pro
50 55 60Thr Ile Phe Glu Ser Phe Ser Lys Leu Arg Arg65 70
752291PRTMus musculus 22Met Val Gln Ser Cys Ser Ala Tyr Gly Cys Lys
Asn Arg Tyr Asp Lys1 5 10 15Asp Lys Pro Val Ser Phe His Lys Phe Pro
Leu Thr Arg Pro Ser Leu 20 25 30Cys Lys Gln Trp Glu Ala Ala Val Lys
Arg Lys Asn Phe Lys Pro Thr 35 40 45Lys Tyr Ser Ser Ile Cys Ser Glu
His Phe Thr Pro Asp Cys Phe Lys 50 55 60Arg Glu Cys Asn Asn Lys Leu
Leu Lys Glu Asn Ala Val Pro Thr Ile65 70 75 80Phe Leu Tyr Ile Glu
Pro His Glu Lys Lys Glu 85 902390PRTMus musculus 23Met Pro Thr Asn
Cys Ala Ala Ala Gly Cys Ala Ala Thr Tyr Asn Lys1 5 10 15His Ile Asn
Ile Ser Phe His Arg Phe Pro Leu Asp Pro Lys Arg Arg 20 25 30Lys Glu
Trp Val Arg Leu Val Arg Arg Lys Asn Phe Val Pro Gly Lys 35 40 45His
Thr Phe Leu Cys Ser Lys His Phe Glu Ala Ser Cys Phe Asp Leu 50 55
60Thr Gly Gln Thr Arg Arg Leu Lys Met Asp Ala Val Pro Thr Ile Phe65
70 75 80Asp Phe Cys Thr His Ile Lys Ser Leu Lys 85 902492PRTMus
musculus 24Met Pro Lys Ser Cys Ala Ala Arg Gln Cys Cys Asn Arg Tyr
Ser Ser1 5 10 15Arg Arg Lys Gln Leu Thr Phe His Arg Phe Pro Phe Ser
Arg Pro Glu 20 25 30Leu Leu Arg Glu Trp Val Leu Asn Ile Gly Arg Ala
Asp Phe Lys Pro 35 40 45Lys Gln His Thr Val Ile Cys Ser Glu His Phe
Arg Pro Glu Cys Phe 50 55 60Ser Ala Phe Gly Asn Arg Lys Asn Leu Lys
His Asn Ala Val Pro Thr65 70 75 80Val Phe Ala Phe Gln Asn Pro Thr
Glu Val Cys Pro 85 902595PRTMus musculus 25Met Val Ile Cys Cys Ala
Ala Val Asn Cys Ser Asn Arg Gln Gly Lys1 5 10 15Gly Glu Lys Arg Ala
Val Ser Phe His Arg Phe Pro Leu Lys Asp Ser 20 25 30Lys Arg Leu Ile
Gln Trp Leu Lys Ala Val Gln Arg Asp Asn Trp Thr 35 40 45Pro Thr Lys
Tyr Ser Phe Leu Cys Ser Glu His Phe Thr Lys Asp Ser 50 55 60Phe Ser
Lys Arg Leu Glu Asp Gln His Arg Leu Leu Lys Pro Thr Ala65 70 75
80Val Pro Ser Ile Phe His Leu Ser Glu Lys Lys Arg Gly Ala Gly 85 90
952652PRTMus musculus 26Ile Leu Gln Ala Phe Gly Ser Leu Lys Lys Gly
Asp Val Leu Cys Ser1 5 10 15Arg His Phe Lys Lys Thr Asp Phe Asp Arg
Ser Thr Leu Asn Thr Lys 20 25 30Leu Lys Ala Gly Ala Ile Pro Ser Ile
Phe Glu Cys Pro Tyr His Leu 35 40 45Gln Glu Lys Arg 5027103PRTMus
musculus 27Met Pro Arg His Cys Ser Ala Ala Gly Cys Cys Thr Arg Asp
Thr Arg1 5 10 15Glu Thr Arg Asn Arg Gly Ile Ser Phe His Arg Leu Pro
Lys Lys Asp 20 25 30Asn Pro Arg Arg Gly Leu Trp Leu Ala Asn Cys Gln
Arg Leu Asp Pro 35 40 45Ser Gly Gln Gly Leu Trp Asp Pro Thr Ser Glu
Tyr Ile Tyr Phe Cys 50 55 60Ser Lys His Phe Glu Glu Asn Cys Phe Glu
Leu Val Gly Ile Ser Gly65 70 75 80Tyr His Arg Leu Lys Glu Gly Ala
Val Pro Thr Ile Phe Glu Ser Phe 85 90 95Ser Lys Leu Arg Arg Thr Ala
1002890PRTMus musculus 28Met Pro Gly Phe Thr Cys Cys Val Pro Gly
Cys Tyr Asn Asn Ser His1 5 10 15Arg Asp Lys Ala Leu His Phe Tyr Thr
Phe Pro Lys Asp Ala Glu Leu 20 25 30Arg Arg Leu Trp Leu Lys Asn Val
Ser Arg Ala Gly Val Ser Gly Cys 35 40 45Phe Ser Thr Phe Gln Pro Thr
Thr Gly His Arg Leu Cys Ser Val His 50 55 60Phe Gln Gly Gly Arg Lys
Thr Tyr Thr Val Arg Val Pro Thr Ile Phe65 70 75 80Pro Leu Arg Gly
Val Asn Glu Arg Lys Val 85 902996PRTMus musculus 29Met Pro Asn Phe
Cys Ala Ala Pro Asn Cys Thr Arg Lys Ser Thr Gln1 5 10 15Ser Asp Leu
Ala Phe Phe Arg Phe Pro Arg Asp Pro Ala Arg Cys Gln 20 25 30Lys Trp
Val Glu Asn Cys Arg Arg Ala Asp Leu Glu Asp Lys Thr Pro 35 40 45Asp
Gln Leu Asn Lys His Tyr Arg Leu Cys Ala Lys His Phe Glu Thr 50 55
60Ser Met Ile Cys Arg Thr Ser Pro Tyr Arg Thr Val Leu Arg Asp Asn65
70 75 80Ala Ile Pro Thr Ile Phe Asp Leu Thr Ser His Leu Asn Asn Pro
His 85 90 953024PRTRattus norvegicus 30Met Pro Thr Asn Cys Ala Ala
Ala Gly Cys Ala Ala Thr Tyr Asn Lys1 5 10 15His Ile Asn Ile Ser Phe
His Arg 203185PRTRattus norvegicus 31Arg Gln Cys Cys Asn Arg Tyr
Ser Ser Arg Arg Lys Gln Leu Thr Phe1 5 10 15His Arg Phe Pro Phe Ser
Arg Pro Glu Leu Leu Arg Glu Trp Val Leu 20 25 30Asn Ile Gly Arg Ala
Asp Phe Lys Pro Lys Gln His Thr Val Ile Cys 35 40 45Ser Glu His Phe
Arg Pro Glu Cys Phe Ser Ala Phe Gly Asn Arg Lys 50 55 60Asn Leu Lys
His Asn Ala Val Pro Thr Val Phe Ala Phe Gln Asn Pro65 70 75 80Ala
Gln Val Cys Pro 853270PRTRattus norvegicus 32Arg Phe Pro Leu Lys
Asp Ser Lys Arg Leu Ile Gln Trp Leu Lys Ala1 5 10 15Val Gln Arg Asp
Asn Trp Thr Pro Thr Lys Tyr Ser Phe Leu Cys Ser 20 25 30Glu His Phe
Thr Lys Asp Ser Phe Ser Lys Arg Leu Glu Asp Gln His 35 40 45Arg Leu
Leu Lys Pro Thr Ala Val Pro Ser Ile Phe His Leu Ser Glu 50 55 60Lys
Lys Arg Gly Ala Gly65 703355PRTRattus norvegicus 33Met Val Lys Cys
Cys Ser Ala Ile Gly Cys Ala Ser Arg Cys Leu Pro1 5 10 15Asn Ser Lys
Leu Lys Gly Leu Thr Phe His Val Phe Pro Thr Asp Glu 20 25 30Asn Ile
Lys Arg Lys Trp Val Leu Ala Met Lys Arg Leu Asp Val Asn 35 40 45Thr
Ala Gly Ile Trp Glu Pro 50 5534103PRTRattus norvegicus 34Met Pro
Arg His Cys Ser Ala Ala Gly Cys Cys Thr Arg Asp Thr Arg1 5 10 15Glu
Thr Arg Asn Arg Gly Ile Ser Phe His Arg Leu Pro Lys Lys Asp 20 25
30Asn Pro Arg Arg Gly Leu Trp Leu Ala Asn Cys Gln Arg Leu Asp Pro
35 40 45Ser Gly Gln Gly Leu Trp Asp Pro Thr Ser Glu Tyr Ile Tyr Phe
Cys 50 55 60Ser Lys His Phe Glu Glu Asn Cys Phe Glu Leu Val Gly Ile
Ser Gly65 70 75 80Tyr His Arg Leu Lys Glu Gly Ala Val Pro Thr Ile
Phe Glu Ser Phe 85 90 95Ser Lys Leu Arg Arg Thr Ala
1003590PRTRattus norvegicus 35Met Pro Gly Phe Thr Cys Cys Val Pro
Gly Cys Tyr Asn Asn Ser His1 5 10 15Arg Asp Lys Ala Leu His Phe Tyr
Thr Phe Pro Lys Asp Ala Glu Leu 20 25 30Arg Arg Leu Trp Leu Lys Asn
Val Ser Arg Ala Gly Val Ser Gly Cys 35 40 45Phe Ser Thr Phe Gln Pro
Thr Thr Gly His Arg Leu Cys Ser Val His 50 55 60Phe Gln Gly Gly Arg
Lys Thr Tyr Thr Val Arg Val Pro Thr Ile Phe65 70 75 80Pro Leu Arg
Gly Val Asn Glu Arg Lys Val 85 903696PRTRattus norvegicus 36Met Pro
Asn Phe Cys Ala Ala Pro Asn Cys Thr Arg Lys Ser Thr Gln1 5 10 15Ser
Asp Leu Ala Phe Phe Arg Phe Pro Arg Asp Pro Ala Arg Cys Gln 20 25
30Lys Trp Val Glu Asn Cys Arg Arg Ala Asp Leu Glu Asp Lys Thr Pro
35 40 45Asp Gln Leu Asn Lys His Tyr Arg Leu Cys Ala Lys His Phe Glu
Thr 50 55 60Ser Met Ile Cys Arg Thr Ser Pro Tyr Arg Thr Val Leu Arg
Asp Asn65 70 75 80Ala Ile Pro Thr Ile Phe Asp Leu Thr Ser His Leu
Asn Asn Pro His 85 90 953794PRTGallus gallus 37Met Val Ile Cys Cys
Ala Ala Ala Asn Cys Ser Asn Arg Gln Gly Lys1 5 10 15Ala Leu Arg Gly
Ala Val Ser Phe His Arg Phe Pro Leu Lys Asp Ser 20 25 30Lys Arg Leu
Ile Gln Trp Leu Lys Ala Val Gln Arg Asp Asn Trp Thr 35 40 45Pro Thr
Lys Tyr Ser Phe Leu Cys Ser Glu His Phe Thr Lys Asp Ser 50 55 60Phe
Ser Arg Arg Leu Glu Asp Gln His Arg Leu Leu Lys Pro Thr Ala65 70 75
80Val Pro Thr Ile Phe Gln Leu Ala Glu Lys Lys Arg Asp Asn 85
903894PRTGallus gallus 38Met Pro Arg Tyr Cys Ala Ala Ser Tyr Cys
Lys Asn Arg Gly Gly Gln1 5 10 15Ser Ala Arg Asp Gln Arg Lys Leu Ser
Phe Tyr Pro Phe Pro Leu His 20 25 30Asp Lys Glu Arg Leu Glu Lys Trp
Leu Arg Asn Met Lys Arg Asp Ala 35 40 45Trp Thr Pro Ser Lys His Gln
Leu Leu Cys Ser Asp His Phe Thr Pro 50 55 60Asp Ser Leu Asp Val Arg
Trp Gly Ile Arg Tyr Leu Lys His Thr Ala65 70 75 80Val Pro Thr Ile
Phe Ser Ser Pro Asp Asp Glu Glu Lys Gly 85 9039102PRTGallus gallus
39Met Pro Arg His Cys Ser Ala Ala Gly Cys Cys Thr Arg Asp Thr Arg1
5 10 15Glu Thr Arg Ser Arg Gly Ile Ser Phe His Arg Leu Pro Lys Lys
Asp 20 25 30Asn Pro Arg Arg Ala Leu Trp Leu Glu Asn Ser Arg Arg Arg
Asp Ala 35 40 45Ser Gly Glu Gly Arg Trp Asp Pro Ala Ser Lys Tyr Ile
Tyr Phe Cys 50 55 60Ser Gln His Phe Glu Lys Ser Cys Phe Glu Ile Val
Gly Phe Ser Gly65 70 75 80Tyr His Arg Leu Lys Glu Gly Ala Val Pro
Thr Val Phe Glu Ser Thr 85 90 95Ser Pro Arg Pro Pro Arg
1004027PRTGallus gallus 40Met Thr Arg Ser Cys Ser Ala Leu Gly Cys
Ser Ala Arg Asp Asn Gly1 5 10 15Arg Ser Arg Glu Arg Gly Ile Ser Phe
His Gln 20 254190PRTXenopus laevi 41Met Val Gln Ser Cys Ser Ala Tyr
Gly Cys Lys Asn Arg Tyr Asp Lys1 5 10 15Asp Arg Pro Ile Ser Phe His
Lys Phe Pro Leu Lys Arg Pro Leu Leu 20 25 30Cys Lys Lys Trp Glu Ala
Ala Val Arg Arg Ala Asp Phe Lys Pro Thr 35 40 45Lys Tyr Ser Ser Ile
Cys Ser Asp His Phe Thr Ala Asp Cys Phe Lys 50 55 60Arg Glu Cys Asn
Asn Lys Leu Leu Lys Asp Asn Ala Val Pro Thr Val65 70 75 80Phe Ala
Leu Ala Glu Ile Lys Lys Lys Met 85 9042103PRTXenopus laevi 42Met
Pro Arg His Cys Ser Ala Leu Gly Cys Thr Thr Arg Asp Ser Arg1 5 10
15Gln Thr Arg Asn Asn Asn Ile Ser Phe His Arg Leu Pro Arg Lys Asp
20 25 30Asp Pro Arg Arg Asn Leu Trp Ile Ala Asn Cys Gln Arg Thr Asp
Pro 35 40 45Ser Gly Lys Gly Leu Trp Asp Pro Ser Ser Asp Tyr Val Tyr
Phe Cys 50 55 60Ser Lys His Phe Glu Lys Ser Cys Phe Glu Val Val Gly
Thr Ser Gly65 70 75 80Tyr His Arg Leu Lys Glu Asp Ala Val Pro Thr
Leu Phe Leu Ser Ser 85 90 95Ala Lys Leu Arg Arg Ala Ala
1004390PRTXenopus laevi 43Met Val Arg Ser Cys Ser Ala Ala Asn Cys
Val Asn Arg Gln Thr Ala1 5 10 15Leu Asn Lys Arg Lys Gly Ile Thr Phe
His Arg Phe Pro Lys Glu Gln 20 25 30Ala Arg Arg Gln Leu Trp Ile Thr
Ala Val Thr His Ser His Ala Ala 35 40 45Val Gly Thr Asp Trp Thr Pro
Ser Ile His Ser Ser Leu Cys Ser Gln 50 55 60His Phe Asn Asn Thr Gln
Phe Asp Arg Thr Gly Gln Thr Val Arg Leu65 70 75 80Arg Asp Ser Ala
Val Pro Thr Val Phe Ser 85 904499PRTXenopus laevi 44Met Pro Val Ser
Cys Ala Ala Ser Gly Cys Lys Ser Arg Tyr Thr Met1 5 10 15Asp Ala Arg
Glu Lys Gly Ile Thr Phe His Arg Phe Pro Arg Ser Asn 20 25 30Pro Thr
Leu Leu Glu Lys Trp Arg Leu Ala Met Arg Arg Ser Thr Arg 35 40 45Asn
Gly Glu Leu Trp Met Pro Ser Arg Tyr Gln Arg Leu Cys Ser Leu 50
55 60His Phe Lys Gln Cys Cys Phe Asp Thr Thr Gly Gln Thr Lys Arg
Leu65 70 75 80Arg Glu Asp Val Ile Pro Thr Ile Phe Asp Phe Pro Glu
Glu Thr His 85 90 95Val Ile Phe4590PRTXenopus laevi 45Met Pro Ala
Cys Ala Ala Ile Asn Cys Thr Ser Arg Gln Thr Arg Gly1 5 10 15Cys Gly
Lys Ser Phe His Lys Phe Pro His Gly Arg Pro Glu Val Leu 20 25 30Lys
Lys Trp Val Met Asn Met Arg Arg Asp Lys Phe Lys Pro Ser Ser 35 40
45Lys Ala Val Leu Cys Ser Asp His Phe Glu Glu Phe Cys Phe Asp Arg
50 55 60Thr Gly Gln Thr Ile Arg Leu Arg Thr Asp Ala Val Pro Thr Val
Phe65 70 75 80Thr Phe Pro Gly Lys Met Lys Lys Asp Arg 85
9046105PRTXenopus laevi 46Met Pro His Cys Val Val Ser Asn Cys Val
His Phe Asn Tyr Lys Lys1 5 10 15Ser Asn Leu His Gly Val Ala Leu His
Pro Phe Pro Asn Asp Leu Ser 20 25 30Arg Ile Lys Leu Trp Leu Gln Gln
Ile Gly Leu Thr Thr Asp Glu Ile 35 40 45Asp Tyr Leu Ala Gln Lys Val
Val Glu Gly Lys Arg Lys Lys Thr Asp 50 55 60Ser His Arg Met Cys Ser
Ala His Phe Thr Pro Asn Cys Tyr Ile Val65 70 75 80Gln Asp Ala Lys
Leu Val Leu Arg Ser Asp Ala Ile Pro Thr Met Phe 85 90 95Pro Gly Leu
Ser Ser Ser Thr Thr Asn 100 10547104PRTXenopus laevi 47Met Pro Lys
Cys Ile Val Thr Lys Cys Pro His Lys Thr Gly Gln Lys1 5 10 15Glu Leu
Tyr Pro Ser Val Ile Leu His Pro Phe Pro Gly Asn Ile Glu 20 25 30Lys
Ile Lys Gln Trp Leu Leu Gln Thr Gly Glu Asp Tyr Gly Asp Tyr 35 40
45Glu Val Phe Ala Glu Lys Val Leu Glu Ala Lys Lys Thr Asp Ala Tyr
50 55 60Arg Ile Cys Ser Arg His Phe Ala Glu Asp Gln Tyr Val Lys Arg
Gly65 70 75 80Pro Arg Lys Leu Leu Ser Lys Asp Ala Val Pro Thr Ile
Phe Ser Asn 85 90 95Leu His Pro Leu Ile Gln Leu His
10048102PRTXenopus laevi 48Met Pro Arg Cys Val Val Lys Asn Cys Pro
His Trp Thr Gly Lys Lys1 5 10 15Gly Ser Gln Val Ile Leu His Gly Phe
Pro Asn Asn Ser Arg Leu Ile 20 25 30Lys Leu Trp Leu Ser Gln Thr Lys
Gln Asp Phe Gly Asp Val Glu Asp 35 40 45Phe Thr Gln Lys Ile Leu Glu
Gly Lys Lys Asn Asp Leu Tyr Arg Leu 50 55 60Cys Ser Lys His Phe Thr
Asn Asp Ser Tyr Glu Ile Arg Gly Thr Lys65 70 75 80Arg Phe Leu Lys
Tyr Gly Ala Val Pro Thr Val Phe Glu Asp Thr Pro 85 90 95Pro Leu Lys
Arg Arg Lys 10049104PRTXenopus laevi 49Met Pro Asn Cys Ile Val Lys
Asp Cys Arg His Lys Ser Gly Gln Lys1 5 10 15Ile Gln Asn Pro Asp Val
Val Leu His Pro Phe Pro Asn Asn Ile Asn 20 25 30Met Ile Lys Asn Trp
Leu Leu Gln Thr Gly Gln Asp Phe Gly Asp Ile 35 40 45Asp Val Leu Ala
Asp Lys Ile Leu Lys Gly Lys Lys Thr Ala Asn Phe 50 55 60Arg Met Cys
Ser Cys His Phe Thr Arg Asp Ser Tyr Met Ala Arg Gly65 70 75 80Ser
Lys Thr Thr Leu Lys Pro Asn Ala Ile Pro Thr Ile Phe Pro Val 85 90
95Ile Leu Pro Thr Thr Val Pro Ser 1005099PRTXenopus laevi 50Met Pro
Lys Cys Phe Val Gln Ser Cys Pro His Tyr Thr Gly Arg Asn1 5 10 15Gly
Lys Pro Asp Asn Val Ile Leu His Thr Phe Pro Arg Cys Lys Lys 20 25
30Gln Val Gln Val Trp Leu Ser Arg Thr Gly Glu Arg Tyr Glu Asn Met
35 40 45Ala Glu Phe Val Thr Tyr Ile Thr Gln Arg Cys Ser Asn Phe Arg
Met 50 55 60Cys Ser Glu His Phe Thr Asp Asp Cys Tyr Ile Thr Val Glu
Gly Lys65 70 75 80Arg Arg Leu Met Glu Asn Ser Ala Pro Thr Ile Phe
Lys Thr Thr Phe 85 90 95Arg Gln Asn51104PRTXenopus laevi 51Met Thr
Lys Cys Ile Val Lys Gly Cys Arg His Thr Thr Gly Gln Lys1 5 10 15Leu
Lys Phe Pro His Ile Val Met His Ala Phe Pro Ser Asn Leu Lys 20 25
30Met Ile Lys Val Trp Leu Lys Gln Thr Gly Gln Tyr Gly Asn Asn Leu
35 40 45Glu Glu Met Ala Leu Lys Val Leu Gly Gly Lys Lys Ser Asp Ser
Tyr 50 55 60Arg Leu Cys Ser Ala His Phe Thr Val Asp Ser Tyr Ala Leu
Arg Arg65 70 75 80Ser Lys Asn Met Leu Lys Lys Asp Ala Phe Pro Thr
Leu Phe Gly Gln 85 90 95Asn Gln Ile Asn Ala Ala Asn Val
1005284PRTXenopus laevi 52Met Pro Lys Cys Ile Val Ile His Cys Pro
His Ser Cys Ser Lys Lys1 5 10 15Val Thr Lys Asn Thr Gly Val Val Met
His Thr Phe Pro Phe Asn Leu 20 25 30Asp Arg Ile Lys Asn Trp Leu Leu
Ser Ile Asp Gln Asn Phe Gly Asn 35 40 45Ile Asp Thr Leu Ala Asn Arg
Ile Leu Glu Glu Lys Lys Lys His Ser 50 55 60Asp Leu Tyr Arg Leu Cys
Ser Glu His Phe Thr Pro Gln Cys Tyr Ile65 70 75 80Ser Thr Gly
Glu53104PRTXenopus laevi 53Met Pro Ser Cys Ile Val Lys Gly Cys Pro
His Arg Thr Gly Gln Lys1 5 10 15Asp Lys Phe Pro Asn Val Thr Leu His
Asn Phe Pro Lys Thr Ile Pro 20 25 30Lys Ile Lys Asn Trp Leu Trp Gln
Thr Gly Gln Tyr Gly Glu Asp Ser 35 40 45Asp Ala Ile Ala Glu Glu Ile
Leu Gln Gly Leu Lys Thr Cys Arg His 50 55 60Arg Met Cys Ser Met His
Phe Ser Glu Asn Cys Phe Ile Thr Leu Gly65 70 75 80Ser Lys Arg Val
Leu Thr Arg Asn Ala Val Pro Thr Ile Phe Lys Pro 85 90 95Gln Thr Thr
Pro Ala Ile Leu Ala 10054104PRTXenopus laevi 54Met Pro Lys Cys Ile
Leu Asn Gly Cys Pro Tyr Arg Thr Gly Gln Lys1 5 10 15Leu Lys Phe Pro
Asp Ile Val Leu His Pro Phe Pro Lys Ser Met Glu 20 25 30Met Ile Arg
Asn Trp Leu Phe Gln Thr Gly Gln His Ala Glu Asp Val 35 40 45Glu Ser
Leu Ser Gln Arg Ile Tyr Gln Gly Leu Lys Thr Ser Asn Phe 50 55 60Arg
Met Cys Ser Lys His Phe Thr Gln Asp Cys Tyr Met Gln Val Gly65 70 75
80Ser Arg Lys Cys Leu Lys Pro Asn Ala Val Pro Thr Val Phe Glu Ser
85 90 95Tyr Asn Val Pro Val Thr Thr Phe 10055105PRTXenopus laevi
55Asn Asn Ala Ser Cys Ile Val Arg Gly Cys His His Ser Thr Ala Arg1
5 10 15Lys Cys Leu Ser Pro Gly Ile Ala Leu His Gly Phe Pro Asn Asn
Leu 20 25 30Ser Arg Ile Lys Gln Trp Leu Val Asn Ile Gly Gln Asn Val
Gly Asp 35 40 45Ile Asp Asp Phe Ala Gln Lys Val Leu Asp Gly Lys Lys
Gln Asn Ser 50 55 60Tyr Arg Ile Cys Ser Ala His Phe Ser Ser Asp Cys
Phe Val Gln Phe65 70 75 80Gly Tyr Ser Lys Gly Leu Lys Ala Asp Ala
Val Pro Thr Ile Phe Ala 85 90 95Trp Asn Thr Pro Glu Ser Arg Gly Arg
100 10556107PRTXenopus laevi 56Met Pro Ser Cys Ile Val Lys Gly Cys
Arg His Lys Ser Gly Gln Lys1 5 10 15Val Leu Tyr Pro Asp Val Val Leu
His Ser Phe Pro Asn Asn Ile His 20 25 30Met Ile Lys Asn Trp Leu Leu
Gln Thr Gly Gln Val Phe Gly Asp Ile 35 40 45Asp Ala Phe Ala Glu Lys
Val Leu Lys Gly Asn Lys Thr Ser Ala Phe 50 55 60Arg Met Cys Ser Arg
His Phe Thr Arg Asp Ser Tyr Met Ala Lys Gly65 70 75 80Ser Lys Ile
Thr Leu Lys Pro Asn Ala Val Pro Thr Ile Phe Asn Thr 85 90 95Leu Pro
Pro Ala Ala Ala Val Pro Ser Leu Met 100 1055791PRTDanio rerio 57Met
Val Gln Ser Cys Ser Ala Tyr Gly Cys Asn Asn Arg Tyr Gln Lys1 5 10
15Asp Arg Ile Ile Ser Phe His Lys Phe Pro Leu Ala Arg Pro Glu Val
20 25 30Cys Val Gln Trp Val Ser Ala Met Ser Arg Arg Asn Phe Lys Pro
Thr 35 40 45Lys Tyr Ser Asn Ile Cys Ser Gln His Phe Thr Ser Asp Cys
Phe Lys 50 55 60Gln Glu Cys Asn Asn Arg Val Leu Lys Asp Asn Ala Val
Pro Ser Leu65 70 75 80Phe Thr Leu Gln Thr Gln Asp Pro Phe Ser Ala
85 9058103PRTDanio rerio 58Met Pro Arg His Cys Ser Ala Val Gly Cys
Lys Ser Arg Asp Thr Lys1 5 10 15Asp Val Arg Lys Ser Gly Ile Thr Phe
His Arg Leu Pro Lys Lys Gly 20 25 30Asn Pro Arg Arg Thr Thr Trp Ile
Ile Asn Ser Arg Arg Lys Gly Pro 35 40 45Glu Gly Lys Gly Gln Trp Asp
Pro Gln Ser Gly Phe Ile Tyr Phe Cys 50 55 60Ser Lys His Phe Thr Pro
Asp Ser Phe Glu Leu Ser Gly Val Ser Gly65 70 75 80Tyr His Arg Leu
Lys Asp Asp Ala Ile Pro Thr Val Phe Glu Ile Glu 85 90 95Pro His Lys
Lys Gly Thr Ala 1005990PRTDanio rerio 59Met Pro Gly Phe Thr Cys Cys
Val Pro Gly Cys Tyr Asn Asn Ser His1 5 10 15Arg Asp Arg Asp Leu Arg
Phe Tyr Thr Phe Pro Lys Asp Pro Thr Gln 20 25 30Arg Glu Ile Trp Leu
Lys Asn Ile Ser Arg Ala Gly Val Ser Gly Cys 35 40 45Phe Ser Thr Phe
Gln Pro Thr Thr Gly His Arg Val Cys Ser Val His 50 55 60Phe Pro Gly
Gly Arg Lys Thr Tyr Thr Ile Arg Val Pro Thr Leu Phe65 70 75 80Pro
Leu Arg Gly Val Asn Glu Arg Arg Ser 85 906096PRTDanio rerio 60Met
Pro Asn Phe Cys Ala Ala Leu Asn Cys Ser Arg Asn Ser Thr His1 5 10
15Ser Val Leu Ala Phe Phe Arg Phe Pro Arg Asp Pro Glu Arg Cys Lys
20 25 30Lys Trp Val Glu Asn Cys Ser Arg Ser Asp Leu Lys Asp Lys Thr
Pro 35 40 45Asp His Leu Asn Lys Tyr His Arg Leu Cys Ala Arg His Phe
Glu Pro 50 55 60Asn Leu Ile Thr Lys Thr Ser Pro Phe Arg Thr Val Leu
Lys Asp Ser65 70 75 80Ala Val Pro Thr Ile Phe Asp Asn Pro Phe Lys
Arg Ser Asn Asn Glu 85 90 956199PRTDanio rerio 61Met Pro Tyr Lys
Cys Val Ala Tyr Gly Cys Gly Lys Ile Ser Gly Gln1 5 10 15Asn Val Ser
Met Phe Arg Phe Pro Lys Asp Pro Glu Glu Phe Ser Lys 20 25 30Trp Gln
Arg Gln Val Gln Lys Thr Arg Arg Asn Trp Leu Ala Asn Thr 35 40 45Tyr
Ser His Leu Cys Asn Glu His Phe Thr Lys Asp Cys Phe Glu Pro 50 55
60Lys Thr Tyr Val Thr Ala Lys Ala Ser Gly Phe Lys Arg Leu Lys Leu65
70 75 80Lys Asp Gly Ala Val Pro Thr Val Phe Ile Arg Arg Arg Cys Arg
Lys 85 90 95Cys Gly Gly6290PRTDanio rerio 62Met Gly Gly Cys Ser Ala
Pro Asn Cys Ser Asn Ser Thr Thr Ile Gly1 5 10 15Lys Gln Leu Phe Arg
Phe Pro Lys Asp Pro Val Arg Met Arg Lys Trp 20 25 30Leu Val Asn Cys
Arg Arg Asp Phe Val Pro Thr Pro Cys Ser Arg Leu 35 40 45Cys Gln Asp
His Phe Glu Glu Ser Gln Phe Glu Glu Ile Ala Arg Ser 50 55 60Pro Ala
Gly Gly Arg Lys Leu Lys Pro Asn Ala Ile Pro Thr Leu Phe65 70 75
80Asn Val Pro Asp Pro Pro Ser Pro Val Thr 85 9063105PRTDanio rerio
63Met Val Leu Asn Cys Ala Tyr Pro Gly Cys Leu Asn Leu Phe Lys Lys1
5 10 15Glu Arg Leu Arg Ser Asn Ser Ser Ser His Gly Gly Lys Leu Thr
Phe 20 25 30His Arg Phe Pro Thr Leu Glu Pro Gly Arg Leu Leu Leu Trp
Arg Ala 35 40 45Ala Leu Gly Met Asp Pro Asp Thr Pro Met Arg Ser Leu
Arg Val Trp 50 55 60Arg Ile Cys Ser Glu His Phe Ser Pro Glu Asp Phe
Arg Ala Val Asn65 70 75 80Gly Asn Lys Val Leu Leu Lys Ala Ser Ala
Val Pro Arg Val Tyr Ser 85 90 95Thr Pro Ala Pro Gly Ser Arg Ala Asp
100 1056499PRTDanio rerio 64Met Ala Ser Ser Arg Arg Cys Tyr Cys Ser
Val Pro Gly Cys Ser Asn1 5 10 15Ser Lys Lys Arg His Pro Tyr Leu Ser
Phe His Asp Phe Pro Lys Asp 20 25 30Glu Gly Gln Arg Lys Ser Trp Val
Lys Phe Ile Arg Arg Glu Glu Gly 35 40 45Pro Phe Phe Gln Ile Lys Arg
Gly Ser Thr Phe Val Cys Ser Met His 50 55 60Phe Lys Ala Asp Asp Ile
Tyr Thr Thr Ile Ser Gly Arg Arg Lys Ile65 70 75 80Asn Pro Gly Ala
Ala Pro Arg Leu Phe Ser Trp Asn Asn Trp Ser Thr 85 90 95Asp Lys
Val6566PRTDanio rerio 65Phe Pro Lys Glu Asn Val Leu Arg Lys Gln Trp
Glu Ile Ala Leu Lys1 5 10 15Arg Lys Gly Phe Ser Ala Ser Glu Ser Ser
Val Leu Cys Ser Glu His 20 25 30Phe Arg Pro Gln Asp Leu Asp Arg Thr
Gly Gln Thr Val Arg Val Arg 35 40 45Asp Gly Ala Lys Pro Ser Val Phe
Ser Phe Pro Ala His Met Gln Lys 50 55 60His Val656693PRTDanio rerio
66Ser Ser Glu His Cys Cys Val Pro Leu Cys Gly Ala Ser Ser Arg Phe1
5 10 15Asn Ser Ala Val Ser Phe His Thr Phe Pro Val Ser Thr Glu Ile
Arg 20 25 30Glu Lys Trp Ile Lys Asn Ile Arg Arg Glu Lys Leu Asn Ile
Thr Tyr 35 40 45His Thr Arg Val Cys Cys Arg His Phe Thr Thr Asp Asp
Leu Ile Gln 50 55 60Pro Arg Asn Pro Ile Gly Arg Arg Leu Leu Arg Lys
Gly Ala Val Pro65 70 75 80Thr Leu Phe Lys Trp Asn Gly Tyr Ser Asp
Ala Glu Ala 85 906793PRTDanio rerio 67Met Pro Asp Phe Cys Ala Ala
Tyr Gly Cys Ser Asn Glu Arg Thr Lys1 5 10 15Lys Leu Lys Asp Lys Gly
Ile Thr Phe His Arg Phe Pro Arg Asp Val 20 25 30Lys Arg Arg Gln Ala
Trp Thr Leu Ala Leu Arg Arg Asp Lys Phe Glu 35 40 45Pro Lys Pro Arg
Ser Leu Leu Cys Ser Cys His Phe Arg Pro Glu Asp 50 55 60Phe Asp Arg
Thr Gly Gln Thr Val Arg Leu Arg Asp Gly Val Ile Pro65 70 75 80Ser
Ile Phe Asn Phe Ser Asn Pro Leu Ser Lys Leu Ser 85 906897PRTDanio
rerio 68Met Pro Val Cys Ser Ala Tyr Lys Cys Lys Lys Arg Ser Asp Arg
Glu1 5 10 15Tyr Lys Glu Ala Tyr Lys Arg Gly Glu Phe Ser Phe His Lys
Phe Pro 20 25 30Leu Glu Asp Gly Leu Arg Val Arg Glu Trp Leu Arg Arg
Met Arg Trp 35 40 45Gln Asn Trp Trp Pro Thr Gly Asn Ser Val Leu Cys
Ser Asp His Phe 50 55 60Glu Lys Asp Cys Phe Glu Gln Val Gly Ser His
Lys Arg Leu Arg Lys65 70 75 80Ser Ala Val Pro Thr Ile Phe Asn Phe
Pro Lys His Leu Gln Trp Lys 85 90 95Val6990PRTDanio rerio 69Met Val
Leu Val Cys Ser Ala Tyr Asn Cys Lys Asn Thr Leu Arg Asn1 5 10 15Lys
Ser Val Ser Phe His Leu Phe Pro Leu Lys Asp Pro Ser Leu Leu 20 25
30Lys Lys Trp Leu Lys Asn Leu Arg Trp Lys Asp Trp Lys Pro Asn Pro
35 40 45Asn Ser Lys Ile Cys Ser Ala His Phe Glu Glu Lys Cys Phe
Ile Leu 50 55 60Glu Gly Lys Lys Thr Arg Leu His Thr Trp Ala Val Pro
Thr Ile Phe65 70 75 80Ser Phe Pro Asn Arg Phe Ser Glu Arg Asn 85
9070107PRTDanio rerio 70Met Asn Ser Ile Ser Leu Lys Tyr Leu Arg Arg
Glu Cys Ala Tyr Ser1 5 10 15Arg Tyr Cys Cys Val Pro Phe Cys Lys Ile
Ser Ser Arg Phe Asn Ser 20 25 30Val Ile Ser Phe His Lys Leu Pro Leu
Asp Arg Ala Thr Arg Lys Met 35 40 45Trp Leu His Asn Ile Arg Arg Lys
Thr Phe Glu Val Ser Pro His Val 50 55 60Arg Val Cys Ser Arg His Phe
Thr Asn Asp Asp Phe Ile Glu Pro Ser65 70 75 80Tyr Pro Thr Ala Arg
Arg Leu Leu Lys Lys Gly Ala Val Pro Thr Leu 85 90 95Phe Arg Trp Asn
Asn Asp Ser Thr Ser Gly Gln 100 1057189PRTDanio rerio 71Leu Arg Leu
Arg Gln Ser Ala Ser Ser His Glu Glu Ser Leu Thr Phe1 5 10 15Tyr Ser
Leu Pro Leu Gln Asp Phe Lys Arg Leu Asn Leu Trp Leu Asn 20 25 30Ala
Val Arg Arg Asp Thr Lys Ser Ser Ile Arg Asn Ile Arg Gly Leu 35 40
45Arg Val Cys Ser Glu His Phe Ala Gln Asp Asp Phe Ser Leu Asn Arg
50 55 60Gly Ser Lys Arg Arg Leu Lys Ser Thr Ala Val Pro Lys Cys Asn
Glu65 70 75 80Ala Leu Pro Gln Ile Arg Arg Ala Gly 8572105PRTDanio
rerio 72Met Val Ile Thr Cys Ala Cys Pro Gly Cys Asp Asn Arg Tyr Lys
Thr1 5 10 15Leu Arg Leu Arg Ser Asp Ser Lys Phe His Pro Gly Lys Leu
Thr Phe 20 25 30His Lys Phe Pro Thr Ser Asp Pro Glu Arg Leu Lys Leu
Trp Leu Leu 35 40 45Ala Leu Gly Leu Asp Ile Asn Thr Pro Leu Ser Val
Leu Glu Thr Arg 50 55 60Arg Ile Cys Ser Asp His Phe Ser Pro Phe Asp
Phe Lys Asp Thr Lys65 70 75 80Gly Ser Ile Val Gln Leu Lys Ser Trp
Ala Val Pro Met Asn Leu Ser 85 90 95Glu Gln Phe Val Asp Asp Pro Ser
Lys 100 1057396PRTDanio rerio 73Met Pro Asp Cys Cys Ala Ala Ala Asn
Cys Lys Gln Ser Thr Asp Gln1 5 10 15Ser Ser Val Ser Phe Phe Glu Phe
Pro Leu Asp Pro Asp Arg Cys Arg 20 25 30Gln Trp Val Gly Arg Cys Asn
Arg Pro Asp Leu Gln Thr Lys Thr Pro 35 40 45Glu Asp Leu His Lys Asn
Tyr Lys Val Cys Ser Arg His Phe Glu Thr 50 55 60Ser Met Ile Cys Gln
Gln Ser Ala Val Lys Cys Ile Leu Lys Asp Asp65 70 75 80Ala Val Pro
Thr Leu Phe Asn Phe Ser Thr Asn Gln Asp Asn Ala Gln 85 90
957491PRTDanio rerio 74Met Val Lys Cys Thr Val Gln Gly Cys Ile Asn
Phe Ser Asp Leu Arg1 5 10 15Pro Glu Glu Gln Pro Asn Arg Pro Arg Lys
Arg Phe Phe Arg Phe Pro 20 25 30Lys Asp Lys Val Leu Val Lys Val Trp
Leu Ala Ala Leu Arg Asp Thr 35 40 45Glu Arg Glu Ile Thr Asp Leu His
Arg Ile Cys Glu Asp His Phe Leu 50 55 60Ser His His Ile Thr Ala Asp
Gly Ile Ser Pro Asp Ala Ile Pro Ile65 70 75 80Met Pro Pro Leu Asp
Gly Pro Val Gly Asn Trp 85 907584PRTDanio rerio 75Met Pro Ile Ser
Cys Ser Ala Val Asp Cys Ser Asn Arg Phe Val Lys1 5 10 15Gly Ser Glu
Ile Arg Phe Tyr Arg Phe Pro Ile Ser Lys Pro Gln Leu 20 25 30Ala Glu
Gln Trp Val Arg Ser Leu Gly Arg Lys Asn Phe Val Pro Thr 35 40 45Gln
Asn Ser Cys Leu Cys Ser Glu His Phe Gln Pro Asp Cys Phe Arg 50 55
60Asp Tyr Asn Gly Lys Leu Phe Leu Arg Glu Asp Ala Val Pro Thr Ile65
70 75 80Phe Ser Asn Ser7695PRTOryzias latipes 76Met Pro Asn Phe Cys
Ala Ala Pro Asn Cys Thr Arg Lys Ser Thr Gln1 5 10 15Ser Asp Leu Ala
Phe Phe Arg Phe Pro Arg Asp Pro Glu Arg Cys Arg 20 25 30Ile Trp Val
Glu Asn Cys Arg Arg Ala Asp Leu Glu Ala Lys Thr Ala 35 40 45Asp Gln
Leu Asn Lys His Tyr Arg Leu Cys Ala Lys His Phe Asp Pro 50 55 60Ala
Met Val Cys Lys Thr Ser Pro Tyr Arg Thr Val Leu Lys Asp Thr65 70 75
80Ala Ile Pro Thr Ile Phe Asp Leu Thr Ser His Leu Lys Asn Pro 85 90
957790PRTOryzias latipes 77Met Pro Thr Gly Cys Ala His Ala Asn Cys
Arg Asn Val Val Gly Lys1 5 10 15Phe Arg Gly Val Thr Phe His Lys Phe
Pro Arg Asp Pro Glu Lys Leu 20 25 30Ser Arg Trp Thr Lys Phe Met Lys
Arg His Glu Ser Trp Val Pro Lys 35 40 45Tyr Tyr Asp Arg Val Cys Ser
Val His Phe Ser Ser Glu His Phe Asp 50 55 60Arg Thr Gly Gln Thr Val
Arg Leu Arg Asp Asn Ala Glu Pro Ser Leu65 70 75 80Pro His Leu Pro
Trp Arg Phe Pro Lys Ser 85 907894PRTOryzias latipes 78Met Gln Asn
Arg Cys Ala Val Leu Thr Cys Pro Ser Gly Lys Thr Asp1 5 10 15Phe Gln
Pro Met Phe Arg Phe Pro His Asp Gln Glu Arg Ser Arg Arg 20 25 30Trp
Val Glu Lys Cys Gln Gly Glu Asn Leu Ile Gly Lys Ser Pro Glu 35 40
45Gln Leu Tyr Arg Tyr Tyr Arg Ile Cys Lys Arg His Phe Glu Thr Ser
50 55 60 Ala Phe Asp Cys Asp Ala Asp Gly Ala Val Leu Lys Lys Asp
Ala Val65 70 75 80Pro Thr Ile Phe Asp Ala Ser Val Pro Pro Gln Ser
Ser Gln 85 907992PRTDrosophila melanogaster 79Met Pro Ala His Cys
Ala Val Ile Asn Cys Ser His Lys Tyr Val His1 5 10 15Ala Gly Ser Ile
Ser Phe His Arg Phe Pro Phe Lys Arg Lys Asp Leu 20 25 30Leu Gln Lys
Trp Lys Glu Phe Thr Gln Arg Ser Ala Gln Trp Met Pro 35 40 45Ser Lys
Trp Ser Ala Leu Cys Ser Arg His Phe Gly Asp Glu Asp Phe 50 55 60Asn
Cys Ser Asn Asn Arg Lys Thr Leu Lys Lys Asn Ala Val Pro Ser65 70 75
80Ile Arg Val Ser Glu Asp Asp Ser Met Ser Gly His 85
908090PRTDrosophila melanogaster 80Met Pro Thr Ile Arg Arg Cys Cys
Ile Ile Gly Cys Leu Ser Asn Ser1 5 10 15Arg Gln His Pro Ser Met Gln
Phe Phe Ala Phe Pro Arg Pro Glu Asn 20 25 30Pro Phe His Lys Leu Trp
Lys Glu Ala Cys His Ala Ser Leu Arg Arg 35 40 45Ile Val Pro Phe Lys
Lys Pro Val Val Cys Ala Leu His Phe Asp Pro 50 55 60Ser Val Leu Gly
Gly Arg Arg Leu Gln Ser Asn Ala Leu Pro Thr Leu65 70 75 80Arg Leu
Glu Val Pro Ser Asn Leu Glu Ala 85 9081104PRTDrosophila
melanogaster 81Met Arg Cys Ala Val Pro Asn Cys Arg Asn Phe Ser Asp
Cys Arg Ser1 5 10 15Lys Arg Asn Ala Ala Gln Gln Gln Arg Leu Gly Phe
Phe Arg Phe Pro 20 25 30Lys Cys Pro Asp Thr Phe Lys Ala Trp Leu Ala
Phe Cys Gly Tyr Thr 35 40 45Glu Glu Ser Leu Lys Leu Lys Asn Pro Cys
Ile Cys Ile Glu His Phe 50 55 60Lys Asp Glu Asp Ile Glu Gly Ser Leu
Lys Phe Glu Met Gly Leu Ala65 70 75 80Lys Lys Arg Thr Leu Arg Pro
Gly Ala Val Pro Cys Val Asn Lys Ser 85 90 95Gln Glu Ser Gly Ser Asp
Arg Ala 1008296PRTDrosophila melanogaster 82Met Gly Gly Thr Lys Cys
Cys Phe Arg Asp Cys Pro Val Gly Ser Ser1 5 10 15Arg Asn Pro Asn Met
His Phe Phe Lys Phe Pro Val Lys Asp Pro Lys 20 25 30Arg Leu Lys Asp
Trp Val Arg Asn Cys Ser Asn Pro Asp Val Ser Asn 35 40 45Ala Pro Pro
Ser Lys Leu Ala Ala Lys Thr Val Cys Ala Arg His Phe 50 55 60Arg Ala
Glu Cys Phe Met Asn Tyr Lys Met Asp Arg Leu Ile Pro Met65 70 75
80Gln Thr Pro Thr Leu Phe Arg Ile Asn Arg Asp Leu Ala Leu Asp Tyr
85 90 958396PRTDrosophila melanogaster 83Met Ala Thr Arg Ser Cys
Ala Tyr Lys Asp Cys Glu Tyr Tyr Tyr Val1 5 10 15Gly His Glu Asn Ala
Leu Thr Lys Gly Arg Thr Leu Phe Ala Phe Pro 20 25 30Lys Gln Pro Gln
Arg Ala Arg Ile Trp His Glu Asn Gly Gln Val His 35 40 45Pro Lys Ile
Pro His Ser Gln Leu Phe Met Cys Ser Leu His Phe Asp 50 55 60Arg Lys
Phe Ile Ser Ser Ser Lys Asn Arg Thr Leu Leu Val Gly Glu65 70 75
80Ala Val Pro Phe Pro Tyr Glu Glu Ser Ser Ser Lys Pro Glu Glu Glu
85 90 958487PRTDrosophila melanogaster 84Met Lys Tyr Cys Lys Phe
Cys Cys Lys Ala Val Thr Gly Val Lys Leu1 5 10 15Ile His Val Pro Lys
Cys Ala Ile Lys Arg Lys Leu Trp Glu Gln Ser 20 25 30Leu Gly Cys Ser
Leu Gly Glu Asn Ser Gln Ile Cys Asp Thr His Phe 35 40 45Asn Asp Ser
Gln Trp Lys Ala Ala Pro Ala Lys Gly Gln Thr Phe Lys 50 55 60Arg Arg
Arg Leu Asn Ala Asp Ala Val Pro Ser Lys Val Ile Glu Pro65 70 75
80Glu Pro Glu Lys Ile Lys Glu 858592PRTAnopheles gambiae 85Met Pro
Ala Ser Cys Val Ile Pro Asp Cys Asp Leu Lys Tyr Thr His1 5 10 15Gly
Asp Asp Val Ser Phe His Lys Phe Pro Leu Lys Ser Pro Glu Leu 20 25
30Leu Lys Gln Trp Ile Gln Phe Thr Gly Arg Asp Glu Gly Trp His Pro
35 40 45Thr Lys Trp Ser Ala Leu Cys Ser Arg His Phe Val Ala Ser Asp
Phe 50 55 60Lys Gly Cys Ala Ala Arg Lys Ile Leu Leu Pro Thr Ala Val
Pro Ser65 70 75 80Val Arg Asn Ala Val Ala Ala Lys Ala Gln Pro Asn
85 9086108PRTAnopheles gambiae 86Met Ser Ala Val Arg Ser Cys Ala
Leu Cys Gln Asn Arg Ser Asn Ile1 5 10 15Thr Asp Gln Gln Thr Asp Asp
Ala Leu Glu Arg Ile Thr Tyr His Lys 20 25 30Phe Pro Thr Asn Pro Val
Arg Arg Asp Arg Trp Ile Glu Phe Cys Asp 35 40 45Leu Pro Lys Glu Ser
Phe Pro Lys Ser Ala Tyr Lys Phe Leu Cys Ser 50 55 60Ser His Phe Thr
Pro Glu Cys Phe Glu Arg Asp Leu Arg Gly Glu Leu65 70 75 80Leu Tyr
Gly Thr Lys Arg Met Thr Leu Gln Lys Asp Ala Met Pro Thr 85 90 95Ile
Arg Ser Val Ser Gln Gln Leu Lys Arg Thr Thr 100
10587100PRTAnopheles gambiae 87Met Trp Asp Cys Ala Val Ile Gly Cys
Pro Asn Ser Arg Phe Asn Ala1 5 10 15Gln Lys Thr Arg Pro Arg Ile Ser
Phe His Val Phe Pro His Pro Val 20 25 30Arg Glu Ser Asn Arg Phe Arg
Arg Trp Leu Ala Leu Ile Asn Asn Pro 35 40 45Arg Leu Phe Arg Leu Asp
Pro Leu Asn Val Phe Lys Ser Val Arg Val 50 55 60Cys Arg Arg His Phe
Gly Pro Asp Cys Phe Asn Gly Val Cys Arg Asn65 70 75 80Leu Leu Pro
Thr Ala Ile Pro Thr Leu Asn Leu Pro Glu Val Arg Pro 85 90 95 Val
Ala Leu Val 1008895PRTAnopheles gambiae 88Met Gly Ile Arg Lys Cys
Ile Val Pro Glu Cys Pro Ser Ser Ser Ala1 5 10 15Arg Pro Glu Asp Arg
Gly Val Thr Tyr His Lys Ile Pro Tyr Leu Asp 20 25 30Glu Met Lys Arg
Leu Trp Ile Val Ala Cys His Leu Pro Asp Asp Tyr 35 40 45Phe Ala Thr
Lys Ala Ser Asn Val Cys Ser Arg His Phe Arg Arg Ala 50 55 60Asp Phe
Gln Glu Phe Lys Gly Lys Lys Tyr Val Leu Lys Leu Gly Val65 70 75
80Val Pro Thr Val Phe Pro Trp Thr Val Thr Lys Pro Pro Gly Glu 85 90
9589107PRTAnopheles gambiae 89Met Gly Lys Ile Ser Gly Ser His Cys
Leu Val Leu Gly Cys Arg Asn1 5 10 15Arg Gln Leu Leu Asn Gln Ala Asn
Ile Arg Ser Tyr Phe Arg Phe Pro 20 25 30Arg Asp Ala Asp Leu Cys Lys
Lys Trp Val Asp Phe Cys Asn Arg Pro 35 40 45Glu Leu Tyr Lys Lys Tyr
Asp Glu Asn Gly Pro Glu Tyr Leu Tyr Lys 50 55 60Ser Ser Arg Ile Cys
Ser Asp His Phe Gln Pro Ala Asp Phe Asn Asn65 70 75 80Pro Asn Leu
Phe Ser Gln Gly Leu Lys Lys Gly Ser Val Pro Ser Val 85 90 95Asn Pro
Ala Asn Leu Glu Ala Ala Lys Pro His 100 10590104PRTAnopheles
gambiae 90Met Thr Asn Cys Ser Cys Ala Val Ala Asp Cys Asn Asn Asn
Arg Arg1 5 10 15Asn Val Arg Lys Arg Met Leu Asp Ile Gly Phe His Thr
Phe Pro Ser 20 25 30Asp Pro Val Gln Arg Gln Arg Trp Val Lys Phe Cys
Gln Arg Glu Pro 35 40 45Ser Trp Gln Pro Lys Ser Cys Asp Ser Met Cys
Ser Val His Phe Lys 50 55 60Asp Thr Asp Tyr Gln Met Ser His Ser Pro
Leu Ile Arg Leu Ala Thr65 70 75 80Asn Leu Arg Arg Leu Lys Pro Asp
Val Ile Pro Thr Ile Arg Lys Gly 85 90 95Arg Ala Ile Pro Val Ala Ala
Arg 1009195PRTAnopheles gambiae 91Met Gly Gly Cys Arg Cys Thr Phe
Arg Asp Cys Glu Asn Gly Thr Ala1 5 10 15Ser Arg Lys Glu Leu His Tyr
Phe Arg Tyr Pro Val Arg Asp Gln Glu 20 25 30Arg Leu Ile Glu Trp Ala
Lys Asn Ala Asp Arg Leu Glu Phe Val Asp 35 40 45Leu Pro Val Asp Lys
Val Ser Asn Lys Val Val Cys Gln Glu His Phe 50 55 60Glu Arg Lys Met
Phe Met Asn Asp Leu Arg Asp Arg Leu Thr Lys Met65 70 75 80Ala Ile
Pro Arg Leu Met Val Met Pro Asp Glu Thr Ile Val Asn 85 90
959297PRTAnopheles gambiae 92Met Lys Cys Phe Val Ser Gly Cys Asp
Thr Asp Asp Asn Val Val Ser1 5 10 15Tyr Thr Ser Val Phe Tyr Val Asn
Cys Pro Thr Asp Pro Thr Ile Gln 20 25 30Gln Gln Trp Phe Thr Leu Leu
Glu Val Thr Asp Pro Asp Ala Met Arg 35 40 45Ala Leu Val Asp Gly Arg
Ser Lys Val Cys Ser Cys His Phe Thr Glu 50 55 60Asp Cys Phe Gly His
His Pro Val Tyr Gly Tyr Arg Tyr Leu Leu Ala65 70 75 80Thr Ala Leu
Pro Thr Val Phe Pro Pro Arg Lys Glu Ile Glu Gln Pro 85 90
95Lys9392PRTBombyx mori 93Met Pro Arg Cys Ser Val Ile Val Cys Lys
Asn Asn Ser Cys Ile Val1 5 10 15Asn Tyr Lys Lys Asp Ser Ile Ser Phe
His Thr Tyr Pro Lys Asp Pro 20 25 30Lys Ile Lys Glu Met Trp Ile Asn
Ala Thr Gly Arg Gly Pro Ser Trp 35 40 45Phe Pro Thr Lys Asn His Thr
Ile Cys Ser Ser His Phe Glu Pro Lys 50 55 60Cys Phe Gln Pro Leu Lys
Lys Val Arg Arg Leu Phe Glu Trp Ser Val65 70 75 80Pro Thr Leu Lys
Leu Arg Met Val Leu Met Asn Tyr 85 909496PRTBombyx mori 94Met Pro
Asp Thr His Arg Thr Cys Glu Val Cys Gly Ile Lys Glu Arg1 5 10 15His
Leu Thr Glu Lys Arg Phe Phe Ala Arg Phe Pro Leu Asp Val Asn 20 25
30Arg Cys Lys Gln Trp Val Lys Met Val Gly Lys Glu Asp Leu Ala Tyr
35 40 45Leu Gln Val His Met Leu His Asp Leu Lys His Val Cys Glu Ala
His 50 55 60Phe Ser Arg Arg Asp
Phe Thr Lys Ser Lys Lys Arg Leu Lys Lys Arg65 70 75 80Ala Val Pro
Lys Leu Asn Leu Thr Leu Pro Pro Leu Arg Asp Glu Ile 85 90
959589PRTCaenorhabditis elegans 95Met Pro Thr Thr Cys Gly Phe Pro
Asn Cys Lys Phe Arg Ser Arg Tyr1 5 10 15Arg Gly Leu Glu Asp Asn Arg
His Phe Tyr Arg Ile Pro Lys Arg Pro 20 25 30Leu Ile Leu Arg Gln Arg
Trp Leu Thr Ala Ile Gly Arg Thr Glu Glu 35 40 45Thr Val Val Ser Gln
Leu Arg Ile Cys Ser Ala His Phe Glu Gly Gly 50 55 60Glu Lys Lys Glu
Gly Asp Ile Pro Val Pro Asp Pro Thr Val Asp Lys65 70 75 80Gln Ile
Lys Ile Glu Leu Pro Pro Lys 8596100PRTCaenorhabditis elegans 96Met
Tyr Gly Val Gln Ser Glu Cys Val Leu Cys Ala His Ala Asn Asp1 5 10
15Cys Thr Ala Met Ile Pro Phe Pro Gly Pro Asp Asp Glu Lys Leu Arg
20 25 30Thr Lys Trp Ile Asn Ser Met Cys Arg Glu Pro Trp Ile Tyr Arg
Tyr 35 40 45Leu Ser Thr Arg Leu Glu Lys Pro Gly Arg His Tyr Leu Cys
Ala Ser 50 55 60His Phe Asn Arg Asn Ser Leu Arg Tyr His Ala Gly Leu
Gly Leu Trp65 70 75 80Arg Arg Ala Ala Ala Cys Pro Val Leu Ala Cys
Thr Thr Asp Glu Glu 85 90 95Arg Gln Glu Val
1009786PRTCaenorhabditis elegans 97Met Glu His Pro Leu Gln Cys Cys
Tyr Cys Leu Glu Val Tyr Glu Lys1 5 10 15Arg Tyr Met Thr Gln Val Pro
Lys Thr Glu Gln Arg Ile Ala Arg Trp 20 25 30Val Ala Ile Leu Gly Glu
Gln Phe Arg Ile Arg Leu Arg Met Lys Pro 35 40 45Ala Asn Tyr Met Cys
Arg Lys His Phe Pro Gln Ala Asp Phe Ser Ser 50 55 60Arg Gly Arg Leu
Leu Lys Thr Ala Val Pro Asn Val Val Ser Gln Glu65 70 75 80Lys Val
Leu Ala Phe Lys 859897PRTCaenorhabditis elegans 98Asn Leu Thr His
Lys Pro Cys Thr Val Cys Asn Arg Val Met Lys Ser1 5 10 15Gly Glu Met
His Leu Asn Phe Pro Ala Asp Leu Asp Arg Arg Arg Ile 20 25 30Trp Ala
Asn Leu Leu Gly Phe Lys Tyr Lys Asp Ile Leu Arg Ser Lys 35 40 45Met
Gly Pro Val Ser Phe Ser Ile Ala Ala Gly Pro Ile Cys Thr Glu 50 55
60His Phe Ala Glu Glu Cys Phe Arg Asn His Asn Phe Asn Lys Ser Ala65
70 75 80Ile Glu Ala Phe Gly Val Pro Val Ala Ile Ser Pro Asp Val Lys
Thr 85 90 95Thr99210PRTMus musculus 99Met Val Gln Ser Cys Ser Ala
Tyr Gly Cys Lys Asn Arg Tyr Asp Lys1 5 10 15Asp Lys Pro Val Ser Phe
His Lys Phe Pro Leu Thr Arg Pro Ser Leu 20 25 30Cys Lys Gln Trp Glu
Ala Ala Val Lys Arg Lys Asn Phe Lys Pro Thr 35 40 45Lys Tyr Ser Ser
Ile Cys Ser Glu His Phe Thr Pro Asp Cys Phe Lys 50 55 60Arg Glu Cys
Asn Asn Lys Leu Leu Lys Glu Asn Ala Val Pro Thr Ile65 70 75 80Phe
Leu Tyr Ile Glu Pro His Glu Lys Lys Glu Asp Leu Glu Ser Gln 85 90
95Glu Gln Leu Pro Ser Pro Ser Pro Pro Ala Ser Gln Val Asp Ala Ala
100 105 110Ile Gly Leu Leu Met Pro Pro Leu Gln Thr Pro Asp Asn Leu
Ser Val 115 120 125Phe Cys Asp His Asn Tyr Thr Val Glu Asp Thr Met
His Gln Arg Lys 130 135 140Arg Ile Leu Gln Leu Glu Gln Gln Val Glu
Lys Leu Arg Lys Lys Leu145 150 155 160Lys Thr Ala Gln Gln Arg Cys
Arg Arg Gln Glu Arg Gln Leu Glu Lys 165 170 175Leu Lys Glu Val Val
His Phe Gln Arg Glu Lys Asp Asp Ala Ser Glu 180 185 190Arg Gly Tyr
Val Ile Leu Pro Asn Asp Tyr Phe Glu Ile Val Glu Val 195 200 205Pro
Ala 210100217PRTMus musculus 100Met Pro Thr Asn Cys Ala Ala Ala Gly
Cys Ala Ala Thr Tyr Asn Lys1 5 10 15His Ile Asn Ile Ser Phe His Arg
Phe Pro Leu Asp Pro Lys Arg Arg 20 25 30Lys Glu Trp Val Arg Leu Val
Arg Arg Lys Asn Phe Val Pro Gly Lys 35 40 45His Thr Phe Leu Cys Ser
Lys His Phe Glu Ala Ser Cys Phe Asp Leu 50 55 60Thr Gly Gln Thr Arg
Arg Leu Lys Met Asp Ala Val Pro Thr Ile Phe65 70 75 80Asp Phe Cys
Thr His Ile Lys Ser Leu Lys Leu Lys Ser Arg Asn Leu 85 90 95Leu Lys
Thr Asn Asn Ser Phe Pro Pro Thr Gly Pro Cys Asn Leu Lys 100 105
110Leu Asn Gly Ser Gln Gln Val Leu Leu Glu His Ser Tyr Ala Phe Arg
115 120 125Asn Pro Met Glu Ala Lys Lys Arg Ile Ile Lys Leu Glu Lys
Glu Ile 130 135 140Ala Ser Leu Arg Lys Lys Met Lys Thr Cys Leu Gln
Arg Glu Arg Arg145 150 155 160Ala Thr Arg Arg Trp Ile Lys Ala Thr
Cys Phe Val Lys Ser Leu Glu 165 170 175Ala Ser Asn Met Leu Pro Lys
Gly Ile Ser Glu Gln Ile Leu Pro Thr 180 185 190Ala Leu Ser Asn Leu
Pro Leu Glu Asp Leu Lys Ser Leu Glu Gln Asp 195 200 205Gln Gln Asp
Lys Thr Val Pro Ile Leu 210 215101218PRTMus musculus 101Met Pro Lys
Ser Cys Ala Ala Arg Gln Cys Cys Asn Arg Tyr Ser Ser1 5 10 15Arg Arg
Lys Gln Leu Thr Phe His Arg Phe Pro Phe Ser Arg Pro Glu 20 25 30Leu
Leu Arg Glu Trp Val Leu Asn Ile Gly Arg Ala Asp Phe Lys Pro 35 40
45Lys Gln His Thr Val Ile Cys Ser Glu His Phe Arg Pro Glu Cys Phe
50 55 60Ser Ala Phe Gly Asn Arg Lys Asn Leu Lys His Asn Ala Val Pro
Thr65 70 75 80Val Phe Ala Phe Gln Asn Pro Thr Glu Val Cys Pro Glu
Val Gly Ala 85 90 95Gly Gly Asp Ser Ser Gly Arg Asn Met Asp Thr Thr
Leu Glu Glu Leu 100 105 110Gln Pro Pro Thr Pro Glu Gly Pro Val Gln
Gln Val Leu Pro Asp Arg 115 120 125Glu Ala Met Glu Ala Thr Glu Ala
Ala Gly Leu Pro Ala Ser Pro Leu130 135 140Gly Leu Lys Arg Pro Leu
Pro Gly Gln Pro Ser Asp His Ser Tyr Ala 145 150 155 160Leu Ser Asp
Leu Asp Thr Leu Lys Lys Lys Leu Phe Leu Thr Leu Lys 165 170 175Glu
Asn Lys Arg Leu Arg Lys Arg Leu Lys Ala Gln Arg Leu Leu Leu 180 185
190Arg Arg Thr Cys Gly Arg Leu Arg Ala Tyr Arg Glu Gly Gln Pro Gly
195 200 205Pro Arg Ala Arg Arg Pro Ala Gln Gly Ser210
215102205PRTMus musculus 102Met Val Ile Cys Cys Ala Ala Val Asn Cys
Ser Asn Arg Gln Gly Lys1 5 10 15Gly Glu Lys Arg Ala Val Ser Phe His
Arg Phe Pro Leu Lys Asp Ser 20 25 30Lys Arg Leu Ile Gln Trp Leu Lys
Ala Val Gln Arg Asp Asn Trp Thr 35 40 45Pro Thr Lys Tyr Ser Phe Leu
Cys Ser Glu His Phe Thr Lys Asp Ser 50 55 60Phe Ser Lys Arg Leu Glu
Asp Gln His Arg Leu Leu Lys Pro Thr Ala65 70 75 80Val Pro Ser Ile
Phe His Leu Ser Glu Lys Lys Arg Gly Ala Gly Gly 85 90 95His Gly His
Ala Arg Arg Lys Thr Thr Ala Ala Met Arg Gly His Thr 100 105 110Ser
Ala Glu Thr Gly Lys Gly Thr Ile Gly Ser Ser Leu Ser Ser Ser 115 120
125Asp Asn Leu Met Ala Lys Pro Glu Ser Arg Lys Leu Lys Arg Ala Ser
130 135 140Leu Gln Asp Asp Ala Ala Pro Lys Val Thr Pro Gly Ala Val
Ser Gln145 150 155 160Glu Gln Gly Gln Ser Leu Glu Lys Thr Pro Gly
Asp Asp Pro Ala Ala 165 170 175Pro Leu Ala Arg Gly Gln Glu Glu Ala
Gln Ala Ser Ala Thr Glu Ala 180 185 190Asp His Gln Lys Ala Ser Ser
Ser Thr Asp Ala Glu Gly 195 200 205103186PRTMus musculus 103Ile Leu
Gln Ala Phe Gly Ser Leu Lys Lys Gly Asp Val Leu Cys Ser1 5 10 15Arg
His Phe Lys Lys Thr Asp Phe Asp Arg Ser Thr Leu Asn Thr Lys 20 25
30Leu Lys Ala Gly Ala Ile Pro Ser Ile Phe Glu Cys Pro Tyr His Leu
35 40 45Gln Glu Lys Arg Glu Lys Leu His Cys Arg Lys Asn Phe Leu Leu
Lys 50 55 60Thr Leu Pro Ile Thr His His Gly Arg Gln Leu Val Gly Ala
Ser Cys65 70 75 80Ile Glu Glu Phe Glu Pro Gln Phe Ile Phe Glu His
Ser Tyr Ser Val 85 90 95Met Asp Ser Pro Lys Lys Leu Lys His Lys Leu
Asp Arg Val Ile Ile 100 105 110Glu Leu Glu Asn Thr Lys Glu Ser Leu
Arg Asn Val Leu Ala Arg Glu 115 120 125Lys His Phe Gln Lys Ser Leu
Arg Lys Thr Ile Met Glu Leu Lys Asp 130 135 140Glu Ser Leu Ile Ser
Gln Glu Thr Ala Asn Ser Leu Gly Ala Phe Cys145 150 155 160Trp Glu
Cys Tyr His Glu Ser Thr Ala Gly Gly Cys Ser Cys Glu Val 165 170
175Ile Ser Tyr Met Leu His Leu Gln Leu Thr 180 185104194PRTMus
musculus 104Met Pro Arg His Cys Ser Ala Ala Gly Cys Cys Thr Arg Asp
Thr Arg1 5 10 15Glu Thr Arg Asn Arg Gly Ile Ser Phe His Arg Leu Pro
Lys Lys Asp 20 25 30Asn Pro Arg Arg Gly Leu Trp Leu Ala Asn Cys Gln
Arg Leu Asp Pro 35 40 45Ser Gly Gln Gly Leu Trp Asp Pro Thr Ser Glu
Tyr Ile Tyr Phe Cys 50 55 60Ser Lys His Phe Glu Glu Asn Cys Phe Glu
Leu Val Gly Ile Ser Gly65 70 75 80Tyr His Arg Leu Lys Glu Gly Ala
Val Pro Thr Ile Phe Glu Ser Phe 85 90 95Ser Lys Leu Arg Arg Thr Ala
Lys Thr Lys Gly His Gly Tyr Pro Pro 100 105 110Gly Leu Pro Asp Val
Ser Arg Leu Arg Arg Cys Arg Lys Arg Cys Ser 115 120 125Glu Arg Gln
Gly Pro Thr Thr Pro Phe Ser Pro Pro Pro Arg Ala Asp 130 135 140Ile
Ile Cys Phe Pro Val Glu Glu Ala Ser Ala Pro Ala Thr Leu Pro145 150
155 160Ala Ser Pro Ala Val Arg Leu Asp Pro Gly Leu Asn Ser Pro Phe
Ser 165 170 175Asp Leu Leu Gly Pro Leu Gly Ala Gln Ala Asp Glu Ala
Gly Cys Ser 180 185 190Thr Gln105305PRTMus musculus 105Met Pro Gly
Phe Thr Cys Cys Val Pro Gly Cys Tyr Asn Asn Ser His1 5 10 15Arg Asp
Lys Ala Leu His Phe Tyr Thr Phe Pro Lys Asp Ala Glu Leu 20 25 30Arg
Arg Leu Trp Leu Lys Asn Val Ser Arg Ala Gly Val Ser Gly Cys 35 40
45Phe Ser Thr Phe Gln Pro Thr Thr Gly His Arg Leu Cys Ser Val His
50 55 60Phe Gln Gly Gly Arg Lys Thr Tyr Thr Val Arg Val Pro Thr Ile
Phe65 70 75 80Pro Leu Arg Gly Val Asn Glu Arg Lys Val Ala Arg Arg
Pro Ala Gly 85 90 95Ala Ala Ala Ala Arg Arg Arg Gln Gln Gln Gln Gln
Gln Gln Gln Gln 100 105 110Gln Gln Gln Gln Gln Gln Leu Gln Gln Gln
Gln Pro Ser Pro Ser Ser 115 120 125Ser Thr Ala Gln Thr Thr Gln Leu
Gln Pro Asn Leu Val Ser Ala Ser 130 135 140Ala Ala Val Leu Leu Thr
Leu Gln Ala Ala Val Asp Ser Asn Gln Ala145 150 155 160Pro Gly Ser
Val Val Pro Val Ser Thr Thr Pro Ser Gly Asp Asp Val 165 170 175Lys
Pro Ile Asp Leu Thr Val Gln Val Glu Phe Ala Ala Ala Glu Gly 180 185
190Ala Ala Ala Ala Ala Ala Ala Ser Glu Leu Glu Ala Ala Thr Ala Gly
195 200 205Leu Glu Ala Ala Glu Cys Thr Leu Gly Pro Gln Leu Val Val
Val Gly 210 215 220Glu Glu Gly Phe Pro Asp Thr Gly Ser Asp His Ser
Tyr Ser Leu Ser225 230 235 240Ser Gly Thr Thr Glu Glu Glu Leu Leu
Arg Lys Leu Asn Glu Gln Arg 245 250 255Asp Ile Leu Ala Leu Met Glu
Val Lys Met Lys Glu Met Lys Gly Ser 260 265 270Ile Arg His Leu Arg
Leu Thr Glu Ala Lys Leu Arg Glu Glu Leu Arg 275 280 285Glu Lys Asp
Arg Leu Leu Ala Met Ala Val Ile Arg Lys Lys His Gly 290 295
300Met305106305PRTMus musculus 106Met Pro Gly Phe Thr Cys Cys Val
Pro Gly Cys Tyr Asn Asn Ser His1 5 10 15Arg Asp Lys Ala Leu His Phe
Tyr Thr Phe Pro Lys Asp Ala Glu Leu 20 25 30Arg Arg Leu Trp Leu Lys
Asn Val Ser Arg Ala Gly Val Ser Gly Cys 35 40 45Phe Ser Thr Phe Gln
Pro Thr Thr Gly His Arg Leu Cys Ser Val His 50 55 60Phe Gln Gly Gly
Arg Lys Thr Tyr Thr Val Arg Val Pro Thr Ile Phe65 70 75 80Pro Leu
Arg Gly Val Asn Glu Arg Lys Val Ala Arg Arg Pro Ala Gly 85 90 95Ala
Ala Ala Ala Arg Arg Arg Gln Gln Gln Gln Gln Gln Gln Gln Gln 100 105
110Gln Gln Gln Gln Gln Gln Leu Gln Gln Gln Gln Pro Ser Pro Ser Ser
115 120 125Ser Thr Ala Gln Thr Thr Gln Leu Gln Pro Asn Leu Val Ser
Ala Ser 130 135 140Ala Ala Val Leu Leu Thr Leu Gln Ala Ala Val Asp
Ser Asn Gln Ala145 150 155 160Pro Gly Ser Val Val Pro Val Ser Thr
Thr Pro Ser Gly Asp Asp Val 165 170 175Lys Pro Ile Asp Leu Thr Val
Gln Val Glu Phe Ala Ala Ala Glu Gly 180 185 190Ala Ala Ala Ala Ala
Ala Ala Ser Glu Leu Glu Ala Ala Thr Ala Gly 195 200 205Leu Glu Ala
Ala Glu Cys Thr Leu Gly Pro Gln Leu Val Val Val Gly 210 215 220Glu
Glu Gly Phe Pro Asp Thr Gly Ser Asp His Ser Tyr Ser Leu Ser225 230
235 240Ser Gly Thr Thr Glu Glu Glu Leu Leu Arg Lys Leu Asn Glu Gln
Arg 245 250 255Asp Ile Leu Ala Leu Met Glu Val Lys Met Lys Glu Met
Lys Gly Ser 260 265 270Ile Arg His Leu Arg Leu Thr Glu Ala Lys Leu
Arg Glu Glu Leu Arg 275 280 285Glu Lys Asp Arg Leu Leu Ala Met Ala
Val Ile Arg Lys Lys His Gly 290 295 300Met305107652PRTMus musculus
107Met Pro Asn Phe Cys Ala Ala Pro Asn Cys Thr Arg Lys Ser Thr Gln1
5 10 15Ser Asp Leu Ala Phe Phe Arg Phe Pro Arg Asp Pro Ala Arg Cys
Gln 20 25 30Lys Trp Val Glu Asn Cys Arg Arg Ala Asp Leu Glu Asp Lys
Thr Pro 35 40 45Asp Gln Leu Asn Lys His Tyr Arg Leu Cys Ala Lys His
Phe Glu Thr 50 55 60Ser Met Ile Cys Arg Thr Ser Pro Tyr Arg Thr Val
Leu Arg Asp Asn65 70 75 80Ala Ile Pro Thr Ile Phe Asp Leu Thr Ser
His Leu Asn Asn Pro His 85 90 95Ser Arg His Arg Lys Arg Ile Lys Glu
Leu Ser Glu Asp Glu Ile Arg 100 105 110Thr Leu Lys Gln Lys Lys Ile
Glu Glu Thr Ser Glu Gln Glu Gln Glu 115 120 125Thr Asn Thr Asn Ala
Gln Asn Pro Ser Ala Glu Ala Val Asn Gln Gln 130 135 140Asp Ala Asn
Val Leu Pro Leu Thr Leu Glu Glu Lys Glu Asn Lys Glu145 150 155
160Tyr Leu Lys Ser Leu Phe Glu Ile Leu Val Leu Met Gly Lys Gln Asn
165 170 175Ile Pro Leu Asp Gly His Glu Ala Asp Glu Val Pro Glu Gly
Leu Phe 180 185 190Ala Pro Asp Asn Phe Gln Ala Leu Leu Glu Cys Arg
Ile Asn
Ser Gly 195 200 205Glu Glu Val Leu Arg Lys Arg Phe Glu Ala Thr Ala
Val Asn Thr Leu 210 215 220Phe Cys Ser Lys Thr Gln Gln Arg His Met
Leu Glu Ile Cys Glu Ser225 230 235 240Cys Ile Arg Glu Glu Thr Leu
Arg Glu Val Arg Asp Ser His Phe Phe 245 250 255Ser Ile Ile Thr Asp
Asp Val Val Asp Ile Ala Gly Glu Glu His Leu 260 265 270Pro Val Leu
Val Arg Phe Val Asp Asp Ala His Asn Leu Arg Glu Glu 275 280 285Phe
Val Gly Phe Leu Pro Tyr Glu Ala Asp Ala Glu Ile Leu Ala Val 290 295
300Lys Phe His Thr Thr Ile Thr Glu Lys Trp Gly Leu Asn Met Glu
Tyr305 310 315 320Cys Arg Gly Gln Ala Tyr Ile Val Ser Ser Gly Phe
Ser Ser Lys Met 325 330 335Lys Val Val Ala Ser Arg Leu Leu Glu Lys
Tyr Pro Gln Ala Val Tyr 340 345 350Thr Leu Cys Ser Ser Cys Ala Leu
Asn Ala Trp Leu Ala Lys Ser Val 355 360 365Pro Val Ile Gly Val Ser
Val Ala Leu Gly Thr Ile Glu Glu Val Cys 370 375 380Ser Phe Phe His
Arg Ser Pro Gln Leu Leu Leu Glu Leu Asp Ser Val385 390 395 400Ile
Ser Val Leu Phe Gln Asn Ser Glu Glu Arg Ala Lys Glu Leu Lys 405 410
415Glu Ile Cys His Ser Gln Trp Thr Gly Arg His Asp Ala Phe Glu Ile
420 425 430Leu Val Asp Leu Leu Gln Ala Leu Val Leu Cys Leu Asp Gly
Ile Ile 435 440 445Asn Ser Asp Thr Asn Val Arg Trp Asn Asn Tyr Ile
Ala Gly Arg Ala 450 455 460Phe Val Leu Cys Ser Ala Val Thr Asp Phe
Asp Phe Ile Val Thr Ile465 470 475 480Val Val Leu Lys Asn Val Leu
Ser Phe Thr Arg Ala Phe Gly Lys Asn 485 490 495Leu Gln Gly Gln Thr
Ser Asp Val Phe Phe Ala Ala Ser Ser Leu Thr 500 505 510Ala Val Leu
His Ser Leu Asn Glu Val Met Glu Asn Ile Glu Val Tyr 515 520 525His
Glu Phe Trp Phe Glu Glu Ala Thr Asn Leu Ala Thr Lys Leu Asp 530 535
540Ile Gln Met Lys Leu Pro Gly Lys Phe Arg Arg Ala Gln Gln Gly
Asn545 550 555 560Leu Glu Ser Gln Leu Thr Ser Glu Ser Tyr Tyr Lys
Asp Thr Leu Ser 565 570 575Val Pro Thr Val Glu His Ile Ile Gln Glu
Leu Lys Asp Ile Phe Ser 580 585 590Glu Gln His Leu Lys Ala Leu Lys
Cys Leu Ser Leu Val Pro Ser Val 595 600 605Met Gly Gln Leu Lys Phe
Asn Thr Ser Glu Glu His His Ala Asp Met 610 615 620Tyr Arg Ser Asp
Leu Pro Asn Pro Asp Thr Leu Ser Ala Glu Leu His625 630 635 640Cys
Trp Arg Ile Lys Trp Lys His Arg Gly Lys Asp 645 650108180PRTRattus
norvegicusRAT THAP 108Arg Gln Cys Cys Asn Arg Tyr Ser Ser Arg Arg
Lys Gln Leu Thr Phe1 5 10 15His Arg Phe Pro Phe Ser Arg Pro Glu Leu
Leu Arg Glu Trp Val Leu 20 25 30Asn Ile Gly Arg Ala Asp Phe Lys Pro
Lys Gln His Thr Val Ile Cys 35 40 45Ser Glu His Phe Arg Pro Glu Cys
Phe Ser Ala Phe Gly Asn Arg Lys 50 55 60Asn Leu Lys His Asn Ala Val
Pro Thr Val Phe Ala Phe Gln Asn Pro65 70 75 80Ala Gln Val Cys Pro
Glu Val Gly Ala Gly Gly Asp Ser Ser Xaa Arg 85 90 95Asn Met Asp Ala
Thr Leu Glu Glu Leu Gln Ser Pro Asn Thr Glu Gly 100 105 110Pro Met
Gln Gln Val Leu Pro Asp Arg Gln Ala Thr Glu Ala Met Glu 115 120
125Ala Ala Gly Leu Pro Ala Gly Pro Leu Gly Leu Lys Arg Pro Leu Pro
130 135 140Gly Gln Pro Ser Asp His Ser Tyr Ala Leu Leu Asp Leu Asp
Thr Leu145 150 155 160Lys Lys Lys Leu Phe Leu Thr Leu Lys Glu Asn
Lys Arg Leu Arg Lys 165 170 175Arg Leu Lys Ala 18010982PRTRattus
norvegicus 109Met Val Lys Cys Cys Ser Ala Ile Gly Cys Ala Ser Arg
Cys Leu Pro1 5 10 15Asn Ser Lys Leu Lys Gly Leu Thr Phe His Val Phe
Pro Thr Asp Glu 20 25 30Asn Ile Lys Arg Lys Trp Val Leu Ala Met Lys
Arg Leu Asp Val Asn 35 40 45Thr Ala Gly Ile Trp Glu Pro Ser Leu Gln
Pro Glu Ser Phe Tyr Phe 50 55 60Ile Phe Met Glu Asn Leu Phe Phe Ile
Leu Pro Pro Gln Leu Ser His65 70 75 80Ala Val 110309PRTRattus
norvegicus 110Met Pro Arg His Cys Ser Ala Ala Gly Cys Cys Thr Arg
Asp Thr Arg1 5 10 15Glu Thr Arg Asn Arg Gly Ile Ser Phe His Arg Leu
Pro Lys Lys Asp 20 25 30Asn Pro Arg Arg Gly Leu Trp Leu Ala Asn Cys
Gln Arg Leu Asp Pro 35 40 45Ser Gly Gln Gly Leu Trp Asp Pro Thr Ser
Glu Tyr Ile Tyr Phe Cys 50 55 60Ser Lys His Phe Glu Glu Asn Cys Phe
Glu Leu Val Gly Ile Ser Gly65 70 75 80Tyr His Arg Leu Lys Glu Gly
Ala Val Pro Thr Ile Phe Glu Ser Phe 85 90 95Ser Lys Leu Arg Arg Thr
Ala Lys Thr Lys Val His Gly Tyr Pro Pro 100 105 110Gly Leu Pro Asp
Val Ser Arg Leu Arg Arg Cys Arg Lys Arg Cys Ser 115 120 125Glu Arg
Gln Gly Pro Thr Ile Pro Phe Ser Pro Pro Pro Arg Ala Asp 130 135
140Ile Ile Arg Phe Pro Val Glu Glu Ala Ser Ala Pro Ala Thr Leu
Pro145 150 155 160Ala Ser Pro Ala Ala Arg Leu Asp Pro Gly Leu Asn
Ser Pro Phe Ser 165 170 175Asp Leu Leu Gly Pro Leu Gly Ala Gln Ala
Asp Glu Ala Gly Cys Ser 180 185 190Ala Gln Pro Ser Pro Glu Gln His
Pro Ser Pro Leu Glu Pro Gln His 195 200 205Val Ser Pro Ser Thr Tyr
Met Leu Arg Leu Pro Pro Pro Ala Gly Ala 210 215 220Tyr Ile Gln Asn
Glu His Ser Tyr Gln Val Gly Ser Ala Leu Leu Trp225 230 235 240Lys
Arg Arg Ala Glu Ala Ala Leu Asp Ala Leu Asp Lys Thr Gln Arg 245 250
255Gln Leu Gln Ala Cys Lys Arg Arg Glu Gln Arg Leu Arg Leu Arg Leu
260 265 270Thr Lys Leu Gln Gln Glu Arg Ala Arg Glu Lys Arg Ala Gln
Ala Asp 275 280 285Ala Arg Gln Thr Leu Lys Asp His Val Gln Asp Phe
Ala Met Gln Leu 290 295 300Ser Ser Ser Met Ala305111142PRTRattus
norvegicus 111Met Pro Asn Phe Cys Ala Ala Pro Asn Cys Thr Arg Lys
Ser Thr Gln1 5 10 15Ser Asp Leu Ala Phe Phe Arg Phe Pro Arg Asp Pro
Ala Arg Cys Gln 20 25 30Lys Trp Val Glu Asn Cys Arg Arg Ala Asp Leu
Glu Asp Lys Thr Pro 35 40 45Asp Gln Leu Asn Lys His Tyr Arg Leu Cys
Ala Lys His Phe Glu Thr 50 55 60Ser Met Ile Cys Arg Thr Ser Pro Tyr
Arg Thr Val Leu Arg Asp Asn65 70 75 80Ala Ile Pro Thr Ile Phe Asp
Leu Thr Ser His Leu Asn Asn Pro His 85 90 95Ser Arg His Arg Lys Arg
Ile Lys Glu Leu Ser Glu Asp Glu Ile Arg 100 105 110Thr Leu Lys Gln
Lys Lys Ile Glu Glu Thr Ser Glu Gln Glu Gln Gly 115 120 125Thr Asn
Ser Asn Ala Gln Tyr Pro Ser Ala Glu Val Gly Asn 130 135
140112104PRTSus scrofa 112Met Val Lys Cys Cys Ser Ala Ile Gly Cys
Ala Ser Arg Cys Leu Pro1 5 10 15Asn Ser Lys Leu Lys Gly Leu Thr Phe
His Val Phe Pro Thr Asp Glu 20 25 30Lys Val Lys Arg Lys Trp Val Leu
Ala Met Lys Arg Leu Asp Val Asn 35 40 45Ala Ala Gly Met Trp Glu Pro
Lys Lys Gly Asp Val Leu Cys Ser Arg 50 55 60His Phe Lys Lys Thr Asp
Phe Asp Arg Thr Thr Pro Asn Ile Lys Leu65 70 75 80Lys Pro Gly Val
Ile Pro Ser Ile Phe Asp Ser Pro Ser His Leu Thr 85 90 95Gly Glu Glu
Arg Lys Ala Pro Leu 100 113235PRTSus scrofaUNSURE57, 124, 192Xaa =
any of the twenty amino acids 113Met Pro Arg His Cys Ser Ala Ala
Gly Cys Cys Thr Arg Asp Thr Arg1 5 10 15Glu Thr Arg Asn Arg Gly Ile
Ser Phe His Arg Leu Pro Lys Lys Asp 20 25 30Asn Pro Arg Arg Gly Leu
Trp Leu Ala Asn Cys Gln Arg Leu Asp Pro 35 40 45Ser Gly Gln Gly Leu
Trp Asp Pro Xaa Ser Glu Tyr Ile Tyr Phe Cys 50 55 60Ser Lys His Phe
Glu Glu Asn Cys Phe Glu Leu Val Gly Ile Ser Gly65 70 75 80Tyr His
Arg Leu Lys Glu Gly Ala Val Pro Thr Ile Phe Glu Ser Phe 85 90 95Ser
Lys Leu Arg Arg Thr Ala Lys Thr Lys Gly His Ser Tyr Pro Pro 100 105
110Gly Pro Pro Asp Val Ser Arg Leu Arg Arg Cys Xaa Lys Arg Cys Ser
115 120 125Glu Gly Arg Gly Pro Thr Thr Pro Phe Ser Pro Pro Pro Pro
Ala Asp 130 135 140Val Thr Cys Phe Pro Val Glu Glu Ala Ser Ala Pro
Ala Ala Leu Ser145 150 155 160Ala Ser Pro Thr Gly Arg Leu Glu Pro
Gly Leu Ser Ser Pro Phe Ser 165 170 175Asp Leu Leu Gly Pro Leu Gly
Ala Gln Ala Asp Glu Ala Gly Cys Xaa 180 185 190Thr Gln Pro Ser Pro
Glu Arg Glu Pro Glu Arg Gln Pro Ser Pro Leu 195 200 205Glu Pro Arg
Pro Val Ser Pro Ser Ala Tyr Met Leu Arg Leu Pro Pro 210 215 220Pro
Ala Gly Ala Tyr Ile Gln Asn Glu His Ser225 230 235114149PRTSus
scrofa 114Met Thr Arg Ser Cys Ser Ala Val Gly Cys Ser Thr Arg Asp
Thr Val1 5 10 15Leu Ser Arg Glu Arg Gly Leu Ser Phe His Gln Phe Pro
Thr Asp Thr 20 25 30Ile Gln Arg Ser Gln Trp Ile Arg Ala Val Asn Arg
Met Asp Pro Arg 35 40 45Ser Lys Lys Ile Trp Ile Pro Gly Pro Gly Ala
Met Leu Cys Ser Lys 50 55 60His Phe Gln Glu Ser Asp Phe Glu Ser Tyr
Gly Ile Arg Arg Lys Leu65 70 75 80Lys Lys Gly Ala Val Pro Ser Val
Ser Leu Tyr Lys Val Leu Gln Gly 85 90 95Ala His Leu Lys Gly Lys Ala
Arg Gln Lys Ile Leu Lys Gln Pro Leu 100 105 110Pro Asp Asn Ser Gln
Glu Val Ala Thr Glu Asp His Asn Tyr Ser Leu 115 120 125Lys Gly Pro
Leu Thr Ile Gly Ala Glu Lys Leu Ala Glu Val Gln Gln 130 135 140Met
Leu Gln Val Ser14511543PRTMus musculus 115Val Leu Glu Asp Val Ala
Ala Ala Glu Gln Gly Leu Arg Glu Leu Gln1 5 10 15Arg Gly Arg Arg Gln
Cys Arg Glu Arg Val Cys Ala Leu Arg Ala Ala 20 25 30Ala Glu Gln Arg
Glu Ala Arg Cys Arg Asp Gly 35 4011645PRTMus musculus 116 Gln Leu
Glu Gln Gln Val Glu Lys Leu Arg Lys Lys Leu Lys Thr Ala1 5 10 15Gln
Gln Arg Cys Arg Arg Gln Glu Arg Gln Leu Glu Lys Leu Lys Glu 20 25
30Val Val His Phe Gln Arg Glu Lys Asp Asp Ala Ser Glu 35 40
4511745PRTHomo sapiens 117Gln Leu Glu Gln Gln Val Glu Lys Leu Arg
Lys Lys Leu Lys Thr Ala1 5 10 15Gln Gln Arg Cys Arg Arg Gln Glu Arg
Gln Leu Glu Lys Leu Lys Glu 20 25 30Val Val His Phe Gln Lys Glu Lys
Asp Asp Val Ser Glu 35 40 45118342PRTHomo sapiens 118Met Ala Thr
Gly Gly Tyr Arg Thr Ser Ser Gly Leu Gly Gly Ser Thr1 5 10 15Thr Asp
Phe Leu Glu Glu Trp Lys Ala Lys Arg Glu Lys Met Arg Ala 20 25 30Lys
Gln Asn Pro Pro Gly Pro Ala Pro Pro Gly Gly Gly Ser Ser Asp 35 40
45Ala Ala Gly Lys Pro Pro Ala Gly Ala Leu Gly Thr Pro Ala Ala Ala
50 55 60Ala Ala Asn Glu Leu Asn Asn Asn Leu Pro Gly Gly Ala Pro Ala
Ala65 70 75 80Pro Ala Val Pro Gly Pro Gly Gly Val Asn Cys Ala Val
Gly Ser Ala 85 90 95Met Leu Thr Arg Ala Pro Pro Ala Arg Gly Pro Arg
Arg Ser Glu Asp 100 105 110Glu Pro Pro Ala Ala Ser Ala Ser Ala Ala
Pro Pro Pro Gln Arg Asp 115 120 125Glu Glu Glu Pro Asp Gly Val Pro
Glu Lys Gly Lys Ser Ser Gly Pro 130 135 140Ser Ala Arg Lys Gly Lys
Gly Gln Ile Glu Lys Arg Lys Leu Arg Glu145 150 155 160Lys Arg Arg
Ser Thr Gly Val Val Asn Ile Pro Ala Ala Glu Cys Leu 165 170 175Asp
Glu Tyr Glu Asp Asp Glu Ala Gly Gln Lys Glu Arg Lys Arg Glu 180 185
190Asp Ala Ile Thr Gln Gln Asn Thr Ile Gln Asn Glu Ala Val Asn Leu
195 200 205Leu Asp Pro Gly Ser Ser Tyr Leu Leu Gln Glu Pro Pro Arg
Thr Val 210 215 220Ser Gly Arg Tyr Lys Ser Thr Thr Ser Val Ser Glu
Glu Asp Val Ser225 230 235 240Ser Arg Tyr Ser Arg Thr Asp Arg Ser
Gly Phe Pro Arg Tyr Asn Arg 245 250 255Asp Ala Asn Val Ser Gly Thr
Leu Val Ser Ser Ser Thr Leu Glu Lys 260 265 270Lys Ile Glu Asp Leu
Glu Lys Glu Val Val Thr Glu Arg Gln Glu Asn 275 280 285Leu Arg Leu
Val Arg Leu Met Gln Asp Lys Glu Glu Met Ile Gly Lys 290 295 300Leu
Lys Glu Glu Ile Asp Leu Leu Asn Arg Asp Leu Asp Asp Ile Glu305 310
315 320Asp Glu Asn Glu Gln Leu Lys Gln Glu Asn Lys Thr Leu Leu Lys
Val 325 330 335Val Gly Gln Leu Thr Arg 340119134PRTHomo sapiens
119Met Ala Gln Ser Leu Ala Leu Ser Leu Leu Ile Leu Val Leu Ala Phe1
5 10 15Gly Ile Pro Arg Thr Gln Gly Ser Asp Gly Gly Ala Gln Asp Cys
Cys 20 25 30Leu Lys Tyr Ser Gln Arg Lys Ile Pro Ala Lys Val Val Arg
Ser Tyr 35 40 45Arg Lys Gln Glu Pro Ser Leu Gly Cys Ser Ile Pro Ala
Ile Leu Phe 50 55 60Leu Pro Arg Lys Arg Ser Gln Ala Glu Leu Cys Ala
Asp Pro Lys Glu65 70 75 80Leu Trp Val Gln Gln Leu Met Gln His Leu
Asp Lys Thr Pro Ser Pro 85 90 95Gln Lys Pro Ala Gln Gly Cys Arg Lys
Asp Arg Gly Ala Ser Lys Thr 100 105 110Gly Lys Lys Gly Lys Gly Ser
Lys Gly Cys Lys Arg Thr Glu Arg Ser 115 120 125Gln Thr Pro Lys Gly
Pro 130120766PRTDrosophila melanogaster 120Met Lys Tyr Cys Lys Phe
Cys Cys Lys Ala Val Thr Gly Val Lys Leu1 5 10 15Ile His Val Pro Lys
Cys Ala Ile Lys Arg Lys Leu Trp Glu Gln Ser 20 25 30Leu Gly Cys Ser
Leu Gly Glu Asn Ser Gln Ile Cys Asp Thr His Phe 35 40 45Asn Asp Ser
Gln Trp Lys Ala Ala Pro Ala Lys Gly Gln Thr Phe Lys 50 55 60Arg Arg
Arg Leu Asn Ala Asp Ala Val Pro Ser Lys Val Ile Glu Pro65 70 75
80Glu Pro Glu Lys Ile Lys Glu Gly Tyr Thr Ser Gly Ser Thr Gln Thr
85 90 95Glu Ser Cys Ser Leu Phe Asn Glu Asn Lys Ser Leu Arg Glu Lys
Ile 100 105 110Arg Thr Leu Glu Tyr Glu Met Arg Arg Leu Glu Gln Gln
Leu Arg Glu 115 120 125Ser Gln Gln Leu Glu Glu Ser Leu Arg Lys Ile
Phe Thr Asp Thr Gln 130 135 140Ile Arg Ile Leu Lys Asn Gly Gly Gln
Arg Ala Thr Phe Asn Ser Asp145 150 155 160Asp Ile Ser Thr Ala Ile
Cys Leu His Thr Ala Gly Pro Arg Ala Tyr 165
170 175Asn His Leu Tyr Lys Lys Gly Phe Pro Leu Pro Ser Arg Thr Thr
Leu 180 185 190Tyr Arg Trp Leu Ser Asp Val Asp Ile Lys Arg Gly Cys
Leu Asp Val 195 200 205Val Ile Asp Leu Met Asp Ser Asp Gly Val Asp
Asp Ala Asp Lys Leu 210 215 220Cys Val Leu Ala Phe Asp Glu Met Lys
Val Ala Ala Ala Phe Glu Tyr225 230 235 240Asp Ser Ser Ala Asp Ile
Val Tyr Glu Pro Ser Asp Tyr Val Gln Leu 245 250 255Ala Ile Val Arg
Gly Leu Lys Lys Ser Trp Lys Gln Pro Val Phe Phe 260 265 270Asp Phe
Asn Thr Arg Met Asp Pro Asp Thr Leu Asn Asn Ile Leu Arg 275 280
285Lys Leu His Arg Lys Gly Tyr Leu Val Val Ala Ile Val Ser Asp Leu
290 295 300Gly Thr Gly Asn Gln Lys Leu Trp Thr Glu Leu Gly Ile Ser
Glu Ser305 310 315 320Lys Thr Trp Phe Ser His Pro Ala Asp Asp His
Leu Lys Ile Phe Val 325 330 335Phe Ser Asp Thr Pro His Leu Ile Lys
Leu Val Arg Asn His Tyr Val 340 345 350Asp Ser Gly Leu Thr Ile Asn
Gly Lys Lys Leu Thr Lys Lys Thr Ile 355 360 365Gln Glu Ala Leu His
Leu Cys Asn Lys Ser Asp Leu Ser Ile Leu Phe 370 375 380Lys Ile Asn
Glu Asn His Ile Asn Val Arg Ser Leu Ala Lys Gln Lys385 390 395
400Val Lys Leu Ala Thr Gln Leu Phe Ser Asn Thr Thr Ala Ser Ser Ile
405 410 415Arg Arg Cys Tyr Ser Leu Gly Tyr Asp Ile Glu Asn Ala Thr
Glu Thr 420 425 430Ala Asp Phe Phe Lys Leu Met Asn Asp Trp Phe Asp
Ile Phe Asn Ser 435 440 445Lys Leu Ser Thr Ser Asn Cys Ile Glu Cys
Ser Gln Pro Tyr Gly Lys 450 455 460Gln Leu Asp Ile Gln Asn Asp Ile
Leu Asn Arg Met Ser Glu Ile Met465 470 475 480Arg Thr Gly Ile Leu
Asp Lys Pro Lys Arg Leu Pro Phe Gln Lys Gly 485 490 495Ile Ile Val
Asn Asn Ala Ser Leu Asp Gly Leu Tyr Lys Tyr Leu Gln 500 505 510Glu
Asn Phe Ser Met Gln Tyr Ile Leu Thr Ser Arg Leu Asn Gln Asp 515 520
525Ile Val Glu His Phe Phe Gly Ser Met Arg Ser Arg Gly Gly Gln Phe
530 535 540Asp His Pro Thr Pro Leu Gln Phe Lys Tyr Arg Leu Arg Lys
Tyr Ile545 550 555 560Ile Ala Arg Asn Thr Glu Met Leu Arg Asn Ser
Gly Asn Ile Glu Glu 565 570 575Gly Met Thr Asn Leu Lys Glu Cys Val
Asn Lys Asn Val Ile Pro Asp 580 585 590Asn Ser Glu Ser Trp Leu Asn
Leu Asp Phe Ser Ser Lys Glu Asn Glu 595 600 605Asn Lys Ser Lys Asp
Asp Glu Pro Val Asp Asp Glu Pro Val Asp Glu 610 615 620Met Leu Ser
Asn Ile Asp Phe Thr Glu Met Asp Glu Leu Thr Glu Asp625 630 635
640Ala Met Glu Tyr Ile Ala Gly Tyr Val Ile Lys Lys Leu Arg Ile Ser
645 650 655Asp Lys Val Lys Glu Asn Leu Thr Phe Thr Tyr Val Asp Glu
Val Ser 660 665 670His Gly Gly Leu Ile Lys Pro Ser Glu Lys Phe Gln
Glu Lys Leu Lys 675 680 685Glu Leu Glu Cys Ile Phe Leu His Tyr Thr
Asn Asn Asn Asn Phe Glu 690 695 700Ile Thr Asn Asn Val Lys Glu Lys
Leu Ile Leu Ala Ala Arg Asn Val705 710 715 720Asp Val Asp Lys Gln
Val Lys Ser Phe Tyr Phe Lys Ile Arg Ile Tyr 725 730 735Phe Arg Ile
Lys Tyr Phe Asn Lys Lys Ile Glu Ile Lys Asn Gln Lys 740 745 750Gln
Lys Leu Ile Gly Asn Ser Lys Leu Leu Lys Ile Lys Leu 755 760
765121103PRTHomo sapiens 121Asp Glu Leu Cys Val Val Cys Gly Asp Lys
Ala Thr Gly Tyr His Tyr1 5 10 15Arg Cys Ile Thr Cys Glu Gly Cys Lys
Gly Phe Phe Arg Arg Thr Ile 20 25 30Gln Lys Asn Leu His Pro Ser Tyr
Ser Cys Lys Tyr Glu Gly Lys Cys 35 40 45Val Ile Asp Lys Val Thr Arg
Asn Gln Cys Gln Glu Cys Arg Phe Lys 50 55 60Lys Cys Ile Tyr Val Gly
Met Ala Thr Asp Leu Val Leu Asp Asp Ser65 70 75 80Lys Arg Leu Ala
Lys Arg Lys Leu Ile Glu Glu Asn Arg Glu Lys Arg 85 90 95Arg Arg Glu
Glu Leu Glu Lys 10012281PRTHomo sapiens 122Met Lys Pro Ala Arg Pro
Cys Leu Val Cys Ser Asp Glu Ala Ser Gly1 5 10 15Cys His Tyr Gly Val
Leu Thr Cys Gly Ser Cys Lys Val Phe Phe Lys 20 25 30Arg Ala Val Glu
Gly Gln His Asn Tyr Leu Cys Ala Gly Arg Asn Asp 35 40 45Cys Ile Ile
Asp Lys Ile Arg Arg Lys Asn Cys Pro Ala Cys Arg Tyr 50 55 60Arg Lys
Cys Leu Gln Ala Gly Met Asn Leu Glu Ala Arg Lys Thr Lys65 70 75
80Lys 12389PRTHomo sapiens 123Met Val Gln Ser Cys Ser Ala Tyr Gly
Cys Lys Asn Arg Tyr Asp Lys1 5 10 15Asp Lys Pro Val Ser Phe His Lys
Phe Pro Leu Thr Arg Pro Ser Leu 20 25 30Cys Lys Glu Trp Glu Ala Ala
Val Arg Arg Lys Asn Phe Lys Pro Thr 35 40 45Lys Tyr Ser Ser Ile Cys
Ser Glu His Phe Thr Pro Asp Cys Phe Lys 50 55 60Arg Glu Cys Asn Asn
Lys Leu Leu Lys Glu Asn Ala Val Pro Thr Ile65 70 75 80Phe Leu Cys
Thr Glu Pro His Asp Lys 8512485PRTDrosophila melanogaster 124Met
Lys Tyr Cys Lys Phe Cys Cys Lys Ala Val Thr Gly Val Lys Leu1 5 10
15Ile His Val Pro Lys Cys Ala Ile Lys Arg Lys Leu Trp Glu Gln Ser
20 25 30Leu Gly Cys Ser Leu Gly Glu Asn Ser Gln Ile Cys Asp Thr His
Phe 35 40 45Asn Asp Ser Gln Trp Lys Ala Ala Pro Ala Lys Gly Gln Thr
Phe Lys 50 55 60Arg Arg Arg Leu Asn Ala Asp Ala Val Pro Ser Lys Val
Ile Glu Pro65 70 75 80Glu Pro Glu Lys Ile 8512558PRTArtificial
SequenceTHAP Domain consensus 125Met Val Xaa Xaa Cys Ser Xaa Tyr
Xaa Cys Lys Asn Xaa Xaa Xaa Xaa1 5 10 15Xaa Lys Xaa Val Xaa Xaa Xaa
Lys Xaa Xaa Leu Xaa Arg Pro Ser Leu 20 25 30Cys Lys Xaa Trp Glu Xaa
Xaa Val Xaa Arg Lys Asn Xaa Xaa Xaa Xaa 35 40 45Xaa Xaa Ser Xaa Ile
Cys Xaa Xaa His Phe 50 5512689PRTHomo sapiens 126Met Val Gln Ser
Cys Ser Ala Tyr Gly Cys Lys Asn Arg Tyr Asp Lys1 5 10 15Asp Lys Pro
Val Ser Phe His Lys Phe Pro Leu Thr Arg Pro Ser Leu 20 25 30Cys Lys
Glu Trp Glu Ala Ala Val Arg Arg Lys Asn Phe Lys Pro Thr 35 40 45Lys
Tyr Ser Ser Ile Cys Ser Glu His Phe Thr Pro Asp Cys Phe Lys 50 55
60Arg Glu Cys Asn Asn Lys Leu Leu Lys Glu Asn Ala Val Pro Thr Ile65
70 75 80Phe Leu Cys Thr Glu Pro His Asp Lys 8512789PRTHomo sapiens
127Met Pro Lys Ser Cys Ala Ala Arg Gln Cys Cys Asn Arg Tyr Ser Ser1
5 10 15Arg Arg Lys Gln Leu Thr Phe His Arg Phe Pro Phe Ser Arg Pro
Glu 20 25 30Leu Leu Lys Glu Trp Val Leu Asn Ile Gly Arg Gly Asn Phe
Lys Pro 35 40 45Lys Gln His Thr Val Ile Cys Ser Glu His Phe Arg Pro
Glu Cys Phe 50 55 60Ser Ala Phe Gly Asn Arg Lys Asn Leu Lys His Asn
Ala Val Pro Thr65 70 75 80Val Phe Ala Phe Gln Asp Pro Thr Gln
8512890PRTHomo sapiens 128Met Pro Arg Tyr Cys Ala Ala Ile Cys Cys
Lys Asn Arg Arg Gly Arg1 5 10 15Asn Asn Lys Asp Arg Lys Leu Ser Phe
Tyr Pro Phe Pro Leu His Asp 20 25 30Lys Glu Arg Leu Glu Lys Trp Leu
Lys Asn Met Lys Arg Asp Ser Trp 35 40 45Val Pro Ser Lys Tyr Gln Phe
Leu Cys Ser Asp His Phe Thr Pro Asp 50 55 60Ser Leu Asp Ile Arg Trp
Gly Ile Arg Tyr Leu Lys Gln Thr Ala Val65 70 75 80Pro Thr Ile Phe
Ser Leu Pro Glu Asp Asn 85 9012992PRTHomo sapiens 129Met Pro Lys
Tyr Cys Arg Ala Pro Asn Cys Ser Asn Thr Ala Gly Arg1 5 10 15Leu Gly
Ala Asp Asn Arg Pro Val Ser Phe Tyr Lys Phe Pro Leu Lys 20 25 30Asp
Gly Pro Arg Leu Gln Ala Trp Leu Gln His Met Gly Cys Glu His 35 40
45Trp Val Pro Ser Cys His Gln His Leu Cys Ser Glu His Phe Thr Pro
50 55 60Ser Cys Phe Gln Trp Arg Trp Gly Val Arg Tyr Leu Arg Pro Asp
Ala65 70 75 80Val Pro Ser Ile Phe Ser Arg Gly Pro Pro Ala Lys 85
9013090PRTHomo sapiens 130Met Val Ile Cys Cys Ala Ala Val Asn Cys
Ser Asn Arg Gln Gly Lys1 5 10 15Gly Glu Lys Arg Ala Val Ser Phe His
Arg Phe Pro Leu Lys Asp Ser 20 25 30Lys Arg Leu Ile Gln Trp Leu Lys
Ala Val Gln Arg Asp Asn Trp Thr 35 40 45Pro Thr Lys Tyr Ser Phe Leu
Cys Ser Glu His Phe Thr Lys Asp Ser 50 55 60Phe Ser Lys Arg Leu Glu
Asp Gln His Arg Leu Leu Lys Pro Thr Ala65 70 75 80Val Pro Ser Ile
Phe His Leu Thr Glu Lys 85 9013189PRTHomo sapiens 131Met Pro Thr
Asn Cys Ala Ala Ala Gly Cys Ala Thr Thr Tyr Asn Lys1 5 10 15His Ile
Asn Ile Ser Phe His Arg Phe Pro Leu Asp Pro Lys Arg Arg 20 25 30Lys
Glu Trp Val Arg Leu Val Arg Arg Lys Asn Phe Val Pro Gly Lys 35 40
45His Thr Phe Leu Cys Ser Lys His Phe Glu Ala Ser Cys Phe Asp Leu
50 55 60Thr Gly Gln Thr Arg Arg Leu Lys Met Asp Ala Val Pro Thr Ile
Phe65 70 75 80Asp Phe Cys Thr His Ile Lys Ser Met 8513290PRTHomo
sapiens 132Met Pro Asn Phe Cys Ala Ala Pro Asn Cys Thr Arg Lys Ser
Thr Gln1 5 10 15Ser Asp Leu Ala Phe Phe Arg Phe Pro Arg Asp Pro Ala
Arg Cys Gln 20 25 30Lys Trp Val Glu Asn Cys Arg Arg Ala Asp Leu Glu
Asp Lys Thr Pro 35 40 45Asp Gln Leu Asn Lys His Tyr Arg Leu Cys Ala
Lys His Phe Glu Thr 50 55 60Ser Met Ile Cys Arg Thr Ser Pro Tyr Arg
Thr Val Leu Arg Asp Asn65 70 75 80Ala Ile Pro Thr Ile Phe Asp Leu
Thr Ser 85 9013397PRTHomo sapiens 133Met Pro Arg His Cys Ser Ala
Ala Gly Cys Cys Thr Arg Asp Thr Arg1 5 10 15Glu Thr Arg Asn Arg Gly
Ile Ser Phe His Arg Leu Pro Lys Lys Asp 20 25 30Asn Pro Arg Arg Gly
Leu Trp Leu Ala Asn Cys Gln Arg Leu Asp Pro 35 40 45Ser Gly Gln Gly
Leu Trp Asp Pro Ala Ser Glu Tyr Ile Tyr Phe Cys 50 55 60Ser Lys His
Phe Glu Glu Asp Cys Phe Glu Leu Val Gly Ile Ser Gly65 70 75 80Tyr
His Arg Leu Lys Glu Gly Ala Val Pro Thr Ile Phe Glu Ser Phe 85 90
95Ser13492PRTHomo sapiens 134Met Thr Arg Ser Cys Ser Ala Val Gly
Cys Ser Thr Arg Asp Thr Val1 5 10 15Leu Ser Arg Glu Arg Gly Leu Ser
Phe His Gln Phe Pro Thr Asp Thr 20 25 30Ile Gln Arg Ser Lys Trp Ile
Arg Ala Val Asn Arg Val Asp Pro Arg 35 40 45Ser Lys Lys Ile Trp Ile
Pro Gly Pro Gly Ala Ile Leu Cys Ser Lys 50 55 60His Phe Gln Glu Ser
Asp Phe Glu Ser Tyr Gly Ile Arg Arg Lys Leu65 70 75 80Lys Lys Gly
Ala Val Pro Ser Val Ser Leu Tyr Lys 85 9013596PRTHomo sappiens
135Met Val Lys Cys Cys Ser Ala Ile Gly Cys Ala Ser Arg Cys Leu Pro1
5 10 15Asn Ser Lys Leu Lys Gly Leu Thr Phe His Val Phe Pro Thr Asp
Glu 20 25 30Asn Ile Lys Arg Lys Trp Val Leu Ala Met Lys Arg Leu Asp
Val Asn 35 40 45Ala Ala Gly Ile Trp Glu Pro Lys Lys Gly Asp Val Leu
Cys Ser Arg 50 55 60His Phe Lys Lys Thr Asp Phe Asp Arg Ser Ala Pro
Asn Ile Lys Leu65 70 75 80Lys Pro Gly Val Ile Pro Ser Ile Phe Asp
Ser Pro Tyr His Leu Gln 85 90 9513690PRTHomo sapiens 136Met Pro Gly
Phe Thr Cys Cys Val Pro Gly Cys Tyr Asn Asn Ser His1 5 10 15Arg Asp
Lys Ala Leu His Phe Tyr Thr Phe Pro Lys Asp Ala Glu Leu 20 25 30Arg
Arg Leu Trp Leu Lys Asn Val Ser Arg Ala Gly Val Ser Gly Cys 35 40
45Phe Ser Thr Phe Gln Pro Thr Thr Gly His Arg Leu Cys Ser Val His
50 55 60Phe Gln Gly Gly Arg Lys Thr Tyr Thr Val Arg Val Pro Thr Ile
Phe65 70 75 80Pro Leu Arg Gly Val Asn Glu Arg Lys Val 85
9013790PRTHomo sapiens 137Met Pro Ala Arg Cys Val Ala Ala His Cys
Gly Asn Thr Thr Lys Ser1 5 10 15Gly Lys Ser Leu Phe Arg Phe Pro Lys
Asp Arg Ala Val Arg Leu Leu 20 25 30Trp Asp Arg Phe Val Arg Gly Cys
Arg Ala Asp Trp Tyr Gly Gly Asn 35 40 45Asp Arg Ser Val Ile Cys Ser
Asp His Phe Ala Pro Ala Cys Phe Asp 50 55 60Val Ser Ser Val Ile Gln
Lys Asn Leu Arg Phe Ser Gln Arg Leu Arg65 70 75 80Leu Val Ala Gly
Ala Val Pro Thr Leu His 85 9013885PRTDrosophila melanogaster 138Met
Lys Tyr Cys Lys Phe Cys Cys Lys Ala Val Thr Gly Val Lys Leu1 5 10
15Ile His Val Pro Lys Cys Ala Ile Lys Arg Lys Leu Trp Glu Gln Ser
20 25 30Leu Gly Cys Ser Leu Gly Glu Asn Ser Gln Ile Cys Asp Thr His
Phe 35 40 45Asn Asp Ser Gln Trp Lys Ala Ala Pro Ala Lys Gly Gln Thr
Phe Lys 50 55 60Arg Arg Arg Leu Asn Ala Asp Ala Val Pro Ser Lys Val
Ile Glu Pro65 70 75 80Glu Pro Glu Lys Ile 8513963PRTArtificial
SequenceTHAP Domain consensus 139Met Pro Lys Xaa Xaa Cys Xaa Ala
Xaa Xaa Cys Xaa Asn Arg Xaa Xaa1 5 10 15Xaa Xaa Xaa Xaa Lys Xaa Lys
Xaa Val Ser Phe His Lys Phe Pro Xaa 20 25 30His Asp Xaa His Asp Xaa
Xaa Arg Arg Xaa Xaa Trp Val Xaa Xaa Val 35 40 45Xaa Xaa Xaa Arg Xaa
Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Trp Xaa 50 55 6014017DNAArtificial
SequenceDR-5-related sequence 140gggcatacta ctggcaa
1714117DNAArtificial SequenceDR-5-related sequence 141gggcaaactg
tgggcat 1714217DNAArtificial SequenceDR-5-related sequence
142gggcatacta ctggcaa 1714317DNAArtificial SequenceDR-5-related
sequence 143gggcaaacta ctggcaa 1714417DNAArtificial
SequenceDR-5-related sequence 144gggccagttc gttgcaa
1714516DNAArtificial SequenceDR-5-related sequence 145gggcatgtac
tggcaa 1614616DNAArtificial SequenceDR-5-related sequence
146gggcaactgt gggcaa 1614718DNAArtificial SequenceDR-5-related
sequence 147gggcaacact actggcaa 1814817DNAArtificial
SequenceDR-5-related sequence 148gggcaaagta ctggcaa
1714917DNAArtificial SequenceDR-5 consensus sequence 149gggcaannnn
ntggcaa
1715023DNAArtificial SequenceER-11-related sequence 150ttgccagtac
taagtgtggg caa 2315123DNAArtificial SequenceER-11-related sequence
151ctgccagtac atagtgtggg caa 2315223DNAArtificial
SequenceER-11-related sequence 152ttgccagtac taagtgtggg caa
2315323DNAArtificial SequenceER-11-related sequence 153ctgccagtag
atactgtggg caa 2315424DNAArtificial SequenceER-11-related sequence
154ttgccagtag ttaggtgtgg gcga 2415523DNAArtificial
SequenceER-11-related sequence 155ttgccagtag ttagtgtggg caa
2315623DNAArtificial SequenceER-11-related sequence 156ttgccagtac
ctactaaggg caa 2315723DNAArtificial SequenceER-11-related sequence
157ttgccagtag ttagtgtggg cag 2315823DNAArtificial
SequenceER-11-related sequence 158ctgccagtag taagtgtggg cag
2315923DNAArtificial SequenceER-11 consensus sequence 159ttgccannnn
nnnnnnnggg caa 23160642DNAHomo sapiens 160atggtgcagt cctgctccgc
ctacggctgc aagaaccgct acgacaagga caagcccgtt 60tctttccaca agtttcctct
tactcgaccc agtctttgta aagaatggga ggcagctgtc 120agaagaaaaa
actttaaacc caccaagtat agcagtattt gttcagagca ctttactcca
180gactgcttta agagagagtg caacaacaag ttactgaaag agaatgctgt
gcccacaata 240tttctttgta ctgagccaca tgacaagaaa gaagatcttc
tggagccaca ggaacagctt 300cccccacctc ctttaccgcc tcctgtttcc
caggttgatg ctgctattgg attactaatg 360ccgcctcttc agacccctgt
taatctctca gttttctgtg accacaacta tactgtggag 420gatacaatgc
accagcggaa aaggattcat cagctagaac agcaagttga aaaactcaga
480aagaagctca agaccgcaca gcagcgatgc agaaggcaag aacggcagct
tgaaaaatta 540aaggaggttg ttcacttcca gaaagagaaa gacgacgtat
cagaaagagg ttatgtgatt 600ctaccaaatg actactttga aatagttgaa
gtaccagcat aa 642161687DNAHomo sapiens 161atgccgacca attgcgctgc
ggcgggctgt gccactacct acaacaagca cattaacatc 60agcttccaca ggtttccttt
ggatcctaaa agaagaaaag aatgggttcg cctggttagg 120cgcaaaaatt
ttgtgccagg aaaacacact tttctttgtt caaagcactt tgaagcctcc
180tgttttgacc taacaggaca aactcgacga cttaaaatgg atgctgttcc
aaccattttt 240gatttttgta cccatataaa gtctatgaaa ctcaagtcaa
ggaatctttt gaagaaaaac 300aacagttgtt ctccagctgg accatctaat
ttaaaatcaa acattagtag tcagcaagta 360ctacttgaac acagctatgc
ctttaggaat cctatggagg caaaaaagag gatcattaaa 420ctggaaaaag
aaatagcaag cttaagaaga aaaatgaaaa cttgcctaca aaaggaacgc
480agagcaactc gaagatggat caaagccacg tgtttggtaa agaatttaga
agcaaatagt 540gtattaccta aaggtacatc agaacacatg ttaccaactg
ccttaagcag tcttcctttg 600gaagatttta agatccttga acaagatcaa
caagataaaa cactgctaag tctaaatcta 660aaacagacca agagtacctt catttaa
687162720DNAHomo sapiens 162atgccgaagt cgtgcgcggc ccggcagtgc
tgcaaccgct acagcagccg caggaagcag 60ctcaccttcc accggtttcc gttcagccgc
ccggagctgc tgaaggaatg ggtgctgaac 120atcggccggg gcaacttcaa
gcccaagcag cacacggtca tctgctccga gcacttccgg 180ccagagtgct
tcagcgcctt tggaaaccgc aagaacctaa agcacaatgc cgtgcccacg
240gtgttcgcct ttcaggaccc cacacagcag gtgagggaga acacagaccc
tgccagtgag 300agaggaaatg ccagctcttc tcagaaagaa aaggtcctcc
ctgaggcggg ggccggagag 360gacagtcctg ggagaaacat ggacactgca
cttgaagagc ttcagttgcc cccaaatgcc 420gaaggccacg taaaacaggt
ctcgccacgg aggccgcaag caacagaggc tgttggccgg 480ccgactggcc
ctgcaggcct gagaaggacc cccaacaagc agccatctga tcacagctat
540gcccttttgg acttagattc cctgaagaaa aaactcttcc tcactctgaa
ggaaaatgaa 600aagctccgga agcgcttgca ggcccagagg ctggtgatgc
gaaggatgtc cagccgcctc 660cgtgcttgca aagggcacca gggactccag
gccagacttg ggccagagca gcagagctga 7201631734DNAHomo sapiens
163atggtgatct gctgtgcggc cgtgaactgc tccaaccggc agggaaaggg
cgagaagcgc 60gccgtctcct tccacaggtt ccccctaaag gactcaaaac gtctaatcca
atggttaaaa 120gctgttcaga gggataactg gactcccact aagtattcat
ttctctgtag tgagcatttc 180accaaagaca gcttctccaa gaggctggag
gaccagcatc gcctgctgaa gcccacggcc 240gtgccatcca tcttccacct
gaccgagaag aagagggggg ctggaggcca tggccgcacc 300cggagaaaag
atgccagcaa ggccacaggg ggtgtgaggg gacactcgag tgccgccacc
360ggcagaggag ctgcaggttg gtcaccgtcc tcgagtggaa acccgatggc
caagccagag 420tcccgcaggt tgaagcaagc tgctctgcaa ggtgaagcca
cacccagggc ggcccaggag 480gccgccagcc aggagcaggc ccagcaagct
ctggaacgga ctccaggaga tggactggcc 540accatggtgg caggcagtca
gggaaaagca gaagcgtctg ccacagatgc tggcgatgag 600agcgccactt
cctccatcga agggggcgtg acagataaga gtggcatttc tatggatgac
660tttacgcccc caggatctgg ggcgtgcaaa tttatcggct cacttcattc
gtacagtttc 720tcctctaagc acacccgaga aaggccatct gtcccccgag
agcccattga ccgcaagagg 780ctgaagaaag atgtggaacc aagctgcagt
gggagcagcc tgggacccga caagggcctg 840gcccagagcc ctcccagctc
atcacttacc gcgacaccgc agaagccttc ccagagcccc 900tctgcccctc
ctgccgacgt caccccaaag ccagccacgg aagccgtgca gagcgagcac
960agcgacgcca gccccatgtc catcaacgag gtcatcctgt cggcgtcagg
ggcctgcaag 1020ctcatcgact cactgcactc ctactgcttc tcctcccggc
agaacaagag ccaggtgtgc 1080tgcctgcggg agcaggtgga gaagaagaac
ggcgagctga agagcctgcg gcagagggtc 1140agccgctccg acagccaggt
gcggaagcta caggagaagc tggatgagct gaggagagtg 1200agcgtcccct
atccaagtag cctgctgtcg cccagccgcg agccccccaa gatgaaccca
1260gtggtggagc cactgtcctg gatgctgggc acctggctgt cggacccacc
tggagccggg 1320acctacccca cactgcagcc cttccagtac ctggaggagg
ttcacatctc ccacgtgggc 1380cagcccatgc tgaacttctc gttcaactcc
ttccacccgg acacgcgcaa gccgatgcac 1440agagagtgtg gcttcattcg
cctcaagccc gacaccaaca aggtggcctt tgtcagcgcc 1500cagaacacag
gcgtggtgga agtggaggag ggcgaggtga acgggcagga gctgtgcatc
1560gcatcccact ccatcgccag gatctccttc gccaaggagc cccacgtaga
gcagatcacc 1620cggaagttca ggctgaattc tgaaggcaaa cttgagcaga
cggtctccat ggcaaccacg 1680acacagccaa tgactcagca tcttcacgtc
acctacaaga aggtgacccc gtaa 17341641188DNAHomo sapiens 164atgccccgct
attgcgcagc gatttgttgt aagaaccgcc ggggacgaaa caataaagac 60cggaagctga
gtttttatcc atttcctcta catgacaaag aaagactgga aaagtggtta
120aagaatatga agcgagattc atgggttccc agtaaatacc agtttctatg
tagtgaccat 180tttactcctg actctcttga catcagatgg ggtattcgat
atttaaaaca aactgcagtt 240ccaacaatat tttctttgcc tgaagacaat
cagggaaaag acccttctaa aaaaaaatcc 300cagaagaaaa acttggaaga
tgagaaagaa gtatgcccaa aagccaagtc agaagaatca 360tttgtattaa
atgagacaaa gaaaaatata gttaacacag atgtgcccca tcaacatcca
420gaattacttc attcatcttc cttggtaaag ccaccagctc ccaaaacagg
aagtatacaa 480aataacatgt taactcttaa tctagttaaa caacatactg
ggaaaccaga atctaccttg 540gaaacatcag ttaaccaaga tacaggtaga
ggtggttttc acacatgttt tgagaatcta 600aattctacaa ctattacttt
gacaacttca aattcagaaa gtattcatca atctttggaa 660actcaagaag
ttcttgaagt aactaccagt catcttgcta atccaaactt tacaagtaat
720tccatggaaa taaagtcagc acaggaaaat ccattcttat tcagcacaat
taatcaaaca 780gttgaagaat taaacacaaa taaagaatct gttattgcca
tttttgtacc tgctgaaaat 840tctaaaccct cagttaattc ttttatatct
gcacaaaaag aaaccacgga aatggaagac 900acagacattg aagactcctt
gtataaggat gtagactatg ggacagaagt tttacaaatc 960gaacattctt
actgcagaca agatataaat aaggaacatc tttggcagaa agtctctaag
1020ctacattcaa agataactct tctagagtta aaagagcaac aaactctagg
tagattgaag 1080tctttggaag ctcttataag gcagctaaag caggaaaact
ggctatctga agaaaacgtc 1140aagattatag aaaaccattt tacaacatat
gaagtcacta tgatatag 1188165669DNAHomo sapiens 165atggtgaaat
gctgctccgc cattggatgt gcttctcgct gcttgccaaa ttcgaagtta 60aaaggactga
catttcacgt attccccaca gatgaaaaca tcaaaaggaa atgggtatta
120gcaatgaaaa gacttgatgt gaatgcagcc ggcatttggg agcctaaaaa
aggagatgtg 180ttgtgttcga ggcactttaa gaagacagat tttgacagaa
gtgctccaaa tattaaactg 240aaacctggag tcataccttc tatctttgat
tctccatatc acctacaggg gaaaagagaa 300aaacttcatt gtagaaaaaa
cttcaccctc aaaaccgttc cagccactaa ctacaatcac 360catcttgttg
gtgcttcctc atgtattgaa gaattccaat cccagttcat ttttgaacat
420agctacagtg taatggacag tccaaagaaa cttaagcata aattagatca
tgtgatcggc 480gagctagagg atacaaagga aagtctacgg aatgttttag
accgagaaaa acgttttcag 540aaatcattga ggaagacaat cagggaatta
aaggatgaat gtctgatcag ccaagaaaca 600gcaaatagac tggacacttt
ctgttgggac tgttgtcagg agagcataga acaggactat 660atttcatga
669166930DNAHomo sapiens 166atgccgcgtc actgctccgc cgccggctgc
tgcacacggg acacgcgcga gacgcgcaac 60cgcggcatct ccttccacag acttcccaag
aaggacaacc cgaggcgagg cttgtggctg 120gccaactgcc agcggctgga
ccccagcggc cagggcctgt gggacccggc atccgagtac 180atctacttct
gctccaaaca ctttgaggag gactgctttg agctggtggg aatcagtgga
240tatcacaggc taaaggaggg ggcagtcccc accatatttg agtctttctc
caagttgcgc 300cggacaacca agaccaaagg acacagttac ccacctggcc
cccctgaagt cagccggctc 360agacgatgca ggaagcgctg ctccgagggc
cgagggccca caactccatt ttctccacct 420ccacctgctg atgtcacctg
ctttcctgtg gaagaggcct cagcacctgc cactttgccg 480gcctccccag
ctgggaggct ggagcctggc cttagcagcc ccttttcaga cctactgggc
540cccttgggtg cccaggcaga tgaagcaggc tgcagcgccc agccttcacc
agagcggcag 600ccctcccctc tcgaaccacg gccagtctcc ccctcagcgt
atatgctgcg cctgccccca 660cccgccggag cctacatcca gaatgaacac
agctaccagg tgggcagcgc cttactctgg 720aagcggcgag ccgaggcagc
ccttgatgcc cttgacaagg cccagcgcca gctgcaggcc 780tgcaagcggc
gggagcagcg gctgcggttg agactgacca agctgcagca ggagcgggca
840cgggagaagc gggcacaggc agatgcccgc cagactctga aggagcatgt
gcaggacttt 900gccatgcagc tgagcagcag catggcctga 930167825DNAHomo
sapiens 167atgcccaagt actgcagggc gccgaactgc tccaacactg cgggccgcct
gggtgcagac 60aaccgccctg tgagcttcta caagttccca ctgaaggatg gtccccggct
gcaggcctgg 120ctgcagcaca tgggctgtga gcactgggtg cccagctgcc
accagcactt gtgcagcgag 180cacttcacac cctcctgctt ccagtggcgc
tggggtgtgc gctacctgcg gcctgatgca 240gtgccctcca tcttctcccg
gggaccacct gccaagagtc agcggaggac ccgaagcacc 300cagaagccag
tctcgccgcc gcctccccta cagaagaata cacccctgcc ccagagccct
360gccatcccag tctctggccc agtgcgccta gtggtgctgg gccccacatc
ggggagcccc 420aagactgtgg ccaccatgct cctgaccccc ctggcccctg
cgccaactcc tgagcggtca 480caacctgaag tccctgccca acaggcccag
accgggctgg gcccagtgct gggagcactg 540caacgccggg tgcggaggct
gcaacggtgc caggagcggc accaggcgca gctgcaggcc 600ctggaacggc
tggcacagca gctacacggg gagagcctgc tggcacgggc acgccggggt
660ctgcagcgcc tgacaacagc ccagaccctt ggacctgagg aatcccaaac
cttcaccatc 720atctgtggag ggcctgacat agccatggtc cttgcccagg
accctgcacc tgccacagtg 780gatgccaagc cggagctcct ggacactcgg
atccccagtg cataa 8251683171DNAHomo sapiens 168atgacccgaa gttgctccgc
agtgggctgc agcacccgtg acaccgtgct cagccgggag 60cgcggcctct ccttccacca
atttccaact gataccatac agcgctcaaa atggatcagg 120gctgttaatc
gtgtggaccc cagaagcaaa aagatttgga ttccaggacc aggtgctata
180ctgtgttcca aacattttca agaaagtgac tttgagtcat atggcataag
aagaaagctg 240aaaaaaggag ctgtgccttc tgtttctcta tacaagattc
ctcaaggtgt acatcttaaa 300ggtaaagcaa gacaaaaaat cctaaaacaa
cctcttccag acaattctca agaagttgct 360actgaggacc ataactatag
tttaaagaca cctttgacga taggtgcaga gaaactggct 420gaggtgcaac
aaatgttaca agtgtccaaa aaaagactta tctccgtaaa gaactacagg
480atgatcaaga agagaaaggg tttacgatta attgatgcac ttgtagaaga
gaaactactt 540tctgaagaaa cagagtgtct gctacgagct caattttcag
attttaagtg ggagttatat 600aattggagag aaacagatga gtactccgca
gaaatgaaac aatttgcatg tacactctac 660ttgtgcagta gcaaagtcta
tgattatgta agaaagattc ttaagctgcc tcattcttcc 720atcctcagaa
cgtggttatc caaatgccaa cccagtccag gtttcaacag caacattttt
780tcttttcttc aacgaagagt agagaatgga gatcagctct atcaatactg
ttcattgtta 840ataaaaagta tacctctcaa gcaacagctt cagtgggatc
ctagcagtca cagtttgcag 900gggtttatgg actttggtct tggaaaactt
gatgctgatg aaacgccact tgcttcagaa 960actgttttgt taatggcagt
gggtattttt ggccattgga gaacacctct tggttatttt 1020tttgtaaaca
gagcatctgg atatttgcag gctcagctgc ttcgtctgac tattggtaaa
1080ctgagtgaca taggaatcac agttctggct gttacatctg atgccacagc
acatagtgtt 1140cagatggcaa aagcattggg gatacatatt gatggagacg
acatgaaatg tacatttcag 1200catccttcat cttctagtca acagattgca
tacttctttg actcttgcca cttgctaaga 1260ttaataagaa atgcatttca
gaattttcaa agcattcagt ttattaatgg tatagcacat 1320tggcagcacc
tcgtggagtt agtagcactg gaggaacagg aattatcaaa tatggaaaga
1380ataccaagta cacttgcaaa tttgaaaaat catgtactga aagtgaatag
tgccacccaa 1440ctctttagtg agagtgtagc cagtgcatta gaatatttgt
tatccttaga cctgccacct 1500tttcaaaact gtattggtac catccatttt
ttacgtttaa ttaacaatct gtttgacatc 1560tttaatagta ggaactgtta
tggaaaggga cttaaagggc ctctgttgcc tgaaacttac 1620agtaaaataa
accacgtgtt aattgaagcc aagactattt ttgttacatt atctgacact
1680agcaataatc aaataattaa aggtaagcaa aaactaggat tcctgggatt
tttgctcaat 1740gctgagagct taaaatggct ctaccaaaat tatgttttcc
caaaggtcat gccttttcct 1800tatcttctga cttacaaatt cagtcatgat
catctggaat tatttctaaa gatgcttagg 1860caggtattag taacaagttc
tagccctacc tgcatggcat tccagaaagc ttactataat 1920ttggagacca
gatacaaatt tcaagatgaa gtttttctaa gcaaagtaag catctttgac
1980atttcaattg ctcgaaggaa agacttggcg ctttggacag ttcaacgtca
gtatggtgtc 2040agcgttacaa agactgtctt tcacgaagag ggtatttgtc
aagactggtc tcattgttca 2100ctaagtgagg cattactaga cctgtcagat
cataggcgaa atctcatctg ttatgctggt 2160tatgttgcaa acaagttatc
agctctttta acttgtgagg actgcatcac tgcactgtat 2220gcatcggatc
tcaaagcctc taaaattggg tcactattat ttgttaaaaa gaagaatggt
2280ttgcattttc cttcagaaag tctgtgtcgg gtcataaata tttgtgagcg
agttgtaaga 2340acccattcaa gaatggcaat ttttgaacta gtttctaaac
aaagggaatt gtatcttcaa 2400cagaaaatat tatgtgagct ttctgggcat
attgatcttt ttgtagatgt gaataagcat 2460ctctttgatg gagaagtgtg
tgccatcaat cactttgtca agttgctaaa ggatataata 2520atctgtttct
taaatatcag agctaaaaat gttgcacaga atcctttaaa acatcattca
2580gagagaactg atatgaaaac tttatcaagg aaacactggt cacctgtaca
ggattataaa 2640tgttcaagtt ttgctaatac cagtagtaaa ttcaggcatt
tgctaagtaa cgatggatat 2700ccattcaaat gagagaccta aaatatatta
acattttaat taagaatact tgatcaacat 2760tttttgaagt tcaatttacc
atattttata aattgcgcat tctgcacagt ggacaagttt 2820gcaattctga
cttattaaaa tttcaaattc tgcatatcac aaaatctcct tatacttttg
2880gtatggcttg cagcatttat gagttttcca aaatatagaa agcagtaggt
cagtaggagc 2940aaactagcca acaggtactg tctttgaatt tactactgta
agactaagca gtgttactgg 3000acacagtttt aacttgttca atctgcttca
aaaacaagaa aaacaacaac tatgagttat 3060caaaatattg actccattta
tgactagact acatttctga aagatctttg gtttacgatt 3120cttaagaata
ttgacaatac ctataaaact ttgaagataa cttttactta a 3171169774DNAHomo
sapiens 169atgccggccc gttgtgtggc cgcccactgc ggcaacacca ccaagtctgg
gaagtcgctg 60ttccgctttc ccaaggaccg ggccgtgcgg ctgctctggg accgcttcgt
gcggggttgc 120cgcgccgact ggtacggagg caatgaccgc tcggtcatct
gctctgacca ctttgcccca 180gcctgttttg acgtctcttc ggttatccag
aagaacctgc gcttctccca gcgcctgagg 240ctggtggcag gcgccgtgcc
caccctgcac cgggtgcccg ccccggcacc taagagggga 300gaggagggag
accaagcagg ccgcctggac acgcgaggag agctccaggc agccaggcat
360tctgaggctg ccccaggtcc agtctcctgt acacgccccc gagctgggaa
gcaggctgca 420gcttcacaga ttacgtgtga aaatgaactt gtgcaaaccc
aaccccatgc tgataatcca 480tctaatactg tcacttcagt acctactcac
tgtgaagaag gcccagtgca taaaagtaca 540caaatttctt tgaaaaggcc
ccgtcaccgt agtgtgggta ttcaagccaa agtgaaagcg 600tttggaaaaa
gactgtgtaa tgcaactact cagacagagg aattgtggtc tagaacttcc
660tctctctttg acatttactc cagtgattca gaaacagata cagactggga
tatcaagagt 720gaacagagtg atttgtctta tatggctgta caggtgaaag
aagaaacatg ttaa 774170945DNAHomo sapiens 170atgcctggct ttacgtgctg
cgtgccaggc tgctacaaca actcgcaccg ggacaaggcg 60ctgcacttct acacgtttcc
aaaggacgct gagttgcggc gcctctggct caagaacgtg 120tcgcgtgccg
gcgtcagtgg gtgcttctcc accttccagc ccaccacagg ccaccgtctc
180tgcagcgttc acttccaggg cggccgcaag acctacacgg tacgcgtccc
caccatcttc 240ccgctgcgcg gcgtcaatga gcgcaaagta gcgcgcagac
ccgctggggc cgcggccgcc 300cgccgcaggc agcagcagca acagcagcag
cagcagcaac agcagcaaca gcagcagcag 360cagcaacagc agcagcagca
gcagcagcag cagcagtcct caccctctgc ctccactgcc 420cagactgccc
agctgcagcc gaacctggta tctgcttccg cggccgtgct tctcaccctt
480caggccactg tagacagcag tcaggctccg ggatccgtac agccggcgcc
catcactccc 540actggagaag acgtgaagcc catcgatctc acagtgcaag
tggagtttgc agccgcagag 600ggcgcagccg ctgcggccgc cgcgtcggag
ttacaggctg ctaccgcagg gctggaggct 660gccgagtgcc ctatgggccc
ccagttggtg gtggtagggg aagagggctt ccctgatact 720ggctccgacc
attcgtactc cttgtcgtca ggcaccacgg aggaggagct cctgcgcaag
780ctgaatgagc agcgggacat cctggctctg atggaagtga agatgaaaga
gatgaaaggc 840agcattcgcc acctgcgtct cactgaggcc aagctgcgcg
aagaactgcg tgagaaggat 900cggctgcttg ccatggctgt catccgcaag
aagcacggaa tgtga 9451712286DNAHomo sapiens 171atgccgaact tctgcgctgc
ccccaactgc acgcggaaga gcacgcagtc cgacttggcc 60ttcttcaggt tcccgcggga
ccctgccaga tgccagaagt gggtggagaa ctgtaggaga 120gcagacttag
aagataaaac acctgatcag ctaaataaac attatcgatt atgtgccaaa
180cattttgaga cctctatgat ctgtagaact agtccttata ggacagttct
tcgagataat 240gcaataccaa caatatttga tcttaccagt catttgaaca
acccacatag tagacacaga 300aaacgaataa aagaactgag tgaagatgaa
atcaggacac tgaaacagaa aaaaattgat 360gaaacttctg agcaggaaca
aaaacataaa gaaaccaaca atagcaatgc tcagaacccc 420agcgaagaag
agggtgaagg gcaagatgag gacattttac ctctaaccct tgaagagaag
480gaaaacaaag aatacctaaa atctctattt gaaatcttga ttctgatggg
aaagcaaaac 540atacctctgg atggacatga ggctgatgaa atcccagaag
gtctctttac tccagataac 600tttcaggcac tgctggagtg tcggataaat
tctggtgaag aggttctgag aaagcggttt 660gagacaacag cagttaacac
gttgttttgt tcaaaaacac agcagaggca gatgctagag 720atctgtgaga
gctgtattcg agaagaaact ctcagggaag tgagagactc acacttcttt
780tccattatca ctgacgatgt agtggacata gcaggggaag agcacctacc
tgtgttggtg 840aggtttgttg atgaatctca taacctaaga gaggaattta
taggcttcct gccttatgaa 900gccgatgcag aaattttggc tgtgaaattt
cacactatga taactgagaa gtggggatta 960aatatggagt attgtcgtgg
ccaggcttac attgtctcta gtggattttc ttccaaaatg 1020aaagttgttg
cttctagact tttagagaaa tatccccaag
ctatctacac actctgctct 1080tcctgtgcct taaatatgtg gttggcaaaa
tcagtacctg ttatgggagt atctgttgca 1140ttaggaacaa ttgaggaagt
ttgttctttt ttccatcgat caccacaact gcttttagaa 1200cttgacaacg
taatttctgt tctttttcag aacagtaaag aaaggggtaa agaactgaag
1260gaaatctgcc attctcagtg gacaggcagg catgatgctt ttgaaatttt
agtggaactc 1320ctgcaagcac ttgttttatg tttagatggt ataaatagtg
acacaaatat tagatggaat 1380aactatatag ctggccgagc atttgtactc
tgcagtgcag tgtcagattt tgatttcatt 1440gttactattg ttgttcttaa
aaatgtccta tcttttacaa gagcctttgg gaaaaacctc 1500caggggcaaa
cctctgatgt cttctttgcg gccggtagct tgactgcagt actgcattca
1560ctcaacgaag tgatggaaaa tattgaagtt tatcatgaat tttggtttga
ggaagccaca 1620aatttggcaa ccaaacttga tattcaaatg aaactccctg
ggaaattccg cagagctcac 1680cagggtaact tggaatctca gctaacctct
gagagttact ataaagaaac cctaagtgtc 1740ccaacagtgg agcacattat
tcaggaactt aaagatatat tctcagaaca gcacctcaaa 1800gctcttaaat
gcttatctct ggtaccctca gtcatgggac aactcaaatt caatacgtcg
1860gaggaacacc atgctgacat gtatagaagt gacttaccca atcctgacac
gctgtcagct 1920gagcttcatt gttggagaat caaatggaaa cacaggggga
aagatataga gcttccgtcc 1980accatctatg aagccctcca cctgcctgac
atcaagtttt ttcctaatgt gtatgcattg 2040ctgaaggtcc tgtgtattct
tcctgtgatg aaggttgaga atgagcggta tgaaaatgga 2100cgaaagcgtc
ttaaagcata tttgaggaac actttgacag accaaaggtc aagtaacttg
2160gctttgctta acataaattt tgatataaaa cacgacctgg atttaatggt
ggacacatat 2220attaaactct atacaagtaa gtcagagctt cctacagata
attccgaaac tgtggaaaat 2280acctaa 2286172633DNAMus musculus
172atggtgcagt cctgctccgc ctacggctgc aagaaccgct acgacaagga
caagcccgtc 60tccttccaca agtttcctct tactcgcccc agcctttgta agcagtggga
ggcagctgtt 120aaaaggaaaa acttcaagcc caccaagtac agcagcatct
gctcggagca cttcaccccg 180gactgcttta agagggagtg caacaacaag
ctactgaagg agaacgctgt gcccacaata 240tttctctata tcgagccaca
tgagaagaag gaagacctgg aatcccaaga acagctcccc 300tctccttcac
cccccgcttc ccaggttgat gctgctattg ggctgctaat gccccctctg
360cagacccctg ataacctgtc ggttttctgt gaccacaatt acactgtgga
ggatacgatg 420caccagagga agaggatcct gcagctggag cagcaggtgg
agaaactcag gaagaagctc 480aagacggccc agcagcggtg ccggcggcag
gagaggcagc tcgagaagct caaggaagtc 540gtccactttc agagagagaa
ggacgacgcg tccgagaggg gctacgtgat cctaccaaat 600gactactttg
aaattgttga agttccagca tga 633173654DNAMus musculus 173atgccgacca
attgcgccgc ggcgggctgt gctgctacct acaacaagca cattaacatc 60agcttccaca
ggtttccttt ggatcctaaa agaagaaaag aatgggttcg cctggttagg
120cgcaaaaatt ttgtgccagg aaaacacact tttctttgct caaagcactt
tgaagcctcc 180tgttttgatc taacaggaca aacccgacga cttaaaatgg
atgctgttcc aaccattttt 240gatttttgta cccatataaa gtctctgaaa
ctcaagtcaa ggaatcttct gaagacaaac 300aacagttttc ctccaactgg
accatgtaat ttaaagctga acggcagtca gcaagtactg 360cttgaacaca
gttatgcctt taggaaccct atggaggcga aaaaaaggat aattaaacta
420gaaaaggaaa tagcaagctt gagaaaaaaa atgaaaactt gcctgcaaag
agaacgcaga 480gcaactcgaa ggtggatcaa agccacgtgc tttgtgaaga
gcttagaagc aagtaacatg 540ctacctaagg gcatctcaga acagatttta
ccaactgcct taagcaatct tcctctggaa 600gatttaaaaa gtcttgaaca
agatcaacaa gataaaacag tacccattct ctaa 654174657DNAMus musculus
174atgccgaagt cttgcgcggc ccggcaatgc tgcaaccgct acagcagccg
caggaagcag 60ctcaccttcc accggttccc cttcagccgc ccggagctgt tgagggagtg
ggtgctcaac 120atcggccggg ctgacttcaa gcctaagcag cacacagtca
tctgctcgga acacttcaga 180cccgagtgct tcagcgcctt tgggaaccgc
aagaacctga aacacaatgc tgtgcccacg 240gtgttcgctt ttcagaaccc
cacagaggtc tgccctgagg tgggggctgg tggggacagc 300tcagggagga
acatggacac cacactggaa gaacttcagc ctccaacccc ggaaggcccc
360gtgcagcagg tcttaccaga tcgagaagca atggaggcca cggaggccgc
tggcctgcct 420gccagccctc tggggttgaa gaggcccctt ccgggacagc
cgtctgatca cagttatgcc 480ctttcggact tggataccct caaaaaaaaa
ctctttctca cactgaagga aaacaagagg 540cttcggaagc ggctgaaagc
ccagaggctg ctgttgcgga ggacatgtgg ccgcctgaga 600gcctacagag
agggacagcc gggacctcgg gccagacggc cggcacaggg aagctga 657175558DNAMus
musculus 175atactgcaag catttggaag cctaaaaaaa ggagatgtgc tgtgttcaag
acacttcaag 60aagacagact ttgacagaag cactctaaac actaagctga aggcaggagc
catcccttct 120atctttgaat gtccatatca cttacaggag aaaagagaaa
aacttcactg tagaaaaaac 180ttccttctca aaacccttcc catcacccac
catggccgcc agcttgttgg tgcctcctgc 240attgaagaat tcgaacccca
gttcattttt gaacatagct acagtgttat ggacagccca 300aagaagctta
agcataagct agaccgtgtg atcatcgagc tggagaatac caaggaaagc
360ctacggaatg ttttagcccg agaaaaacac tttcaaaagt cactgaggaa
gacaatcatg 420gaactaaagg atgaaagtct gatcagccag gaaacagcca
atagtctggg tgctttctgt 480tgggagtgct atcatgaaag cacagcagga
ggctgtagtt gtgaagtcat ttcttatatg 540cttcatctgc agttgaca
5581761719DNAHomo sapiens 176ctttccgcgc ggcggaagag cgcgcgccag
cttcggcaca cttgggagcc ggatcccagc 60cctacgcctc gtcccctaca agctcctcca
agccccgccg gctgctgtgg gagcggcggc 120cgtcctctcc tggaggtcgt
ctcctggcat cctcggggcc gcaggaagga agaggaggca 180gcggccggag
ccctggtggg cggcctgagg tgagagcccg accggcccct ttgggaatat
240ggcgaccggt ggctaccgga ccagcagcgg cctcggcggc agcaccacag
acttcctgga 300ggagtggaag gcgaaacgcg agaagatgcg cgccaagcag
aaccccccgg gcccggcccc 360cccgggaggg ggcagcagcg acgccgctgg
gaagcccccc gcgggggctc tgggcacccc 420ggcggccgcc gctgccaacg
agctcaacaa caacctcccg ggcggcgcgc cggccgcacc 480tgccgtcccc
ggtcccgggg gcgtgaactg cgcggtcggc tccgccatgc tgacgcgggc
540gcccccggcc cgcggcccgc ggcggtcgga ggacgagccc ccagccgcct
ctgcctcggc 600tgcaccgccg ccccagcgtg acgaggagga gccggacggc
gtcccagaga agggcaagag 660ctcgggcccc agtgccagga aaggcaaggg
gcagatcgag aagaggaagc tgcgggagaa 720gcggcgctcc accggcgtgg
tcaacatccc tgccgcagag tgcttagatg agtacgaaga 780tgatgaagca
gggcagaaag agcggaaacg agaagatgca attacacaac agaacactat
840tcagaatgaa gctgtaaact tactagatcc aggcagttcc tatctgctac
aggagccacc 900tagaacagtt tcaggcagat ataaaagcac aaccagtgtc
tctgaagaag atgtctcaag 960tagatattct cgaacagata gaagtgggtt
ccctagatat aacagggatg caaatgtttc 1020aggtactctg gtttcaagta
gcacactgga aaagaaaatt gaagatcttg aaaaggaagt 1080agtaacagaa
agacaagaaa acctaagact tgtgagactg atgcaagata aagaggaaat
1140gattggaaaa ctcaaagaag aaattgattt attaaataga gacctagatg
acatagaaga 1200tgaaaatgaa cagctaaagc aggaaaataa aactcttttg
aaagttgtgg gtcagctgac 1260caggtagagg attcaagact caatgtggaa
aaaatatttt aaactactga ttgaatgtta 1320atggtcaatg ctagcacaat
attcctatgc tgcaatacat taaaataact aagcaagtat 1380atttatttct
agcaaacaga tgtttgtttt caaaatactt ctttttcatt attggtttta
1440aaaaagcatt atccttttat ctcacaaata agtaatatct ttcagttatt
aaatgataga 1500taatgccttt ttggttttgt gtggtattca actaatacat
ggtttaaagt cacagccgtt 1560tgaatatatt ttatcttggt agtacatttt
ctcccttagg aatatacata gtctttgttt 1620acatgagttc caatactttt
gggatgttac cctcacatgt ccctatactg atgtgtgcca 1680ccttttatgt
gttgatgact cactcataag gttttggtc 1719177878DNAHomo sapiens
177atcccagccc acgcacagac ccccaacttg cagctgccca cctcaccctc
agctctggcc 60tcttactcac cctctaccac agacatggct cagtcactgg ctctgagcct
ccttatcctg 120gttctggcct ttggcatccc caggacccaa ggcagtgatg
gaggggctca ggactgttgc 180ctcaagtaca gccaaaggaa gattcccgcc
aaggttgtcc gcagctaccg gaagcaggaa 240ccaagcttag gctgctccat
cccagctatc ctgttcttgc cccgcaagcg ctctcaggca 300gagctatgtg
cagacccaaa ggagctctgg gtgcagcagc tgatgcagca tctggacaag
360acaccatccc cacagaaacc agcccagggc tgcaggaagg acaggggggc
ctccaagact 420ggcaagaaag gaaagggctc caaaggctgc aagaggactg
agcggtcaca gacccctaaa 480gggccatagc ccagtgagca gcctggagcc
ctggagaccc caccagcctc accagcgctt 540gaagcctgaa cccaagatgc
aagaaggagg ctatgctcag gggccctgga gcagccaccc 600catgctggcc
ttgccacact ctttctcctg ctttaaccac cccatctgca ttcccagctc
660taccctgcat ggctgagctg cccacagcag gccaggtcca gagagaccga
ggagggagag 720tctcccaggg agcatgagag gaggcagcag gactgtcccc
ttgaaggaga atcatcagga 780ccctggacct gatacggctc cccagtacac
cccacctctt ccttgtaaat atgatttata 840cctaactgaa taaaaagctg
ttctgtcttc ccacccaa 87817834PRTArtificial SequenceInterferon gamma
homology motif of THAP1 178Asn Tyr Thr Val Glu Asp Thr Met His Gln
Arg Lys Arg Ile His Gln1 5 10 15Leu Glu Gln Gln Val Glu Lys Leu Arg
Lys Lys Leu Lys Thr Ala Gln 20 25 30Gln Arg17920PRTArtificial
SequenceNuclear localization sequence of THAP1 179Arg Lys Arg Ile
His Gln Leu Glu Gln Gln Val Glu Lys Leu Arg Lys1 5 10 15Lys Leu Lys
Thr 2018038PRTArtificial SequenceConsensus sequence for PAR4
binding domain of THAP 180Leu Glu Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa
Xaa Xaa Xaa Xaa Xaa Xaa1 5 10 15Gln Arg Xaa Arg Arg Gln Xaa Arg Xaa
Xaa Xaa Xaa Xaa Xaa Xaa Xaa 20 25 30Xaa Xaa Xaa Gln Arg Glu
3518150DNAArtificial SequencePrimer 181gaattcggcc attatggcct
gcaggatccg gccgcctcgg cccaggatcc 50182111PRTHomo sapiens 182Ser Asp
Gly Gly Ala Gln Asp Cys Cys Leu Lys Tyr Ser Gln Arg Lys1 5 10 15Ile
Pro Ala Lys Val Val Arg Ser Tyr Arg Lys Gln Glu Pro Ser Leu 20 25
30Gly Cys Ser Ile Pro Ala Ile Leu Phe Leu Pro Arg Lys Arg Ser Gln
35 40 45Ala Glu Leu Cys Ala Asp Pro Lys Glu Leu Trp Val Gln Gln Leu
Met 50 55 60Gln His Leu Asp Lys Thr Pro Ser Pro Gln Lys Pro Ala Gln
Gly Cys65 70 75 80Arg Lys Asp Arg Gly Ala Ser Lys Thr Gly Lys Lys
Gly Lys Gly Ser 85 90 95Lys Gly Cys Lys Arg Thr Glu Arg Ser Gln Thr
Pro Lys Gly Pro 100 105 11018337DNAArtificial SequencePrimer
183gcgggatccg tagtgatgga ggggctcagg actgttg 3718435DNAArtificial
SequencePrimer 184gcgggatccc tatggccctt taggggtctg tgacc
3518533DNAArtificial SequencePrimer 185ccgaattcag gatggtgcag
tcctgctccg cct 3318639DNAArtificial SequencePrimer 186cgcggatcct
gctggtactt caactatttc aaagtagtc 3918733DNAArtificial SequencePrimer
187ccgaattcag gatggtgcag tcctgctccg cct 3318839DNAArtificial
SequencePrimer 188cgcggatcct gctggtactt caactatttc aaagtagtc
3918933DNAArtificial SequencePrimer 189gcggaattca tggcgaccgg
tggctaccgg acc 3319035DNAArtificial SequencePrimer 190gcgggatccc
tctacctggt cagctgaccc acaac 3519133DNAArtificial SequencePrimer
191ccgaattcag gatggtgcag tcctgctccg cct 3319239DNAArtificial
SequencePrimer 192cgcggatcct gctggtactt caactatttc aaagtagtc
3919346DNAArtificial SequencePrimer 193cgcgaattcg ccatcatggg
gttccctaga tataacaggg atgcaa 4619437DNAArtificial SequencePrimer
194gccggatccg ggttccctag atataacagg gatgcaa 3719537DNAArtificial
SequencePrimer 195gcgctctaga gccatcatgg aggagcagaa gctgatc
3719637DNAArtificial SequencePrimer 196cttgcggccg cctctacctg
gtcagctgac ccacaac 3719737DNAArtificial SequencePrimer
197gcggaattca aagaagatct tctggagcca caggaac 3719839DNAArtificial
SequencePrimer 198cgcggatcct gctggtactt caactatttc aaagtagtc
3919935DNAArtificial SequencePrimer 199gcggaattca tgccgcctct
tcagacccct gttaa 3520036DNAArtificial SequencePrimer 200gcggaattca
tgcaccagcg gaaaaggatt catcag 3620133DNAArtificial SequencePrimer
201ccgaattcag gatggtgcag tcctgctccg cct 3320239DNAArtificial
SequencePrimer 202gcgggatccc ttgtcatgtg gctcagtaca aagaaatat
3920334DNAArtificial SequencePrimer 203cgggatcctg tgcggtcttg
agcttctttc tgag 3420436DNAArtificial SequencePrimer 204gcgggatccg
tcgtctttct ctttctggaa gtgaac 3620536PRTArtificial SequenceConsensus
sequence for PAR4 binding domain of THAP 205Leu Glu Xaa Xaa Xaa Xaa
Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Gln Arg1 5 10 15Xaa Arg Arg Gln Xaa
Arg Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa 20 25 30Xaa Gln Xaa Glu
3520639DNAArtificial SequencePrimer 206ccgcacagca gcgatgcgct
gctcaagaac ggcagcttg 3920739DNAArtificial SequencePrimer
207caagctgccg ttcttgagca gcgcatcgct gctgtgcgg 3920832DNAArtificial
SequencePrimer 208gctcaagacc gcacagcaag aacggcagct tg
3220932DNAArtificial SequencePrimer 209caagctgccg ttcttgctgt
gcggtcttga gc 3221036DNAArtificial SequencePrimer 210gcgggatccc
taaattagaa aggggtgggg gtagcc 3621132DNAArtificial SequencePrimer
211gcggaattca tggagcctgc acccgcccga tc 3221237DNAArtificial
SequencePrimer 212gcggaattca aagaagatct tctggagcca caggaac
3721339DNAArtificial SequencePrimer 213cgcggatcct gctggtactt
caactatttc aaagtagtc 3921433DNAArtificial SequencePrimer
214cgcggatccg tgcagtcctg ctccgcctac ggc 3321539DNAArtificial
SequencePrimer 215ccgaattctt atgctggtac ttcaactatt tcaaagtag
3921633DNAArtificial SequencePrimer 216gccgaattca tgccgaactt
ctgcgctgcc ccc 3321740DNAArtificial SequencePrimer 217cgcggatcct
taggttattt tccacagttt cggaattatc 4021839DNAArtificial
SequencePrimer 218gcgctgcagc aagctaaatt taaatgaagg tactcttgg
3921935DNAArtificial SequencePrimer 219gcgagatctg ggaaatgccg
accaattgcg ctgcg 3522035DNAArtificial SequencePrimer 220agaggatcct
tagctctgct gctctggccc aagtc 3522132DNAArtificial SequencePrimer
221agagaattca tgccgaagtc gtgcgcggcc cg 3222232DNAArtificial
SequencePrimer 222gcggaattca tgccgcgtca ctgctccgcc gc
3222334DNAArtificial SequencePrimer 223gcgggatcct caggccatgc
tgctgctcag ctgc 3422438DNAArtificial SequencePrimer 224gcgagatctc
gatggtgaaa tgctgctccg ccattgga 3822539DNAArtificial SequencePrimer
225gcgggatcct catgaaatat agtcctgttc tatgctctc 3922635DNAArtificial
SequencePrimer 226gcgagatctc gatgcccaag tactgcaggg cgccg
3522737DNAArtificial SequencePrimer 227gcggaattct tatgcactgg
ggatccgagt gtccagg 3722832DNAArtificial SequencePrimer
228gcggaattca tgccggcccg ttgtgtggcc gc 3222939DNAArtificial
SequencePrimer 229gcgggatcct taacatgttt cttctttcac ctgtacagc
3923036DNAArtificial SequencePrimer 230gcgagatctc gatgcctggc
tttacgtgct gcgtgc 3623136DNAArtificial SequencePrimer 231gcggaattct
cacattccgt gcttcttgcg gatgac 3623233DNAArtificial SequencePrimer
232ccgaattcag gatggtgcag tcctgctccg cct 3323339DNAArtificial
SequencePrimer 233cgcggatcct gctggtactt caactatttc aaagtagtc
3923437DNAArtificial SequencePrimer 234gcgctctaga gccatcatgg
aggagcagaa gctgatc 3723541DNAArtificial SequencePrimer
235gcgctctaga ttatgctggt acttcaacta tttcaaagta g
4123633DNAArtificial SequencePrimer 236cgcggatccg tgcagtcctg
ctccgcctac ggc 3323739DNAArtificial SequencePrimer 237cgcggatcct
gctggtactt caactatttc aaagtagtc 3923837DNAArtificial SequencePrimer
238gccggatccg ggttccctag atataacagg gatgcaa 3723935DNAArtificial
SequencePrimer 239gcgggatccc tctacctggt cagctgaccc acaac
3524035DNAArtificial SequencePrimer 240gcgggatcca gtgatggagg
ggctcaggac tgttg 3524135DNAArtificial SequencePrimer 241gcgggatccc
tatggccctt taggggtctg tgacc 3524233DNAArtificial SequencePrimer
242gcgcatatgg tgcagtcctg ctccgcctac ggc 3324336DNAArtificial
SequencePrimer 243gcgctcgagt ttcttgtcat gtggctcagt acaaag
3624462DNAArtificial SequenceOligonucleotide 244tgggcactat
ttatatcaac nnnnnnnnnn nnnnnnnnnn nnnnnaatgt cgttggtggc 60cc
6224530DNAArtificial SequencePrimer 245accgcaagct tgggcactat
ttatatcaac 3024624DNAArtificial SequencePrimer 246ggtctagagg
gccaccaacg catt 242472173DNAHomo sapiens 247gacgggcgat ggctgtggtc
cttctgctaa tgcaaacaac aaaacgggca cactagtcac 60ccccgaggga ggccaccatc
actgtaactg ttggccaaag ctacaaaaga agcgagggaa 120tccaaccgag
cgcagcgaca ctgagaacag cttcccctgc cttctgcggc ggcagaagtg
180aagtgcctga ggaccggaag gatggtgcag tcctgctccg cctacggctg
caagaaccgc 240tacgacaagg acaagcccgt ttctttccac aagtttcctc
ttactcgacc cagtctttgt 300aaagaatggg aggcagctgt cagaagaaaa
aactttaaac ccaccaagta tagcagtatt 360tgttcagagc actttactcc
agactgcttt aagagagagt gcaacaacaa gttactgaaa 420gagaatgctg
tgcccacaat atttctttgt actgagccac atgacaagaa agaagatctt
480ctggagccac aggaacagct tcccccacct cctttaccgc ctcctgtttc
ccaggttgat 540gctgctattg gattactaat gccgcctctt cagacccctg
ttaatctctc agttttctgt 600gaccacaact atactgtgga ggatacaatg
caccagcgga aaaggattca tcagctagaa 660cagcaagttg aaaaactcag
aaagaagctc aagaccgcac agcagcgatg cagaaggcaa 720gaacggcagc
ttgaaaaatt aaaggaggtt gttcacttcc agaaagagaa agacgacgta
780tcagaaagag
gttatgtgat tctaccaaat gactactttg aaatagttga agtaccagca
840taaaaaaatg aaatgtgtat tgatttctaa tggggcaata ccacatatcc
tcctctagcc 900tgtaaaggag tttcatttaa aaaaataaca tttgattact
tatataaaaa cagttcagaa 960tattttttta aaaaaaattc tatatatact
gtaaaattat aaattttttt gtttgtaatt 1020tcaggttttt tacattttaa
caaaatattt taaaagttat aaactaacct cagacctcta 1080atgtaagttg
gtttcaagat tggggatttt ggggtttttt ttttagtatt tatagaaata
1140atgtaaaaat aaaaagtaaa gagaatgaga acagtgtggt aaaagggtga
tttcagttta 1200aaacttaaaa ttagtactgt tttattgaga gaatttagtt
atattttaaa tcagaagtat 1260gggtcagatc atgggacata acttcttaga
atatatatat acatatgtac atattctcat 1320atgtaaagtc acaaggttca
tttatctttc tgaatcagtt atcaaagata aattggcaag 1380tcagtactta
agaaaaaaga tttgattatc atcacagcag aaaaaagtca ttgcatatct
1440gatcaataac ttcagattct aagagtggat tttttttttt tacatgggct
cctatttttt 1500cccctactgt cttgcattat aaaattagaa gtgtattttc
agtggaagaa acatttttca 1560ataaataaag taaggcattg tcatcaatga
agtaattaaa actgggacct gatctatgat 1620acgctttttt ctttcattac
accctagctg aaggacatcc cagttcccca gctgtagtta 1680tgtatctgcc
ttcaagtctc tgacaaatgt gctgtgttag tagagtttga tttgtatcat
1740atgataatct tgcacttgac tgagttggga caaggcttca cataaaaaat
tatttcttca 1800cttttaacac aagttagaaa ttatatccca tttagttaaa
tgcgtgattt atattcagaa 1860caacctacta tgtagcgttt attttactga
atgtggagat ttaaacactg aggtttctgt 1920tcaaactgtg agttctgttc
tttgtgagaa attttacata tattggaagt gaaaatatgt 1980tctgagtaaa
caaatattgc tatgggagtt atctttttag atttagaata actgttccaa
2040tgataattat tacttttata tttcaaagta cactaagatc gttgaagagc
aatagaacct 2100ttaagacagt attaaaggtg tgaaacaaaa aaaaaaaaaa
taaaaaaaaa aaaaaaaaaa 2160aaaaaaaaaa aaa 21732481302DNAHomo sapiens
248aattgctctg aggaccgctg ccaaagaaac gcagtagatc cgctccctct
tgggggcggg 60gagaaagaac gggttgtgtc cgccatgttg gtgaagtcaa gcgaaggcga
ctagagctcc 120aggagggcca gttctgtggg ctctagtcgg ccatattaat
aaagagaaag ggaaggctga 180ccgtccttcg cctccgcccc cacatacaca
ccccttcttc ccactccgct ctcacgacta 240agctctcacg attaaggcac
gcctgcctcg attgtccagc ctctgccaga agaaagctta 300gcagccagcg
cctcagtaga gacctaaggg cgctgaatga gtgggaaagg gaaatgccga
360ccaattgcgc tgcggcgggc tgtgccacta cctacaacaa gcacattaac
atcagcttcc 420acaggtttcc tttggatcct aaaagaagaa aagaatgggt
tcgcctggtt aggcgcaaaa 480attttgtgcc aggaaaacac acttttcttt
gttcaaagca ctttgaagcc tcctgttttg 540acctaacagg acaaactcga
cgacttaaaa tggatgctgt tccaaccatt tttgattttt 600gtacccatat
aaagtctatg aaactcaagt caaggaatct tttgaagaaa aacaacagtt
660gttctccagc tggaccatct aatttaaaat caaacattag tagtcagcaa
gtactacttg 720aacacagcta tgcctttagg aatcctatgg aggcaaaaaa
gaggatcatt aaactggaaa 780aagaaatagc aagcttaaga agaaaaatga
aaacttgcct acaaaaggaa cgcagagcaa 840ctcgaagatg gatcaaagcc
acgtgtttgg taaagaattt agaagcaaat agtgtattac 900ctaaaggtac
atcagaacac atgttaccaa ctgccttaag cagtcttcct ttggaagatt
960ttaagatcct tgaacaagat caacaagata aaacactgct aagtctaaat
ctaaaacaga 1020ccaagagtac cttcatttaa atttagcttg cacagagctt
gatgcctatc cttcattctt 1080ttcagaagta aagataatta tggcacttat
gccaaaattc attatttaat aaagttttac 1140ttgaagtaac attactgaat
ttgtgaagac ttgattacaa aagaataaaa aacttcatat 1200ggaaatttta
tttgaaaatg agtggaagtg ccttacatta gaattacgga cttaaaaatt
1260ttgctaataa attgtgtatt tgaaaaaaaa aaaaaaaaaa aa
13022491995DNAHomo sapiens 249ccagtgacgt cagaggagtc cagacctatt
cacaattcaa agccctaaaa acactgaggg 60gttggccgtt ggtttccagt tgtccaagcc
tgtgagtggc tatgcgtcct ggttgggtgc 120tcaaagcaag gaggtgaaag
gcgaccagca ttggcgaatg gggtaagact tgcacaggcc 180caaggctagg
agttggggtt tcgggcctga attggggccc ggagcacccc tttacgtggc
240gccccgggtc ccgtccgacc ctggggagac gcgggtggct gggatggcag
gatgagcgcg 300ccctggaggc gagccaggcc cgtcaccacc tcccagcggc
cccgcccctc cccgcaggtc 360cctcccctct ccgcaggccc cgccgccgcc
gccatctttg ttgggggcag ccaggcctgg 420ctcgagatgc cgaagtcgtg
cgcggcccgg cagtgctgca accgctacag cagccgcagg 480aagcagctca
ccttccaccg gtttccgttc agccgcccgg agctgctgaa ggaatgggtg
540ctgaacatcg gccggggcaa cttcaagccc aagcagcaca cggtcatctg
ctccgagcac 600ttccggccag agtgcttcag cgcctttgga aaccgcaaga
acctaaagca caatgccgtg 660cccacggtgt tcgcctttca ggaccccaca
cagcaggtga gggagaacac agaccctgcc 720agtgagagag gaaatgccag
ctcttctcag aaagaaaagg tcctccctga ggcgggggcc 780ggagaggaca
gtcctgggag aaacatggac actgcacttg aagagcttca gttgccccca
840aatgccgaag gccacgtaaa acaggtctcg ccacggaggc cgcaagcaac
agaggctgtt 900ggccggccga ctggccctgc aggcctgaga aggaccccca
acaagcagcc atctgatcac 960agctatgccc ttttggactt agattccctg
aagaaaaaac tcttcctcac tctgaaggaa 1020aatgaaaagc tccggaagcg
cttgcaggcc cagaggctgg tgatgcgaag gatgtccagc 1080cgcctccgtg
cttgcaaagg gcaccaggga ctccaggcca gacttgggcc agagcagcag
1140agctgagccc cacaggctcc ggacgcagag gtggcagtgg caccagggcc
ggcagagctt 1200tggagctctg gctgtggaca tttttgtctg ctgtggacac
tgagaaagtt ggccatgagg 1260cctgcttggc cggggatcga gacagtagcc
aagctccccg gcgagagccc caatgccgtc 1320tgggggacgt ttagaggcgt
ggcactagga gtgcacatct gtgagcatga caagcttatc 1380ctcccatggt
aacagaagtc caggctgagg ctgattctgg acgctgccct ttcagcacac
1440gcagagcaaa gatcgttgga agccccagtg tgggagatgc tcctcaggga
ggaagccatg 1500tgagggggct ggctctgtgg cgggtgagtg gtcccctcct
ccatcagcct ggacagccgc 1560tcggggttct aaggagtgac tcctgtcccg
gcctggtgtg agtgggcagt gtaataaagt 1620gtctttctat acggtgtcgc
tcccatcatc attttctcta gtgccgtgat tccttctaag 1680aagactgact
tccgtggccg ggcgcagtgg ctcatgcctg taatcccagc actttgagag
1740gccgaggtgg ggagatcact tgaggtcagg agttcaagac cagcctggcc
aacatggtga 1800aatcccatgt ctactaaaaa agacacaaat tagccaggcg
tggtggcaca cacctgtagt 1860cccagctacc tgggaggctg agacaggagg
atcagctgaa cccgggaggt ggaggttgca 1920gtgagccgag atcacaccac
tgccctctag tattgtcact gggtgacaga gcgagactca 1980gtctgaaaaa aaaaa
19952501999DNAHomo sapiens 250gggctagggc cggggcctgg ctgcgcggct
gggccaaggc ccgcgatggt gatctgctgt 60gcggccgtga actgctccaa ccggcaggga
aagggcgaga agcgcgccgt ctccttccac 120aggttccccc taaaggactc
aaaacgtcta atccaatggt taaaagctgt tcagagggat 180aactggactc
ccactaagta ttcatttctc tgtagtgagc atttcaccaa agacagcttc
240tccaagaggc tggaggacca gcatcgcctg ctgaagccca cggccgtgcc
atccatcttc 300cacctgaccg agaagaagag gggggctgga ggccatggcc
gcacccggag aaaagatgcc 360agcaaggcca cagggggtgt gaggggacac
tcgagtgccg ccaccggcag aggagctgca 420ggttggtcac cgtcctcgag
tggaaacccg atggccaagc cagagtcccg caggttgaag 480caagctgctc
tgcaaggtga agccacaccc agggcggccc aggaggccgc cagccaggag
540caggcccagc aagctctgga acggactcca ggagatggac tggccaccat
ggtggcaggc 600agtcagggaa aagcagaagc gtctgccaca gatgctggcg
atgagagcgc cacttcctcc 660atcgaagggg gcgtgacaga taagagtggc
atttctatgg atgactttac gcccccagga 720tctggggcgt gcaaatttat
cggctcactt cattcgtaca gtttctcctc taagcacacc 780cgagaaaggc
catctgtccc ccgagagccc attgaccgca agaggctgaa gaaagatgtg
840gaaccaagct gcagtgggag cagcctggga cccgacaagg gcctggccca
gagccctccc 900agctcatcac ttaccgcgac accgcagaag ccttcccaga
gcccctctgc ccctcctgcc 960gacgtcaccc caaagccagc cacggaagcc
gtgcagagcg agcacagcga cgccagcccc 1020atgtccatca acgaggtcat
cctgtcggcg tcaggggcct gcaagctcat cgactcactg 1080cactcctact
gcttctcctc ccggcagaac aagagccagg tgtgctgcct gcgggagcag
1140gtggagaaga agaacggcga gctgaagagc ctgcggcaga gggtcagccg
ctccgacagc 1200caggtgcgga agctacagga gaagctggat gagctgagga
gagtgagcgt cccctatcca 1260agtagcctgc tgtcgcccag ccgcgagccc
cccaagatga acccagtggt ggagccactg 1320tcctggatgc tgggcacctg
gctgtcggac ccacctggag ccgggaccta ccccacactg 1380cagcccttcc
agtacctgga ggaggttcac atctcccacg tgggccagcc catgctgaac
1440ttctcgttca actccttcca cccggacacg cgcaagccga tgcacagaga
gtgtggcttc 1500attcgcctca agcccgacac caacaaggtg gcctttgtca
gcgcccagaa cacaggcgtg 1560gtggaagtgg aggagggcga ggtgaacggg
caggagctgt gcatcgcatc ccactccatc 1620gccaggatct ccttcgccaa
ggagccccac gtagagcaga tcacccggaa gttcaggctg 1680aattctgaag
gcaaacttga gcagacggtc tccatggcaa ccacgacaca gccaatgact
1740cagcatcttc acgtcaccta caagaaggtg accccgtaaa cctagagctt
ctggagccct 1800cgggagggcc tggctactgt gcctcaacgg ttcggctcct
caacagacag tccctgcggc 1860aaaagtgggt gtggccgtga gcctctgcag
gctcaagagt gttgtccaga tgtttctgta 1920ctggcataga aaaaccaaat
aaaaggcctt tatttttatg gctgaggatt ttgaatatta 1980aaaaaaaaaa
aaaaaaaaa 19992511398DNAHomo sapiens 251ggctgtgcgc cacttccggc
ttcaaccccc gaaaaggcgg tgcttaaacc ggaggaggcg 60gaagtgagtc gacagacgag
gcggctttcc cggcagaatg ctagcgcagg cgcaggggct 120cgagaggcct
ggacctgtgg cgcatcctca gtgaggaggg ccgccctgca tccgtcgccg
180gccccggtct ccaggggcct cacccgagtc atgccccgct attgcgcagc
gatttgttgt 240aagaaccgcc ggggacgaaa caataaagac cggaagctga
gtttttatcc atttcctcta 300catgacaaag aaagactgga aaagtggtta
aagaatatga agcgagattc atgggttccc 360agtaaatacc agtttctatg
tagtgaccat tttactcctg actctcttga catcagatgg 420ggtattcgat
atttaaaaca aactgcagtt ccaacaatat tttctttgcc tgaagacaat
480cagggaaaag acccttctaa aaaaaaatcc cagaagaaaa acttggaaga
tgagaaagaa 540gtatgcccaa aagccaagtc agaagaatca tttgtattaa
atgagacaaa gaaaaatata 600gttaacacag atgtgcccca tcaacatcca
gaattacttc attcatcttc cttggtaaag 660ccaccagctc ccaaaacagg
aagtatacaa aataacatgt taactcttaa tctagttaaa 720caacatactg
ggaaaccaga atctaccttg gaaacatcag ttaaccaaga tacaggtaga
780ggtggttttc acacatgttt tgagaatcta aattctacaa ctattacttt
gacaacttca 840aattcagaaa gtattcatca atctttggaa actcaagaag
ttcttgaagt aactaccagt 900catcttgcta atccaaactt tacaagtaat
tccatggaaa taaagtcagc acaggaaaat 960ccattcttat tcagcacaat
taatcaaaca gttgaagaat taaacacaaa taaagaatct 1020gttattgcca
tttttgtacc tgctgaaaat tctaaaccct cagttaattc ttttatatct
1080gcacaaaaag aaaccacgga aatggaagac acagacattg aagactcctt
gtataaggat 1140gtagactatg ggacagaagt tttacaaatc gaacattctt
actgcagaca agatataaat 1200aaggaacatc tttggcagaa agtctctaag
ctacattcaa agataactct tctagagtta 1260aaagagcaac aaactctagg
tagattgaag tctttggaag ctcttataag gcagctaaag 1320caggaaaact
ggctatctga agaaaacgtc aagattatag aaaaccattt tacaacatat
1380gaagtcacta tgatatag 13982522291DNAHomo sapiens 252agcgaaggca
gacgcagtct ccatcgttga cgttagtcgc agtcttcgct gctaacgttt 60tgttatgagt
tgctaaaatg gtgaaatgct gctccgccat tggatgtgct tctcgctgct
120tgccaaattc gaagttaaaa ggactgacat ttcacgtatt ccccacagat
gaaaacatca 180aaaggaaatg ggtattagca atgaaaagac ttgatgtgaa
tgcagccggc atttgggagc 240ctaaaaaagg agatgtgttg tgttcgaggc
actttaagaa gacagatttt gacagaagtg 300ctccaaatat taaactgaaa
cctggagtca taccttctat ctttgattct ccatatcacc 360tacaggggaa
aagagaaaaa cttcattgta gaaaaaactt caccctcaaa accgttccag
420ccactaacta caatcaccat cttgttggtg cttcctcatg tattgaagaa
ttccaatccc 480agttcatttt tgaacatagc tacagtgtaa tggacagtcc
aaagaaactt aagcataaat 540tagatcatgt gatcggcgag ctagaggata
caaaggaaag tctacggaat gttttagacc 600gagaaaaacg ttttcagaaa
tcattgagga agacaatcag ggaattaaag gatgaatgtc 660tgatcagcca
agaaacagca aatagactgg acactttctg ttgggactgt tgtcaggaga
720gcatagaaca ggactatatt tcatgaaata atttcatgtt acgttccacc
taaaattgtc 780attggtacaa atttttataa aatctcattt accatcacta
aataatatcc atcatttaaa 840gtgctgcttt ggattctctg gagcattatg
cattatagtt gttatccaaa gacttttttg 900aaaatatgca gaaatttgtg
gtaattatgt atttgtgtct tgtgacaatt atgttttata 960gacctacact
agtgccaggt cactattgta agatgttaaa atctcaagaa aatttcacag
1020agctaaagaa atgatgtcaa attagtcaca ttaagctata gtagaaggaa
ttggacactt 1080ctccagatat ttggcttcaa aggagtacct ttacttacat
gtgctttatg gtaagtacat 1140tgaattttac tttaaatgca ttttactaca
aagcacaatt catttgtaat gcatatccat 1200cttggattca atccaaggtg
ctttagctat cagtagtacc aaaggatctt tttacaaggc 1260ttcctgtggt
attgactctg agaataacac atagtgaaga tctgtgggct tttaaaattg
1320ttcacagcca atttaagaag acccctcatg aagtctcagt tttcagtaca
gtacatcatt 1380cctcctcact aggagcactt tgatgtaaac cagaatagct
ttaaaaagac aaaaaggatc 1440gtagatctga tttttaaatg gttggttgct
ctgacagatc tgaacacttt gcttcatgac 1500tatttcgtca taaaggtata
tgtttaaaat ctgaatggca gtactagctc tatactttta 1560atactgcttt
gtattttata tgtaaagtag tattgctgac attttaaaaa aatacaaaat
1620acaaaagaaa ccattagaaa ttaataactg tggctcttcc agttgaaata
ggaattggag 1680agaaaggatt agaatatttt aattagggga gtagattatt
gtccaaaggc ttttatttag 1740agaaacgggt aattaaaaca gcagctttag
aatagcttct tactgaatat gcaaaagaat 1800aattccttgt tatttcctaa
ttgatccaag tctcataaat ttagcttttg tcataattcc 1860ttaccgaaaa
caactgaaat tgagagtcat aaatactgtg ggttagaata aaaaccattt
1920gccaaagcaa cactctactt agaagcacat gtacatacat ggacctcatt
cagaagtcca 1980tgttgtagca gttagaattt gagtatcagc catttcattg
tagtaacaaa aattgaattg 2040cattttgtgc tcagttgttt attgtaattt
tatttttgtt acattaatat tagttaagat 2100atggtcactt gaattttttg
tatttaagaa ttttctgttt taatgcatgt tatactttta 2160tgtaggattc
ccaaccttcc ctctaaatgg gatttaaccc acatctgcga gatcagcgtt
2220atgctaagag gaaatcactg aggccatatc tttttacaat ctgaaaaaaa
agtagtaaaa 2280aggtagttaa a 22912531242DNAHomo sapiens
253cgtgagtgcc gctgacagaa gtcaagagaa tcggctggga cggggttggg
gcgacaacgg 60gccggggggg acccgacagg ccagagcccc ttggggagga gcggcggctg
gaggcgcgag 120gctcctccgg atgcccggag agccgcttgc gacttaactc
ccgcctcttt cccagatgcc 180gcgtcactgc tccgccgccg gctgctgcac
acgggacacg cgcgagacgc gcaaccgcgg 240catctccttc cacagacttc
ccaagaagga caacccgagg cgaggcttgt ggctggccaa 300ctgccagcgg
ctggacccca gcggccaggg cctgtgggac ccggcatccg agtacatcta
360cttctgctcc aaacactttg aggaggactg ctttgagctg gtgggaatca
gtggatatca 420caggctaaag gagggggcag tccccaccat atttgagtct
ttctccaagt tgcgccggac 480aaccaagacc aaaggacaca gttacccacc
tggcccccct gaagtcagcc ggctcagacg 540atgcaggaag cgctgctccg
agggccgagg gcccacaact ccattttctc cacctccacc 600tgctgatgtc
acctgctttc ctgtggaaga ggcctcagca cctgccactt tgccggcctc
660cccagctggg aggctggagc ctggccttag cagccccttt tcagacctac
tgggcccctt 720gggtgcccag gcagatgaag caggctgcag cgcccagcct
tcaccagagc ggcagccctc 780ccctctcgaa ccacggccag tctccccctc
agcgtatatg ctgcgcctgc ccccacccgc 840cggagcctac atccagaatg
aacacagcta ccaggtgggc agcgccttac tctggaagcg 900gcgagccgag
gcagcccttg atgcccttga caaggcccag cgccagctgc aggcctgcaa
960gcggcgggag cagcggctgc ggttgagact gaccaagctg cagcaggagc
gggcacggga 1020gaagcgggca caggcagatg cccgccagac tctgaaggag
catgtgcagg actttgccat 1080gcagctgagc agcagcatgg cctgaggggc
tgctggactg accgaggggc tgcccagcaa 1140gactgcagcc tcttcctccc
tcagatccca ccagacccac caggtgccat aataaagcgg 1200attctagacg
gagaaaaaaa aaaaaaaaaa aaaaaaaaaa aa 12422541383DNAHomo sapiens
254agcgggggtc ggggttaggc ggcgctccgc gagaaccaaa gtgcagccgc
tgacccggca 60aaactcagcg ggggctggat agccatgccc aagtactgca gggcgccgaa
ctgctccaac 120actgcgggcc gcctgggtgc agacaaccgc cctgtgagct
tctacaagtt cccactgaag 180gatggtcccc ggctgcaggc ctggctgcag
cacatgggct gtgagcactg ggtgcccagc 240tgccaccagc acttgtgcag
cgagcacttc acaccctcct gcttccagtg gcgctggggt 300gtgcgctacc
tgcggcctga tgcagtgccc tccatcttct cccggggacc acctgccaag
360agtcagcgga ggacccgaag cacccagaag ccagtctcgc cgccgcctcc
cctacagaag 420aatacacccc tgccccagag ccctgccatc ccagtctctg
gcccagtgcg cctagtggtg 480ctgggcccca catcggggag ccccaagact
gtggccacca tgctcctgac ccccctggcc 540cctgcgccaa ctcctgagcg
gtcacaacct gaagtccctg cccaacaggc ccagaccggg 600ctgggcccag
tgctgggagc actgcaacgc cgggtgcgga ggctgcaacg gtgccaggag
660cggcaccagg cgcagctgca ggccctggaa cggctggcac agcagctaca
cggggagagc 720ctgctggcac gggcacgccg gggtctgcag cgcctgacaa
cagcccagac ccttggacct 780gaggaatccc aaaccttcac catcatctgt
ggagggcctg acatagccat ggtccttgcc 840caggaccctg cacctgccac
agtggatgcc aagccggagc tcctggacac tcggatcccc 900agtgcataag
gatcaagaca gacaatgtcg agggacaaaa gatagaagat ggaggaggaa
960agacattata cgtgggcttg gcccagcccc accgcccacg cctgggtagt
agcagtgcct 1020ccctcaaggg cctgggttct accaccccac tcctagggat
ctcttgaacc ttaggggtga 1080cctgggccca agtctctcat cagcccccaa
tcccctgggt accaggcttc tgccaccccc 1140ggctcagatc tttgcaaatc
agtacgacag cctcagagca gagcaagggt tgtttgggag 1200aatcatacct
ggttctaagg agtcccacgc tttttgccaa gcctggtact gagttcatga
1260taccatggtg gacacagctg agaaaatccc tgccctcatg gtgctcattc
tacttgagta 1320gacgatgaac tagtaaacaa ataaacaaga acactgcaga
catgaaaaaa aaaaaaaaaa 1380aaa 13832553627DNAHomo sapiens
255attcatgctg tcgcgggaac cccgaaggtg gggccccacg taacaagaag
atgacccgaa 60gttgctccgc agtgggctgc agcacccgtg acaccgtgct cagccgggag
cgcggcctct 120ccttccacca atttccaact gataccatac agcgctcaaa
atggatcagg gctgttaatc 180gtgtggaccc cagaagcaaa aagatttgga
ttccaggacc aggtgctata ctgtgttcca 240aacattttca agaaagtgac
tttgagtcat atggcataag aagaaagctg aaaaaaggag 300ctgtgccttc
tgtttctcta tacaagattc ctcaaggtgt acatcttaaa ggtaaagcaa
360gacaaaaaat cctaaaacaa cctcttccag acaattctca agaagttgct
actgaggacc 420ataactatag tttaaagaca cctttgacga taggtgcaga
gaaactggct gaggtgcaac 480aaatgttaca agtgtccaaa aaaagactta
tctccgtaaa gaactacagg atgatcaaga 540agagaaaggg tttacgatta
attgatgcac ttgtagaaga gaaactactt tctgaagaaa 600cagagtgtct
gctacgagct caattttcag attttaagtg ggagttatat aattggagag
660aaacagatga gtactccgca gaaatgaaac aatttgcatg tacactctac
ttgtgcagta 720gcaaagtcta tgattatgta agaaagattc ttaagctgcc
tcattcttcc atcctcagaa 780cgtggttatc caaatgccaa cccagtccag
gtttcaacag caacattttt tcttttcttc 840aacgaagagt agagaatgga
gatcagctct atcaatactg ttcattgtta ataaaaagta 900tacctctcaa
gcaacagctt cagtgggatc ctagcagtca cagtttgcag gggtttatgg
960actttggtct tggaaaactt gatgctgatg aaacgccact tgcttcagaa
actgttttgt 1020taatggcagt gggtattttt ggccattgga gaacacctct
tggttatttt tttgtaaaca 1080gagcatctgg atatttgcag gctcagctgc
ttcgtctgac tattggtaaa ctgagtgaca 1140taggaatcac agttctggct
gttacatctg atgccacagc acatagtgtt cagatggcaa 1200aagcattggg
gatacatatt gatggagacg acatgaaatg tacatttcag catccttcat
1260cttctagtca acagattgca tacttctttg actcttgcca cttgctaaga
ttaataagaa 1320atgcatttca gaattttcaa agcattcagt ttattaatgg
tatagcacat tggcagcacc 1380tcgtggagtt agtagcactg gaggaacagg
aattatcaaa tatggaaaga ataccaagta 1440cacttgcaaa tttgaaaaat
catgtactga aagtgaatag tgccacccaa ctctttagtg 1500agagtgtagc
cagtgcatta gaatatttgt tatccttaga cctgccacct
tttcaaaact 1560gtattggtac catccatttt ttacgtttaa ttaacaatct
gtttgacatc tttaatagta 1620ggaactgtta tggaaaggga cttaaagggc
ctctgttgcc tgaaacttac agtaaaataa 1680accacgtgtt aattgaagcc
aagactattt ttgttacatt atctgacact agcaataatc 1740aaataattaa
aggtaagcaa aaactaggat tcctgggatt tttgctcaat gctgagagct
1800taaaatggct ctaccaaaat tatgttttcc caaaggtcat gccttttcct
tatcttctga 1860cttacaaatt cagtcatgat catctggaat tatttctaaa
gatgcttagg caggtattag 1920taacaagttc tagccctacc tgcatggcat
tccagaaagc ttactataat ttggagacca 1980gatacaaatt tcaagatgaa
gtttttctaa gcaaagtaag catctttgac atttcaattg 2040ctcgaaggaa
agacttggcg ctttggacag ttcaacgtca gtatggtgtc agcgttacaa
2100agactgtctt tcacgaagag ggtatttgtc aagactggtc tcattgttca
ctaagtgagg 2160cattactaga cctgtcagat cataggcgaa atctcatctg
ttatgctggt tatgttgcaa 2220acaagttatc agctctttta acttgtgagg
actgcatcac tgcactgtat gcatcggatc 2280tcaaagcctc taaaattggg
tcactattat ttgttaaaaa gaagaatggt ttgcattttc 2340cttcagaaag
tctgtgtcgg gtcataaata tttgtgagcg agttgtaaga acccattcaa
2400gaatggcaat ttttgaacta gtttctaaac aaagggaatt gtatcttcaa
cagaaaatat 2460tatgtgagct ttctgggcat attgatcttt ttgtagatgt
gaataagcat ctctttgatg 2520gagaagtgtg tgccatcaat cactttgtca
agttgctaaa ggatataata atctgtttct 2580taaatatcag agctaaaaat
gttgcacaga atcctttaaa acatcattca gagagaactg 2640atatgaaaac
tttatcaagg aaacactggt cacctgtaca ggattataaa tgttcaagtt
2700ttgctaatac cagtagtaaa ttcaggcatt tgctaagtaa cgatggatat
ccattcaaat 2760gagagaccta aaatatatta acattttaat taagaatact
tgatcaacat tttttgaagt 2820tcaatttacc atattttata aattgcgcat
tctgcacagt ggacaagttt gcaattctga 2880cttattaaaa tttcaaattc
tgcatatcac aaaatctcct tatacttttg gtatggcttg 2940cagcatttat
gagttttcca aaatatagaa agcagtaggt cagtaggagc aaactagcca
3000acaggtactg tctttgaatt tactactgta agactaagca gtgttactgg
acacagtttt 3060aacttgttca atctgcttca aaaacaagaa aaacaacaac
tatgagttat caaaatattg 3120actccattta tgactagact acatttctga
aagatctttg gtttacgatt cttaagaata 3180ttgacaatac ctataaaact
ttgaagataa cttttactta aatatgaaaa ttatagtttg 3240aaaattaggc
tcaagcaaat atcaaatact gcaaaaatcc ccttgtccca ggatacccta
3300aaatagaagt atattttgat gtttgtttat tctacctcaa acagaggctt
aagttttgaa 3360gtgtaaccag tttatacttc attttataca aaacttattg
ctgagaagtc tgaatattgt 3420gctttttgtt gtttgtaaat agaattgaat
ttaaatacac caggataaat cttatttaaa 3480ggaagcctgt ttgaaaatca
ccaactttaa cttattgctt atataaatcc aagctctgta 3540cctgatcttt
atgtaaagca agattcatat gtgtagtatc taatgccctt tggtgttaca
3600tttgactaaa atacaaatgt ctgtatt 3627256771DNAHomo sapiens
256atgccggccc gttgtgtggc cgcccactgc ggcaacacca ccaagtctgg
gaagtcgctg 60ttccgctttc ccaaggaccg ggccgtgcgg ctgctctggg accgcttcgt
gcggggttgc 120cgcgccgact ggtacggagg caatgaccgc tcggtcatct
gctctgacca ctttgcccca 180gcctgttttg acgtctcttc ggttatccag
aagaacctgc gcttctccca gcgcctgagg 240ctggtggcag gcgccgtgcc
caccctgcac cgggtgcccg ccccggcacc taagagggga 300gaggagggag
accaagcagg ccgcctggac acgcgaggag agctccaggc agccaggcat
360tctgaggctg ccccaggtcc agtctcctgt acacgccccc gagctgggaa
gcaggctgca 420gcttcacaga ttacgtgtga aaatgaactt gtgcaaaccc
aaccccatgc tgataatcca 480tctaatactg tcacttcagt acctactcac
tgtgaagaag gcccagtgca taaaagtaca 540caaatttctt tgaaaaggcc
ccgtcaccgt agtgtgggta ttcaagccaa agtgaaagcg 600tttggaaaaa
gactgtgtaa tgcaactact cagacagagg aattgtggtc tagaacttcc
660tctctctttg acatttactc cagtgattca gaaacagata cagactggga
tatcaagagt 720gaacagagtg atttgtctta tatggctgta caggtgaaag
aagaaacatg t 771257942DNAHomo sapiens 257atgcctggct ttacgtgctg
cgtgccaggc tgctacaaca actcgcaccg ggacaaggcg 60ctgcacttct acacgtttcc
aaaggacgct gagttgcggc gcctctggct caagaacgtg 120tcgcgtgccg
gcgtcagtgg gtgcttctcc accttccagc ccaccacagg ccaccgtctc
180tgcagcgttc acttccaggg cggccgcaag acctacacgg tacgcgtccc
caccatcttc 240ccgctgcgcg gcgtcaatga gcgcaaagta gcgcgcagac
ccgctggggc cgcggccgcc 300cgccgcaggc agcagcagca acagcagcag
cagcagcaac agcagcaaca gcagcagcag 360cagcaacagc agcagcagca
gcagcagcag cagcagtcct caccctctgc ctccactgcc 420cagactgccc
agctgcagcc gaacctggta tctgcttccg cggccgtgct tctcaccctt
480caggccactg tagacagcag tcaggctccg ggatccgtac agccggcgcc
catcactccc 540actggagaag acgtgaagcc catcgatctc acagtgcaag
tggagtttgc agccgcagag 600ggcgcagccg ctgcggccgc cgcgtcggag
ttacaggctg ctaccgcagg gctggaggct 660gccgagtgcc ctatgggccc
ccagttggtg gtggtagggg aagagggctt ccctgatact 720ggctccgacc
attcgtactc cttgtcgtca ggcaccacgg aggaggagct cctgcgcaag
780ctgaatgagc agcgggacat cctggctctg atggaagtga agatgaaaga
gatgaaaggc 840agcattcgcc acctgcgtct cactgaggcc aagctgcgcg
aagaactgcg tgagaaggat 900cggctgcttg ccatggctgt catccgcaag
aagcacggaa tg 9422582283DNAHomo sapiens 258atgccgaact tctgcgctgc
ccccaactgc acgcggaaga gcacgcagtc cgacttggcc 60ttcttcaggt tcccgcggga
ccctgccaga tgccagaagt gggtggagaa ctgtaggaga 120gcagacttag
aagataaaac acctgatcag ctaaataaac attatcgatt atgtgccaaa
180cattttgaga cctctatgat ctgtagaact agtccttata ggacagttct
tcgagataat 240gcaataccaa caatatttga tcttaccagt catttgaaca
acccacatag tagacacaga 300aaacgaataa aagaactgag tgaagatgaa
atcaggacac tgaaacagaa aaaaattgat 360gaaacttctg agcaggaaca
aaaacataaa gaaaccaaca atagcaatgc tcagaacccc 420agcgaagaag
agggtgaagg gcaagatgag gacattttac ctctaaccct tgaagagaag
480gaaaacaaag aatacctaaa atctctattt gaaatcttga ttctgatggg
aaagcaaaac 540atacctctgg atggacatga ggctgatgaa atcccagaag
gtctctttac tccagataac 600tttcaggcac tgctggagtg tcggataaat
tctggtgaag aggttctgag aaagcggttt 660gagacaacag cagttaacac
gttgttttgt tcaaaaacac agcagaggca gatgctagag 720atctgtgaga
gctgtattcg agaagaaact ctcagggaag tgagagactc acacttcttt
780tccattatca ctgacgatgt agtggacata gcaggggaag agcacctacc
tgtgttggtg 840aggtttgttg atgaatctca taacctaaga gaggaattta
taggcttcct gccttatgaa 900gccgatgcag aaattttggc tgtgaaattt
cacactatga taactgagaa gtggggatta 960aatatggagt attgtcgtgg
ccaggcttac attgtctcta gtggattttc ttccaaaatg 1020aaagttgttg
cttctagact tttagagaaa tatccccaag ctatctacac actctgctct
1080tcctgtgcct taaatatgtg gttggcaaaa tcagtacctg ttatgggagt
atctgttgca 1140ttaggaacaa ttgaggaagt ttgttctttt ttccatcgat
caccacaact gcttttagaa 1200cttgacaacg taatttctgt tctttttcag
aacagtaaag aaaggggtaa agaactgaag 1260gaaatctgcc attctcagtg
gacaggcagg catgatgctt ttgaaatttt agtggaactc 1320ctgcaagcac
ttgttttatg tttagatggt ataaatagtg acacaaatat tagatggaat
1380aactatatag ctggccgagc atttgtactc tgcagtgcag tgtcagattt
tgatttcatt 1440gttactattg ttgttcttaa aaatgtccta tcttttacaa
gagcctttgg gaaaaacctc 1500caggggcaaa cctctgatgt cttctttgcg
gccggtagct tgactgcagt actgcattca 1560ctcaacgaag tgatggaaaa
tattgaagtt tatcatgaat tttggtttga ggaagccaca 1620aatttggcaa
ccaaacttga tattcaaatg aaactccctg ggaaattccg cagagctcac
1680cagggtaact tggaatctca gctaacctct gagagttact ataaagaaac
cctaagtgtc 1740ccaacagtgg agcacattat tcaggaactt aaagatatat
tctcagaaca gcacctcaaa 1800gctcttaaat gcttatctct ggtaccctca
gtcatgggac aactcaaatt caatacgtcg 1860gaggaacacc atgctgacat
gtatagaagt gacttaccca atcctgacac gctgtcagct 1920gagcttcatt
gttggagaat caaatggaaa cacaggggga aagatataga gcttccgtcc
1980accatctatg aagccctcca cctgcctgac atcaagtttt ttcctaatgt
gtatgcattg 2040ctgaaggtcc tgtgtattct tcctgtgatg aaggttgaga
atgagcggta tgaaaatgga 2100cgaaagcgtc ttaaagcata tttgaggaac
actttgacag accaaaggtc aagtaacttg 2160gctttgctta acataaattt
tgatataaaa cacgacctgg atttaatggt ggacacatat 2220attaaactct
atacaagtaa gtcagagctt cctacagata attccgaaac tgtggaaaat 2280acc
2283259986DNAMus musculus 259cttctgctaa agcaaacccc acaacggaca
gggtagtcac tcgcccaccc caacccccac 60cccacggcga ggtgatcgtc cccgtaactg
ctgaccgacg ccaccgagag cggcgagcgt 120tatcaaggcc gagcgcggga
ccccgacggc ccccttcgcc tgcctcccgg gccgaaggag 180agtgtggagg
gccagaagga tggtgcagtc ctgctccgcc tacggctgca agaaccgcta
240cgacaaggac aagcccgtct ccttccacaa gtttcctctt actcgcccca
gcctttgtaa 300gcagtgggag gcagctgtta aaaggaaaaa cttcaagccc
accaagtaca gcagcatctg 360ctcggagcac ttcaccccgg actgctttaa
gagggagtgc aacaacaagc tactgaagga 420gaacgctgtg cccacaatat
ttctctatat cgagccacat gagaagaagg aagacctgga 480atcccaagaa
cagctcccct ctccttcacc ccccgcttcc caggttgatg ctgctattgg
540gctgctaatg ccccctctgc agacccctga taacctgtcg gttttctgtg
accacaatta 600cactgtggag gatacgatgc accagaggaa gaggatcctg
cagctggagc agcaggtgga 660gaaactcagg aagaagctca agacggccca
gcagcggtgc cggcggcagg agaggcagct 720cgagaagctc aaggaagtcg
tccactttca gagagagaag gacgacgcgt ccgagagggg 780ctacgtgatc
ctaccaaatg actactttga aattgttgaa gttccagcat gaaaaaatga
840gatgtgttag tgggacaaga ctatacacct tcttttagcc tacatacagg
agttcatttg 900aaaaaataac acttaattac ttgtattaaa aaaacaatat
ttttttaaaa taaattagat 960atatactgta aaaaaaaaaa aaaaaa
9862601515DNAMus musculus 260gctctgccct ccccgcgctc tgcaccgagc
tggcggcgcg gggtcgcctg cctcgtttgt 60ctagcgtttg acagaagctt gcttagcggg
cagcgcctcc gaagtggcgt aaggtggcgc 120cgaatgaggg gcccggggaa
atgccgacca attgcgccgc ggcgggctgt gctgctacct 180acaacaagca
cattaacatc agcttccaca ggtttccttt ggatcctaaa agaagaaaag
240aatgggttcg cctggttagg cgcaaaaatt ttgtgccagg aaaacacact
tttctttgct 300caaagcactt tgaagcctcc tgttttgatc taacaggaca
aacccgacga cttaaaatgg 360atgctgttcc aaccattttt gatttttgta
cccatataaa gtctctgaaa ctcaagtcaa 420ggaatcttct gaagacaaac
aacagttttc ctccaactgg accatgtaat ttaaagctga 480acggcagtca
gcaagtactg cttgaacaca gttatgcctt taggaaccct atggaggcga
540aaaaaaggat aattaaacta gaaaaggaaa tagcaagctt gagaaaaaaa
atgaaaactt 600gcctgcaaag agaacgcaga gcaactcgaa ggtggatcaa
agccacgtgc tttgtgaaga 660gcttagaagc aagtaacatg ctacctaagg
gcatctcaga acagatttta ccaactgcct 720taagcaatct tcctctggaa
gatttaaaaa gtcttgaaca agatcaacaa gataaaacag 780tacccattct
ctaaatgtaa aatggaagag actctctgca ctcaagtttt cctcacacag
840aacccagtgc ccagctcctg ccgtccccac ccaccgcact ctgacagtta
cactacaatc 900aagtcctgca gttttacttg aagtagtagt gtcagtgtca
ctctctggag actgaggaag 960tgggaaatcc aatgacaagc ttgacaccga
gcagaagtgc cttacatgag ggtcacggac 1020ttaggaaaca ctgccagcag
ggtttctgct cttgtttttt taagctgctg tcaaatagga 1080atgacaagtg
atatgttcat aaaagtaaaa gcattccgca ccaaagctgg gatattacat
1140tctaaagaac atgtgaagta ggagctaact gcattaaata tgatcttaaa
actactaatg 1200tattttgtat gaattaaatt attgggattg tggttgaaaa
ttttatagaa taaaacctct 1260ggggtacggg gcaaggtttg tttctttgtt
ttgttttgtt ttttgtcttt tttagccttt 1320tgtattttaa ctagtaaaag
taaacttatc atggcctttt tttataagaa cattgaattt 1380aaaagtaggt
tgtaaaataa tctgaaatag tattttgaat gtgaaatacc tttgaaactc
1440caaactaggt aaggccccaa gcacctcaga ctgggaaaac ccagtgagtt
atagtcaacg 1500tctaagaaaa tatac 15152611120DNAMus musculus
261gaggggcagt gggcccatct ccgagatgcc gaagtcttgc gcggcccggc
aatgctgcaa 60ccgctacagc agccgcagga agcagctcac cttccaccgg ttccccttca
gccgcccgga 120gctgttgagg gagtgggtgc tcaacatcgg ccgggctgac
ttcaagccta agcagcacac 180agtcatctgc tcggaacact tcagacccga
gtgcttcagc gcctttggga accgcaagaa 240cctgaaacac aatgctgtgc
ccacggtgtt cgcttttcag aaccccacag aggtctgccc 300tgaggtgggg
gctggtgggg acagctcagg gaggaacatg gacaccacac tggaagaact
360tcagcctcca accccggaag gccccgtgca gcaggtctta ccagatcgag
aagcaatgga 420ggccacggag gccgctggcc tgcctgccag ccctctgggg
ttgaagaggc cccttccggg 480acagccgtct gatcacagtt atgccctttc
ggacttggat accctcaaaa aaaaactctt 540tctcacactg aaggaaaaca
agaggcttcg gaagcggctg aaagcccaga ggctgctgtt 600gcggaggaca
tgtggccgcc tgagagccta cagagaggga cagccgggac ctcgggccag
660acggccggca cagggaagct gagcctgagc aagctctggg atgtgggggt
ggtggcaaca 720ccttagcagg aagtggtgtt ctggcctgct atgggcgttt
ctacccgctg ctgatgctgc 780aggtgccttg agagtgggat gggatgctgc
gacaggcagt tgtcgggtgg gggcccaagt 840actgcggagg caccgtccca
ggtttcttgg gctgaggctg tcagctgtgg ggaagcagca 900gtgaccaaat
gtgagccgtc acaaccccct caagagatgc tcccagaggg agagctggtc
960attcttacag ccggtggggt ccttactgtc tccccatagg agccattctg
atggcaggca 1020gggcaagggt ccccgtcagc ctgtatttct gagtgactct
tttttctgcc tggttcgtgt 1080agatgtggaa taaatctttt gaagtctcca
aaaaaaaaaa 1120262558DNAMus musculus 262atactgcaag catttggaag
cctaaaaaaa ggagatgtgc tgtgttcaag acacttcaag 60aagacagact ttgacagaag
cactctaaac actaagctga aggcaggagc catcccttct 120atctttgaat
gtccatatca cttacaggag aaaagagaaa aacttcactg tagaaaaaac
180ttccttctca aaacccttcc catcacccac catggccgcc agcttgttgg
tgcctcctgc 240attgaagaat tcgaacccca gttcattttt gaacatagct
acagtgttat ggacagccca 300aagaagctta agcataagct agaccgtgtg
atcatcgagc tggagaatac caaggaaagc 360ctacggaatg ttttagcccg
agaaaaacac tttcaaaagt cactgaggaa gacaatcatg 420gaactaaagg
atgaaagtct gatcagccag gaaacagcca atagtctggg tgctttctgt
480tgggagtgct atcatgaaag cacagcagga ggctgtagtt gtgaagtcat
ttcttatatg 540cttcatctgc agttgaca 55826337PRTArtificial
SequenceConsensus sequence for PAR4 binding domain of THAP 263Leu
Glu Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Gln1 5 10
15Arg Xaa Arg Arg Gln Xaa Arg Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa
20 25 30Xaa Xaa Gln Xaa Glu 35
* * * * *
References