U.S. patent application number 12/392614 was filed with the patent office on 2009-10-29 for human antibodies that bind human il-12 and methods for producing.
This patent application is currently assigned to ABBOTT GMBH & CO. KG. Invention is credited to Subhashis BANERJEE, Sara CARMEN, Elaine Joy DERBYSHIRE, Sarah Leila DU FOU, Alexander Robert DUNCAN, John Gawain ELVIN, Stuart FRIEDRICH, Thor Las HOLTET, Zehra KAYMAKCALAN, Boris LABKOVSKY, Angela MYLES, Michael PASKIND, Michael ROGUSKA, Paul SAKORAFAS, Jochen SALFELD, Stephen SMITH, Daniel TRACEY, Geertruida M. VELDMAN, Amy VENTURINI, Nicholas W. WARNE, Michael WHITE, Angela WIDOM.
Application Number | 20090269302 12/392614 |
Document ID | / |
Family ID | 33554721 |
Filed Date | 2009-10-29 |
United States Patent
Application |
20090269302 |
Kind Code |
A1 |
SALFELD; Jochen ; et
al. |
October 29, 2009 |
HUMAN ANTIBODIES THAT BIND HUMAN IL-12 AND METHODS FOR
PRODUCING
Abstract
Human antibodies, preferably recombinant human antibodies, that
specifically bind to human interleukin-12 (hIL-12) are disclosed.
Preferred antibodies have high affinity for hIL-12 and neutralize
hIL-12 activity in vitro and in vivo. An antibody of the invention
can be a full-length antibody or an antigen-binding portion
thereof. The antibodies, or antibody portions, of the invention are
useful for detecting hIL-12 and for inhibiting hIL-12 activity,
e.g., in a human subject suffering from a disorder in which hIL-12
activity is detrimental. Nucleic acids, vectors and host cells for
expressing the recombinant human antibodies of the invention, and
methods of synthesizing the recombinant human antibodies, are also
encompassed by the invention.
Inventors: |
SALFELD; Jochen; (North
Grafton, MA) ; ROGUSKA; Michael; (Ashland, MA)
; PASKIND; Michael; (Sterling, MA) ; BANERJEE;
Subhashis; (Hamden, MA) ; TRACEY; Daniel;
(Harvard, MA) ; WHITE; Michael; (Framingham,
MA) ; KAYMAKCALAN; Zehra; (Westborough, MA) ;
LABKOVSKY; Boris; (Marlborough, MA) ; SAKORAFAS;
Paul; (Newton Highlands, MA) ; VELDMAN; Geertruida
M.; (Sudbury, MA) ; VENTURINI; Amy;
(Lexington, MA) ; WIDOM; Angela; (Acton, MA)
; FRIEDRICH; Stuart; (Cary, NC) ; WARNE; Nicholas
W.; (Andover, MA) ; MYLES; Angela; (Andover,
MA) ; ELVIN; John Gawain; (Cambridge, GB) ;
DUNCAN; Alexander Robert; (Cambridge, GB) ;
DERBYSHIRE; Elaine Joy; (Royston, GB) ; CARMEN;
Sara; (Cambridge, GB) ; SMITH; Stephen; (Ely,
GB) ; HOLTET; Thor Las; (Royston, GB) ; DU
FOU; Sarah Leila; (Hitchen, GB) |
Correspondence
Address: |
LAHIVE & COCKFIELD, LLP/ABBOTT;FLOOR 30, SUITE 3000
ONE POST OFFICE SQUARE
BOSTON
MA
02109-2127
US
|
Assignee: |
ABBOTT GMBH & CO. KG
Wiesbaden
DE
|
Family ID: |
33554721 |
Appl. No.: |
12/392614 |
Filed: |
February 25, 2009 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
10884830 |
Jul 1, 2004 |
7504485 |
|
|
12392614 |
|
|
|
|
09534717 |
Mar 24, 2000 |
6914128 |
|
|
10884830 |
|
|
|
|
60126603 |
Mar 25, 1999 |
|
|
|
Current U.S.
Class: |
424/85.2 ;
424/130.1; 424/141.1 |
Current CPC
Class: |
A61K 9/0019 20130101;
A61K 2039/505 20130101; A61P 1/00 20180101; A61P 11/06 20180101;
C07K 2317/73 20130101; A61P 25/16 20180101; C07K 2317/565 20130101;
C07K 2317/21 20130101; C07K 16/18 20130101; A61K 47/22 20130101;
A61P 17/06 20180101; A61P 1/04 20180101; Y10S 514/863 20130101;
A61P 25/00 20180101; A61K 39/39591 20130101; A61P 25/28 20180101;
A61K 45/06 20130101; C07K 16/244 20130101; Y10S 514/886 20130101;
A61P 13/12 20180101; Y10S 514/885 20130101; C07K 2317/76 20130101;
A61P 19/02 20180101; C07K 16/00 20130101; A61K 47/26 20130101; A61K
47/20 20130101; A61P 1/16 20180101; A61P 3/10 20180101; C07K
2317/94 20130101; C07K 14/5434 20130101; A61K 38/208 20130101; A61P
9/10 20180101; A61K 39/3955 20130101; A61P 37/00 20180101; A61K
39/00 20130101 |
Class at
Publication: |
424/85.2 ;
424/130.1; 424/141.1 |
International
Class: |
A61K 39/395 20060101
A61K039/395; A61K 38/20 20060101 A61K038/20; A61P 19/02 20060101
A61P019/02; A61P 11/06 20060101 A61P011/06; A61P 25/00 20060101
A61P025/00; A61P 37/00 20060101 A61P037/00 |
Claims
1. A pharmaceutical composition comprising a human antibody, or
antigen binding portion thereof, capable of binding to an epitope
of the p40 subunit of IL-12, and at least one additional agent
selected from the group consisting of a buffer, a polyalcohol and a
surfactant.
2. The pharmaceutical composition of claim 1, wherein said buffer
is selected from the group consisting of L-histidine, sodium
succinate, sodium citrate, sodium phosphate and potassium
phosphate.
3. The pharmaceutical composition of claim 1, wherein said
polyalcohol is selected from the group consisting of mannitol and
sorbitol.
4. The pharmaceutical composition of claim 1, wherein said
surfactant is selected from the group consisting of polysorbate 80,
polysorbate 20 and BRIJ surfactants.
5. The pharmaceutical composition of claim 1, wherein said
composition further comprises methionine.
6. The pharmaceutical composition of claim 1, wherein said
composition comprises a polyalcohol, a surfactant, and a buffer
comprising L-histidine.
7. The pharmaceutical composition of claim 6, wherein the
polyalcohol is mannitol.
8. The pharmaceutical composition of claim 6, wherein the
surfactant is polysorbate 80.
9. The pharmaceutical composition of claim 6, wherein said
composition further comprises methionine.
10. The pharmaceutical composition of claim 9, wherein said
composition comprises (a) 1-10% mannitol, (b) 0-0.05%
polysorbate-80, (c) 1-50 mM methionine, and (d) a buffer comprising
1-50 mM L-histidine, with a pH of 5 to 7.
11. The pharmaceutical composition of claim 9, wherein said
composition comprises (a) 2-4% mannitol, (b) 0.005-0.01%
polysorbate-80, (c) 5-10 mM methionine, and (d) a buffer comprising
5-10 mM L-histidine, with a pH of 5 to 7.
12. The pharmaceutical composition of claim 9, wherein said
composition comprises (a) 4% mannitol, (b) 0.01% polysorbate-80,
(c) 10 mM methionine, and (d) a buffer comprising 10 mM
L-histidine, with a pH of 6.
13. The pharmaceutical composition of claim 1, wherein the
concentration of the antibody, or antigen binding portion thereof,
is 0.1-250 mg/ml.
14. The pharmaceutical composition of claim 1, wherein said
composition is suitable for parenteral administration.
15. The pharmaceutical composition of claim 1, wherein said
composition is suitable for intravenous injection or intravenous
infusion.
16. The pharmaceutical composition of claim 1, wherein said
composition is suitable for subcutaneous injection or intramuscular
injection.
17. The pharmaceutical composition of claim 1, wherein the
antibody, or antigen-binding portion thereof, is capable of binding
to the epitope of the p40 subunit when the p40 subunit is bound to
the p35 subunit of IL-12.
18. The pharmaceutical composition of claim 1, wherein the
antibody, or antigen-binding portion thereof, is capable of binding
to the epitope of the p40 subunit when the p40 subunit is bound to
a p19 subunit.
19. The pharmaceutical composition of claim 1, wherein the
antibody, or antigen-binding portion thereof, is capable of binding
to the epitope of the p40 subunit when the p40 subunit is bound to
the p35 subunit of IL-12 and when the p40 subunit is bound to a p19
subunit.
20. The pharmaceutical composition of claim 1, wherein the
antibody, or antigen binding portion thereof, binds to an epitope
of the p40 subunit of IL-12 to which an antibody selected from the
group consisting of Y61 and J695 binds.
21. The pharmaceutical composition of claim 1, wherein the
antibody, or antigen binding portion thereof, dissociates from the
p40 subunit of IL-12 with a K.sub.d of 1.34.times.10.sup.-10 M or
less or a k.sub.off rate constant of 1.times.10.sup.-3 s.sup.-1 or
less, as determined by surface plasmon resonance.
22. The pharmaceutical composition of claim 21, wherein the
antibody, or antigen-binding portion thereof, dissociates from the
p40 subunit of human IL-12 with a k.sub.off rate constant of
1.times.10.sup.-4 s.sup.-1 or less.
23. The pharmaceutical composition of claim 21, wherein the
antibody, or antigen-binding portion thereof, dissociates from the
p40 subunit of human IL-12 with a k.sub.off rate constant of
1.times.10.sup.-5s.sup.-1 or less.
24. The pharmaceutical composition of claim 21, wherein the human
antibody, or antigen-binding portion thereof, dissociates from the
p40 subunit of human IL-12 with a K.sub.d of 1.times.10.sup.-10 M
or less.
25. The pharmaceutical composition of claim 21, wherein the human
antibody, or antigen-binding portion thereof, dissociates from the
p40 subunit of human IL-12 with a K.sub.d of 9.74.times.10.sup.-11
M or less.
26. The pharmaceutical composition of any one of claims 21-25,
wherein the antibody, or antigen binding portion thereof, is a
recombinant antibody, or antigen binding portion thereof.
27. The pharmaceutical composition of claim 1, wherein the
antibody, or antigen binding portion thereof, neutralizes the
biological activity of the p40 subunit of IL-12.
28. The pharmaceutical composition of claim 27, wherein the
antibody neutralizes the biological activity of the p40 subunit
when the p40 subunit is bound to the p35 subunit of IL-12.
29. The pharmaceutical composition of claim 27, wherein the
antibody neutralizes the biological activity of the p40 subunit
when the p40 subunit is bound to a p19 subunit.
30. The pharmaceutical composition of claim 27, wherein the
antibody neutralizes the biological activity of free p40.
31. The pharmaceutical composition of claims 27-28, wherein the
antibody, or antigen binding portion thereof, inhibits
phytohemagglutinin blast proliferation in an in vitro PHA assay
with an IC.sub.50 of 1.times.10.sup.-7 M or less, or which inhibits
human IFN.gamma. production with an IC.sub.50 of 1.times.10.sup.-10
M or less.
32. The pharmaceutical composition of claim 31, wherein the
antibody, or antigen-binding portion thereof, inhibits
phytohemagglutinin blast proliferation in an in vitro PHA assay
with an IC.sub.50 of 1.times.10.sup.-8 M or less.
33. The pharmaceutical composition of claim 31, wherein the
antibody, or antigen-binding portion thereof, inhibits
phytohemagglutinin blast proliferation in an in vitro PHA assay
with an IC.sub.50 of 1.times.10.sup.-9 M or less.
34. The pharmaceutical composition of claim 31, wherein the
antibody, or antigen-binding portion thereof, inhibits
phytohemagglutinin blast proliferation in an in vitro PHA assay
with an IC.sub.50 of 1.times.10.sup.-10M or less.
35. The pharmaceutical composition of claim 31, wherein the
antibody, or antigen-binding portion thereof, inhibits
phytohemagglutinin blast proliferation in an in vitro PHA assay
with an IC.sub.50 of 1.times.10.sup.-11 M or less.
36. The pharmaceutical composition of claim 31, wherein the
antibody, or antigen-binding portion thereof, inhibits human
IFN.gamma. production with an IC.sub.50 of 1.times.10.sup.-11 M or
less.
37. The pharmaceutical composition of claim 31, wherein the
antibody, or antigen-binding portion thereof, inhibits human
IFN.gamma. production with an IC.sub.50 of 5.times.10.sup.-12 M or
less.
38. The pharmaceutical composition of claim 1, wherein the
antibody, or antigen binding portion thereof, has a heavy chain
CDR3 comprising the amino acid sequence of SEQ ID NO: 25 and a
light chain CDR3 comprising the amino acid sequence of SEQ ID NO:
26.
39. The pharmaceutical composition of claim 38, wherein the human
antibody, or antigen binding portion thereof, further has a heavy
chain CDR2 comprising the amino acid sequence of SEQ ID NO: 27 and
a light chain CDR2 comprising the amino acid sequence of SEQ ID NO:
28.
40. The pharmaceutical composition of claim 38, wherein the human
antibody, or antigen binding portion thereof, further has a heavy
chain CDR1 comprising the amino acid sequence of SEQ ID NO: 29 and
a light chain CDR1 comprising the amino acid sequence of SEQ ID NO:
30.
41. The pharmaceutical composition of claim 1, wherein the
antibody, or antigen binding portion thereof, has heavy chain
variable region comprising the amino acid sequence of SEQ ID NO:
31, and a light chain variable region comprising the amino acid
sequence of SEQ ID NO: 32.
42. The pharmaceutical composition of claim 41, wherein the
antibody, or antigen binding portion thereof, comprises a heavy
chain constant region selected from the group consisting of IgG1,
IgG2, IgG3, IgG4, IgM, IgA and IgE constant regions.
43. The pharmaceutical composition of claim 42, wherein the
antibody heavy chain constant region is IgG1.
44. The pharmaceutical composition of claim 41, wherein the
antibody, or antigen binding portion thereof, is a Fab
fragment.
45. The pharmaceutical composition of claim 41, wherein the
antibody, or antigen binding portion thereof, is a F(ab').sub.2
fragment.
46. The pharmaceutical composition of claim 41, wherein the
antibody, or antigen binding portion thereof, is a single chain Fv
fragment.
47. The pharmaceutical composition of claim 1, wherein the antibody
is the antibody J695, or an antigen binding portion thereof.
48. The pharmaceutical composition of claim 1, further comprising
an additional therapeutic agent.
49. The pharmaceutical composition of claim 48, wherein the
additional therapeutic agent is selected from the group consisting
of budenoside, epidermal growth factor, corticosteroids,
cyclosporin, sulfasalazine, aminosalicylates, 6-mercaptopurine,
azathioprine, metronidazole, lipoxygenase inhibitors, mesalamine,
olsalazine, balsalazide, antioxidants, thromboxane inhibitors, IL-1
receptor antagonists, anti-IL-1.beta. monoclonal antibodies,
anti-IL-6 monoclonal antibodies, growth factors, elastase
inhibitors, pyridinyl-imidazole compounds, antibodies or agonists
of TNF, LT, IL-1, IL-2, IL-6, IL-7, IL-8, IL-15, IL-16, IL-18,
EMAP-II, GM-CSF, FGF, and PDGF, antibodies of CD2, CD3, CD4, CD8,
CD25, CD28, CD30, CD40, CD45, CD69, CD90 or their ligands,
methotrexate, cyclosporin, FK506, rapamycin, mycophenolate mofetil,
leflunomide, NSAIDs, ibuprofen, corticosteroids, prednisolone,
phosphodiesterase inhibitors, adenosine agonists, antithrombotic
agents, complement inhibitors, adrenergic agents, IRAK, NIK, IKK,
p38, MAP kinase inhibitors, IL-1.beta. converting enzyme
inhibitors, TNF.alpha. converting enzyme inhibitors, T-cell
signalling inhibitors, metalloproteinase inhibitors, sulfasalazine,
azathioprine, 6-mercaptopurines, angiotensin converting enzyme
inhibitors, soluble cytokine receptors, soluble p55 TNF receptor,
soluble p75 TNF receptor, sIL-1RI, sIL-1RII, sIL-6R,
antiinflammatory cytokines, IL-4, IL-10, IL-11, IL-13 and
TGF.beta..
50. The pharmaceutical composition of claim 48, wherein the
additional therapeutic agent is selected from the group consisting
of anti-TNF antibodies and antibody fragments thereof, TNFR-Ig
constructs, TACE inhibitors, PDE4 inhibitors, corticosteroids,
budenoside, dexamethasone, sulfasalazine, 5-aminosalicylic acid,
olsalazine, IL-1.beta. converting enzyme inhibitors, IL-1ra,
tyrosine kinase inhibitors, 6-mercaptopurines and IL-11.
51. The pharmaceutical composition of claim 48, wherein the
additional therapeutic agent is selected from the group consisting
of corticosteroids, prednisolone, methylprednisolone, azathioprine,
cyclophosphamide, cyclosporine, methotrexate, 4-aminopyridine,
tizanidine, interferon-.beta.1a, interferon-.beta.1b, Copolymer 1,
hyperbaric oxygen, intravenous immunoglobulin, clabribine,
antibodies or agonists of TNF, LT, IL-1, IL-2, IL-6, IL-7, IL-8,
IL-15, IL-16, IL-18, EMAP-II, GM-CSF, FGF, PDGF, antibodies to CD2,
CD3, CD4, CD8, CD25, CD28, CD30, CD40, CD45, CD69, CD80, CD86, CD90
or their ligands, methotrexate, cyclosporine, FK506, rapamycin,
mycophenolate mofetil, leflunomide, NSAIDs, ibuprofen,
corticosteroids, prednisolone, phosphodiesterase inhibitors,
adenosine agonists, antithrombotic agents, complement inhibitors,
adrenergic agents, IRAK, NIK, IKK, p38 or MAP kinase inhibitors,
IL-1.beta. converting enzyme inhibitors, TACE inhibitors, T-cell
signalling inhibitors, kinase inhibitors, metalloproteinase
inhibitors, sulfasalazine, azathioprine, 6-mercaptopurines,
angiotensin converting enzyme inhibitors, soluble cytokine
receptors, soluble p55 TNF receptor, soluble p75 TNF receptor,
sIL-1RI, sIL-1RII, sIL-6R, sIL-13R, anti-P7s, p-selectin
glycoprotein ligand (PSGL), antiinflammatory cytokines, IL-4,
IL-10, IL-13 and TGF.beta..
52. A pharmaceutical composition comprising a human antibody, or
antigen binding portion thereof, that binds to an epitope of the
p40 subunit of IL-12 and dissociates from the p40 subunit of IL-12
with a k.sub.off rate constant of 1.times.10.sup.-3 s.sup.-1 or
less or a K.sub.d of 1.34.times.10.sup.-10 M or less, as determined
by surface plasmon resonance, and which is a recombinant antibody,
or antigen binding portion thereof, wherein the composition further
comprises (a) 4% mannitol, (b) 0.01% polysorbate-80, (c) 10 mM
methionine, and (d) a buffer comprising 10 mM L-histidine, with a
pH of 6.
53. The pharmaceutical composition of claim 52, wherein the
concentration of the antibody, or antigen binding portion thereof,
is 0.1-250 mg/ml.
54. A pharmaceutical composition comprising a human antibody, or
antigen-binding portion thereof, with a light chain variable region
(LCVR) having a CDR3 domain comprising the amino acid sequence of
SEQ ID NO: 26, and with a heavy chain variable region (HCVR) having
a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 25,
wherein the composition further comprises (a) 4% mannitol, (b)
0.01% polysorbate-80, (c) 10 mM methionine, and (d) a buffer
comprising 10 mM L-histidine, with a pH of 6.
55. The pharmaceutical composition of claim 54, wherein the
concentration of the antibody, or antigen binding portion thereof,
is 0.1-250 mg/ml.
56. The pharmaceutical composition of claim 54, wherein the LCVR
further has a CDR2 domain comprising the amino acid sequence of SEQ
ID NO: 28 and the HCVR further has a CDR2 domain comprising the
amino acid sequence of SEQ ID NO: 27.
57. The pharmaceutical composition of claim 54, wherein the LCVR
further has CDR1 domain comprising the amino acid sequence of SEQ
ID NO: 30 and the HCVR has a CDR1 domain comprising the amino acid
sequence of SEQ ID NO: 29.
58. A method for inhibiting the activity of the p40 subunit of
human IL-12 in a human subject, comprising administering to the
human subject the composition of any one of claims 1, 52 or 53, to
thereby inhibit the activity of the p40 subunit of human IL-12 in
the human subject.
59. The method of claim 58, wherein said subject is suffering from
a disorder selected from the group consisting of rheumatoid
arthritis, osteoarthritis, juvenile chronic arthritis, Lyme
arthritis, psoriatic arthritis, reactive arthritis,
spondyoarthropathy, ankylosing spondylitis, systemic lupus
erythematosis, Crohn's disease, ulcerative colitis, inflammatory
bowel disease, multiple sclerosis, insulin dependent diabetes
mellitus, thyroiditis, asthma, allergic diseases, psoriasis,
dermatitis scleroderma, thyroiditis, graft versus host disease,
organ transplant rejection, acute or chronic immune disease
associated with organ transplantation, sarcoidosis,
atherosclerosis, disseminated intravascular coagulation, Kawasaki's
disease, Grave's disease, nephrotic syndrome, chronic fatigue
syndrome, polyarteritis nodosa, Wegener's granulomatosis,
Henoch-Schonlein purpura, microscopic vasculitis of the kidneys,
chronic active hepatitis, Sjogren's syndrome, uveitis, sepsis,
septic shock, sepsis syndrome, adult respiratory distress syndrome,
cachexia, infectious diseases, parasitic diseases, acquired
immunodeficiency syndrome, acute transverse myelitis, myasthenia
gravis, Huntington's chorea, Parkinson's disease, Alzheimer's
disease, stroke, primary biliary cirrhosis, fibrotic lung diseases,
hemolytic anemia, malignancies, heart failure and myocardial
infarction.
60. The method of claim 59, wherein the disorder is Crohn's
disease.
61. The method of claim 59, wherein the disorder is multiple
sclerosis.
62. The method of claim 59, wherein the disorder is rheumatoid
arthritis.
63. The method of claim 59, wherein the disorder is psoriasis.
Description
RELATED APPLICATIONS
[0001] This application is a continuation of U.S. patent
application Ser. No. 10/884,830, filed Jul. 1, 2004, which is a
divisional of U.S. patent application Ser. No. 09/534,717, filed
Mar. 24, 2000, now U.S. Pat. No. 6,914,128, which is a
non-provisional application claiming priority to U.S. provisional
application Ser. No. 60/126,603, filed Mar. 25, 1999. The entire
contents of each of the foregoing applications are hereby
incorporated herein by reference.
SUBMISSION ON COMPACT DISC
[0002] This application incorporates by reference the ASCII text
file identified by the name BBI093CPDVCN2.txt, containing 787 KB of
data, created on Feb. 24, 2009 and filed in computer-readable
format (CRF).
BACKGROUND OF THE INVENTION
[0003] Human interleukin 12 (IL-12) has recently been characterized
as a cytokine with a unique structure and pleiotropic effects
(Kobayashi, et al. (1989) J. Exp Med. 170:827-845; Seder, et al.
(1993) Proc. Natl. Acad. Sci. 90:10188-10192; Ling, et al. (1995)
J. Exp Med. 154:116-127; Podlaski, et al. (1992) Arch. Biochem.
Biophys. 294:230-237). IL-12 plays a critical role in the pathology
associated with several diseases involving immune and inflammatory
responses. A review of IL-12, its biological activities, and its
role in disease can be found in Gately et al. (1998) Ann. Rev.
Immunol. 16: 495-521.
[0004] Structurally, IL-12 is a heterodimeric protein comprising a
35 kDa subunit (p35) and a 40 kDa subunit (p40) which are both
linked together by a disulfide bridge (referred to as the "p70
subunit"). The heterodimeric protein is produced primarily by
antigen-presenting cells such as monocytes, macrophages and
dendritic cells. These cell types also secrete an excess of the p40
subunit relative to p70 subunit. The p40 and p35 subunits are
genetically unrelated and neither has been reported to possess
biological activity, although the p40 homodimer may function as an
IL-12 antagonist.
[0005] Functionally, IL-12 plays a central role in regulating the
balance between antigen specific T helper type (Th1) and type 2
(Th2) lymphocytes. The Th1 and Th2 cells govern the initiation and
progression of autoimmune disorders, and IL-12 is critical in the
regulation of Th1-lymphocyte differentiation and maturation.
Cytokines released by the Th1 cells are inflammatory and include
interferon .gamma. (IFN.gamma.), IL-2 and lymphotoxin (LT). Th2
cells secrete IL-4, IL-5, IL-6, IL-10 and IL-13 to facilitate
humoral immunity, allergic reactions, and immunosuppression.
[0006] Consistent with the preponderance of Th1 responses in
autoimmune diseases and the proinflammatory activities of
IFN.gamma., IL-12 may play a major role in the pathology associated
with many autoimmune and inflammatory diseases such as rheumatoid
arthritis (RA), multiple sclerosis (MS), and Crohn's disease.
[0007] Human patients with MS have demonstrated an increase in
IL-12 expression as documented by p40 mRNA levels in acute MS
plaques. (Windhagen et al., (1995) J. Exp. Med. 182: 1985-1996). In
addition, ex vivo stimulation of antigen-presenting cells with
CD40L-expressing T cells from MS patients resulted in increased
IL-12 production compared with control T cells, consistent with the
observation that CD40/CD40L interactions are potent inducers of
IL-12.
[0008] Elevated levels of IL-12 p70 have been detected in the
synovia of RA patients compared with healthy controls (Morita et al
(1998) Arthritis and Rheumatism. 41: 306-314). Cytokine messenger
ribonucleic acid (mRNA) expression profile in the RA synovia
identified predominantly Th1 cytokines. (Bucht et al., (1996) Clin.
Exp. Immunol. 103: 347-367). IL-12 also appears to play a critical
role in the pathology associated with Crohn's disease (CD).
Increased expression of INF.gamma. and IL-12 has been observed in
the intestinal mucosa of patients with this disease (Fais et al.
(1994) J. Interferon Res. 14:235-238; Parronchi et al., (1997) Am.
J. Path. 150:823-832; Monteleone et al., (1997) Gastroenterology.
112:1169-1178, and Berrebi et al., (1998) Am. J. Path 152:667-672).
The cytokine secretion profile of T cells from the lamina propria
of CD patients is characteristic of a predominantly Th1 response,
including greatly elevated IFN.gamma. levels (Fuss, et al., (1996)
J. Immunol. 157:1261-1270). Moreover, colon tissue sections from CD
patients show an abundance of IL-12 expressing macrophages and
IFN.gamma. expressing T cells (Parronchi et al (1997) Am. J. Path.
150:823-832).
[0009] Due to the role of human IL-12 in a variety of human
disorders, therapeutic strategies have been designed to inhibit or
counteract IL-12 activity. In particular, antibodies that bind to,
and neutralize, IL-12 have been sought as a means to inhibit IL-12
activity. Some of the earliest antibodies were murine monoclonal
antibodies (mAbs), secreted by hybridomas prepared from lymphocytes
of mice immunized with IL-12 (see e.g., World Patent Application
Publication No. WO 97/15327 by Strober et al.; Neurath et al.
(1995) J. Exp. Med. 182:1281-1290; Duchmann et al. (1996) J.
Immunol. 26:934-938). These murine IL-12 antibodies are limited for
their use in vivo due to problems associated with administration of
mouse antibodies to humans, such as short serum half life, an
inability to trigger certain human effector functions and
elicitation of an unwanted immune response against the mouse
antibody in a human (the "human anti-mouse antibody" (HAMA)
reaction).
[0010] In general, attempts to overcome the problems associated
with use of fully-murine antibodies in humans, have involved
genetically engineering the antibodies to be more "human-like." For
example, chimeric antibodies, in which the variable regions of the
antibody chains are murine-derived and the constant regions of the
antibody chains are human-derived, have been prepared (Junghans, et
al. (1990) Cancer Res. 50:1495-1502; Brown et al. (1991) Proc.
Natl. Acad. Sci. 88:2663-2667; Kettleborough et al. (1991) Protein
Engineering. 4:773-783). However, because these chimeric and
humanized antibodies still retain some murine sequences, they still
may elicit an unwanted immune reaction, the human anti-chimeric
antibody (HACA) reaction, especially when administered for
prolonged periods.
[0011] A preferred IL-12 inhibitory agent to murine antibodies or
derivatives thereof (e.g., chimeric or humanized antibodies) would
be an entirely human anti-IL-12 antibody, since such an agent
should not elicit the HAMA reaction, even if used for prolonged
periods. However, such antibodies have not been described in the
art and, therefore are still needed.
SUMMARY OF THE INVENTION
[0012] The present invention provides human antibodies that bind
human IL-12. The invention also relates to the treatment or
prevention of acute or chronic diseases or conditions whose
pathology involves IL-12, using the human anti-IL-12 antibodies of
the invention.
[0013] In one aspect, the invention provides an isolated human
antibody, or an antigen-binding portion thereof, that binds to
human IL-12.
[0014] In one embodiment, the invention provides a selectively
mutated human IL-12 antibody, comprising:
[0015] a human antibody or antigen-binding portion thereof,
selectively mutated at a preferred selective mutagenesis position,
contact or hypermutation position with an activity enhancing amino
acid residue such that it binds to human IL-12.
[0016] In a preferred embodiment, the invention provides a
selectively mutated human IL-12 antibody, comprising:
[0017] a human antibody or antigen-binding portion thereof,
selectively mutated at a preferred selective mutagenesis position
with an activity enhancing amino acid residue such that it binds to
human IL-12.
[0018] In another preferred embodiment, the selectively mutated
human IL-12 antibody or antigen-binding portion thereof is
selectively mutated at more than one preferred selective
mutagenesis position, contact or hypermutation positions with an
activity enhancing amino acid residue. In another preferred
embodiment, the selectively mutated human IL-12 antibody or
antigen-binding portion thereof is selectively mutated at no more
than three preferred selective mutagenesis positions, contact or
hypermutation positions. In another preferred embodiment, the
selectively mutated human IL-12 antibody or antigen-binding portion
thereof is selectively mutated at no more than two preferred
selective mutagenesis position, contact or hypermutation positions.
In yet another preferred embodiment, the selectively mutated human
IL-12 antibody or antigen-binding portion thereof, is selectively
mutated such that a target specificity affinity level is attained,
the target level being improved over that attainable when selecting
for an antibody against the same antigen using phage display
technology. In another preferred embodiment, the selectively
mutated human IL-12 antibody further retains at least one desirable
property or characteristic, e.g., preservation of non-cross
reactivity with other proteins or human tissues, preservation of
epitope recognition, production of an antibody with a close to a
germline immunoglobulin sequence.
[0019] In another embodiment, the invention provides an isolated
human antibody, or antigen-binding portion thereof, that binds to
human IL-12 and dissociates from human IL-12 with a K.sub.off rate
constant of 0.1 s.sup.-1 or less, as determined by surface plasmon
resonance, or which inhibits phytohemagglutinin blast proliferation
in an in vitro phytohemagglutinin blast proliferation assay (PHA
assay) with an IC.sub.50 of 1.times.10.sup.-6 M or less. More
preferably, the isolated human antibody or an antigen-binding
portion thereof, dissociates from human IL-12 with a K.sub.off rate
constant of 1.times.10.sup.-2 s.sup.-1 or less, or inhibits
phytohemagglutinin blast proliferation in an in vitro PHA assay
with an IC.sub.50 of 1.times.10.sup.-7 M or less. More preferably,
the isolated human antibody, or an antigen-binding portion thereof,
dissociates from human IL-12 with a K.sub.off rate constant of
1.times.10.sup.-3 s.sup.-1 or less, or inhibits phytohemagglutinin
blast proliferation in an in vitro PHA assay with an IC.sub.50 of
1.times.10.sup.-8 M or less. More preferably, the isolated human
antibody, or an antigen-binding portion thereof, dissociates from
human IL-12 with a K.sub.off rate constant of 1.times.10.sup.-4
s.sup.-1 or less, or inhibits phytohemagglutinin blast
proliferation in an in vitro PHA assay with an IC.sub.50 of
1.times.10.sup.-9 M or less. More preferably, the isolated human
antibody, or an antigen-binding portion thereof, dissociates from
human IL-12 with a K.sub.off rate constant of 1.times.10.sup.-5
s.sup.-1 or less, or inhibits phytohemagglutinin blast
proliferation in an in vitro PHA assay with an IC.sub.50 of
1.times.10.sup.-10 M or less. Even more preferably, the isolated
human antibody, or an antigen-binding portion thereof, dissociates
from human IL-12 with a K.sub.off rate constant of
1.times.10.sup.-5 s.sup.-1 or less, or inhibits phytohemagglutinin
blast proliferation in an in vitro PHA assay with an IC.sub.50 of
1.times.10.sup.-11 M or less.
[0020] In another embodiment, the invention provides an isolated
human antibody, or an antigen-binding portion thereof, which has
the following characteristics:
[0021] a) inhibits phytohemagglutinin blast proliferation in an in
vitro PHA assay with an IC.sub.50 of 1.times.10.sup.-6 M or
less;
[0022] b) has a heavy chain CDR3 comprising the amino acid sequence
of SEQ ID NO: 1; and
[0023] c) has a light chain CDR3 comprising the amino acid sequence
of SEQ ID NO: 2.
[0024] In a preferred embodiment, the isolated human antibody, or
an antigen-binding portion thereof, has a heavy chain CDR2
comprising the amino acid sequence of SEQ ID NO: 3; and has a light
chain CDR2 comprising the amino acid sequence of SEQ ID NO: 4. In a
preferred embodiment, the isolated human antibody, or an
antigen-binding portion thereof, has a heavy chain CDR1 comprising
the amino acid sequence of SEQ ID NO: 5; and has a light chain CDR1
comprising the amino acid sequence of SEQ ID NO: 6. In a preferred
embodiment, the isolated human antibody, or antigen binding portion
thereof, has a heavy chain variable region comprising the amino
acid sequence of SEQ ID NO: 7; and has a light chain variable
region comprising the amino acid sequence of SEQ ID NO: 8.
[0025] In another embodiment, the invention provides an isolated
human antibody, or an antigen-binding portion thereof, which has
the following characteristics:
[0026] a) inhibits phytohemagglutinin blast proliferation in an in
vitro PHA assay with an IC.sub.50 of 1.times.10.sup.-9 M or
less;
[0027] b) has a heavy chain CDR3 comprising the amino acid sequence
of SEQ ID NO: 9; and
[0028] c) has a light chain CDR3 comprising the amino acid sequence
of SEQ ID NO: 10.
[0029] In a preferred embodiment, the isolated human antibody, or
an antigen-binding portion thereof, has a heavy chain CDR2
comprising the amino acid sequence of SEQ ID NO: 11; and has a
light chain CDR2 comprising the amino acid sequence of SEQ ID NO:
12. In a preferred embodiment, the isolated human antibody, or an
antigen-binding portion thereof, has a heavy chain CDR1 comprising
the amino acid sequence of SEQ ID NO: 13; and has a light chain
CDR1 comprising the amino acid sequence of SEQ ID NO: 14. In a
preferred embodiment, the isolated human antibody has a heavy chain
variable region comprising the amino acid sequence of SEQ ID NO:
15; and has a light chain variable region comprising the amino acid
sequence of SEQ ID NO: 16.
[0030] In another embodiment, the invention provides an isolated
human antibody, or an antigen-binding portion thereof, which
[0031] a) inhibits phytohemagglutinin blast proliferation in an in
vitro PHA assay with an IC.sub.50 of 1.times.10.sup.-9 M or
less;
[0032] b) has a heavy chain CDR3 comprising the amino acid sequence
of SEQ ID NO: 17; and
[0033] c) has a light chain CDR3 comprising the amino acid sequence
of SEQ ID NO: 18.
[0034] In a preferred embodiment, the isolated human antibody, or
an antigen-binding portion thereof, has a heavy chain CDR2
comprising the amino acid sequence of SEQ ID NO: 19; and a light
chain CDR2 comprising the amino acid sequence of SEQ ID NO: 20. In
a preferred embodiment, the isolated human antibody, or an
antigen-binding portion thereof, has a heavy chain CDR1 comprising
the amino acid sequence of SEQ ID NO: 21; and a light chain CDR1
comprising the amino acid sequence of SEQ ID NO: 22. In a preferred
embodiment, the isolated human antibody, or an antigen-binding
portion thereof, has the heavy chain variable region comprising the
amino acid sequence of SEQ ID NO: 23, and a light chain variable
region comprising the amino acid sequence of SEQ ID NO: 24. In a
preferred embodiment, the isolated human antibody comprises a heavy
chain constant region selected from the group consisting of IgG1,
IgG2, IgG3, IgG4, IgM, IgA and IgE constant regions or any allelic
variation thereof as discussed in Kabat et al. (Kabat, E. A., et
al. (1991) Sequences of Proteins of Immunological Interest, Fifth
Edition, U.S. Department of Health and Human Services, NIH
Publication No. 91-3242), included herein by reference. In a more
preferred embodiment, the antibody heavy chain constant region is
IgG1. In another preferred embodiment, the isolated human antibody
is a Fab fragment, or a F(ab').sub.2 fragment or a single chain Fv
fragment.
[0035] In another embodiment, the invention provides an isolated
human antibody, or an antigen-binding portion thereof, which
[0036] a) inhibits phytohemagglutinin blast proliferation in an in
vitro PHA assay with an IC.sub.50 of 1.times.10.sup.-9 M or
less;
[0037] b) has a heavy chain CDR3 comprising the amino acid sequence
selected from the group consisting of SEQ ID NO: 404-SEQ ID NO:
469; and
[0038] c) has a light chain CDR3 comprising the amino acid sequence
selected from the group consisting of SEQ ID NO: 534-SEQ ID NO:
579.
[0039] In a preferred embodiment, the isolated human antibody, or
an antigen-binding portion thereof, has a heavy chain CDR2
comprising the amino acid sequence selected from the group
consisting of SEQ ID NO:335-SEQ ID NO: 403; and a light chain CDR2
comprising the amino acid sequence selected from the group
consisting of SEQ ID NO: 506-SEQ ID NO: 533. In a preferred
embodiment, the isolated human antibody, or an antigen-binding
portion thereof, has a heavy chain CDR1 comprising the amino acid
sequence selected from the group consisting of SEQ ID NO: 288-SEQ
ID NO: 334; and a light chain CDR1 comprising the amino acid
sequence selected from the group consisting of SEQ ID NO: 470-SEQ
ID NO: 505. In a preferred embodiment, the isolated human antibody,
or an antigen-binding portion thereof, comprising a the heavy chain
variable region comprising the amino acid sequence of SEQ ID NO:
23, and a light chain variable region comprising the amino acid
sequence of SEQ ID NO: 24. In a preferred embodiment, the isolated
human antibody comprises a heavy chain constant region, or an Fab
fragment or a F(ab').sub.2 fragment or a single chain Fv fragment
as described above.
[0040] In another embodiment, the invention provides an isolated
human antibody, or an antigen-binding portion thereof, which
[0041] a) inhibits phytohemagglutinin blast proliferation in an in
vitro PHA assay with an IC.sub.50 of 1.times.10.sup.-9 M or
less;
[0042] b) has a heavy chain CDR3 comprising the amino acid sequence
of SEQ ID NO: 25; and
[0043] c) has a light chain CDR3 comprising the amino acid sequence
of SEQ ID NO: 26.
[0044] In a preferred embodiment, the isolated human antibody, or
an antigen-binding portion thereof, has a heavy chain CDR2
comprising the amino acid sequence of SEQ ID NO: 27; and a light
chain CDR2 comprising the amino acid sequence of SEQ ID NO: 28. In
a preferred embodiment, the isolated human antibody, or an
antigen-binding portion thereof, has a heavy chain CDR1 comprising
the amino acid sequence of SEQ ID NO: 29; and a light chain CDR1
comprising the amino acid sequence of SEQ ID NO: 30. In a preferred
embodiment, the isolated human antibody, or an antigen-binding
portion thereof, which has a heavy chain variable region comprising
the amino acid sequence of SEQ ID NO: 31, and a light chain
variable region comprising the amino acid sequence of SEQ ID NO:
32. In a preferred embodiment, the isolated human antibody
comprises a heavy chain constant region, or an Fab fragment, or a
F(ab').sub.2 fragment or a single chain Fv fragment as described
above.
[0045] In another embodiment, the invention provides an isolated
human antibody, or an antigen-binding portion thereof, which
[0046] a) inhibits phytohemagglutinin blast proliferation in an in
vitro PHA assay with an IC.sub.50 of 1.times.10.sup.-6 M or
less;
[0047] b) comprises a heavy chain CDR3 comprising the amino acid
sequence of SEQ ID NO: 1, a heavy chain CDR2 comprising the amino
acid sequence of SEQ ID NO: 3 and a heavy chain CDR1 comprising the
amino acid sequence of SEQ ID NO: 5, or a mutant thereof having one
or more amino acid substitutions at a contact position or a
hypermutation position, wherein said mutant has a k.sub.off rate no
more than 10-fold higher than the antibody comprising a heavy chain
CDR3 comprising the amino acid sequence of SEQ ID NO: 1, a heavy
chain CDR2 comprising the amino acid sequence of SEQ ID NO: 3, and
a heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO:
5; and
[0048] c) comprises a light chain CDR3 comprising the amino acid
sequence of SEQ ID NO: 2, a light chain CDR2 comprising the amino
acid sequence of SEQ ID NO: 4, and a light chain CDR1 comprising
the amino acid sequence of SEQ ID NO: 6, or a mutant thereof having
one or more amino acid substitutions at a contact position or a
hypermutation position, wherein said mutant has a k.sub.off rate no
more than 10-fold higher than the antibody comprising a light chain
CDR3 comprising the amino acid sequence of SEQ ID NO: 2, a light
chain CDR2 comprising the amino acid sequence of SEQ ID NO: 4, and
a light chain CDR1 comprising the amino acid sequence of SEQ ID NO:
6.
[0049] In another embodiment, the invention provides an isolated
human antibody, or an antigen-binding portion thereof, which
[0050] a) inhibits phytohemagglutinin blast proliferation in an in
vitro PHA assay with an IC.sub.50 of 1.times.10.sup.-9 M or
less;
[0051] b) comprises a heavy chain CDR3 comprising the amino acid
sequence of SEQ ID NO: 9, a heavy chain CDR2 comprising the amino
acid sequence of SEQ ID NO: 11 and a heavy chain CDR1 comprising
the amino acid sequence of SEQ ID NO: 13, or a mutant thereof
having one or more amino acid substitutions at a contact position
or a hypermutation position, wherein said mutant has a k.sub.off
rate no more than 10-fold higher than the antibody comprising a
heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO:
9, a heavy chain CDR2 comprising the amino acid sequence of SEQ ID
NO: 11, and a heavy chain CDR1 comprising the amino acid sequence
of SEQ ID NO: 13; and
[0052] c) comprises a light chain CDR3 comprising the amino acid
sequence of SEQ ID NO: 10, a light chain CDR2 comprising the amino
acid sequence of SEQ ID NO: 12, and a light chain CDR1 comprising
the amino acid sequence of SEQ ID NO: 14, or a mutant thereof
having one or more amino acid substitutions at a preferred
selective mutagenesis position, contact position or a hypermutation
position, wherein said mutant has a k.sub.off rate no more than
10-fold higher than the antibody comprising a light chain CDR3
comprising the amino acid sequence of SEQ ID NO: 10, a light chain
CDR2 comprising the amino acid sequence of SEQ ID NO: 12, and a
light chain CDR1 comprising the amino acid sequence of SEQ ID NO:
14.
[0053] In another embodiment, the invention provides an isolated
human antibody, or an antigen-binding portion thereof, which
[0054] a) inhibits phytohemagglutinin blast proliferation in an in
vitro PHA assay with an IC.sub.50 of 1.times.10.sup.-9 M or
less;
[0055] b) comprises a heavy chain CDR3 comprising the amino acid
sequence of SEQ ID NO: 17, a heavy chain CDR2 comprising the amino
acid sequence of SEQ ID NO: 19 and a heavy chain CDR1 comprising
the amino acid sequence of SEQ ID NO: 21, or a mutant thereof
having one or more amino acid substitutions at a preferred
selective mutagenesis position, contact position or a hypermutation
position, wherein said mutant has a k.sub.off rate no more than
10-fold higher than the antibody comprising a heavy chain CDR3
comprising the amino acid sequence of SEQ ID NO: 17, a heavy chain
CDR2 comprising the amino acid sequence of SEQ ID NO: 19, and a
heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO:
21; and
[0056] c) comprises a light chain CDR3 comprising the amino acid
sequence of SEQ ID NO: 18, a light chain CDR2 comprising the amino
acid sequence of SEQ ID NO: 20, and a light chain CDR1 comprising
the amino acid sequence of SEQ ID NO: 22, or a mutant thereof
having one or more amino acid substitutions at preferred selective
mutagenesis position, contact position or a hypermutation position,
wherein said mutant has a k.sub.off rate no more than 10-fold
higher than the antibody comprising a light chain CDR3 comprising
the amino acid sequence of SEQ ID NO: 18, a light chain CDR2
comprising the amino acid sequence of SEQ ID NO: 20, and a light
chain CDR1 comprising the amino acid sequence of SEQ ID NO: 22.
[0057] The invention also provides nucleic acid molecules encoding
antibodies, or antigen binding portions thereof, of the invention.
A preferred isolated nucleic acid encodes the heavy chain CDR3
comprising the amino acid sequence of SEQ ID NO: 17. The isolated
nucleic acid encoding an antibody heavy chain variable region. In
another embodiment, the isolated nucleic acid encodes the CDR2 of
the antibody heavy chain variable region comprising the amino acid
sequence of SEQ ID NO: 19. In another embodiment, the isolated
nucleic acid encodes the CDR1 of the antibody heavy chain variable
region comprising the amino acid sequence of SEQ ID NO: 21. In
another embodiment, the isolated nucleic acid encodes an antibody
heavy chain variable region comprising the amino acid sequence of
SEQ ID NO: 23. In another embodiment, the isolated nucleic acid
encodes the light chain CDR3 comprising the amino acid sequence of
SEQ ID NO: 18. The isolated nucleic acid encoding an antibody light
chain variable region. In another embodiment, the isolated nucleic
acid encodes the CDR2 of the antibody light chain variable region
comprising the amino acid sequence of SEQ ID NO: 20. In another
embodiment, the isolated nucleic acid encodes the CDR1 of the
antibody light chain variable region comprising the amino acid
sequence of SEQ ID NO: 22. In another embodiment, the isolated
nucleic acid encodes an antibody light chain variable region
comprising the amino acid sequence of SEQ ID NO: 24.
[0058] In another embodiment, the invention provides an isolated
human antibody, or an antigen-binding portion thereof, which
[0059] a) inhibits phytohemagglutinin blast proliferation in an in
vitro PHA assay with an IC.sub.50 of 1.times.10.sup.-9 M or
less;
[0060] b) comprises a heavy chain CDR3 comprising the amino acid
sequence of SEQ ID NO: 25, a heavy chain CDR2 comprising the amino
acid sequence of SEQ ID NO: 27 and a heavy chain CDR1 comprising
the amino acid sequence of SEQ ID NO: 29, or a mutant thereof
having one or more amino acid substitutions at a preferred
selective mutagenesis position, contact position or a hypermutation
position, wherein said mutant has a k.sub.off rate no more than
10-fold higher than the antibody comprising a heavy chain CDR3
comprising the amino acid sequence of SEQ ID NO: 25, a heavy chain
CDR2 comprising the amino acid sequence of SEQ ID NO: 27, and a
heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO:
29; and
[0061] c) comprises a light chain CDR3 comprising the amino acid
sequence of SEQ ID NO: 26, a light chain CDR2 comprising the amino
acid sequence of SEQ ID NO: 28, and a light chain CDR1 comprising
the amino acid sequence of SEQ ID NO: 30, or a mutant thereof
having one or more amino acid substitutions at a preferred
selective mutagenesis position, contact position or a hypermutation
position, wherein said mutant has a k.sub.off rate no more than
10-fold higher than the antibody comprising a light chain CDR3
comprising the amino acid sequence of SEQ ID NO: 26, a light chain
CDR2 comprising the amino acid sequence of SEQ ID NO: 28, and a
light chain CDR1 comprising the amino acid sequence of SEQ ID NO:
30.
[0062] A preferred isolated nucleic acid encodes the heavy chain
CDR3 comprising the amino acid sequence of SEQ ID NO: 25. The
isolated nucleic acid encoding an antibody heavy chain variable
region. In another embodiment, the isolated nucleic acid encodes
the CDR2 of the antibody heavy chain variable region comprising the
amino acid sequence of SEQ ID NO: 27. In another embodiment, the
isolated nucleic acid encodes the CDR1 of the antibody heavy chain
variable region comprising the amino acid sequence of SEQ ID NO:
29. In another embodiment, the isolated nucleic acid encodes an
antibody heavy chain variable region comprising the amino acid
sequence of SEQ ID NO: 31. In another embodiment, the isolated
nucleic acid encodes the light chain CDR3 comprising the amino acid
sequence of SEQ ID NO: 26. The isolated nucleic acid encoding an
antibody light chain variable region. In another embodiment, the
isolated nucleic acid encodes the CDR2 of the antibody light chain
variable region comprising the amino acid sequence of SEQ ID NO:
28. In another embodiment, the isolated nucleic acid encodes the
CDR1 of the antibody light chain variable region comprising the
amino acid sequence of SEQ ID NO: 30. In another embodiment, the
isolated nucleic acid encodes an antibody light chain variable
region comprising the amino acid sequence of SEQ ID NO: 32.
[0063] In another aspect, the invention provides an isolated human
antibody, or an antigen-binding portion thereof, which has the
following characteristics: [0064] a) that binds to human IL-12 and
dissociates from human IL-12 with a k.sub.off rate constant of 0.1
s.sup.-1 or less, as determined by surface plasmon resonance, or
which inhibits phytohemagglutinin blast proliferation in an in
vitro phytohemagglutinin blast proliferation assay (PHA assay) with
an IC.sub.50 of 1.times.10.sup.-6M or less. [0065] b) has a heavy
chain variable region comprising an amino acid sequence selected
from a member of the V.sub.H3 germline family, wherein the heavy
chain variable region has a mutation at a preferred selective
mutagenesis position, contact or hypermutation position with an
activity enhancing amino acid residue. [0066] c) has a light chain
variable region comprising an amino acid sequence selected from a
member of the V.sub..lamda.1 germline family, wherein the light
chain variable region has a mutation at a preferred selective
mutagenesis position, contact position or hypermutation position
with an activity enhancing amino acid residue.
[0067] In another embodiment, the invention provides an isolated
human antibody, or an antigen-binding portion thereof, which has
the following characteristics: [0068] a) that binds to human IL-12
and dissociates from human IL-12 with a k.sub.off rate constant of
0.1 s.sup.-1 or less, as determined by surface plasmon resonance,
or which inhibits phytohemagglutinin blast proliferation in an in
vitro phytohemagglutinin blast proliferation assay (PHA assay) with
an IC.sub.50 of 1.times.10.sup.-6M or less. [0069] b) has a heavy
chain variable region comprising an amino acid sequence selected
from the group consisting of SEQ ID NOs: 595-667, wherein the heavy
chain variable region has a mutation at a preferred selective
mutagenesis position, contact position or hypermutation position
with an activity enhancing amino acid residue. [0070] c) has a
light chain variable region comprising an amino acid sequence
selected from the group consisting of SEQ ID NOs: 669-675, wherein
the light chain variable region has a mutation at a preferred
selective mutagenesis position, contact or hypermutation position
with an activity enhancing amino acid residue.
[0071] In another embodiment, the invention provides an isolated
human antibody, or an antigen-binding portion thereof, which has
the following characteristics: [0072] a) that binds to human IL-12
and dissociates from human IL-12 with a k.sub.off rate constant of
0.1 s.sup.-1 or less, as determined by surface plasmon resonance,
or which inhibits phytohemagglutinin blast proliferation in an in
vitro phytohemagglutinin blast proliferation assay (PHA assay) with
an IC.sub.50 of 1.times.10.sup.-6M or less. [0073] b) has a heavy
chain variable region comprising the COS-3 germline amino acid
sequence, wherein the heavy chain variable region has a mutation at
a preferred selective mutagenesis position, contact or
hypermutation position with an activity enhancing amino acid
residue. [0074] c) has a light chain variable region comprising the
DPL8 germline amino acid sequence, wherein the light chain variable
region has a mutation at a preferred selective mutagenesis
position, contact or hypermutation position with an activity
enhancing amino acid residue.
[0075] In another embodiment, the invention provides an isolated
human antibody, or an antigen-binding portion thereof, which has
the following characteristics: [0076] a) that binds to human IL-12
and dissociates from human IL-12 with a k.sub.off rate constant of
0.1 s.sup.-1 or less, as determined by surface plasmon resonance,
or which inhibits phytohemagglutinin blast proliferation in an in
vitro phytohemagglutinin blast proliferation assay (PHA assay) with
an IC.sub.50 of 1.times.10.sup.-6M or less. [0077] b) has a heavy
chain variable region comprising an amino acid sequence selected
from a member of the V.sub.H3 germline family, wherein the heavy
chain variable region comprises a CDR2 that is structurally similar
to CDR2s from other V.sub.H3 germline family members, and a CDR1
that is structurally similar to CDR1s from other V.sub.H3 germline
family members, and wherein the heavy chain variable region has a
mutation at a preferred selective mutagenesis position, contact or
hypermutation position with an activity enhancing amino acid
residue; [0078] c) has a light chain variable region comprising an
amino acid sequence selected from a member of the V.sub..lamda.1
germline family, wherein the light chain variable region comprises
a CDR2 that is structurally similar to CDR2s from other
V.sub..lamda.1 germline family members, and a CDR1 that is
structurally similar to CDR1s from other V.sub..lamda.1 germline
family members, and wherein the light chain variable region has a
mutation at a preferred selective mutagenesis position, contact or
hypermutation position with an activity enhancing amino acid
residue.
[0079] In a preferred embodiment, the isolated human antibody, or
antigen binding portion thereof, has a mutation in the heavy chain
CDR3. In another preferred embodiment, the isolated human antibody,
or antigen binding portion thereof, has a mutation in the light
chain CDR3. In another embodiment, the isolated human antibody, or
antigen binding portion thereof, has a mutation in the heavy chain
CDR2. In another preferred embodiment, the isolated human antibody,
or antigen binding portion thereof, has a mutation in the light
chain CDR2. In another preferred embodiment, the isolated human
antibody, or antigen binding portion thereof, has a mutation in the
heavy chain CDR1. In another preferred embodiment, the isolated
human antibody, or antigen binding portion thereof, has a mutation
in the light chain CDR1.
[0080] In another aspect, the invention provides recombinant
expression vectors carrying the antibody-encoding nucleic acids of
the invention, and host cells into which such vectors have been
introduced, are also encompassed by the invention, as are methods
of making the antibodies of the invention by culturing the host
cells of the invention.
[0081] In another aspect, the invention provides an isolated human
antibody, or antigen-binding portion thereof, that neutralizes the
activity of human IL-12, and at least one additional primate IL-12
selected from the group consisting of baboon IL-12, marmoset IL-12,
chimpanzee IL-12, cynomolgus IL-12 and rhesus IL-12, but which does
not neutralize the activity of the mouse IL-12.
[0082] In another aspect, the invention provides a pharmaceutical
composition comprising the antibody or an antigen binding portion
thereof, of the invention and a pharmaceutically acceptable
carrier.
[0083] In another aspect, the invention provides a composition
comprising the antibody or an antigen binding portion thereof, and
an additional agent, for example, a therapeutic agent.
[0084] In another aspect, the invention provides a method for
inhibiting human IL-12 activity comprising contacting human IL-12
with the antibody of the invention, e.g., J695, such that human
IL-12 activity is inhibited.
[0085] In another aspect, the invention provides a method for
inhibiting human IL-12 activity in a human subject suffering from a
disorder in which IL-12 activity is detrimental, comprising
administering to the human subject the antibody of the invention,
e.g., J695, such that human IL-12 activity in the human subject is
inhibited. The disorder can be, for example, Crohn's disease,
multiple sclerosis or rheumatoid arthritis.
[0086] In another aspect, the invention features a method for
improving the activity of an antibody, or an antigen binding
portion thereof, to attain a predetermined target activity,
comprising:
[0087] a) providing a parent antibody a antigen-binding portion
thereof;
[0088] b) selecting a preferred selective mutagenesis position
selected from group consisting of H30, H31, H31B, H32, H33, H52,
H56, H58, L30, L31, L32, L50, L91, L92, L93, L94.
[0089] c) individually mutating the selected preferred selective
mutagenesis position to at least two other amino acid residues to
hereby create a first panel of mutated antibodies, or antigen
binding portions thereof;
[0090] d) evaluating the activity of the first panel of mutated
antibodies, or antigen binding portions thereof to determined if
mutation of a single selective mutagenesis position produces an
antibody or antigen binding portion thereof with the predetermined
target activity or a partial target activity;
[0091] e) combining in a stepwise fashion, in the parent antibody,
or antigen binding portion thereof, individual mutations shown to
have an improved activity, to form combination antibodies, or
antigen binding portions thereof.
[0092] f) evaluating the activity of the combination antibodies, or
antigen binding portions thereof to determined if the combination
antibodies, or antigen binding portions thereof have the
predetermined target activity or a partial target activity.
[0093] g) if steps d) or f) do not result in an antibody or antigen
binding portion thereof having the predetermined target activity,
or result an antibody with only a partial activity, additional
amino acid residues selected from the group consisting of H35, H50,
H53, H54, H95, H96, H97, H98, L30A and L96 are mutated to at least
two other amino acid residues to thereby create a second panel of
mutated antibodies or antigen-binding portions thereof;
[0094] h) evaluating the activity of the second panel of mutated
antibodies or antigen binding portions thereof, to determined if
mutation of a single amino acid residue selected from the group
consisting of H35, H50, H53, H54, H95, H96, H97, H98, L30A and L96
results an antibody or antigen binding portion thereof, having the
predetermined target activity or a partial activity;
[0095] i) combining in stepwise fashion in the parent antibody, or
antigen-binding portion thereof, individual mutations of step g)
shown to have an improved activity, to form combination antibodies,
or antigen binding portions thereof;
[0096] j) evaluating the activity of the combination antibodies or
antigen binding portions thereof, to determined if the combination
antibodies, or antigen binding portions thereof have the
predetermined target activity or a partial target activity;
[0097] k) if steps h) or j) do not result in an antibody or antigen
binding portion thereof having the predetermined target activity,
or result in an antibody with only a partial activity, additional
amino acid residues selected from the group consisting of H33B,
H52B and L31A are mutated to at least two other amino acid residues
to thereby create a third panel of mutated antibodies or antigen
binding portions thereof;
[0098] l) evaluating the activity of the third panel of mutated
antibodies or antigen binding portions thereof, to determine if a
mutation of a single amino acid residue selected from the group
consisting of H33B, H52B and L31A resulted in an antibody or
antigen binding portion thereof, having the predetermined target
activity or a partial activity;
[0099] m) combining in a stepwise fashion in the parent antibody,
or antigen binding portion thereof, individual mutation of step k)
shown to have an improved activity, to form combination antibodies,
or antigen binding portions, thereof;
[0100] n) evaluating the activity of the combination antibodies or
antigen-binding portions thereof, to determine if the combination
antibodies, or antigen binding portions thereof have the
predetermined target activity to thereby produce an antibody or
antigen binding portion thereof with a predetermined target
activity.
[0101] In another aspect, the invention provides a method for
improving the activity of an antibody, or antigen-binding portion
thereof, comprising:
[0102] a) providing a parent antibody or antigen-binding portion
thereof;
[0103] b) selecting a preferred selective mutagenesis position,
contact or hypermutation position within a complementarity
determining region (CDR) for mutation, thereby identifying a
selected preferred selective mutagenesis position, contact or
hypermutation position;
[0104] c) individually mutating said selected preferred selective
mutagenesis position, contact or hypermutation position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof;
[0105] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof;
[0106] e) repeating steps b) through d) for at least one other
contact or hypermutation position;
[0107] f) combining, in the parent antibody, or antigen-binding
portion thereof, individual mutations shown to have improved
activity, to form combination antibodies, or antigen-binding
portions thereof; and
[0108] g) evaluating the activity of the combination antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof;
until an antibody, or antigen-binding portion thereof, with an
improved activity, relative to the parent antibody, or
antigen-binding portion thereof, is obtained.
[0109] In one embodiment, the invention provides a method for
improving the activity of an antibody, or antigen-binding portion
thereof, comprising:
[0110] a) providing a recombinant parent antibody or
antigen-binding portion thereof; that was obtained by selection in
a phage-display system but whose activity is not further improved
by mutagenesis in said phage-display system;
[0111] b) selecting a preferred selective mutagenesis position,
contact or hypermutation position within a complementarity
determining region (CDR) for mutation, thereby identifying a
selected contact or hypermutation position;
[0112] c) individually mutating said selected preferred selective
mutagenesis position, contact or hypermutation position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof, and expressing
said panel in a non-phage display system;
[0113] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof;
[0114] e) repeating steps b) through d) for at least one other
contact or hypermutation position;
[0115] f) combining, in the parent antibody, or antigen-binding
portion thereof, individual mutations shown to have improved
activity, to form combination antibodies, or antigen-binding
portions thereof; and
[0116] g) evaluating the activity of the combination antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof;
until an antibody, or antigen-binding portion thereof, with an
improved activity, relative to the parent antibody, or
antigen-binding portion thereof, is obtained.
[0117] In a preferred embodiment, the contact positions are
selected from the group consisting of H30, H31, H31B, H32, H33,
H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97, H98, H101,
L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93, L94 and L96.
In another preferred embodiment, the hypermutation positions are
selected from the group consisting of H30, H31, H31B, H32, H52,
H56, H58, L30, L31, L32, L53 and L93. In a more preferred
embodiment the residues for selective mutagenesis are selected from
the preferred selective mutagenesis positions from the group
consisting of H30, H31, H31B, H32, H33, H52, H56, H58, L30, L31,
L32, L50, L91, L92, L93, L94. In a more preferred embodiment, the
contact positions are selected from the group consisting of L50 and
L94.
[0118] In another embodiment, the invention provides a method for
improving the activity of an antibody, or antigen-binding portion
thereof, comprising:
[0119] a) providing a recombinant parent antibody or
antigen-binding portion thereof;
[0120] b) selecting a preferred selective mutagenesis position,
contact or hypermutation position within a complementarity
determining region (CDR) for mutation, thereby identifying a
selected contact or hypermutation position;
[0121] c) individually mutating said selected preferred selective
mutagenesis position, contact or hypermutation position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof and expressing said
panel in an appropriate expression system;
[0122] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof thereby
identifying an activity enhancing amino acid residue;
[0123] e) evaluating the panel of mutated antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof for at least one other property
or characteristics, wherein the property or characteristic is one
that needs to be retained in the antibody;
until an antibody, or antigen-binding portion thereof, with an
improved activity and at least one retained property or
characteristic, relative to the parent antibody, or antigen-binding
portion thereof, is obtained.
[0124] In a preferred embodiment, the contact positions are
selected from the group consisting of H30, H31, H31B, H32, H33,
H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97, H98, H101,
L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93, L94 and L96
and the other characteristic is selected from 1) preservation of
non-crossreactivity with other proteins or human tissues, 2)
preservation of epitope recognition, i.e. recognizing p40 epitope
preferably in the context of the p70 p40/p35 heterodimer preventing
binding interference from free, soluble p40 and/or 3) to produce an
antibody with a close to germline immunoglobulin sequence. In
another preferred embodiment, the hypermutation positions are
selected from the group consisting of H30, H31, H31B, H32, H52,
H56, H58, L30, L31, L32, L53 and L93 and the other characteristic
is selected from 1) preservation of non-crossreactivity with other
proteins or human tissues, 2) preservation of epitope recognition,
i.e. recognizing p40 epitope preferably in the context of the p70
p40/p35 heterodimer preventing binding interference from free,
soluble p40 and/or 3) to produce an antibody with a close to
germline immunoglobulin sequence. In a more preferred embodiment
the residues for selective mutagenesis are selected from the
preferred selective mutagenesis positions from the group consisting
of H30, H31, H31B, H32, H33, H52, H56, H58, L30, L31, L32, L50,
L91, L92, L93, L94 and the other characteristic is selected from 1)
preservation of non-crossreactivity with other proteins or human
tissues, 2) preservation of epitope recognition, i.e. recognizing
p40 epitope preferably in the context of the p70 p40/p35
heterodimer preventing binding interference from free, soluble p40
and/or 3) to produce an antibody with a close to germline
immunoglobulin sequence. In a more preferred embodiment, the
contact positions are selected from the group consisting of L50 and
L94 and the other characteristic is selected from 1) preservation
of non-crossreactivity with other proteins or human tissues, 2)
preservation of epitope recognition, i.e. recognizing p40 epitope
preferably in the context of the p70 p40/p35 heterodimer preventing
binding interference from free, soluble p40 and/or 3) to produce an
antibody with a close to germline immunoglobulin sequence.
[0125] In another embodiment of the invention provides a method for
improving the activity of an antibody, or antigen-binding portion
thereof, comprising:
[0126] a) providing a recombinant parent antibody or
antigen-binding portion thereof; that was obtained by selection in
a phage-display system but whose activity cannot be further
improved by mutagenesis in said phage-display system;
[0127] b) selecting a preferred selective mutagenesis position,
contact or hypermutation position within a complementarity
determining region (CDR) for mutation, thereby identifying a
selected preferred selective mutagenesis position, contact or
hypermutation position;
[0128] c) individually mutating said selected preferred selective
mutagenesis position, contact or hypermutation position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof, and expressing
said panel in a non-phage display system;
[0129] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof thereby
identifying an activity enhancing amino acid residue;
[0130] e) evaluating the panel of mutated antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof for at least one other property
or characteristic, wherein the property or characteristic is one
that needs to be retained, until an antibody, or antigen-binding
portion thereof, with an improved activity and at least one
retained property or characteristic, relative to the parent
antibody, or antigen-binding portion thereof, is obtained.
[0131] f) repeating steps a) through e) for at least one other
preferred selective mutagenesis position, contact or hypermutation
position;
[0132] g) combining, in the parent antibody, or antigen-binding
portion thereof, at least two individual activity enhancing amino
acid residues shown to have improved activity and at least on
retained property or characteristic, to form combination
antibodies, or antigen-binding portions thereof; and
[0133] h) evaluating the activity of the combination antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof;
until an antibody, or antigen-binding portion thereof, with an
improved activity and at least one retained property or
characteristic, relative to the parent antibody, or antigen-binding
portion thereof, is obtained.
[0134] In a preferred embodiment, the contact positions are
selected from the group consisting of H30, H31, H31B, H32, H33,
H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97, H98, H101,
L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93, L94 and L96
and the other characteristic is selected from 1) preservation of
non-crossreactivity with other proteins or human tissues, 2)
preservation of epitope recognition, i.e. recognizing p40 epitope
preferably in the context of the p70 p40/p35 heterodimer preventing
binding interference from free, soluble p40 and/or 3) to produce an
antibody with a close to germline immunoglobulin sequence. In
another preferred embodiment, the hypermutation positions are
selected from the group consisting of H30, H31, H31B, H32, H52,
H56, H58, L30, L31, L32, L53 and L93 and the other characteristic
is selected from 1) preservation of non-crossreactivity with other
proteins or human tissues, 2) preservation of epitope recognition,
i.e. recognizing p40 epitope preferably in the context of the p70
p40/p35 heterodimer preventing binding interference from free,
soluble p40 and/or 3) to produce an antibody with a close to
germline immunoglobulin sequence. In a more preferred embodiment
the residues for selective mutagenesis are selected from the
preferred selective mutagenesis positions from the group consisting
of H30, H31, H31B, H32, H33, H52, H56, H58, L30, L31, L32, L50,
L91, L92, L93, L94 and the other characteristic is selected from 1)
preservation of non-crossreactivity with other proteins or human
tissues, 2) preservation of epitope recognition, i.e. recognizing
p40 epitope preferably in the context of the p70 p40/p35
heterodimer preventing binding interference from free, soluble p40
and/or 3) to produce an antibody with a close to germline
immunoglobulin sequence. In a more preferred embodiment, the
contact positions are selected from the group consisting of L50 and
L94 and the other characteristic is selected from 1) preservation
of non-crossreactivity with other proteins or human tissues, 2)
preservation of epitope recognition, i.e. recognizing p40 epitope
preferably in the context of the p70 p40/p35 heterodimer preventing
binding interference from free, soluble p40 and/or 3) to produce an
antibody with a close to germline immunoglobulin sequence.
[0135] In another embodiment, the invention provides a method for
improving the activity of an antibody, or antigen-binding portion
thereof, comprising:
[0136] a) providing a recombinant parent antibody or
antigen-binding portion thereof; that was obtained by selection in
a phage-display system but whose activity cannot be further
improved by mutagenesis in said phage-display system;
[0137] b) selecting a contact or hypermutation position within a
complementarity determining region (CDR) for mutation, thereby
identifying a selected contact or hypermutation position;
[0138] c) individually mutating said selected contact or
hypermutation position to at least two other amino acid residues to
thereby create a panel of mutated antibodies, or antigen-binding
portions thereof, and expressing said panel in a non-phage display
system;
[0139] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof thereby
identifying an activity enhancing amino acid residue;
[0140] e) evaluating the panel of mutated antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof for at least one other property
or characteristics, wherein the property or characteristic is one
that needs to be retained;
until an antibody, or antigen-binding portion thereof, with an
improved activity and at least one retained property or
characteristic, relative to the parent antibody, or antigen-binding
portion thereof, is obtained.
[0141] In a preferred embodiment, the contact positions are
selected from the group consisting of H30, H31, H31B, H32, H33,
H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97, H98, H101,
L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93, L94 and L96
and the other characteristic is selected from 1) preservation of
non-crossreactivity with other proteins or human tissues, 2)
preservation of epitope recognition, i.e. recognizing p40 epitope
preferably in the context of the p70 p40/p35 heterodimer preventing
binding interference from free, soluble p40 and/or 3) to produce an
antibody with a close to germline immunoglobulin sequence. In
another preferred embodiment, the hypermutation positions are
selected from the group consisting of H30, H31, H31B, H32, H52,
H56, H58, L30, L31, L32, L53 and L93 and the other characteristic
is selected from 1) preservation of non-crossreactivity with other
proteins or human tissues, 2) preservation of epitope recognition,
i.e. recognizing p40 epitope preferably in the context of the p70
p40/p35 heterodimer preventing binding interference from free,
soluble p40 and/or 3) to produce an antibody with a close to
germline immunoglobulin sequence. In a more preferred embodiment
the residues for selective mutagenesis are selected from the
preferred selective mutagenesis positions from the group consisting
of H30, H31, H31B, H32, H33, H52, H56, H58, L30, L31, L32, L50,
L91, L92, L93, L94 and the other characteristic is selected from 1)
preservation of non-crossreactivity with other proteins or human
tissues, 2) preservation of epitope recognition, i.e. recognizing
p40 epitope preferably in the context of the p70 p40/p35
heterodimer preventing binding interference from free, soluble p40
and/or 3) to produce an antibody with a close to germline
immunoglobulin sequence. In a more preferred embodiment, the
contact positions are selected from the group consisting of L50 and
L94 and the other characteristic is selected from 1) preservation
of non-crossreactivity with other proteins or human tissues, 2)
preservation of epitope recognition, i.e. recognizing p40 epitope
preferably in the context of the p70 p40/p35 heterodimer preventing
binding interference from free, soluble p40 and/or 3) to produce an
antibody with a close to germline immunoglobulin sequence.
[0142] In another embodiment, the invention provides a method for
improving the activity of an antibody, or antigen-binding portion
thereof, comprising:
[0143] a) providing a recombinant parent antibody or
antigen-binding portion thereof; that was obtained by selection in
a phage-display system but whose activity cannot be further
improved by mutagenesis in said phage-display system;
[0144] b) selecting a preferred selective mutagenesis position,
contact or hypermutation position within a complementarity
determining region (CDR) for mutation, thereby identifying a
selected preferred selective mutagenesis position contact or
hypermutation position;
[0145] c) individually mutating said selected preferred selective
mutagenesis position, contact or hypermutation position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof, and expressing
said panel in a non-phage display system;
[0146] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof thereby
identifying an activity enhancing amino acid residue;
[0147] e) evaluating the panel of mutated antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof for at least one other property
or characteristic, wherein the property or characteristic is one
that needs to be retained, until an antibody, or antigen-binding
portion thereof, with an improved activity and at least one
retained property or characteristic, relative to the parent
antibody, or antigen-binding portion thereof, is obtained.
[0148] f) repeating steps a) through e) for at least one other
preferred selective mutagenesis position, contact or hypermutation
position;
[0149] g) combining, in the parent antibody, or antigen-binding
portion thereof, at least two individual activity enhancing amino
acid residues shown to have improved activity and at least on
retained other characteristic, to form combination antibodies, or
antigen-binding portions thereof; and
[0150] h) evaluating the activity of the combination antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof;
until an antibody, or antigen-binding portion thereof, with an
improved activity and at least one retained property or
characteristic, relative to the parent antibody, or antigen-binding
portion thereof, is obtained.
[0151] In a preferred embodiment, the contact positions are
selected from the group consisting of H30, H31, H31B, H32, H33,
H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97, H98, H101,
L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93, L94 and L96
and the other characteristic is selected from 1) preservation of
non-crossreactivity with other proteins or human tissues, 2)
preservation of epitope recognition, i.e. recognizing p40 epitope
preferably in the context of the p70 p40/p35 heterodimer preventing
binding interference from free, soluble p40 and/or 3) to produce an
antibody with a close to germline immunoglobulin sequence. In
another preferred embodiment, the hypermutation positions are
selected from the group consisting of H30, H31, H31B, H32, H52,
H56, H58, L30, L31, L32, L53 and L93 and the other characteristic
is selected from 1) preservation of non-crossreactivity with other
proteins or human tissues, 2) preservation of epitope recognition,
i.e. recognizing p40 epitope preferably in the context of the p70
p40/p35 heterodimer preventing binding interference from free,
soluble p40 and/or 3) to produce an antibody with a close to
germline immunoglobulin sequence. In a more preferred embodiment
the residues for selective mutagenesis are selected from the
preferred selective mutagenesis positions from the group consisting
of H30, H31, H31B, H32, H33, H52, H56, H58, L30, L31, L32, L50,
L91, L92, L93, L94 and the other characteristic is selected from 1)
preservation of non-crossreactivity with other proteins or human
tissues, 2) preservation of epitope recognition, i.e. recognizing
p40 epitope preferably in the context of the p70 p40/p35
heterodimer preventing binding interference from free, soluble p40
and/or 3) to produce an antibody with a close to germline
immunoglobulin sequence. In a more preferred embodiment, the
contact positions are selected from the group consisting of L50 and
L94 and the other characteristic is selected from 1) preservation
of non-crossreactivity with other proteins or human tissues, 2)
preservation of epitope recognition, i.e. recognizing p40 epitope
preferably in the context of the p70 p40/p35 heterodimer preventing
binding interference from free, soluble p40 and/or 3) to produce an
antibody with a close to germline immunoglobulin sequence.
[0152] In another embodiment, the invention provides a method for
improving the activity of an antibody, or antigen-binding portion
thereof, comprising:
[0153] a) providing a parent antibody or antigen-binding portion
thereof;
[0154] b) selecting an amino acid residue within a complementarity
determining region (CDR) for mutation other than H30, H31, H31B,
H32, H33, H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97,
H98, H101, L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93,
L94 and L96;
[0155] c) individually mutating said selected position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof;
[0156] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof thereby
identifying an activity enhancing amino acid residue;
[0157] e) evaluating the panel of mutated antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof, for changes in at least one
other property or characteristic;
until an antibody, or antigen-binding portion thereof, with an
improved activity, relative to the parent antibody, or
antigen-binding portion thereof, is obtained.
[0158] Preferably, the other characteristic or property is selected
from 1) preservation of non-crossreactivity with other proteins or
human tissues, 2) preservation of epitope recognition, i.e.
recognizing p40 epitope preferably in the context of the p70
p40/p35 heterodimer preventing binding interference from free,
soluble p40 and/or 3) to produce an antibody with a close to
germline immunoglobulin sequence
[0159] In another embodiment, the invention provides a method for
improving the activity of an antibody, or antigen-binding portion
thereof, comprising:
[0160] a) providing a parent antibody or antigen-binding portion
thereof;
[0161] b) selecting an amino acid residue within a complementarity
determining region (CDR) for mutation other than H30, H31, H31B,
H32, H33, H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97,
H98, H101, L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93,
L94 and L96;
[0162] c) individually mutating said selected position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof;
[0163] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof, thereby
identifying an activity enhancing amino acid residue;
[0164] e) repeating steps b) through d) for at least one other CDR
position which is neither the position selected under b) nor a
position at H30, H31, H31B, H32, H33, H35, H50, H52, H52A, H53,
H54, H56, H58, H95, H96, H97, H98, H101, L30, L31, L32, L34, L50,
L52, L53, L55, L91, L92, L93, L94 and L96;
[0165] f) combining, in the parent antibody, or antigen-binding
portion thereof, at least two individual activity enhancing amino
acid residues shown to have improved activity, to form combination
antibodies, or antigen-binding portions thereof; and
[0166] g) evaluating the activity of the combination antibodies, or
antigen-binding portions thereof with two activity enhancing amino
acid residues, relative to the parent antibody or antigen-binding
portion thereof until an antibody, or antigen-binding portion
thereof, with an improved activity, relative to the parent
antibody, or antigen-binding portion thereof, is obtained.
[0167] In another embodiment, the invention provides a method for
improving the activity of an antibody, or antigen-binding portion
thereof, comprising:
[0168] a) providing a recombinant parent antibody or
antigen-binding portion thereof; that was obtained by selection in
a phage-display system but whose activity cannot be further
improved by mutagenesis in said phage-display system;
[0169] b) selecting an amino acid residue within a complementarity
determining region (CDR) for mutation other than H30, H31, H31B,
H32, H33, H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97,
H98, H101, L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93,
L94 and;
[0170] c) individually mutating said selected contact or
hypermutation position to at least two other amino acid residues to
thereby create a panel of mutated antibodies, or antigen-binding
portions thereof, and expressing said panel in a non-phage display
system;
[0171] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof thereby
identifying an activity enhancing amino acid residue;
[0172] e) evaluating the panel of mutated antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof, for changes in at least one
other property or characteristic until an antibody, or
antigen-binding portion thereof, with an improved activity,
relative to the parent antibody, or antigen-binding portion
thereof, is obtained.
[0173] Preferably, the other characteristic or property is selected
from 1) preservation of non-crossreactivity with other proteins or
human tissues, 2) preservation of epitope recognition, i.e.
recognizing p40 epitope preferably in the context of the p70
p40/p35 heterodimer preventing binding interference from free,
soluble p40 and/or 3) to produce an antibody with a close to
germline immunoglobulin sequence.
[0174] In another embodiment, the invention provides a method for
improving the activity of an antibody, or antigen-binding portion
thereof, comprising:
[0175] a) providing a parent antibody or antigen-binding portion
thereof that was obtained by selection in a phage-display system
but whose activity cannot be further improved by mutagenesis in
said phage-display system;
[0176] b) selecting an amino acid residue within a complementarity
determining region (CDR) for mutation other than H30, H31, H31B,
H32, H33, H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97,
H98, H101, L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93,
L94 and L96;
[0177] c) individually mutating said selected position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof and expression in a
non-phage display system;
[0178] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof thereby
identifying an activity enhancing amino acid residue;
[0179] e) repeating steps b) through d) for at least one other
position within the CDR which is neither the position selected
under b) nor a position at H30, H31, H31B, H32, H33, H35, H50, H52,
H52A, H53, H54, H56, H58, H95, H96, H97, H98, H101, L30, L31, L32,
L34, L50, L52, L53, L55, L91, L92, L93, L94;
[0180] f) combining, in the parent antibody, or antigen-binding
portion thereof, at least two individual activity enhancing amino
acid residues shown to have improved activity, to form combination
antibodies, or antigen-binding portions thereof; and
[0181] g) evaluating the activity and other property or
characteristic of the combination antibodies, or antigen-binding
portions thereof with two activity enhancing amino acid residues,
relative to the parent antibody or antigen-binding portion
thereof;
until an antibody, or antigen-binding portion thereof, with an
improved activity, relative to the parent antibody, or
antigen-binding portion thereof, is obtained.
[0182] Preferably, the other characteristic or property is selected
from 1) preservation of non-crossreactivity with other proteins or
human tissues, 2) preservation of epitope recognition, i.e.
recognizing p40 epitope preferably in the context of the p70
p40/p35 heterodimer preventing binding interference from free,
soluble p40 and/or 3) to produce an antibody with a close to
germline immunoglobulin sequence.
[0183] In another embodiment, the invention provides a method for
improving the activity of an antibody, or antigen-binding portion
thereof, comprising:
[0184] a) providing a parent antibody or antigen-binding portion
thereof;
[0185] b) selecting an amino acid residue within a complementarity
determining region (CDR) for mutation other than H30, H31, H31B,
H32, H33, H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97,
H98, H101, L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93,
L94 and L96;
[0186] c) individually mutating said selected position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof;
[0187] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof, thereby
identifying an activity enhancing amino acid residue;
[0188] e) evaluating the panel of mutated antibodies or
antigen-binding portions thereof, relative to the parent antibody
or antigen-portion thereof, for changes in at least one other
property or characteristic;
[0189] f) repeating steps b) through e) for at least one other CDR
position which is neither the position selected under b) nor a
position at H30, H31, H31B, H32, H33, H35, H50, H52, H52A, H53,
H54, H56, H58, H95, H96, H97, H98, H101, L30, L31, L32, L34, L50,
L52, L53, L55, L91, L92, L93, L94 and L96;
[0190] g) combining, in the parent antibody, or antigen-binding
portion thereof, at least two individual activity enhancing amino
acid residues shown to have improved activity and not affecting at
least one other property or characteristic, to form combination
antibodies, or antigen-binding portions thereof; and
[0191] h) evaluating the activity and the retention of at least one
other characteristic or property of the combination antibodies, or
antigen-binding portions thereof with two activity enhancing amino
acid residues, relative to the parent antibody or antigen-binding
portion thereof until an antibody, or antigen-binding portion
thereof, with an improved activity and at least one retained
property or characteristic, relative to the parent antibody, or
antigen-binding portion thereof, is obtained.
[0192] In another embodiment the invention provides a method to
improve the affinity of an antibody or antigen-binding portion
thereof, comprising:
[0193] a) providing a parent antibody or antigen-binding portion
thereof that was obtained by selection in a phage-display system
but whose activity cannot be further improved by mutagenesis in
said phage-display system;
[0194] b) selecting an amino acid residue within a complementarity
determining region (CDR) for mutation other than H30, H31, H31B,
H32, H33, H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97,
H98, H101, L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93,
L94 and L96;
[0195] c) individually mutating said selected position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof and expression in a
non-phage display system;
[0196] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof thereby
identifying an activity enhancing amino acid residue;
[0197] e) evaluating the panel of mutated antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof, for changes in at least one
other characteristic or property until an antibody, or
antigen-binding portion thereof, with an improved activity,
relative to the parent antibody, or antigen-binding portion
thereof, is obtained.
[0198] In another embodiment, the invention provides a method for
improving the activity of an antibody, or antigen-binding portion
thereof, comprising:
[0199] a) providing a parent antibody or antigen-binding portion
thereof;
[0200] b) selecting an amino acid residue within a complementarity
determining region (CDR) for mutation at a position other than H30,
H31, H31B, H32, H33, H35, H50, H52, H52A, H53, H54, H56, H58, H95,
H96, H97, H98, H101, L30, L31, L32, L34, L50, L52, L53, L55, L91,
L92, L93, L94 and L96;
[0201] c) individually mutating said selected position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof;
[0202] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof, thereby
identifying an activity enhancing amino acid residue;
[0203] e) evaluating the panel of mutated antibodies or
antigen-binding portions thereof, relative to the parent antibody
or antigen-portion thereof, for changes in at least one other
property or characteristic;
[0204] f) repeating steps b) through e) for at least one other CDR
position which is neither the position selected under b) nor a
position at H30, H31, H31B, H32, H33, H35, H50, H52, H52A, H53,
H54, H56, H58, H95, H96, H97, H98, H101, L30, L31, L32, L34, L50,
L52, L53, L55, L91, L92, L93, L94 and L96;
[0205] g) combining, in the parent antibody, or antigen-binding
portion thereof, at least two individual activity enhancing amino
acid residues shown to have improved activity but not affecting at
least one other property or characteristic, to form combination
antibodies, or antigen-binding portions thereof with at least one
retained property or characteristic; and
[0206] h) evaluating the activity and the retention of at least one
property of characteristic of the combination antibodies, or
antigen-binding portions thereof with two activity enhancing amino
acid residues, relative to the parent antibody or antigen-binding
portion thereof until an antibody, or antigen-binding portion
thereof, with an improved activity and at least one retained
property or characteristic, relative to the parent antibody, or
antigen-binding portion thereof, is obtained.
[0207] Preferably, the other characteristic or property is selected
from 1) preservation of non-crossreactivity with other proteins or
human tissues, 2) preservation of epitope recognition, i.e.
recognizing p40 epitope preferably in the context of the p70
p40/p35 heterodimer preventing binding interference from free,
soluble p40 and/or 3) to produce an antibody with a close to
germline immunoglobulin sequence
[0208] In another embodiment, the invention provides a method for
improving the activity of an antibody, or antigen-binding portion
thereof, without affecting other characteristics, comprising:
[0209] a) providing a parent antibody or antigen-binding portion
thereof;
[0210] b) selecting an amino acid residue within a complementarity
determining region (CDR) for mutation other than H30, H31, H31B,
H32, H33, H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97,
H98, H101, L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93,
L94 and L96;
[0211] c) individually mutating said selected position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof;
[0212] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof thereby
identifying an activity enhancing amino acid residue;
[0213] e) evaluating the panel of mutated antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof, for changes in at least one
other property or characteristic until an antibody, or
antigen-binding portion thereof, with an improved activity and
retained other characteristic or property, relative to the parent
antibody, or antigen-binding portion thereof, is obtained.
[0214] In another embodiment, the invention provides a method for
improving the activity of an antibody, or antigen-binding portion
thereof, comprising:
[0215] a) providing a parent antibody or antigen-binding portion
thereof that was obtained by selection in a phage-display system
but whose activity cannot be further improved by mutagenesis in
said phage-display system;
[0216] b) selecting an amino acid residue within a complementarity
determining region (CDR) for mutation other than H30, H31, H31B,
H32, H33, H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97,
H98, H101, L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93,
L94 and L96;
[0217] c) individually mutating said selected position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof and expression in a
non-phage display system;
[0218] d) evaluating the activity and retention of at least one
other characteristic or property of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof, thereby
identifying an activity enhancing amino acid residue;
[0219] e) repeating steps b) through d) for at least one other CDR
position which is neither the position selected under b nor other
than H30, H31, H31B, H32, H33, H35, H50, H52, H52A, H53, H54, H56,
H58, H95, H96, H97, H98, H101, L30, L31, L32, L34, L50, L52, L53,
L55, L91, L92, L93, L94 and L96;
[0220] f) combining, in the parent antibody, or antigen-binding
portion thereof, at least two individual activity enhancing amino
acid residues shown to have improved activity and not to affect at
least one other characteristic or property, to form combination
antibodies, or antigen-binding portions thereof; and
[0221] g) evaluating the activity and retention of at least one
other characteristic or property of the combination antibodies, or
antigen-binding portions thereof with two activity enhancing amino
acid residues, relative to the parent antibody or antigen-binding
portion thereof until an antibody, or antigen-binding portion
thereof, with an improved activity and at least one other retained
characteristic or property, relative to the parent antibody, or
antigen-binding portion thereof, is obtained.
[0222] Preferably, the other characteristic or property is selected
from 1) preservation of non-crossreactivity with other proteins or
human tissues, 2) preservation of epitope recognition, i.e.
recognizing p40 epitope preferably in the context of the p70
p40/p35 heterodimer preventing binding interference from free,
soluble p40 and/or 3) to produce an antibody with a close to
germline immunoglobulin sequence
BRIEF DESCRIPTION OF THE DRAWINGS
[0223] FIGS. 1A-1B show the heavy chain variable region amino acid
sequence alignments of a series of human antibodies that bind human
IL-12 compared to germline sequences Cos-3/JH3 and Dpl18 Lv1042.
Kabat numbering is used to identify amino acid positions. For the
Joe 9 wild type, the full sequence is shown. For the other
antibodies, only those amino acids positions that differ from Joe 9
wild type are shown.
[0224] FIGS. 1C-1D show the light chain variable region amino acid
sequence alignments of a series of human antibodies that bind human
IL-12. Kabat numbering is used to identify amino acid positions.
For the Joe 9 wild type, the full sequence is shown. For the other
antibodies, only those amino acids positions that differ from Joe 9
wild type are shown.
[0225] FIGS. 2A-2E show the CDR positions in the heavy chain of the
Y61 antibody that were mutated by site-directed mutagenesis and the
respective amino acid substitutions at each position. The graphs at
the right of the figures show the off-rates for the substituted
antibodies (black bars) as compared to unmutated Y61 (open
bar).
[0226] FIGS. 2F-2H show the CDR positions in the light chain of the
Y61 antibody that were mutated by site-directed mutagenesis and the
respective amino acid substitutions at each position. The graphs at
the right of the figures show the off-rates for the substituted
antibodies (black bars) as compared to unmutated Y61 (open
bar).
[0227] FIG. 3 demonstrates the in vivo efficacy of the human
anti-IL-12 antibody J695, on plasma neopterin levels in cynomolgus
monkeys.
[0228] FIG. 4 shows a graph of mean arthritic score versus days
after immunization of mice with collagen, demonstrating that
treatment with C17.15 significantly decreases arthritis-related
symptoms as compared to treatment with rat IgG.
DETAILED DESCRIPTION OF THE INVENTION
[0229] In order that the present invention may be more readily
understood, certain terms are first defined.
[0230] The term "activity enhancing amino acid residue" includes an
amino acid residue which improves the activity of the antibody. It
should be understood that the activity enhancing amino acid residue
may replace an amino acid residue at a contact, hypermutation or
preferred selective mutagenesis position and, further, more than
one activity enhancing amino acid residue can be present within one
or more CDRs. An activity enhancing amino acid residue include, an
amino acid residue that improves the binding specificity/affinity
of an antibody, for example anti-human IL-12 antibody binding to
human IL-12. The activity enhancing amino acid residue is also
intended to include an amino acid residue that improves the
neutralization potency of an antibody, for example, the human IL-12
antibody which inhibits human IL-12.
[0231] The term "antibody" includes an immunoglobulin molecule
comprised of four polypeptide chains, two heavy (H) chains and two
light (L) chains inter-connected by disulfide bonds. Each heavy
chain is comprised of a heavy chain variable region (abbreviated
herein as HCVR or VH) and a heavy chain constant region. The heavy
chain constant region is comprised of three domains, CH1, CH2 and
CH3. Each light chain is comprised of a light chain variable region
(abbreviated herein as LCVR or VL) and a light chain constant
region. The light chain constant region is comprised of one domain,
CL. The VH and VL regions can be further subdivided into regions of
hypervariability, termed complementarity determining regions
(CDRs), interspersed with regions that are more conserved, termed
framework regions (FR). Each VH and VL is composed of three CDRs
and four FRs, arranged from amino-terminus to carboxy-terminus in
the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
[0232] The term "antigen-binding portion" of an antibody (or
"antibody portion") includes fragments of an antibody that retain
the ability to specifically bind to an antigen (e.g., hIL-12). It
has been shown that the antigen-binding function of an antibody can
be performed by fragments of a full-length antibody. Examples of
binding fragments encompassed within the term "antigen-binding
portion" of an antibody include (i) a Fab fragment, a monovalent
fragment consisting of the VL, VH, CL and CH1 domains; (ii) a
F(ab').sub.2 fragment, a bivalent fragment comprising two Fab
fragments linked by a disulfide bridge at the hinge region; (iii) a
Fd fragment consisting of the VH and CH1 domains; (iv) a Fv
fragment consisting of the VL and VH domains of a single arm of an
antibody, (v) a dAb fragment (Ward et al., (1989) Nature
341:544-546), which consists of a VH domain; and (vi) an isolated
complementarity determining region (CDR). Furthermore, although the
two domains of the Fv fragment, VL and VH, are coded for by
separate genes, they can be joined, using recombinant methods, by a
synthetic linker that enables them to be made as a single protein
chain in which the VL and VH regions pair to form monovalent
molecules (known as single chain Fv (scFv); see e.g., Bird et al.
(1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl.
Acad. Sci. USA 85:5879-5883). Such single chain antibodies are also
intended to be encompassed within the term "antigen-binding
portion" of an antibody. Other forms of single chain antibodies,
such as diabodies are also encompassed. Diabodies are bivalent,
bispecific antibodies in which VH and VL domains are expressed on a
single polypeptide chain, but using a linker that is too short to
allow for pairing between the two domains on the same chain,
thereby forcing the domains to pair with complementary domains of
another chain and creating two antigen binding sites (see e.g.,
Holliger, P., et al. (1993) Proc. Nat. Acad. Sci. USA 90:6444-6448;
Poljak, R. J., et al. (1994) Structure 2:1121-1123). Still further,
an antibody or antigen-binding portion thereof may be part of a
larger immunoadhesion molecules, formed by covalent or non-covalent
association of the antibody or antibody portion with one or more
other proteins or peptides. Examples of such immunoadhesion
molecules include use of the streptavidin core region to make a
tetrameric scFv molecule (Kipriyanov, S. M., et al. (1995) Human
Antibodies and Hybridomas 6:93-101) and use of a cysteine residue,
a marker peptide and a C-terminal polyhistidine tag to make
bivalent and biotinylated scFv molecules (Kipriyanov, S. M., et al.
(1994) Mol. Immunol. 31:1047-1058). Antibody portions, such as Fab
and F(ab').sub.2 fragments, can be prepared from whole antibodies
using conventional techniques, such as papain or pepsin digestion,
respectively, of whole antibodies. Moreover, antibodies, antibody
portions and immunoadhesion molecules can be obtained using
standard recombinant DNA techniques, as described herein. Preferred
antigen binding portions are complete domains or pairs of complete
domains.
[0233] The term "backmutation" refers to a process in which some or
all of the somatically mutated amino acids of a human antibody are
replaced with the corresponding germline residues from a homologous
germline antibody sequence. The heavy and light chain sequences of
the human antibody of the invention are aligned separately with the
germline sequences in the VBASE database to identify the sequences
with the highest homology. Differences in the human antibody of the
invention are returned to the germline sequence by mutating defined
nucleotide positions encoding such different amino acid. The role
of each amino acid thus identified as candidate for backmutation
should be investigated for a direct or indirect role in antigen
binding and any amino acid found after mutation to affect any
desirable characteristic of the human antibody should not be
included in the final human antibody; as an example, activity
enhancing amino acids identified by the selective mutagenesis
approach will not be subject to backmutation. To minimize the
number of amino acids subject to backmutation those amino acid
positions found to be different from the closest germline sequence
but identical to the corresponding amino acid in a second germline
sequence can remain, provided that the second germline sequence is
identical and colinear to the sequence of the human antibody of the
invention for at least 10, preferably 12 amino acids, on both sides
of the amino acid in question. Backmutation may occur at any stage
of antibody optimization; preferably, backmutation occurs directly
before or after the selective mutagenesis approach. More
preferably, backmutation occurs directly before the selective
mutagenesis approach.
[0234] The phrase "human interleukin 12" (abbreviated herein as
hIL-12, or IL-12), as used herein, includes a human cytokine that
is secreted primarily by macrophages and dendritic cells. The term
includes a heterodimeric protein comprising a 35 kD subunit (p35)
and a 40 kD subunit (p40) which are both linked together with a
disulfide bridge. The heterodimeric protein is referred to as a
"p70 subunit". The structure of human IL-12 is described further
in, for example, Kobayashi, et al. (1989) J. Exp Med. 170:827-845;
Seder, et al. (1993) Proc. Natl. Acad. Sci. 90:10188-10192; Ling,
et al. (1995) J. Exp Med. 154:116-127; Podlaski, et al. (1992)
Arch. Biochem. Biophys. 294:230-237. The term human IL-12 is
intended to include recombinant human IL-12 (rh IL-12), which can
be prepared by standard recombinant expression methods.
[0235] The terms "Kabat numbering", "Kabat definitions" and "Kabat
labeling" are used interchangeably herein. These terms, which are
recognized in the art, refer to a system of numbering amino acid
residues which are more variable (i.e. hypervariable) than other
amino acid residues in the heavy and light chain variable regions
of an antibody, or an antigen binding portion thereof (Kabat et al.
(1971) Ann. NY Acad, Sci. 190:382-391 and, Kabat, E. A., et al.
(1991) Sequences of Proteins of Immunological Interest, Fifth
Edition, U.S. Department of Health and Human Services, NIH
Publication No. 91-3242). For the heavy chain variable region, the
hypervariable region ranges from amino acid positions 31 to 35 for
CDR1, amino acid positions 50 to 65 for CDR2, and amino acid
positions 95 to 102 for CDR3. For the light chain variable region,
the hypervariable region ranges from amino acid positions 24 to 34
for CDR1, amino acid positions 50 to 56 for CDR2, and amino acid
positions 89 to 97 for CDR3.
[0236] The Kabat numbering is used herein to indicate the positions
of amino acid modifications made in antibodies of the invention.
For example, the Y61 anti-IL-12 antibody can be mutated from serine
(S) to glutamic acid (E) at position 31 of the heavy chain CDR1
(H31S.fwdarw.E), or glycine (G) can be mutated to tyrosine (Y) at
position 94 of the light chain CDR3 (L94G.fwdarw.Y).
[0237] The term "human antibody" includes antibodies having
variable and constant regions corresponding to human germline
immunoglobulin sequences as described by Kabat et al. (See Kabat,
et al. (1991) Sequences of Proteins of Immunological Interest,
Fifth Edition, U.S. Department of Health and Human Services, NIH
Publication No. 91-3242). The human antibodies of the invention may
include amino acid residues not encoded by human germline
immunoglobulin sequences (e.g., mutations introduced by random or
site-specific mutagenesis in vitro or by somatic mutation in vivo),
for example in the CDRs and in particular CDR3. The mutations
preferably are introduced using the "selective mutagenesis
approach" described herein. The human antibody can have at least
one position replaced with an amino acid residue, e.g., an activity
enhancing amino acid residue which is not encoded by the human
germline immunoglobulin sequence. The human antibody can have up to
twenty positions replaced with amino acid residues which are not
part of the human germline immunoglobulin sequence. In other
embodiments, up to ten, up to five, up to three or up to two
positions are replaced. In a preferred embodiment, these
replacements are within the CDR regions as described in detail
below. However, the term "human antibody", as used herein, is not
intended to include antibodies in which CDR sequences derived from
the germline of another mammalian species, such as a mouse, have
been grafted onto human framework sequences.
[0238] The phrase "recombinant human antibody" includes human
antibodies that are prepared, expressed, created or isolated by
recombinant means, such as antibodies expressed using a recombinant
expression vector transfected into a host cell (described further
in Section II, below), antibodies isolated from a recombinant,
combinatorial human antibody library (described further in Section
III, below), antibodies isolated from an animal (e.g., a mouse)
that is transgenic for human immunoglobulin genes (see e.g.,
Taylor, L. D., et al. (1992) Nucl. Acids Res. 20:6287-6295) or
antibodies prepared, expressed, created or isolated by any other
means that involves splicing of human immunoglobulin gene sequences
to other DNA sequences. Such recombinant human antibodies have
variable and constant regions derived from human germline
immunoglobulin sequences (See Kabat, E. A., et al. (1991) Sequences
of Proteins of Immunological Interest, Fifth Edition, U.S.
Department of Health and Human Services, NIH Publication No.
91-3242). In certain embodiments, however, such recombinant human
antibodies are subjected to in vitro mutagenesis (or, when an
animal transgenic for human Ig sequences is used, in vivo somatic
mutagenesis) and thus the amino acid sequences of the VH and VL
regions of the recombinant antibodies are sequences that, while
derived from and related to human germline VH and VL sequences, may
not naturally exist within the human antibody germline repertoire
in vivo. In certain embodiments, however, such recombinant
antibodies are the result of selective mutagenesis approach or
backmutation or both.
[0239] An "isolated antibody" includes an antibody that is
substantially free of other antibodies having different antigenic
specificities (e.g., an isolated antibody that specifically binds
hIL-12 is substantially free of antibodies that specifically bind
antigens other than hIL-12). An isolated antibody that specifically
binds hIL-12 may bind IL-12 molecules from other species (discussed
in further detail below). Moreover, an isolated antibody may be
substantially free of other cellular material and/or chemicals.
[0240] A "neutralizing antibody" (or an "antibody that neutralized
hIL-12 activity") includes an antibody whose binding to hIL-12
results in inhibition of the biological activity of hIL-12. This
inhibition of the biological activity of hIL-12 can be assessed by
measuring one or more indicators of hIL-12 biological activity,
such as inhibition of human phytohemagglutinin blast proliferation
in a phytohemagglutinin blast proliferation assay (PHA), or
inhibition of receptor binding in a human IL-12 receptor binding
assay (see Example 3-Interferon-gamma Induction Assay). These
indicators of hIL-12 biological activity can be assessed by one or
more of several standard in vitro or in vivo assays known in the
art (see Example 3).
[0241] The term "activity" includes activities such as the binding
specificity/affinity of an antibody for an antigen, for example, an
anti-hIL-12 antibody that binds to an IL-12 antigen and/or the
neutralizing potency of an antibody, for example, an anti-hIL-12
antibody whose binding to hIL-12 inhibits the biological activity
of hIL-12, e.g. inhibition of PHA blast proliferation or inhibition
of receptor binding in a human IL-12 receptor binding assay (see
Example 3).
[0242] The phrase "surface plasmon resonance" includes an optical
phenomenon that allows for the analysis of real-time biospecific
interactions by detection of alterations in protein concentrations
within a biosensor matrix, for example using the BIAcore system
(Pharmacia Biosensor AB, Uppsala, Sweden and Piscataway, N.J.). For
further descriptions, see Example 5 and Jonsson, U., et al. (1993)
Ann. Biol. Clin. 51:19-26; Jonsson, U., et al. (1991) Biotechniques
11:620-627; Johnsson, B., et al. (1995) J. Mol. Recognit.
8:125-131; and Johnnson, B., et al. (1991) Anal. Biochem.
198:268-277.
[0243] The term "K.sub.off", as used herein, is intended to refer
to the off rate constant for dissociation of an antibody from the
antibody/antigen complex.
[0244] The term "K.sub.d", as used herein, is intended to refer to
the dissociation constant of a particular antibody-antigen
interaction.
[0245] The phrase "nucleic acid molecule" includes DNA molecules
and RNA molecules. A nucleic acid molecule may be single-stranded
or double-stranded, but preferably is double-stranded DNA.
[0246] The phrase "isolated nucleic acid molecule", as used herein
in reference to nucleic acids encoding antibodies or antibody
portions (e.g., VH, VL, CDR3) that bind hIL-12 including "isolated
antibodies"), includes a nucleic acid molecule in which the
nucleotide sequences encoding the antibody or antibody portion are
free of other nucleotide sequences encoding antibodies or antibody
portions that bind antigens other than hIL-12, which other
sequences may naturally flank the nucleic acid in human genomic
DNA. Thus, for example, an isolated nucleic acid of the invention
encoding a VH region of an anti-IL-12 antibody contains no other
sequences encoding other VH regions that bind antigens other than
IL-12. The phrase "isolated nucleic acid molecule" is also intended
to include sequences encoding bivalent, bispecific antibodies, such
as diabodies in which VH and VL regions contain no other sequences
other than the sequences of the diabody.
[0247] The term "vector" includes a nucleic acid molecule capable
of transporting another nucleic acid to which it has been linked.
One type of vector is a "plasmid", which refers to a circular
double stranded DNA loop into which additional DNA segments may be
ligated. Another type of vector is a viral vector, wherein
additional DNA segments may be ligated into the viral genome.
Certain vectors are capable of autonomous replication in a host
cell into which they are introduced (e.g., bacterial vectors having
a bacterial origin of replication and episomal mammalian vectors).
Other vectors (e.g., non-episomal mammalian vectors) can be
integrated into the genome of a host cell upon introduction into
the host cell, and thereby are replicated along with the host
genome. Moreover, certain vectors are capable of directing the
expression of genes to which they are operatively linked. Such
vectors are referred to herein as "recombinant expression vectors"
(or simply, "expression vectors"). In general, expression vectors
of utility in recombinant DNA techniques are often in the form of
plasmids. In the present specification, "plasmid" and "vector" may
be used interchangeably as the plasmid is the most commonly used
form of vector. However, the invention is intended to include such
other forms of expression vectors, such as viral vectors (e.g.,
replication defective retroviruses, adenoviruses and
adeno-associated viruses), which serve equivalent functions.
[0248] The phrase "recombinant host cell" (or simply "host cell")
includes a cell into which a recombinant expression vector has been
introduced. It should be understood that such terms are intended to
refer not only to the particular subject cell but to the progeny of
such a cell. Because certain modifications may occur in succeeding
generations due to either mutation or environmental influences,
such progeny may not, in fact, be identical to the parent cell, but
are still included within the scope of the term "host cell" as used
herein.
[0249] The term "modifying", as used herein, is intended to refer
to changing one or more amino acids in the antibodies or
antigen-binding portions thereof. The change can be produced by
adding, substituting or deleting an amino acid at one or more
positions. The change can be produced using known techniques, such
as PCR mutagenesis.
[0250] The phrase "contact position" includes an amino acid
position of in the CDR1, CDR2 or CDR3 of the heavy chain variable
region or the light chain variable region of an antibody which is
occupied by an amino acid that contacts antigen in one of the
twenty-six known antibody-antigen structures. If a CDR amino acid
in any of the 26 known solved structures of antibody-antigen
complexes contacts the antigen, then that amino acid can be
considered to occupy a contact position. Contact positions have a
higher probability of being occupied by an amino acid which contact
antigen than non-contact positions. Preferably a contact position
is a CDR position which contains an amino acid that contacts
antigen in greater than 3 of the 26 structures (>11.5%). Most
preferably a contact position is a CDR position which contains an
amino acid that contacts antigen in greater than 8 of the 25
structures (>32%).
[0251] The term "hypermutation position" includes an amino acid
residue that occupies position in the CDR1, CDR2 or CDR3 region of
the heavy chain variable region or the light chain variable region
of an antibody that is considered to have a high frequency or
probability for somatic hypermutation during in vivo affinity
maturation of the antibody. "High frequency or probability for
somatic hypermutation" includes frequencies or probabilities of a 5
to about 40% chance that the residue will undergo somatic
hypermutation during in vivo affinity maturation of the antibody.
It should be understood that all ranges within this stated range
are also intended to be part of this invention, e.g., 5 to about
30%, e.g., 5 to about 15%, e.g., 15 to about 30%.
[0252] The term "preferred selective mutagenesis position" includes
an amino acid residue that occupies a position in the CDR1, CDR2 or
CDR3 region of the heavy chain variable region or the light chain
variable region which can be considered to be both a contact and a
hypermutation position.
[0253] The phrase "selective mutagenesis approach" includes a
method of improving the activity of an antibody by selecting and
individually mutating CDR amino acids at least one preferred
selective mutagenesis position, hypermutation, and/or contact
position. A "selectively mutated" human antibody is an antibody
which contains a mutation at a position selected using a selective
mutagenesis approach. In another embodiment, the selective
mutagenesis approach is intended to provide a method of
preferentially mutating selected individual amino acid residues in
the CDR1, CDR2 or CDR3 of the heavy chain variable region
(hereinafter H1, H2, and H3, respectively), or the CDR1, CDR2 or
CDR3 of the light chain variable region (hereinafter referred to as
L1, L2, and L3, respectively) of an antibody. Amino acid residues
may be selected from preferred selective mutagenesis positions,
contact positions, or hypermutation positions. Individual amino
acids are selected based on their position in the light or heavy
chain variable region. It should be understood that a hypermutation
position can also be a contact position. In an embodiment, the
selective mutagenesis approach is a "targeted approach". The
language "targeted approach" is intended to include a method of
preferentially mutating selected individual amino acid residues in
the CDR1, CDR2 or CDR3 of the heavy chain variable region or the
CDR1, CDR2 or CDR3 of the light chain variable region of an
antibody in a targeted manner, e.g., a "Group-wise targeted
approach" or "CDR-wise targeted approach". In the "Group-wise
targeted approach", individual amino acid residues in particular
groups are targeted for selective mutations including groups I
(including L3 and H3), II (including H2 and L1) and III (including
L2 and H1), the groups being listed in order of preference for
targeting. In the "CDR-wise targeted approach", individual amino
acid residues in particular CDRs are targeted for selective
mutations with the order of preference for targeting as follows:
H3, L3, H2, L1, H1 and L2. The selected amino acid residue is
mutated, e.g., to at least two other amino acid residues, and the
effect of the mutation on the activity of the antibody is
determined. Activity is measured as a change in the binding
specificity/affinity of the antibody, and/or neutralization potency
of the antibody. It should be understood that the selective
mutagenesis approach can be used for the optimization of any
antibody derived from any source including phage display,
transgenic animals with human IgG germline genes, human antibodies
isolated from human B-cells. Preferably, the selective mutagenesis
approach is used on antibodies which can not be optimized further
using phage display technology. It should be understood that
antibodies from any source including phage display, transgenic
animals with human IgG germline genes, human antibodies isolated
from human B-cells can be subject to backmutation prior to or after
the selective mutagenesis approach.
[0254] The term "activity enhancing amino acid residue" includes an
amino acid residue which improves the activity of the antibody. It
should be understood that the activity enhancing amino acid residue
may replace an amino acid residue at a preferred selective
mutagenesis position, contact position, or a hypermutation position
and, further, more than one activity enhancing amino acid residue
can be present within one or more CDRs. An activity enhancing amino
acid residue include, an amino acid residue that improves the
binding specificity/affinity of an antibody, for example anti-human
IL-12 antibody binding to human IL-12. The activity enhancing amino
acid residue is also intended to include an amino acid residue that
improves the neutralization potency of an antibody, for example,
the human IL-12 antibody which inhibits human IL-12.
[0255] Various aspects of the invention are described in further
detail in the following subsections.
I. Human Antibodies that Bind Human IL-12
[0256] This invention provides isolated human antibodies, or
antigen-binding portions thereof, that bind to human IL-12.
Preferably, the human antibodies of the invention are recombinant,
neutralizing human anti-hIL-12 antibodies. Antibodies of the
invention that bind to human IL-12 can be selected, for example, by
screening one or more human V.sub.L and V.sub.H cDNA libraries with
hIL-12, such as by phage display techniques as described in Example
1. Screening of human V.sub.L and V.sub.H cDNA libraries initially
identified a series of anti-IL-12 antibodies of which one antibody,
referred to herein as "Joe 9" (or "Joe 9 wild type"), was selected
for further development. Joe 9 is a relatively low affinity human
IL-12 antibody (e.g., a K.sub.off of about 0.1 sec.sup.-1), yet is
useful for specifically binding and detecting hIL-12. The affinity
of the Joe 9 antibody was improved by conducting mutagenesis of the
heavy and light chain CDRs, producing a panel of light and heavy
chain variable regions that were "mixed and matched" and further
mutated, leading to numerous additional anti-hIL-12 antibodies with
increased affinity for hIL-12 (see Example 1, Table 2 (see Appendix
A) and the sequence alignments of FIGS. 1A-D).
[0257] Of these antibodies, the human anti-hIL-12 antibody referred
to herein as Y61 demonstrated a significant improvement in binding
affinity (e.g., a K.sub.off of about 2.times.10.sup.-4 sec.sup.-1).
The Y61 anti-hIL-12 antibody was selected for further affinity
maturation by individually mutating specific amino acids residues
within the heavy and light chain CDRs. Amino acids residues of Y61
were selected for site-specific mutation (selective mutagenesis
approach) based on the amino acid residue occupying a preferred
selective mutagenesis position, contact and/or a hypermutation
position. A summary of the substitutions at selected positions in
the heavy and light chain CDRs is shown in FIGS. 2A-2H. A preferred
recombinant neutralizing antibody of the invention, referred to
herein as J695, resulted from a Gly to Tyr substitution at position
50 of the light chain CDR2 of Y61, and a Gly to Tyr substitution at
position 94 of the light chain CDR3 of Y61.
[0258] Amino acid sequence alignments of the heavy and light chain
variable regions of a panel of anti-IL-12 antibodies of the
invention, on the lineage from Joe 9 wild type to J695, are shown
in FIGS. 1A-1D. These sequence alignments allowed for the
identification of consensus sequences for preferred heavy and light
chain variable regions of antibodies of the invention that bind
hIL-12, as well as consensus sequences for the CDR3, CDR2, and
CDR1, on the lineage from Joe 9 to J695. Moreover, the Y61
mutagenesis analysis summarized in FIGS. 2A-2H allowed for the
identification of consensus sequences for heavy and light chain
variable regions that bind hIL-12, as well as consensus sequences
for the CDR3, CDR2, and CDR1 that bind hIL-12 on the lineage from
Y61 to J695 that encompasses sequences with modifications from Y61
yet that retain good hIL-12 binding characteristics. Preferred CDR,
VH and VL sequences of the invention (including consensus
sequences) as identified by sequence identifiers in the attached
Sequence Listing, are summarized below.
TABLE-US-00001 SEQ ID ANTIBODY NO: CHAIN REGION SEQUENCE 1
Consensus CDR H3 (H/S)-G-S-(H/Y)-D-(N/T/Y) Joe 9 to J695 2
Consensus CDR L3 Q-(S/T)-Y-(D/E)-(S/R/K)- Joe 9 to J695
(S/G/Y)-(L/F/T/S)-(R/S/T/W/ H)-(G/P)-(S/T/A/L)-(R/S/M/
T/L)-(V/I/T/M/L) 3 Consensus CDR H2 F-I-R-Y-D-G-S-N-K-Y-Y-A-D-S-
Joe 9 to J695 V-K-G 4 Consensus CDR L2 (G/Y)-N-(D/S)-(Q/N)-R-P-S
Joe 9 to J695 5 Consensus CDR H1 F-T-F-S-(S/E)-Y-G-M-H Joe 9 to
J695 6 Consensus CDR L1 (S/T)-G-(G/S)-(R/S-)-S-N-I- Joe 9 to J695
(G/V)-(S/A)-(N/G/Y)-(T/D)- V-(K/H) 7 Consensus VH (full VH
sequence; see Joe 9 to J695 sequence listing) 8 Consensus VL (full
VL sequence; see Joe 9 to J695 sequence listing) 9 Consensus CDR H3
H-(G/V/C/H)-(S/T)-(H/T/V/R/ Y61 to J695 I)-(D/S)-(N/K/A/T/S/F/W/H)
10 Consensus CDR L3 Q-S-Y-(D/S)-(Xaa)- Y61 to J695
(G/D/Q/L/F/R/H/N/Y)-T-H-P-A- L-L 11 Consensus CDR H2
(F/T/Y)-I-(R/A)-Y-(D/S/E/ Y61 to J695 A)-(G/R)-S-(Xaa)-K-(Y/E)-Y-
A-D-S-V-K-G 12 Consensus CDR L2 (G/Y/S/T/N/Q)-N-D-Q-R-P-S Y61 to
J695 13 Consensus CDR H1 F-T-F-(Xaa)-(Xaa)-(Y/H)- Y61 to J695
(G/M/A/N/S)-M-H 14 Consensus CDR L1 S-G-G-R-S-N-I-G-(S/C/R/N/D/ Y61
to J695 T)-(N/M/I)-(T/Y/D/H/K/P)-V- K 15 Consensus VH (full VH
sequence; see Y61 to J695 sequence listing) 16 Consensus VL (full
VL sequence; see Y61 to J695 sequence listing) 17 Y61 CDR H3
H-G-S-H-D-N 18 Y61 CDR L3 Q-S-Y-D-R-G-T-H-P-A-L-L 19 Y61 CDR H2
F-I-R-Y-D-G-S-N-K-Y-Y-A-D- S-V-K-G 20 Y61 CDR L2 G-N-D-Q-R-P-S 21
Y61 CDR H1 F-T-F-S-S-Y-G-M-H 22 Y61 CDR L1
S-G-G-R-S-N-I-G-S-N-T-V-K 23 Y61 VH (full VH sequence; see sequence
listing) 24 Y61 VL (full VL sequence; see sequence listing) 25 J695
CDR H3 H-G-S-H-D-N 26 J695 CDR L3 Q-S-Y-D-R-Y-T-H-P-A-L-L 27 J695
CDR H2 F-I-R-Y-D-G-S-N-K-Y-Y-A-D- S-V-K-G 28 J695 CDR L2
Y-N-D-Q-R-P-S 29 J695 CDR H1 F-T-F-S-S-Y-G-M-H 30 J695 CDR L1
S-G-S-R-S-N-I-G-S-N-T-V-K 31 J695 VH (full VH sequence; see
sequence listing) 32 J695 VL (full VL sequence; see sequence
listing)
[0259] Antibodies produced from affinity maturation of Joe 9 wild
type were functionally characterized by surface plasmon resonance
analysis to determine the K.sub.d and K.sub.off rate. A series of
antibodies were produced having a K.sub.off rate within the range
of about 0.1 s.sup.-1 to about 1.times.10.sup.-5 s.sup.-1, and more
preferably a K.sub.off of about 1.times.10.sup.-4 s.sup.-1 to
1.times.10.sup.-5 s.sup.-1 or less. Antibodies were also
characterized in vitro for their ability to inhibit
phytohemagglutinin (PHA) blast proliferation, as described in
Example 3. A series of antibodies were produced having an IC.sub.50
value in the range of about 1.times.10.sup.-6 M to about
1.times.10.sup.-11 M, more preferably about 1.times.10.sup.-10 M to
1.times.10.sup.-11 M or less.
[0260] Accordingly, in one aspect, the invention provides an
isolated human antibody, or antigen-binding portion thereof, that
binds to human IL-12 and dissociates from human IL-12 with a
K.sub.off rate constant of 0.1 s.sup.-1 or less, as determined by
surface plasmon resonance, or which inhibits phytohemagglutinin
blast proliferation in an in vitro phytohemagglutinin blast
proliferation assay (PHA assay) with an IC.sub.50 of
1.times.10.sup.-6 M or less. In preferred embodiments, the isolated
human IL-12 antibody, or an antigen-binding portion thereof,
dissociates from human IL-12 with a K.sub.off rate constant of
1.times.10.sup.-2 s.sup.-1 or less, or inhibits phytohemagglutinin
blast proliferation in an in vitro PHA assay with an IC.sub.50 of
1.times.10.sup.-7 M or less. In more preferred embodiments, the
isolated human IL-12 antibody, or an antigen-binding portion
thereof, dissociates from human IL-12 with a K.sub.off rate
constant of 1.times.10.sup.-3 s.sup.-1 or less, or inhibits
phytohemagglutinin blast proliferation in an in vitro PHA assay
with an IC.sub.50 of 1.times.10.sup.-8 M or less. In more preferred
embodiments, the isolated human IL-12 antibody, or an
antigen-binding portion thereof, dissociates from human IL-12 with
a K.sub.off rate constant of 1.times.10.sup.-4 s.sup.-1 or less, or
inhibits phytohemagglutinin blast proliferation in an in vitro PHA
assay with an IC.sub.50 of 1.times.10.sup.-9 M or less. In more
preferred embodiments, the isolated human IL-12 antibody, or an
antigen-binding portion thereof, dissociates from human IL-12 with
a K.sub.off rate constant of 1.times.10.sup.-5 s.sup.-1 or less, or
inhibits phytohemagglutinin blast proliferation in an in vitro PHA
assay with an IC.sub.50 of 1.times.10.sup.-10 M or less. In even
more preferred embodiments, the isolated human IL-12 antibody, or
an antigen-binding portion thereof, dissociates from human IL-12
with a K.sub.off rate constant of 1.times.10.sup.-5 s.sup.-1 or
less, or inhibits phytohemagglutinin blast proliferation in an in
vitro PHA assay with an IC.sub.50 of 1.times.10.sup.-11 M or
less.
[0261] The dissociation rate constant (K.sub.off) of an IL-12
antibody can be determined by surface plasmon resonance (see
Example 5). Generally, surface plasmon resonance analysis measures
real-time binding interactions between ligand (recombinant human
IL-12 immobilized on a biosensor matrix) and analyte (antibodies in
solution) by surface plasmon resonance (SPR) using the BIAcore
system (Pharmacia Biosensor, Piscataway, N.J.). Surface plasmon
analysis can also be performed by immobilizing the analyte
(antibodies on a biosensor matrix) and presenting the ligand
(recombinant IL-12 in solution). Neutralization activity of IL-12
antibodies, or antigen binding portions thereof, can be assessed
using one or more of several suitable in vitro assays (see Example
3).
[0262] It is well known in the art that antibody heavy and light
chain CDRs play an important role in the binding
specificity/affinity of an antibody for an antigen. Accordingly,
the invention encompasses human antibodies having light and heavy
chain CDRs of Joe 9, as well as other antibodies having CDRs that
have been modified to improve the binding specificity/affinity of
the antibody. As demonstrated in Example 1, a series of
modifications to the light and heavy chain CDRs results in affinity
maturation of human anti-hIL-12 antibodies. The heavy and light
chain variable region amino acid sequence alignments of a series of
human antibodies ranging from Joe 9 wild type to J695 that bind
human IL-12 is shown in FIGS. 1A-1D. Consensus sequence motifs for
the CDRs of antibodies can be determined from the sequence
alignment (as summarized in the table above). For example, a
consensus motif for the VH CDR3 of the lineage from Joe 9 to J695
comprises the amino acid sequence: (H/S)-G-S-(H/Y)-D-(N/T/Y) (SEQ
ID NO: 1), which encompasses amino acids from position 95 to 102 of
the consensus HCVR shown in SEQ ID NO: 7. A consensus motif for the
VL CDR3 comprises the amino acid sequence:
Q-(S/T)-Y-(D/E)-(S/R/K)-(S/G/Y)-(L/F/T/S)-(R/S/T/W/H)-(G/P)-(S/T/A/L)-(R/-
S/M/T/L-V/I/T/M/L) (SEQ ID NO: 2), which encompasses amino acids
from position 89 to 97 of the consensus LCVR shown in SEQ ID NO:
8.
[0263] Accordingly, in another aspect, the invention provides an
isolated human antibody, or an antigen-binding portion thereof,
which has the following characteristics:
[0264] a) inhibits phytohemagglutinin blast proliferation in an in
vitro PHA assay with an IC.sub.50 of 1.times.10.sup.-6 M or
less;
[0265] b) has a heavy chain CDR3 comprising the amino acid sequence
of SEQ ID NO: 1; and
[0266] c) has a light chain CDR3 comprising the amino acid sequence
of SEQ ID NO: 2.
[0267] In a preferred embodiment, the antibody further comprises a
VH CDR2 comprising the amino acid sequence:
F-I-R-Y-D-G-S-N-K-Y-Y-A-D-S-V-K-G (SEQ ID NO: 3) (which encompasses
amino acids from position 50 to 65 of the consensus HCVR comprising
the amino acid sequence SEQ ID NO: 7) and further comprises a VL
CDR2 comprising the amino acid sequence: (G/Y)-N-(D/S)-(Q/N)-R-P-S
(SEQ ID NO: 4) (which encompasses amino acids from position 50 to
56 of the consensus LCVR comprising the amino acid sequence SEQ ID
NO: 8).
[0268] In another preferred embodiment, the antibody further
comprises a VH CDR1 comprising the amino acid sequence:
F-T-F-S-(S/E)-Y-G-M-H (SEQ ID NO: 5) (which encompasses amino acids
from position 27 to 35 of the consensus HCVR comprising the amino
acid sequence SEQ ID NO: 7) and further comprises a VL CDR1
comprising the amino acid sequence:
(S/T)-G-(G/S)-(R/S)-S-N-I-(G/V)-(S/A)-(N/G/Y)-(T/D)-V-(K/H) (SEQ ID
NO: 6) (which encompasses amino acids from position 24 to 34 of the
consensus LCVR comprising the amino acid sequence SEQ ID NO:
8).
[0269] In yet another preferred embodiment, the antibody of the
invention comprises a HCVR comprising the amino acid sequence of
SEQ ID NO: 7 and a LCVR comprising the amino acid sequence of SEQ
ID NO: 8.
[0270] Additional consensus motifs can be determined based on the
mutational analysis performed on Y61 that led to the J695 antibody
(summarized in FIGS. 2A-2H). As demonstrated by the graphs shown in
FIGS. 2A-2H, certain residues of the heavy and light chain CDRs of
Y61 were amenable to substitution without significantly impairing
the hIL-12 binding properties of the antibody. For example,
individual substitutions at position 30 in CDR H1 with twelve
different amino acid residues did not significantly reduce the
K.sub.off rate of the antibody, indicating that is position is
amenable to substitution with a variety of different amino acid
residues. Thus, based on the mutational analysis (i.e., positions
within Y61 that were amenable to substitution by other amino acid
residues) consensus motifs were determined. The consensus motifs
for the heavy and light chain CDR3s are shown in SEQ ID NOs: 9 and
10, respectively, consensus motifs for the heavy and light chain
CDR2s are shown in SEQ ID NOs: 11 and 12, respectively, and
consensus motifs for the heavy and light chain CDR1s are shown in
SEQ ID NOs: 13 and 14, respectively. Consensus motifs for the VH
and VL regions are shown in SEQ ID NOs: 15 and 16,
respectively.
[0271] Accordingly, in one aspect, the invention features an
isolated human antibody, or an antigen-binding portion thereof,
which has the following characteristics:
[0272] a) inhibits phytohemagglutinin blast proliferation in an in
vitro PHA assay with an IC.sub.50 of 1.times.10.sup.-9 M or
less;
[0273] b) has a heavy chain CDR3 comprising the amino acid sequence
of SEQ ID NO: 9; and
[0274] c) has a light chain CDR3 comprising the amino acid sequence
of SEQ ID NO: 10.
[0275] In a preferred embodiment, the antibody further comprises a
VH CDR2 comprising the amino acid sequence of SEQ ID NO: 11 and
further comprises a VL CDR2 comprising the amino acid sequence of
SEQ ID NO: 12.
[0276] In another preferred embodiment, the antibody further
comprises a VH CDR1 comprising the amino acid sequence of SEQ ID
NO: 13 and further comprises a VL CDR1 comprising the amino acid
sequence of SEQ ID NO: 14.
[0277] In yet another preferred embodiment, the antibody of the
invention comprises a HCVR comprising the amino acid sequence of
SEQ ID NO: 15 and a LCVR comprising the amino acid sequence of SEQ
ID NO: 16.
[0278] A preferred antibody of the invention, the human anti-hIL-12
antibody Y61, was produced by affinity maturation of Joe 9 wild
type by PCR mutagenesis of the CDR3 (as described in Example 1).
Y61 had an improved specificity/binding affinity determined by
surface plasmon resonance and by in vitro neutralization assays.
The heavy and light chain CDR3s of Y61 are shown in SEQ ID NOs: 17
and 18, respectively, the heavy and light chain CDR2s of Y61 are
shown in SEQ ID NOs: 19 and 20, respectively, and the heavy and
light chain CDR1s of Y61 are shown in SEQ ID NOs: 21 and 22,
respectively. The VH of Y61 has the amino acid sequence of SEQ ID
NO: 23 and the VL of Y61 has the amino acid sequence of SEQ ID NO:
24 (these sequences are also shown in FIGS. 1A-1D, aligned with
Joe9).
[0279] Accordingly, in another aspect, the invention features an
isolated human antibody, or an antigen-binding portion thereof,
which
[0280] a) inhibits phytohemagglutinin blast proliferation in an in
vitro PHA assay with an IC.sub.50 of 1.times.10.sup.-9 M or
less;
[0281] b) has a heavy chain CDR3 comprising the amino acid sequence
of SEQ ID NO: 17; and
[0282] c) has a light chain CDR3 comprising the amino acid sequence
of SEQ ID NO: 18.
[0283] In a preferred embodiment, the isolated human antibody, or
an antigen-binding portion thereof, has a heavy chain CDR2
comprising the amino acid sequence of SEQ ID NO: 19 and a light
chain CDR2 comprising the amino acid sequence of SEQ ID NO: 20.
[0284] In another preferred embodiment, the isolated human
antibody, or an antigen-binding portion thereof has a heavy chain
CDR1 comprising the amino acid sequence of SEQ ID NO: 21 and a
light chain CDR1 comprising the amino acid sequence of SEQ ID NO:
22.
[0285] In yet another preferred embodiment, the isolated human
antibody, or an antigen-binding portion thereof, comprising a the
heavy chain variable region comprising the amino acid sequence of
SEQ ID NO: 23, and a light chain variable region comprising the
amino acid sequence of SEQ ID NO: 24.
[0286] In certain embodiments, the full length antibody comprises a
heavy chain constant region, such as IgG1, IgG2, IgG3, IgG4, IgM,
IgA and IgE constant regions, and any allotypic variant therein as
described in Kabat (, Kabat, E. A., et al. (1991) Sequences of
Proteins of Immunological Interest, Fifth Edition, U.S. Department
of Health and Human Services, NIH Publication No. 91-3242).
Preferably, the antibody heavy chain constant region is an IgG1
heavy chain constant region. Alternatively, the antibody portion
can be an Fab fragment, an F(ab'.sub.2) fragment or a single chain
Fv fragment.
[0287] Modifications of individual residues of Y61 led to the
production of a panel of antibodies shown in FIGS. 2A-2H. The
specificity/binding affinity of each antibody was determined by
surface plasmon resonance and/or by in vitro neutralization
assays.
[0288] Accordingly, in another aspect, the invention features an
isolated human antibody, or an antigen-binding portion thereof,
which
[0289] a) inhibits phytohemagglutinin blast proliferation in an in
vitro PHA assay with an IC.sub.50 of 1.times.10.sup.-9 M or
less;
[0290] b) has a heavy chain CDR3 comprising the amino acid sequence
selected from the group consisting of SEQ ID NO: 404-SEQ ID NO:
469; and
[0291] c) has a light chain CDR3 comprising the amino acid sequence
selected from the group consisting of SEQ ID NO: 534-SEQ ID NO:
579.
[0292] In preferred embodiment, the isolated human antibody, or an
antigen-binding portion thereof, has a heavy chain CDR2 comprising
the amino acid sequence selected from the group consisting of SEQ
ID NO:335-SEQ ID NO: 403; and a light chain CDR2 comprising the
amino acid sequence selected from the group consisting of SEQ ID
NO: 506-SEQ ID NO: 533.
[0293] In another preferred embodiment, the isolated human
antibody, or an antigen-binding portion thereof, has a heavy chain
CDR1 comprising the amino acid sequence selected from the group
consisting of SEQ ID NO: 288-SEQ ID NO: 334; and a light chain CDR1
comprising the amino acid sequence selected from the group
consisting of SEQ ID NO: 470-SEQ ID NO: 505.
[0294] In yet another preferred embodiment, the isolated human
antibody, or an antigen-binding portion thereof, comprising a the
heavy chain variable region comprising the amino acid sequence of
SEQ ID NO: 23, and a light chain variable region comprising the
amino acid sequence of SEQ ID NO: 24.
[0295] In certain embodiments, the full length antibody comprising
a heavy chain constant region such as IgG1, IgG2, IgG3, IgG4, IgM,
IgA and IgE constant regions and any allotypic variant therein as
described in Kabat (, Kabat, E. A., et al. (1991) Sequences of
Proteins of Immunological Interest, Fifth Edition, U.S. Department
of Health and Human Services, NIH Publication No. 91-3242).
Preferably, the antibody heavy chain constant region is an IgG1
heavy chain constant region. Alternatively, the antibody portion
can be a Fab fragment, an F(ab'.sub.2) fragment or a single chain
Fv fragment.
[0296] A particularly preferred recombinant, neutralizing antibody
of the invention, J695, was produced by site-directed mutagenesis
of contact and hypermutation amino acids residues of antibody Y61
(see Example 2 and section III below). J695 differs from Y61 by a
Gly to Tyr substitution in Y61 at position 50 of the light chain
CDR2 and by a Gly to Tyr substitution at position 94 of the light
chain CDR3. The heavy and light chain CDR3s of J695 are shown in
SEQ ID NOs: 25 and 26, respectively, the heavy and light chain
CDR2s of J695 are shown in SEQ ID NOs: 27 and 28, respectively, and
the heavy and light chain CDR1s of J695 are shown in SEQ ID NOs: 29
and 30, respectively. The VH of J695 has the amino acid sequence of
SEQ ID NO: 31 and the VL of J695 has the amino acid sequence of SEQ
ID NO: 32 (these sequences are also shown in FIGS. 1A-1D, aligned
with Joe9).
[0297] Accordingly, in another aspect, the invention features an
isolated human antibody, or an antigen-binding portion thereof,
which
[0298] a) inhibits phytohemagglutinin blast proliferation in an in
vitro PHA assay with an IC.sub.50 of 1.times.10.sup.-9 M or
less;
[0299] b) has a heavy chain CDR3 comprising the amino acid sequence
of SEQ ID NO: 25; and
[0300] c) has a light chain CDR3 comprising the amino acid sequence
of SEQ ID NO: 26.
[0301] In preferred embodiment, the isolated human antibody, or an
antigen-binding portion thereof, has a heavy chain CDR2 comprising
the amino acid sequence of SEQ ID NO: 27, and a light chain CDR2
comprising the amino acid sequence of SEQ ID NO: 28.
[0302] In another preferred embodiment, the isolated human
antibody, or an antigen-binding portion thereof, has a heavy chain
CDR1 comprising the amino acid sequence of SEQ ID NO: 29, and a
light chain CDR1 comprising the amino acid sequence of SEQ ID NO:
30.
[0303] In yet another preferred embodiment, the isolated human
antibody, or an antigen-binding portion thereof, has a heavy chain
variable region comprising the amino acid sequence of SEQ ID NO:
31, and a light chain variable region comprising the amino acid
sequence of SEQ ID NO: 32.
[0304] In certain embodiments, the full length antibody comprises a
heavy chain constant region, such as IgG1, IgG2, IgG3, IgG4, IgM,
IgA and IgE constant regions and any allotypic variant therein as
described in Kabat (, Kabat, E. A., et al. (1991) Sequences of
Proteins of Immunological Interest, Fifth Edition, U.S. Department
of Health and Human Services, NIH Publication No. 91-3242).
Preferably, the antibody heavy chain constant region is an IgG1
heavy chain constant region. Alternatively, the antibody portion
can be an Fab fragment, an F(ab'.sub.2) fragment or a single chain
Fv fragment.
[0305] Additional mutations in the preferred consensus sequences
for CDR3, CDR2, and CDR1 of antibodies on the lineage from Joe 9 to
J695, or from the lineage Y61 to J695, can be made to provide
additional anti-IL-12 antibodies of the invention. Such methods of
modification can be performed using standard molecular biology
techniques, such as by PCR mutagenesis, targeting individual
contact or hypermutation amino acid residues in the light chain
and/or heavy chain CDRs-, followed by kinetic and functional
analysis of the modified antibodies as described herein (e.g.,
neutralization assays described in Example 3, and by BIAcore
analysis, as described in Example 5).
[0306] Accordingly, in another aspect the invention features an
isolated human antibody, or an antigen-binding portion thereof,
which
[0307] a) inhibits phytohemagglutinin blast proliferation in an in
vitro PHA assay with an IC.sub.50 of 1.times.10.sup.-6 M or
less;
[0308] b) comprises a heavy chain CDR3 comprising the amino acid
sequence of SEQ ID NO: 1, a heavy chain CDR2 comprising the amino
acid sequence of SEQ ID NO: 3 and a heavy chain CDR1 comprising the
amino acid sequence of SEQ ID NO: 5, or a mutant thereof having one
or more amino acid substitutions at a preferred selective
mutagenesis position or a hypermutation position, wherein said
mutant has a k.sub.off rate no more than 10-fold higher than the
antibody comprising a heavy chain CDR3 comprising the amino acid
sequence of SEQ ID NO: 1, a heavy chain CDR2 comprising the amino
acid sequence of SEQ ID NO: 3, and a heavy chain CDR1 comprising
the amino acid sequence of SEQ ID NO: 5; and
[0309] c) comprises a light chain CDR3 comprising the amino acid
sequence of SEQ ID NO: 2, a light chain CDR2 comprising the amino
acid sequence of SEQ ID NO: 4, and a light chain CDR1 comprising
the amino acid sequence of SEQ ID NO: 6, or a mutant thereof having
one or more amino acid substitutions at a preferred selective
mutagenesis position or a hypermutation position, wherein said
mutant has a k.sub.off rate no more than 10-fold higher than the
antibody comprising a light chain CDR3 comprising the amino acid
sequence of SEQ ID NO: 2, a light chain CDR2 comprising the amino
acid sequence of SEQ ID NO: 4, and a light chain CDR1 comprising
the amino acid sequence of SEQ ID NO: 6.
[0310] In another aspect the invention features an isolated human
antibody, or an antigen-binding portion thereof, which
[0311] a) inhibits phytohemagglutinin blast proliferation in an in
vitro PHA assay with an IC.sub.50 of 1.times.10.sup.-9 M or
less;
[0312] b) comprises a heavy chain CDR3 comprising the amino acid
sequence of SEQ ID NO: 9, a heavy chain CDR2 comprising the amino
acid sequence of SEQ ID NO: 11 and a heavy chain CDR1 comprising
the amino acid sequence of SEQ ID NO: 13, or a mutant thereof
having one or more amino acid substitutions at a preferred
selective mutagenesis position, contact position or a hypermutation
position, wherein said mutant has a k.sub.off rate no more than
10-fold higher than the antibody comprising a heavy chain CDR3
comprising the amino acid sequence of SEQ ID NO: 9, a heavy chain
CDR2 comprising the amino acid sequence of SEQ ID NO: 1, and a
heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO:
13; and
[0313] c) comprises a light chain CDR3 comprising the amino acid
sequence of SEQ ID NO: 10, a light chain CDR2 comprising the amino
acid sequence of SEQ ID NO: 12, and a light chain CDR1 comprising
the amino acid sequence of SEQ ID NO: 14, or a mutant thereof
having one or more amino acid substitutions at a preferred
selective mutagenesis position, contact position or a hypermutation
position, wherein said mutant has a k.sub.off rate no more than
10-fold higher than the antibody comprising a light chain CDR3
comprising the amino acid sequence of SEQ ID NO: 10, a light chain
CDR2 comprising the amino acid sequence of SEQ ID NO: 12, and a
light chain CDR1 comprising the amino acid sequence of SEQ ID NO:
14.
[0314] An ordinarily skilled artisan will also appreciate that
additional mutations to the CDR regions of an antibody of the
invention, for example in Y61 or in J695, can be made to provide
additional anti-IL-12 antibodies of the invention. Such methods of
modification can be performed using standard molecular biology
techniques, as described above. The functional and kinetic analysis
of the modified antibodies can be performed as described in Example
3 and Example 5, respectively. Modifications of individual residues
of Y61 that led to the identification of J695 are shown in FIGS.
2A-2H and are described in Example 2.
[0315] Accordingly, in another aspect the invention features an
isolated human antibody, or an antigen-binding portion thereof,
which
[0316] a) inhibits phytohemagglutinin blast proliferation in an in
vitro PHA assay with an IC.sub.50 of 1.times.10.sup.-9 M or
less;
[0317] b) comprises a heavy chain CDR3 comprising the amino acid
sequence of SEQ ID NO: 17, a heavy chain CDR2 comprising the amino
acid sequence of SEQ ID NO: 19 and a heavy chain CDR1 comprising
the amino acid sequence of SEQ ID NO: 21, or a mutant thereof
having one or more amino acid substitutions at a preferred
selective mutagenesis position or a hypermutation position, wherein
said mutant has a k.sub.off rate no more than 10-fold higher than
the antibody comprising a heavy chain CDR3 comprising the amino
acid sequence of SEQ ID NO: 17, a heavy chain CDR2 comprising the
amino acid sequence of SEQ ID NO: 19, and a heavy chain CDR1
comprising the amino acid sequence of SEQ ID NO: 21; and
[0318] c) comprises a light chain CDR3 comprising the amino acid
sequence of SEQ ID NO: 18, a light chain CDR2 comprising the amino
acid sequence of SEQ ID NO: 20, and a light chain CDR1 comprising
the amino acid sequence of SEQ ID NO: 22, or a mutant thereof
having one or more amino acid substitutions at a preferred
selective mutagenesis position or a hypermutation position, wherein
said mutant has a k.sub.off rate no more than 10-fold higher than
the antibody comprising a light chain CDR3 comprising the amino
acid sequence of SEQ ID NO: 18, a light chain CDR2 comprising the
amino acid sequence of SEQ ID NO: 20, and a light chain CDR1
comprising the amino acid sequence of SEQ ID NO: 22.
[0319] In another aspect the invention features an isolated human
antibody, or an antigen-binding portion thereof, which
[0320] a) inhibits phytohemagglutinin blast proliferation in an in
vitro PHA assay with an IC.sub.50 of 1.times.10.sup.-9 M or
less;
[0321] b) comprises a heavy chain CDR3 comprising the amino acid
sequence of SEQ ID NO: 25, a heavy chain CDR2 comprising the amino
acid sequence of SEQ ID NO: 27 and a heavy chain CDR1 comprising
the amino acid sequence of SEQ ID NO: 29, or a mutant thereof
having one or more amino acid substitutions at a preferred
selective mutagenesis position or a hypermutation position, wherein
said mutant has a k.sub.off rate no more than 10-fold higher than
the antibody comprising a heavy chain CDR3 comprising the amino
acid sequence of SEQ ID NO: 25, a heavy chain CDR2 comprising the
amino acid sequence of SEQ ID NO: 27, and a heavy chain CDR1
comprising the amino acid sequence of SEQ ID NO: 29; and
[0322] c) comprises a light chain CDR3 comprising the amino acid
sequence of SEQ ID NO: 26, a light chain CDR2 comprising the amino
acid sequence of SEQ ID NO: 28, and a light chain CDR1 comprising
the amino acid sequence of SEQ ID NO: 30, or a mutant thereof
having one or more amino acid substitutions at a preferred
selective mutagenesis position or a hypermutation position, wherein
said mutant has a k.sub.off rate no more than 10-fold higher than
the antibody comprising a light chain CDR3 comprising the amino
acid sequence of SEQ ID NO: 26, a light chain CDR2 comprising the
amino acid sequence of SEQ ID NO: 28, and a light chain CDR1
comprising the amino acid sequence of SEQ ID NO: 30.
[0323] In yet another embodiment, the invention provides isolated
human antibodies, or antigen-binding portions thereof, that
neutralize the activity of human IL-12, and at least one additional
primate IL-12 selected from the group consisting of baboon IL-12,
marmoset IL-12, chimpanzee IL-12, cynomolgus IL-12 and rhesus
IL-12, but which do not neutralize the activity of the mouse
IL-12.
II Selection of Recombinant Human Antibodies
[0324] Recombinant human antibodies of the invention can be
isolated by screening of a recombinant combinatorial antibody
library, preferably a scFv phage display library, prepared using
human VL and VH cDNAs prepared from mRNA derived from human
lymphocytes. Methodologies for preparing and screening such
libraries are known in the art. In addition to commercially
available kits for generating phage display libraries (e.g., the
Pharmacia Recombinant Phage Antibody System, catalog no.
27-9400-01; and the Stratagene SurfZAP.TM. phage display kit,
catalog no. 240612), examples of methods and reagents particularly
amenable for use in generating and screening antibody display
libraries can be found in, for example, Kang et al. PCT Publication
No. WO 92/18619; Winter et al. PCT Publication No. WO 92/20791;
Breitling et al. PCT Publication No. WO 93/01288; McCafferty et al.
PCT Publication No. WO 92/01047; Garrard et al. PCT Publication No.
WO 92/09690; Fuchs et al. (1991) Bio/Technology 9:1370-1372; Hay et
al. (1992) Hum Antibod Hybridomas 3:81-85; Huse et al. (1989)
Science 246:1275-1281; McCafferty et al., Nature (1990)
348:552-554; Griffiths et al. (1993) EMBO J 12:725-734; Hawkins et
al. (1992) J Mol Biol 226:889-896; Clackson et al. (1991) Nature
352:624-628; Gram et al. (1992) PNAS 89:3576-3580; Garrad et al.
(1991) Bio/Technology 9:1373-1377; Hoogenboom et al. (1991) Nuc
Acid Res 19:4133-4137; and Barbas et al. (1991) PNAS
88:7978-7982.
[0325] The antibody libraries used in this method are preferably
scFv libraries prepared from human VL and VH cDNAs. The scFv
antibody libraries are preferably screened using recombinant human
IL-12 as the antigen to select human heavy and light chain
sequences having a binding activity toward IL-12. To select for
antibodies specific for the p35 subunit of IL-12 or the p70
heterodimer, screening assays were performed in the presence of
excess free p40 subunit. Subunit preferences can be determined, for
example by, micro-Friguet titration, as described in Example 1.
[0326] Once initial human VL and VH segments are selected, "mix and
match" experiments, in which different pairs of the selected VL and
VH segments are screened for IL-12 binding, are performed to select
preferred VL/VH pair combinations (see Example 1). Additionally, to
further improve the affinity and/or lower the off rate constant for
hIL-12 binding, the VL and VH segments of the preferred VL/VH
pair(s) can be randomly mutated, preferably within the CDR3 region
of VH and/or VL, in a process analogous to the in vivo somatic
mutation process responsible for affinity maturation of antibodies
during a natural immune response. This in vitro affinity maturation
can be accomplished by amplifying VH and VL regions using PCR
primers complimentary to the VH CDR3 or VL CDR3, respectively,
which primers have been "spiked" with a random mixture of the four
nucleotide bases at certain positions such that the resultant PCR
products encode VH and VL segments into which random mutations have
been introduced into the VH and/or VL CDR3 regions. These randomly
mutated VH and VL segments can be reselected and rescreened for
binding to hIL-12 and sequences that exhibit high affinity and a
low off rate for IL-12 binding can be selected. Table 2 (see
Appendix A) shows antibodies that displayed altered binding
specificity/affinity produced as a result of in vitro affinity
maturation.
[0327] Following selection, isolation and screening of an
anti-hIL-12 antibody of the invention from a recombinant
immunoglobulin display library, nucleic acid encoding the selected
antibody can be recovered from the phage particle(s) (e.g., from
the phage genome) and subcloned into other expression vectors by
standard recombinant DNA techniques. If desired, the nucleic acid
can be further manipulated to create other antibody forms of the
invention (e.g., linked to nucleic acid encoding additional
immunoglobulin domains, such as additional constant regions). To
express a recombinant human antibody isolated by screening of a
combinatorial library, the DNA encoding the antibody is cloned into
a recombinant expression vector and introduced into a mammalian
host cells, as described in further detail in Section IV below.
[0328] Methods for selecting human IL-12 binding antibodies by
phage display technology, and affinity maturation of selected
antibodies by random or site-directed mutagenesis of CDR regions
are described in further detail in Example 1.
[0329] As described in Example 1, screening of human VL and VH cDNA
libraries identified a series of anti-IL-12 antibodies, of which
the Joe 9 antibody was selected for further development. A
comparison of the heavy chain variable region of Joe 9 with the
heavy chain germline sequences selected from the VBASE database,
revealed that Joe 9 was similar to the COS-3 germline sequence.
COS-3 belongs to the V.sub.H3 family of germline sequences.
[0330] The V.sub.H3 family is part of the human VH germline
repertoire which is grouped into seven families, V.sub.H1-V.sub.H7,
based on nucleotide sequence homology (Tomlinson et al. (1992) J.
Mol. Biol., 227, 776-798 and Cook et al. (1995) Immunology Today,
16, 237-242). The V.sub.H3 family contains the highest number of
members and makes the largest contribution to the germline
repertoire. For any given human V.sub.H3-germline antibody
sequence, the amino acid sequence identity within the entire
V.sub.H3 family is high (See e.g., Tomlinson et al. (1992) J. Mol.
Biol., 227, 776-798 and Cook et al. (1995) Immunology Today, 16,
237-242). The range of amino acid sequence identity between any two
germline VH sequences of the V.sub.H3 family varies from 69-98
residues out of approximately 100 VH residues, (i.e., 69-98% amino
acid sequence homology between any two germline VH sequences). For
most pairs of germline sequences there is at least 80 or more
identical amino acid residues, (i.e., at least 80% amino acid
sequence homology). The high degree of amino acid sequence homology
between the V.sub.H3 family members results in certain amino acid
residues being present at key sites in the CDR and framework
regions of the VH chain. These amino acid residues confer
structural features upon the CDRs.
[0331] Studies of antibody structures have shown that CDR
conformations can be grouped into families of canonical CDR
structures based on the key amino acid residues that occupy certain
positions in the CDR and framework regions. Consequently, there are
similar local CDR conformations in different antibodies that have
canonical structures with identical key amino acid residues
(Chothia et al. (1987) J. Mol. Biol., 196, 901-917 and Chothia et
al. (1989) Nature, 342, 877-883). Within the V.sub.H3 family there
is a conservation of amino acid residue identity at the key sites
for the CDR1 and CDR2 canonical structures (Chothia et al. (1992)
J. Mol. Biol., 227, 799-817).
[0332] The COS-3 germline VH gene, is a member of the V.sub.H3
family and is a variant of the 3-30 (DP-49) germline VH allele.
COS-3, differs from Joe9 VH amino acid sequences at only 5
positions. The high degree of amino acid sequence homology between
Joe9 VH and COS-3, and between Joe9 VH and the other V.sub.H3
family members also confers a high degree of CDR structural
homology (Chothia et al. (1992) J. Mol. Biol., 227, 799-817;
Chothia et al. (1987) J. Mol. Biol., 196, 901-917 and Chothia et
al. (1989) Nature, 342, 877-883).
[0333] The skilled artisan will appreciate that based on the high
amino acid sequence and canonical structural similarity to Joe 9,
other V.sub.H3 family members could also be used to generate
antibodies that bind to human IL-12. This can be performed, for
example, by selecting an appropriate VL by chain-shuffling
techniques (Winter et al. (1994) Annual Rev. Immunol., 12, 433-55),
or by the grafting of CDRs from a rodent or other human antibody
including CDRs from antibodies of this invention onto a V.sub.H3
family framework.
[0334] The human V lambda germline repertoire is grouped into 10
families based on nucleotide sequence homology (Williams et al.
(1996) J. Mol. Biol., 264, 220-232). A comparison of the light
chain variable region of Joe 9 with the light chain germline
sequences selected from the VBASE database, revealed that Joe 9 was
similar to the DPL8 lambda germline. The Joe9 VL differs from DPL8
sequence at only four framework positions, and is highly homologous
to the framework sequences of the other V.sub..lamda.1 family
members. Based on the high amino acid sequence homology and
canonical structural similarity to Joe 9, other V.sub..lamda.1
family members may also be used to generate antibodies that bind to
human IL-12. This can be performed, for example, by selecting an
appropriate VH by chain-shuffling techniques (Winter et al. Supra,
or by the grafting of CDRs from a rodent or other human antibody
including CDRs from antibodies of this invention onto a
V.sub..lamda.1 family framework.
[0335] The methods of the invention are intended to include
recombinant antibodies that bind to hIL-12, comprising a heavy
chain variable region derived from a member of the V.sub.H3 family
of germline sequences, and a light chain variable region derived
from a member of the V.sub..lamda.1 family of germline sequences.
Moreover, the skilled artisan will appreciate that any member of
the V.sub.H3 family heavy chain sequence can be combined with any
member of the V.sub..lamda.1 family light chain sequence.
[0336] Those skilled in the art will also appreciate that DNA
sequence polymorphisms that lead to changes in the amino acid
sequences of the germline may exist within a population (e.g., the
human population). Such genetic polymorphism in the germline
sequences may exist among individuals within a population due to
natural allelic variation. Such natural allelic variations can
typically result in 1-5% variance in the nucleotide sequence of the
a gene. Any and all such nucleotide variations and resulting amino
acid polymorphisms in germline sequences that are the result of
natural allelic variation are intended to be within the scope of
the invention.
[0337] Accordingly, in one aspect, the invention features an
isolated human antibody, or an antigen-binding portion thereof,
which has the following characteristics: [0338] a) that binds to
human IL-12 and dissociates from human IL-12 with a k.sub.off rate
constant of 0.1 s.sup.-1 or less, as determined by surface plasmon
resonance, or which inhibits phytohemagglutinin blast proliferation
in an in vitro phytohemagglutinin blast proliferation assay (PHA
assay) with an IC.sub.50 of 1.times.10.sup.-6M or less. [0339] b)
has a heavy chain variable region comprising an amino acid sequence
selected from a member of the V.sub.H3 germline family, wherein the
heavy chain variable region has a mutation at a contact or
hypermutation position with an activity enhancing amino acid
residue. [0340] c) has a light chain variable region comprising an
amino acid sequence selected from a member of the V.sub..lamda.1
germline family, wherein the light chain variable region has a
mutation at a preferred selective mutagenesis position, contact or
hypermutation position with an activity enhancing amino acid
residue.
[0341] In a preferred embodiment, the isolated human antibody, or
antigen binding has mutation in the heavy chain CDR3.
[0342] In another preferred embodiment, the isolated human
antibody, or antigen binding has mutation in the light chain
CDR3.
[0343] In another preferred embodiment, the isolated human
antibody, or antigen binding has mutation in the heavy chain
CDR2.
[0344] In another preferred embodiment, the isolated human
antibody, or antigen binding has mutation in the light chain
CDR2.
[0345] In another preferred embodiment, the isolated human
antibody, or antigen binding has mutation in the heavy chain
CDR1.
[0346] In another preferred embodiment, the isolated human
antibody, or antigen binding has mutation in the light chain
CDR1.
[0347] An ordinarily skilled artisan will appreciate that based on
the high amino acid sequence similarity between members of the
V.sub.H3 germline family, or between members of the light chain
V.sub..lamda.1 germline family, that mutations to the germlines
sequences can provide additional antibodies that bind to human
IL-12. Table 1 (see Appendix A) shows the germline sequences of the
V.sub.H3 family members and demonstrates the significant sequence
homology within the family members. Also shown in Table 1 are the
germline sequences for V.sub..lamda.1 family members. The heavy and
light chain sequences of Joe 9 are provided as a comparison.
Mutations to the germline sequences of V.sub.H3 or V.sub..lamda.1
family members may be made, for example, at the same amino acid
positions as those made in the antibodies of the invention (e.g.
mutations in Joe 9). The modifications can be performed using
standard molecular biology techniques, such as by PCR mutagenesis,
targeting individual amino acid residues in the germline sequences,
followed by kinetic and functional analysis of the modified
antibodies as described herein (e.g., neutralization assays
described in Example 3, and by BIAcore analysis, as described in
Example 5).
[0348] Accordingly, in one aspect, the invention features isolated
human antibody, or an antigen-binding portion thereof, which has
the following characteristics: [0349] a) has a heavy chain variable
region comprising an amino acid sequence selected from the group
consisting of SEQ ID NOs: 595-667, wherein the heavy chain variable
region has a mutation at a preferred selective mutagenesis
position, contact or hypermutation position with an activity
enhancing amino acid residue. [0350] b) has a light chain variable
region comprising an amino acid sequence selected from the group
consisting of SEQ ID NOs: 669-675, wherein the light chain variable
region has a mutation at a preferred selective mutagenesis
position, contact or hypermutation position with an activity
enhancing amino acid residue.
[0351] An ordinarily skilled artisan will appreciate that based on
the high amino acid sequence similarity between Joe 9 and COS-3
heavy chain germline sequence, and between Joe 9 and DPL8 lambda
germline sequence, that other mutations to the CDR regions of these
germlines sequences can provide additional antibodies that bind to
human IL-12. Such methods of modification can be performed using
standard molecular biology techniques as described above.
[0352] Accordingly, in one aspect, the invention features isolated
human antibody, or an antigen-binding portion thereof, which has
the following characteristics: [0353] a) that binds to human IL-12
and dissociates from human IL-12 with a k.sub.off rate constant of
0.1 s.sup.-1 or less, as determined by surface plasmon resonance,
or which inhibits phytohemagglutinin blast proliferation in an in
vitro phytohemagglutinin blast proliferation assay (PHA assay) with
an IC.sub.50 of 1.times.10.sup.-6M or less. [0354] b) has a heavy
chain variable region comprising the COS-3 germline amino acid
sequence, wherein the heavy chain variable region has a mutation at
a preferred selective mutagenesis position, contact or
hypermutation position with an activity enhancing amino acid
residue. [0355] c) has a light chain variable region comprising the
DPL8 germline amino acid sequence, wherein the light chain variable
region has a mutation at a preferred selective mutagenesis
position, contact or hypermutation position with an activity
enhancing amino acid residue.
[0356] Due to certain amino acid residues occupying key sites in
the CDR and framework regions in the light and heavy chain variable
region, structural features are conferred at these regions. In
particular, the CDR2 and CDR1 regions are subject to canonical
structural classifications. Since there is a high degree of amino
acids sequence homology between family members, these canonical
features are present between family members. The skilled artisan
will appreciate that modifications at the amino acid residues that
confer these canonical structures would produce additional
antibodies that bind to IL-12. The modifications can be performed
using standard molecular biology techniques as described above.
[0357] Accordingly, in another aspect, the invention features an
isolated human antibody, or an antigen-binding portion thereof,
which has the following characteristics: [0358] a) that binds to
human IL-12 and dissociates from human IL-12 with a k.sub.off rate
constant of 0.1 s.sup.-1 or less, as determined by surface plasmon
resonance, or which inhibits phytohemagglutinin blast proliferation
in an in vitro phytohemagglutinin blast proliferation assay (PHA
assay) with an IC.sub.50 of 1.times.10.sup.-6M or less. [0359] b)
has a heavy chain variable region comprising an amino acid sequence
selected from a member of the V.sub.H3 germline family, wherein the
heavy chain variable region comprises a CDR2 that is structurally
similar to CDR2s from other V.sub.H3 germline family members, and a
CDR1 that is structurally similar to CDR1s from other V.sub.H3
germline family members, and wherein the heavy chain variable
region has a mutation at a preferred selective mutagenesis
position, contact or hypermutation position with an activity
enhancing amino acid residue; [0360] c) has a light chain variable
region comprising an amino acid sequence selected from a member of
the V.sub..lamda.1 germline family, wherein the light chain
variable region comprises a CDR2 that is structurally similar to
CDR2s from other V.sub..lamda.1 germline family members, and a CDR1
that is structurally similar to CDR1s from other V.sub..lamda.1
germline family members, and wherein the light chain variable
region has a mutation at a preferred selective mutagenesis
position, contact or hypermutation position with an activity
enhancing amino acid residue.
[0361] Recombinant human antibodies of the invention have variable
and constant regions which are homologous to human germline
immunoglobulin sequences selected from the VBASE database.
Mutations to the recombinant human antibodies (e.g., by random
mutagenesis or PCR mutagenesis) result in amino acids that are not
encoded by human germline immunoglobulin sequences. Also, libraries
of recombinant antibodies which were derived from human donors will
contain antibody sequences that differ from their corresponding
germline sequences due to the normal process of somatic mutation
that occurs during B-cell development. It should be noted that if
the "germline" sequences obtained by PCR amplification encode amino
acid differences in the framework regions from the true germline
configuration (i.e., differences in the amplified sequence as
compared to the true germline sequence), it may be desirable to
change these amino acid differences back to the true germline
sequences (i.e., "backmutation" of framework residues to the
germline configuration). Thus, the present invention can optionally
include a backmutation step. To do this, the amino acid sequences
of heavy and light chain encoded by the germline (as found as
example in VBASE database) are first compared to the mutated
immunoglobulin heavy and light chain framework amino acid sequences
to identify amino acid residues in the mutated immunoglobulin
framework sequence that differ from the closest germline sequences.
Then, the appropriate nucleotides of the mutated immunoglobulin
sequence are mutated back to correspond to the germline sequence,
using the genetic code to determine which nucleotide changes should
be made. Mutagenesis of the mutated immunoglobulin framework
sequence is carried out by standard methods, such as PCR-mediated
mutagenesis (in which the mutated nucleotides are incorporated into
the PCR primers such that the PCR product contains the mutations)
or site-directed mutagenesis. The role of each amino acid
identified as candidate for backmutation should be investigated for
a direct or indirect role in antigen binding and any amino acid
found after mutation to affect any desirable characteristic of the
human antibody should not be included in the final human antibody;
as an example, activity enhancing amino acids identified by the
selective mutagenesis approach will not be subject to backmutation.
Assays to determine the characteristics of the antibody resulting
from mutagenesis can include ELISA, competitive ELISA, in vitro and
in vivo neutralization assays and/or (see e.g. Example 3)
immunohistochemistry with tissue sections from various sources
(including human, primate and/or other species).
[0362] To minimize the number of amino acids subject to
backmutation those amino acid positions found to be different from
the closest germline sequence but identical to the corresponding
amino acid in a second germline sequence can remain, provided that
the second germline sequence is identical and colinear to the
sequence of the human antibody of the invention for at least 10,
preferably 12 amino acids, on both sides of the amino acid in
question. This would assure that any peptide epitope presented to
the immune system by professional antigen presenting cells in a
subject treated with the human antibody of the invention would not
be foreign but identical to a self-antigen, i.e. the immunoglobulin
encoded by that second germline sequence. Backmutation may occur at
any stage of antibody optimization; preferably, backmutation occurs
directly before or after the selective mutagenesis approach. More
preferably, backmutation occurs directly before the selective
mutagenesis approach.
III. Modifications to Preferred Selective Mutagenesis Positions,
Contact and/or Hypermutation Positions
[0363] Typically, selection of antibodies with improved affinities
can be carried out using phage display methods, as described in
section II above. This can be accomplished by randomly mutating
combinations of CDR residues and generating large libraries
containing antibodies of different sequences. However, for these
selection methods to work, the antibody-antigen reaction must tend
to equilibrium to allow, over time, preferential binding of higher
affinity antibodies to the antigen. Selection conditions that would
allow equilibrium to be established could not be determined
(presumably due to additional non-specific interactions between the
antigen and phage particle) when phage display methods were used to
improve the affinity of selected anti-IL-12 antibodies, upon
attaining a certain level of affinity achieved (i.e., that of
antibody Y61). Accordingly, antibodies with even higher affinities
could not be selected by phage display methods. Thus, for at least
certain antibodies or antigens, phage display methods are limiting
in their ability to select antibodies with a highly improved
binding specificity/affinity. Accordingly, a method termed
Selective Mutagenesis Approach which does not require phage display
affinity maturation of antibodies, was established to overcome this
limitation and is provided by the invention. Although this
Selective Mutagenesis Approach was developed to overcome
limitations using the phage display system, it should be noted that
this method can also be used with the phage display system.
Moreover, the selective mutagenesis approach can be used to improve
the activity of any antibody.
[0364] To improve the activity (e.g., affinity or neutralizing
activity) of an antibody, ideally one would like to mutate every
CDR position in both the heavy and light chains to every other
possible amino acid residue. However, since there are, on average,
70 CDR positions within an antibody, such an approach would be very
time consuming and labor intensive. Accordingly, the method of the
invention allows one to improve the activity of the antibody by
mutating only certain selected residues within the heavy and/or
light chain CDRs. Furthermore, the method of the invention allows
improvement in activity of the antibody without affecting other
desirable properties of the antibody.
[0365] Determining which amino acid residues of an antibody
variable region are in contact with an antigen cannot be accurately
predicted based on primary sequence or their positions within the
variable region. Nevertheless, alignments of sequences from
antibodies with different specificities conducted by Kabat et al.
have identified the CDRs as local regions within the variable
regions which differ significantly among antibodies (Kabat et al.
(1971) Ann. NY Acad, Sci. 190:382-393, Kabat, E. A., et al. (1991)
Sequences of Proteins of Immunological Interest, Fifth Edition,
U.S. Department of Health and Human Services, NIH Publication No.
91-3242). Structural studies have shown that the antigen binding
surface is formed by amino acid residues present in the CDRs. Other
amino acid residues outside the CDR are also known to play
structural roles or be directly involved in antigen binding.
Therefore, for each antigen-antibody pair, amino acid residues
within and outside of the CDRs may be important.
[0366] The sequence alignment studies by Tomlison et al identified
a number of positions in the heavy and light chain CDR1 and CDR2,
and in a portion of the kappa chain CDR3 which are frequent sites
of somatic mutation. (Tomlison et al (1996) J. Mol. Biol. 256:
813-817). In particular, positions H31, H31B, H33, H33B, H52B, H56,
H58, L30, L31, L31A, L50, L53, L91, L92, L93 and L94 were
identified as frequent sites for somatic mutation. However, this
analysis excludes the important heavy chain CDR3 regions, and
sections of the light chain CDR3 which are known to lie in the
center of an antibody binding site, and potentially provide
important interactions with an antigen. Furthermore, Tomlison et
al. propose that somatic diversity alone does not necessarily
predict a role of a specific amino acid in antigen binding, and
suggest conserved amino acid residues that contact the antigen, and
diverse amino acid residues which do not contact the antigen. This
conclusion is further supported by mutational studies on the role
of somatic mutations to antibody affinity (Sharon, (1990), PNAS,
87:4814-7). Nineteen somatic mutations in a high-affinity
anti-p-azophenylarsonate (Ars) antibody were simultaneously
replaced with their corresponding germline residues, generating a
germline version of the anti-Ars antibody which had a two-hundred
fold loss in activity. The full affinity of the anti-Ars antibody
could be recovered by restoring only three of the nineteen somatic
mutations, demonstrating that many somatic mutations may be
permitted that do not contribute to antigen binding activity.
[0367] The result can be explained in part by the nature of
antibody diversity itself. Immature B-cells may produce initially
low affinity antibodies that recognize a number of self or non-self
antigens. Moreover, antibodies may undergo in the course of
affinity maturation sequence variations that may cause
self-reactivity. Hypermutation of such low affinity antibodies may
serve to abolish self-reactivity ("negative selection") and
increase affinity for the foreign antigen. Therefore, the analysis
of primary and structural data of a large number of antibodies does
not provide a method of predicting either (1) the role of somatic
hyper-mutation sites in the affinity maturation process versus the
process of decreasing affinity towards unwanted antigens, or (2)
how a given amino acid contributes to the properties of a specific
antigen-antibody pair.
[0368] Other attempts to address the role of specific amino acid
residues in antigen recognition were made by analyzing a number of
crystal structures of antigen-antibody complexes (MacCallum et al.
(1996) J. Mol. Biol. 262: 732-745). The potential role of positions
located within and outside the CDRs was indicated. Positions in
CDRs involved in antigen binding in more than 10 of 26 analyzed
structures included H31, H33, H50, H52, H53, H54, H56, H58, H95,
H96, H97, H98 and H100 in the heavy chain and L30A, L32, L91, L92,
L93, L94, L96 in the light chain. However, the authors noted that
prediction of antigen contacts using these and other structural
data may over and under predict contact positions, leading to the
speculation that a different strategy may have to be applied to
different antigens.
[0369] Pini et al. describe randomizing multiple residues in
antibody CDR sequences in a large phage display library to rapidly
increase antibody affinity (Pini et al. (1998) J. Biol Chem. 273:
21769-21776). However, the high affinity antibodies discussed by
Pini et al. had mutations in a total of eight positions, and a
reductionary analysis of which changes are absolutely required to
improve affinity of the antibody becomes impractical because of the
large number of possible combinations to be tested for the smallest
number of amino acids required.
[0370] Furthermore, randomizing multiple residues may not
necessarily preserve other desired properties of the antibody.
Desirable properties or characteristics of an antibody are
art-recognized and include for example, preservation of non-cross
reactivity, e.g., with other proteins or human tissues and
preservation of antibody sequences that are close to human germline
immunoglobulin sequences improvement of neutralization potency.
Other desirable properties or characteristics include ability to
preserve species cross reactivity, ability to preserve epitope
specificity and ability to preserve high expression levels of
protein in mammalian cells. The desirable properties or
characteristics can be observed or measured using art-recognized
techniques including but not limited to ELISA, competitive ELISA,
in vitro and in vivo neutralization assays (see e.g. Example 3),
immunohistochemistry with tissue sections from different sources
including human, primate or other sources as the need may be, and
studies to expression in mammalian cells using transient expression
or stable expression.
[0371] In addition, the method of Pini et al may introduce more
changes than the minimal number actually required to improve
affinity and may lead to the antibodies triggering
anti-human-antibody (HAMA) formation in human subjects. Further, as
discussed elsewhere, the phage display as demonstrated here, or
other related method including ribosome display may not work
appropriately upon reaching certain affinities between antibody and
antigen and the conditions required to reach equilibrium may not be
established in a reasonable time frame because of additional
interactions including interactions with other phage or ribosome
components and the antigen.
[0372] The ordinarily skilled artisan may glean interesting
scientific information on the origin of antibody diversity from the
teachings of the references discussed above. The present invention,
however, provides a method for increasing antibody affinity of a
specific antigen-antibody pair while preserving other relevant
features or desirable characteristics of the antibody. This is
especially important when considering the desirability of imparting
a multitude of different characteristics on a specific antibody
including antigen binding.
[0373] If the starting antibody has desirable properties or
characteristics which need to be retained, a selective mutagenesis
approach can be the best strategy for preserving these desirable
properties while improving the activity of the antibody. For
example, in the mutagenesis of Y61, the aim was to increase
affinity for hIL-12, and to improve the neutralization potency of
the antibody while preserving desired properties. Desired
properties of Y61 included (1) preservation of non-cross reactivity
with other proteins or human tissues, (2) preservation of fine
epitope specificity, i.e. recognizing a p40 epitope preferably in
the context of the p70 (p40/p35) heterodimer, thereby preventing
binding interference from free soluble p40; and (3) generation of
an antibody with heavy and light chain amino acid sequences that
were as close as possible to their respective germline
immunoglobulin sequences.
[0374] In one embodiment, the method of the invention provides a
selective mutagenesis approach as a strategy for preserving the
desirable properties or characteristics of the antibody while
improving the affinity and/or neutralization potency. The term
"selective mutagenesis approach" is as defined above and includes a
method of individually mutating selected amino acid residues. The
amino acid residues to be mutated may first be selected from
preferred selective mutagenesis positions, then from contact
positions, and then from hypermutation positions. The individual
selected position can be mutated to at least two other amino acid
residue and the effect of the mutation both on the desired
properties of the antibody, and improvement in antibody activity is
determined.
[0375] The Selective Mutagenesis approach comprises the steps
of:
[0376] selecting candidate positions in the order 1) preferred
selective mutagenesis positions; 2) contact positions; 3)
hypermutation positions and ranking the positions based on the
location of the position within the heavy and light chain variable
regions of an antibody (CDR3 preferred over CDR2 preferred over
CDR1);
[0377] individually mutating candidate preferred selective
mutagenesis positions, hypermutation and/or contact positions in
the order of ranking, to all possible other amino acid residues and
analyzing the effect of the individual mutations on the activity of
the antibody in order to determine activity enhancing amino acid
residues;
[0378] if necessary, making stepwise combinations of the individual
activity enhancing amino acid residues and analyzing the effect of
the various combinations on the activity of the antibodies;
selecting mutant antibodies with activity enhancing amino acid
residues and ranking the mutant antibodies based on the location
and identity of the amino acid substitutions with regard to their
immunogenic potential. Highest ranking is given to mutant
antibodies that comprise an amino acid sequence which nearly
identical to a variable region sequence that is described in a
germline database, or has an amino acid sequence that is comparable
to other human antibodies. Lower ranking is given to mutant
antibodies containing an amino acid substitution that is rarely
encountered in either germline sequences or the sequences of other
human antibodies. The lowest ranking is given to mutant antibodies
with an amino acid substitution that has not been encountered in a
germline sequence or the sequence of another human antibody. As set
forth above, mutant antibodies comprising at least one activity
enhancing amino acid residue located in CDR3 is preferred over CDR2
which is preferred over CDR1. The CDRs of the heavy chain variable
regions are preferred over those of the light chain variable
region.
[0379] The mutant antibodies can also be studied for improvement in
activity, e.g. when compared to their corresponding parental
antibody. The improvement in activity of the mutant antibody can be
determined for example, by neutralization assays, or binding
specificity/affinity by surface plasmon resonance analysis (see
Example 3). Preferably, the improvement in activity can be at least
2-20 fold higher than the parental antibody. The improvement in
activity can be at least "x.sub.1" to "x.sub.2" fold higher than
the parental antibody wherein "x.sub.1" and "x.sub.2" are integers
between and including 2 to 20, including ranges within the state
range, e.g. 2-15, e.g. 5-10.
[0380] The mutant antibodies with the activity enhancing amino acid
residue also can be studied to determine whether at least one other
desirable property has been retained after mutation. For example,
with anti-hIL-12 antibodies testing for, (1) preservation of
non-cross reactivity with other proteins or human tissues, (2)
preservation of epitope recognition, i.e. recognizing a p40 epitope
preferably in the context of the p70 (p40/p35) heterodimer, thereby
preventing binding interference from free soluble p40; and (3)
generation of antibodies with heavy and light chain amino acid
sequences that were as close as possible to their respective
germline immunoglobulin sequences, and determining which would be
least likely to elicit a human immune response based on the number
of differences from the germline sequence. The same observations
can be made on an antibody having more than one activity enhancing
amino acid residues, e.g. at least two or at least three activity
enhancing amino acid residues, to determine whether retention of
the desirable property or characteristic has occurred.
[0381] An example of the use of a "selective mutagenesis approach",
in the mutagenesis of Y61 is described below. The individual
mutations H31S.fwdarw.E, L50.fwdarw.Y, or L94G.fwdarw.Y each
improved neutralization activity of the antibody. However, when
combination clones were tested, the activity of the combined clone
H31S.fwdarw.E+L50.fwdarw.Y+L94G.fwdarw.Y was no better than
L50.fwdarw.Y+L94G.fwdarw.Y (J695). Therefore, changing the germline
amino acid residue Ser to Glu at position 31 of CDR1 was
unnecessary for the improved activity of J695 over Y61. The
selective mutagenesis approach therefore, identified the minimal
number of changes that contributed to the final activity, thereby
reducing the immunogenic potential of the final antibody and
preserving other desired properties of the antibody.
[0382] Isolated DNA encoding the VH and VL produced by the selected
mutagenesis approach can be converted into full length antibody
chain genes, to Fab fragment genes as to a scFV gene, as described
in section IV. For expression of VH and VL regions produced by the
selected mutagenesis approach, expression vectors encoding the
heavy and light chain can be transfected into variety host cells as
described in detail in section IV. Preferred host cells include
either prokaryotic host cells, for example, E coli, or eukaryotic
host cells, for example, yeast cells, e.g., S. cerevisae. Most
preferred eukaryotic host cells are mammalian host cells, described
in detail in section IV.
[0383] The selective mutagenesis approach provides a method of
producing antibodies with improved activities without prior
affinity maturation of the antibody by other means. The selective
mutagenesis approach provides a method of producing antibodies with
improved affinities which have been subject to back mutations. The
selective mutagenesis approach also provides a method of improving
the activity of affinity matured antibodies.
[0384] The skilled artisan will recognize that the selective
mutagenesis approach can be used in standard antibody manipulation
techniques known in the art. Examples include, but are not limited
to, CDR grafted antibodies, chimeric antibodies, scFV fragments,
Fab fragments of a full length antibodies and human antibodies from
other sources, e.g., transgenic mice.
[0385] Rapid large scale mutational analysis of antibodies include
in vitro transcription and translation using ribosome display
technology (see e.g., Hanes et al., (1997) Proc. Natl. Acad. Sci.
94: 4937-4942; Dall Acqua et al., (1998) Curr. Opin. Struc. Biol.
8: 443-450; He et al., (1997) Nucleic Acid Res. 25: 5132-5134), and
U.S. Pat. Nos. 5,643,768 and 5,658,754 issued to Kawasaki. The
selective mutagenesis approach also provides a method of producing
antibodies with improved activities that can be selected using
ribosomal display techniques.
[0386] In the methods of the invention, antibodies or antigen
binding portions thereof are further modified by altering
individual positions in the CDRs of the HCVR and/or LCVR. Although
these modifications can be made in phage-displayed antibodies, the
method is advantageous in that it can be performed with antibodies
that are expressed in other types of host systems, such as
bacterial, yeast or mammalian cell expression systems. The
individual positions within the CDRs selected for modification are
based on the positions being a contact and/or hypermutation
position.
[0387] Preferred contact positions and hypermutation positions as
defined herein are shown in Table 3 (see Appendix A) and their
modification in accordance with the method of the invention is
described in detail in Example 2. Preferred contact positions are
selected from the group consisting of H30, H31, H31B, H32, H33,
H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97, H98, H101,
L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93, L94 and L96.
Preferred hypermutation positions are selected from the group
consisting of H30, H31, H31B, H32, H52, H56, H58, L30, L31, L32,
L53 and L93. More preferred amino acid residues (referred to as
"preferred selective mutagenesis positions") are both contact and
hypermutation positions and are selected from the group consisting
of H30, H31, H31B, H32, H33, H52, H56, H58, L30, L31, L32, L50,
L91, L92, L93, L94. Particularly preferred contact positions are
selected from the group consisting of L50 and L94.
Preferred activity enhancing amino acid residues replace amino acid
residues located at positions selected from the group consisting of
H30, H31, H31B, H32, H33, H35, H50, H52, H52A, H53, H54, H56, H58,
H95, H96, H97, H98, H101, L30, L31, L32, L34, L50, L52, L53, L55,
L91, L92, L93, L94, and L96. More preferred activity enhancing
amino acid residues replace amino acid residues located at
positions H30, H31, H31B, H32, H33, H52, H56, H58, L30, L31, L32,
L50, L91, L92, L93, L94. Particularly, preferred activity enhancing
amino acid residues replace amino acid residues located at
positions selected from the group consisting of L50 and L94.
[0388] In general, the method of the invention involves selecting a
particular preferred selective mutagenesis position, contact and/or
hypermutation position within a CDR of the heavy or light chain of
a parent antibody of interest, or antigen binding portion thereof,
randomly mutagenizing that individual position (e.g., by genetic
means using a mutagenic oligonucleotide to generate a
"mini-library" of modified antibodies), or mutating a position to
specific desired amino acids, to identify activity enhancing amino
acid residues expressing, and purifying the modified antibodies
(e.g., in a non-phage display host system), measuring the activity
of the modified antibodies for antigen (e.g., by measuring
k.sub.off rates by BIAcore analysis), repeating these steps for
other CDR positions, as necessary, and combining individual
mutations shown to have improved activity and testing whether the
combination(s) generate an antibody with even greater activity
(e.g., affinity or neutralizing potency) than the parent antibody,
or antigen-binding portion thereof.
[0389] Accordingly, in one embodiment, the invention provides a
method for improving the activity of an antibody, or
antigen-binding portion thereof, comprising:
[0390] a) providing a parent antibody or antigen-binding portion
thereof;
[0391] b) selecting in order a 1) preferred selective mutagenesis
position, 2) contact position, or 3) hypermutation position within
a complementarity determining region (CDR) for mutation, thereby
identifying a selected preferred selective mutagenesis position,
contact or hypermutation position;
[0392] c) individually mutating said selected preferred selective
mutagenesis position, contact or hypermutation position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof;
[0393] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof;
[0394] e) optionally, repeating steps a) through d) for at least
one other preferred selective mutagenesis position, contact or
hypermutation position;
[0395] f) combining, in the parent antibody, or antigen-binding
portion thereof, individual mutations shown to have improved
activity, to form combination antibodies, or antigen-binding
portions thereof; and
[0396] g) evaluating the activity of the combination antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof;
until an antibody, or antigen-binding portion thereof, with an
improved activity, relative to the parent antibody, or
antigen-binding portion thereof, is obtained. Preferably, the
selected antibody or antibodies have an improved activity without
loss or with retention of at least one desirable characteristic or
property of the parental antibody as described above. The desirable
characteristic or property can be measured or observed by the
ordinarily skilled artisan using art-recognized techniques.
[0397] Preferred contact positions are selected from the group
consisting of H30, H31, H31B, H32, H33, H35, H50, H52, H52A, H53,
H54, H56, H58, H95, H96, H97, H98, H101, L30, L31, L32, L34, L50,
L52, L53, L55, L91, L92, L93, L94 and L96. Preferred hypermutation
positions are selected from the group consisting of H30, H31, H31B,
H32, H52, H56, H58, L30, L31, L32, L53 and L93. More preferred
selective mutagenesis positions are selected from the group
consisting of H30, H31, H31B, H32, H33, H52, H56, H58, L30, L31,
L32, L50, L91, L92, L93 and L94. Particularly preferred contact
positions are selected from the group consisting of L50 and
L94.
[0398] In another embodiment, the invention provides a method for
improving the activity of an antibody, or antigen-binding portion
thereof, comprising:
[0399] a) providing a parent antibody or antigen-binding portion
thereof;
[0400] b) selecting a preferred selective mutagenesis position,
contact or hypermutation position within a complementarity
determining region (CDR) for mutation;
[0401] c) individually mutating said selected preferred selective
mutagenesis position, contact or hypermutation position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof;
[0402] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof, thereby
identifying an activity enhancing amino acid residue;
[0403] e) optionally, repeating steps a) through d) for at least
one other preferred selective mutagenesis position, contact or
hypermutation position;
[0404] f) combining, in the parent antibody, or antigen-binding
portion thereof, two individual activity enhancing amino acid
residues shown to have improved activity, to form combination
antibodies, or antigen-binding portions thereof; and
[0405] g) evaluating the activity of the combination antibodies, or
antigen-binding portions thereof with two activity enhancing amino
acid residues, relative to the parent antibody or antigen-binding
portion thereof;
until an antibody, or antigen-binding portion thereof, with an
improved activity, relative to the parent antibody, or
antigen-binding portion thereof, is obtained.
[0406] Preferred contact positions are selected from the group
consisting of H30, H31, H31B, H32, H33, H35, H50, H52, H52A, H53,
H54, H56, H58, H95, H96, H97, H98, H101, L30, L31, L32, L34, L50,
L52, L53, L55, L91, L92, L93, L94 and L96. Preferred hypermutation
positions are selected from the group consisting of H30, H31, H31B,
H32, H52, H56, H58, L30, L31, L32, L53 and L93. More preferred
selective mutagenesis positions are selected from the group
consisting of H30, H31, H31B, H32, H33, H52, H56, H58, L30, L31,
L32, L50, L91, L92, L93 and L94. Particularly preferred contact
positions are selected from the group consisting of L50 and
L94.
[0407] In another embodiment, the invention provides a method for
improving the activity of an antibody, or antigen-binding portion
thereof, comprising:
[0408] a) providing a parent antibody or antigen-binding portion
thereof;
[0409] b) selecting a preferred selective mutagenesis position,
contact or hypermutation position within a complementarity
determining region (CDR) for mutation;
[0410] c) individually mutating said selected preferred selective
mutagenesis position, contact or hypermutation position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof;
[0411] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof, thereby
identifying an activity enhancing amino acid residue;
[0412] e) optionally, repeating steps a) through d) for at least
one other preferred selective mutagenesis position, contact or
hypermutation position;
[0413] f) combining, in the parent antibody, or antigen-binding
portion thereof, three individual activity enhancing amino acid
residues shown to have improved activity, to form combination
antibodies, or antigen-binding portions thereof; and
[0414] g) evaluating the activity of the combination antibodies, or
antigen-binding portions thereof with two activity enhancing amino
acid residues, relative to the parent antibody or antigen-binding
portion thereof;
until an antibody, or antigen-binding portion thereof, with an
improved activity, relative to the parent antibody, or
antigen-binding portion thereof, is obtained.
[0415] Preferably, the activity enhancing amino acid residue
replaces amino acid residues located at positions selected from the
group consisting of H30, H31, H31B, H32, H33, H35, H50, H52, H52A,
H53, H54, H56, H58, H95, H96, H97, H98, H101, L30, L31, L32, L34,
L50, L52, L53, L55, L91, L92, L93, L94 and L96.
[0416] Following mutagenesis of individual selected positions,
mutated clones can be sequenced to identify which amino acid
residues have been introduced into the selected position in each
clone. A small number of clones (e.g., about 24) can be selected
for sequencing, which statistically should yield 10-15 unique
antibodies, whereas larger numbers of clones (e.g., greater than
60) can be sequenced to ensure that antibodies with every possible
substitution at the selected position are identified.
[0417] In one embodiment, contact and/or hypermutation positions
within the CDR3 regions of the heavy and/or light chains are first
selected for mutagenesis. However, for antibodies that have already
been affinity matured in vitro by random mutagenesis of the CDR3
regions via phage display selection, it may be preferably to first
select contact and/or hypermutation positions within CDR1 or CDR2
of the heavy and/or light chain.
[0418] In a more preferred embodiment, preferred selective
mutagenesis positions within the CDR3 regions of the heavy and/or
light chains are first selected for mutagenesis. However, for
antibodies that have already been affinity matured in vitro by
random mutagenesis of the CDR3 regions via phage display selection,
it may be preferably to first select preferred selective
mutagenesis positions within CDR1 or CDR2 of the heavy and/or light
chain.
[0419] In another preferred embodiment, the optimization of a
selected antibody by the selective mutagenesis approach is done
sequentially as follows: preferred selective mutagenesis positions
selected from the group consisting of H30, H31, H31B, H32, H33,
H52, H56, H58, L30, L31, L32, L50, L91, L92, L93, L94 are mutated
first to at least 2 other amino acids each (preferably 5-14 other
amino acids) and the resulting antibodies are characterized for
increased affinity, neutralization potency (and possibly also for
at least one other retained characteristic or property discussed
elsewhere). If a mutation of a single preferred selective
mutagenesis position does not increase the affinity or
neutralization potency at all or sufficiently and if even the
combination of multiple activity enhancing amino acids replacing
amino acids in preferred selective mutagenesis positions does not
result in an combination antibody which meets the target activity
(including affinity and/or neutralization potency), additional
amino acid residues will be selected for selective mutagenesis from
the group consisting of H35, H50, H53, H54, H95, H96, H97, H98,
L30A and L96 are mutated to at least 2 other amino acids each
(preferably 5-14 other amino acids) and the resulting antibodies
are characterized for increased affinity, neutralization potency
(and possibly also for at least one other retained characteristic
or property discussed elsewhere).
[0420] If a mutation of a single amino acid residue selected from
the group consisting of H35, H50, H53, H54, H95, H96, H97, H98,
L30A and L96 does not increase the activity (including affinity
and/or neutralization potency) at all or not sufficiently and if
even the combination of multiple activity enhancing amino acids
replacing amino acids in those positions does not result in an
combination antibody which meets the targeted activity (including
affinity and/or target neutralization potency), additional amino
acid residues will be selected for selective mutagenesis from the
group consisting of H33B, H52B, L31A and are mutated to at least 2
other amino acids each (preferably 5-14 other amino acids) and the
resulting antibodies are characterized for increased affinity,
neutralization potency (and possibly also for at least one other
retained characteristic or property discussed elsewhere).
[0421] It should be understood that the sequential selective
mutagenesis approach may end at any of the steps outline above as
soon as an antibody with the desired activity (including affinity
and neutralization potency) has been identified. If mutagenesis of
the preselected positions has identified activity enhancing amino
acids residues but the combination antibody still do not meet the
targets set for activity (including affinity and neutralization
potency) and/or if the identified activity enhancing amino acids
also affect other desired characteristics and are therefore not
acceptable, the remaining CDR residues may be subjected to
mutagenesis (see section IV).
[0422] The method of the invention can be used to improve activity
of an antibody, or antigen binding portion thereof, to reach a
predetermined target activity (e.g. a predetermined affinity and/or
neutralization potency, and/or a desired property or
characteristic).
[0423] Accordingly, the invention provides a method of improving
the activity of an antibody, or antigen-binding portion thereof, to
attain a predetermined target activity, comprising:
[0424] a) providing a parent antibody a antigen-binding portion
thereof;
[0425] b) selecting a preferred selective mutagenesis position
selected from group consisting of H30, H31, H31B, H32, H33, H52,
H56, H58, L30, L31, L32, L50, L91, L92, L93, L94.
[0426] c) individually mutating the selected preferred selective
mutagenesis position to at least two other amino acid residues to
hereby create a first panel of mutated antibodies, or antigen
binding portions thereof;
[0427] d) evaluating the activity of the first panel of mutated
antibodies, or antigen binding portions thereof to determined if
mutation of a single selective mutagenesis position produces an
antibody or antigen binding portion thereof with the predetermined
target activity or a partial target activity;
[0428] e) combining in a stepwise fashion, in the parent antibody,
or antigen binding portion thereof, individual mutations shown to
have an improved activity, to form combination antibodies, or
antigen binding portions thereof.
[0429] f) evaluating the activity of the combination antibodies, or
antigen binding portions thereof to determined if the combination
antibodies, or antigen binding portions thereof have the
predetermined target activity or a partial target activity.
[0430] g) if steps d) or f) do not result in an antibody or antigen
binding portion thereof having the predetermined target activity,
or result an antibody with only a partial activity, additional
amino acid residues selected from the group consisting of H35, H50,
H53, H54, H95, H96, H97, H98, L30A and L96 are mutated to at least
two other amino acid residues to thereby create a second panel of
mutated antibodies or antigen-binding portions thereof;
[0431] h) evaluating the activity of the second panel of mutated
antibodies or antigen binding portions thereof, to determined if
mutation of a single amino acid residue selected from the group
consisting of H35, H50, H53, H54, H95, H96, H97, H98, L30A and L96
results an antibody or antigen binding portion thereof, having the
predetermined target activity or a partial activity;
[0432] i) combining in stepwise fashion in the parent antibody, or
antigen-binding portion thereof, individual mutations of step g)
shown to have an improved activity, to form combination antibodies,
or antigen binding portions thereof;
[0433] j) evaluating the activity of the combination antibodies or
antigen binding portions thereof, to determined if the combination
antibodies, or antigen binding portions thereof have the
predetermined target activity or a partial target activity;
[0434] k) if steps h) or j) do not result in an antibody or antigen
binding portion thereof having the predetermined target activity,
or result in an antibody with only a partial activity, additional
amino acid residues selected from the group consisting of H33B,
H52B and L31A are mutated to at least two other amino acid residues
to thereby create a third panel of mutated antibodies or antigen
binding portions thereof;
[0435] l) evaluating the activity of the third panel of mutated
antibodies or antigen binding portions thereof, to determine if a
mutation of a single amino acid residue selected from the group
consisting of H33B, H52B and L31A resulted in an antibody or
antigen binding portion thereof, having the predetermined target
activity or a partial activity;
[0436] m) combining in a stepwise fashion in the parent antibody,
or antigen binding portion thereof, individual mutation of step k)
shown to have an improved activity, to form combination antibodies,
or antigen binding portions, thereof;
[0437] n) evaluating the activity of the combination antibodies or
antigen-binding portions thereof, to determine if the combination
antibodies, or antigen binding portions thereof have the
predetermined target activity to thereby produce an antibody or
antigen binding portion thereof with a predetermined target
activity.
[0438] A number of mutagenesis methods can be used, including PCR
assembly, Kunkel (dut-ung-) and thiophosphate (Amersham Sculptor
kit) oligonucleotide-directed mutagenesis.
[0439] A wide variety of host expression systems can be used to
express the mutated antibodies, including bacterial, yeast,
baculoviral and mammalian expression systems (as well as phage
display expression systems). An example of a suitable bacterial
expression vector is pUC119(Sfi). Other antibody expression systems
are known in the art and/or are described below in section IV.
[0440] The modified antibodies, or antigen binding portions
thereof, produced by the method of the invention can be identified
without the reliance on phage display methods for selection.
Accordingly, the method of the invention is particularly
advantageous for improving the activity of a recombinant parent
antibody or antigen-binding portion thereof, that was obtained by
selection in a phage-display system but whose activity cannot be
further improved by mutagenesis in the phage-display system.
[0441] Accordingly, in another embodiment, the invention provides a
method for improving the affinity of an antibody, or
antigen-binding portion thereof, comprising:
[0442] a) providing a recombinant parent antibody or
antigen-binding portion thereof; that was obtained by selection in
a phage-display system but whose activity cannot be further
improved by mutagenesis in said phage-display system;
[0443] b) selecting a preferred selective mutagenesis position,
contact or hypermutation position within a complementarity
determining region (CDR) for mutation, thereby identifying a
selected contact or hypermutation position;
[0444] c) individually mutating said selected preferred selective
mutagenesis position, contact or hypermutation position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof, and expressing
said panel in a non-phage display system;
[0445] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof;
[0446] e) optionally repeating steps b) through d) for at least one
other preferred selective mutagenesis position, contact or
hypermutation position;
[0447] f) combining, in the parent antibody, or antigen-binding
portion thereof, individual mutations shown to have improved
activity, to form combination antibodies, or antigen-binding
portions thereof; and
[0448] g) evaluating the activity of the combination antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof;
until an antibody, or antigen-binding portion thereof, with an
improved activity, relative to the parent antibody, or
antigen-binding portion thereof, is obtained.
[0449] Preferred contact positions are selected from the group
consisting of H30, H31, H31B, H32, H33, H35, H50, H52, H52A, H53,
H54, H56, H58, H95, H96, H97, H98, H101, L30, L31, L32, L34, L50,
L52, L53, L55, L91, L92, L93, L94 and L96. Preferred hypermutation
positions are selected from the group consisting of H30, H31, H31B,
H32, H52, H56, H58, L30, L31, L32, L53 and L93. More preferred
selective mutagenesis positions are selected from the group
consisting of H30, H31, H31B, H32, H33, H52, H56, H58, L30, L31,
L32, L50, L91, L92, L93 and L94. Particularly preferred contact
positions are selected from the group consisting of L50 and
L94.
[0450] With available methods it is not possible or it is extremely
laborious to derive an antibody with increased binding affinity and
neutralization potency while retaining other properties or
characteristics of the antibodies as discussed above. The method of
this invention, however, can readily identify such antibodies. The
antibodies subjected to the method of this invention can come from
any source.
[0451] Therefore, in another embodiment, the invention provides a
method for improving the activity of an antibody, or
antigen-binding portion thereof, comprising:
[0452] a) providing a recombinant parent antibody or
antigen-binding portion thereof;
[0453] b) selecting a preferred selective mutagenesis position,
contact or hypermutation position within a complementarity
determining region (CDR) for mutation, thereby identifying a
selected preferred selective mutagenesis position, contact or
hypermutation position;
[0454] c) individually mutating said selected preferred selective
mutagenesis position, contact or hypermutation position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof and expressing said
panel in an appropriate expression system;
[0455] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof, thereby
identifying an activity enhancing amino acid residue;
[0456] e) evaluating the panel of mutated antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof for at least one other property
or characteristics, wherein the property or characteristic is one
that needs to be retained in the antibody;
until an antibody, or antigen-binding portion thereof, with an
improved activity and at least one retained property or
characteristic, relative to the parent antibody, or antigen-binding
portion thereof, is obtained.
[0457] In a preferred embodiment, the contact positions are
selected from the group consisting of H30, H31, H31B, H32, H33,
H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97, H98, H101,
L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93, L94 and L96
and the other characteristic is selected from 1) preservation of
non-crossreactivity with other proteins or human tissues, 2)
preservation of epitope recognition, i.e. recognizing p40 epitope
preferably in the context of the p70 p40/p35 heterodimer preventing
binding interference from free, soluble p40 and/or 3) to produce an
antibody with a close to germline immunoglobulin sequence.
[0458] In another preferred embodiment, the hypermutation positions
are selected from the group consisting of H30, H31, H31B, H32, H52,
H56, H58, L30, L31, L32, L53 and L93 and the other characteristic
is selected from 1) preservation of non-crossreactivity with other
proteins or human tissues, 2) preservation of epitope recognition,
i.e. recognizing p40 epitope preferably in the context of the p70
p40/p35 heterodimer preventing binding interference from free,
soluble p40 and/or 3) to produce an antibody with a close to
germline immunoglobulin sequence.
[0459] In a more preferred embodiment the residues for selective
mutagenesis are selected from the preferred selective mutagenesis
positions from the group consisting of H30, H31, H31B, H32, H33,
H52, H56, H58, L30, L31, L32, L50, L91, L92, L93, L94 and the other
characteristic is selected from 1) preservation of
non-crossreactivity with other proteins or human tissues, 2)
preservation of epitope recognition, i.e. recognizing p40 epitope
preferably in the context of the p70 p40/p35 heterodimer preventing
binding interference from free, soluble p40 and/or 3) to produce an
antibody with a close to germline immunoglobulin sequence.
[0460] In a more preferred embodiment, the contact positions are
selected from the group consisting of L50 and L94 and the other
characteristic is selected from 1) preservation of
non-crossreactivity with other proteins or human tissues, 2)
preservation of epitope recognition, i.e. recognizing p40 epitope
preferably in the context of the p70 p40/p35 heterodimer preventing
binding interference from free, soluble p40 and/or 3) to produce an
antibody with a close to germline immunoglobulin sequence.
[0461] If therefore, the affinity of an antibody for a specific
antigen should be improved, but where the phage display (or related
system including ribosome display) method is no longer applicable,
and other desirable properties or characteristics should be
retained, the method of the invention can be used. Accordingly, in
another embodiment, the invention provides a method for improving
the activity of an antibody, or antigen-binding portion thereof,
comprising:
[0462] a) providing a recombinant parent antibody or
antigen-binding portion thereof; that was obtained by selection in
a phage-display system but whose activity cannot be further
improved by mutagenesis in said phage-display system;
[0463] b) selecting a preferred selective mutagenesis position,
contact or hypermutation position within a complementarity
determining region (CDR) for mutation, thereby identifying a
selected preferred selective mutagenesis position, contact or
hypermutation position;
[0464] c) individually mutating said selected preferred selective
mutagenesis position, contact or hypermutation position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof, and expressing
said panel in a non-phage display system;
[0465] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof thereby
identifying an activity enhancing amino acid residue;
[0466] e) evaluating the panel of mutated antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof for at least one other property
or characteristic, wherein the property or characteristic is one
that needs to be retained, until an antibody, or antigen-binding
portion thereof, with an improved activity and at least one
retained property or characteristic, relative to the parent
antibody, or antigen-binding portion thereof, is obtained.
[0467] f) optionally, repeating steps a) through e) for at least
one other preferred selective mutagenesis position, contact or
hypermutation position;
[0468] g) combining, in the parent antibody, or antigen-binding
portion thereof, at least two individual activity enhancing amino
acid residues shown to have improved activity and at least one
retained property or characteristic, to form combination
antibodies, or antigen-binding portions thereof; and
[0469] h) evaluating the activity of the combination antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof;
until an antibody, or antigen-binding portion thereof, with an
improved activity and at least one retained other property or
characteristic, relative to the parent antibody, or antigen-binding
portion thereof, is obtained.
[0470] In a preferred embodiment, the contact positions are
selected from the group consisting of H30, H31, H31B, H32, H33,
H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97, H98, H101,
L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93, L94 and L96
and the other characteristic is selected from 1) preservation of
non-crossreactivity with other proteins or human tissues, 2)
preservation of epitope recognition, i.e. recognizing p40 epitope
preferably in the context of the p70 p40/p35 heterodimer preventing
binding interference from free, soluble p40 and/or 3) to produce an
antibody with a close to germline immunoglobulin sequence.
[0471] In another preferred embodiment, the hypermutation positions
are selected from the group consisting of H30, H31, H31B, H32, H52,
H56, H58, L30, L31, L32, L53 and L93 and the other characteristic
is selected from 1) preservation of non-crossreactivity with other
proteins or human tissues, 2) preservation of epitope recognition,
i.e. recognizing p40 epitope preferably in the context of the p70
p40/p35 heterodimer preventing binding interference from free,
soluble p40 and/or 3) to produce an antibody with a close to
germline immunoglobulin sequence.
[0472] In a more preferred embodiment the residues for selective
mutagenesis are selected from the preferred selective mutagenesis
positions from the group consisting of H30, H31, H31B, H32, H33,
H52, H56, H58, L30, L31, L32, L50, L91, L92, L93, L94 and the other
characteristic is selected from 1) preservation of
non-crossreactivity with other proteins or human tissues, 2)
preservation of epitope recognition, i.e. recognizing p40 epitope
preferably in the context of the p70 p40/p35 heterodimer preventing
binding interference from free, soluble p40 and/or 3) to produce an
antibody with a close to germline immunoglobulin sequence.
[0473] In a more preferred embodiment, the contact positions are
selected from the group consisting of L50 and L94 and the other
characteristic is selected from 1) preservation of
non-crossreactivity with other proteins or human tissues, 2)
preservation of epitope recognition, i.e. recognizing p40 epitope
preferably in the context of the p70 p40/p35 heterodimer preventing
binding interference from free, soluble p40 and/or 3) to produce an
antibody with a close to germline immunoglobulin sequence.
[0474] In another embodiment, the invention provides a method for
improving the activity of an antibody, or antigen-binding portion
thereof, comprising:
[0475] a) providing a recombinant parent antibody or
antigen-binding portion thereof; that was obtained by selection in
a phage-display system but whose activity cannot be further
improved by mutagenesis in said phage-display system;
[0476] b) selecting a preferred selective mutagenesis position,
contact or hypermutation position within a complementarity
determining region (CDR) for mutation, thereby identifying a
selected contact or hypermutation position;
[0477] c) individually mutating said selected preferred selective
mutagenesis position, contact or hypermutation position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof, and expressing
said panel in a non-phage display system;
[0478] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof thereby
identifying an activity enhancing amino acid residue;
[0479] e) evaluating the panel of mutated antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof for at least one other property
or characteristic, wherein the property or characteristic is one
that needs to be retained, until an antibody, or antigen-binding
portion thereof, with an improved activity and at least one
retained property or characteristic, relative to the parent
antibody, or antigen-binding portion thereof, is obtained.
[0480] In a preferred embodiment, the contact positions are
selected from the group consisting of H30, H31, H31B, H32, H33,
H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97, H98, H101,
L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93, L94 and L96
and the other characteristic is selected from 1) preservation of
non-crossreactivity with other proteins or human tissues, 2)
preservation of epitope recognition, i.e. recognizing p40 epitope
preferably in the context of the p70 p40/p35 heterodimer preventing
binding interference from free, soluble p40 and/or 3) to produce an
antibody with a close to germline immunoglobulin sequence.
[0481] In another preferred embodiment, the hypermutation positions
are selected from the group consisting of H30, H31, H31B, H32, H52,
H56, H58, L30, L31, L32, L53 and L93 and the other characteristic
is selected from 1) preservation of non-crossreactivity with other
proteins or human tissues, 2) preservation of epitope recognition,
i.e. recognizing p40 epitope preferably in the context of the p70
p40/p35 heterodimer preventing binding interference from free,
soluble p40 and/or 3) to produce an antibody with a close to
germline immunoglobulin sequence.
[0482] In a more preferred embodiment the residues for selective
mutagenesis are selected from the preferred selective mutagenesis
positions from the group consisting of H30, H31, H31B, H32, H33,
H52, H56, H58, L30, L31, L32, L50, L91, L92, L93, L94 and the other
characteristic is selected from 1) preservation of
non-crossreactivity with other proteins or human tissues, 2)
preservation of epitope recognition, i.e. recognizing p40 epitope
preferably in the context of the p70 p40/p35 heterodimer preventing
binding interference from free, soluble p40 and/or 3) to produce an
antibody with a close to germline immunoglobulin sequence.
[0483] In a more preferred embodiment, the contact positions are
selected from the group consisting of L50 and L94 and the other
characteristic is selected from 1) preservation of
non-crossreactivity with other proteins or human tissues, 2)
preservation of epitope recognition, i.e. recognizing p40 epitope
preferably in the context of the p70 p40/p35 heterodimer preventing
binding interference from free, soluble p40 and/or 3) to produce an
antibody with a close to germline immunoglobulin sequence.
[0484] In another embodiment, the invention provides a method for
improving the activity of an antibody, or antigen-binding portion
thereof, comprising:
[0485] a) providing a recombinant parent antibody or
antigen-binding portion thereof; that was obtained by selection in
a phage-display system but whose activity cannot be further
improved by mutagenesis in said phage-display system;
[0486] b) selecting a preferred selective mutagenesis position,
contact or hypermutation position within a complementarity
determining region (CDR) for mutation, thereby identifying a
selected contact or hypermutation position;
[0487] c) individually mutating said selected preferred selective
mutagenesis positions, contact or hypermutation position to at
least two other amino acid residues to thereby create a panel of
mutated antibodies, or antigen-binding portions thereof, and
expressing said panel in a non-phage display system;
[0488] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof thereby
identifying an activity enhancing amino acid residue;
[0489] e) evaluating the panel of mutated antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof for at least one other property
or characteristic, wherein the property or characteristic is one
that needs to be retained, until an antibody, or antigen-binding
portion thereof, with an improved activity and at least one
retained characteristic, relative to the parent antibody, or
antigen-binding portion thereof, is obtained.
[0490] f) optionally, repeating steps a) through e) for at least
one other preferred selective mutagenesis position, contact or
hypermutation position;
[0491] g) combining, in the parent antibody, or antigen-binding
portion thereof, at least two individual activity enhancing amino
acid residues shown to have improved activity and at least on
retained other characteristic, to form combination antibodies, or
antigen-binding portions thereof; and
[0492] h) evaluating the activity of the combination antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof;
until an antibody, or antigen-binding portion thereof, with an
improved activity and at least one retained property or
characteristic, relative to the parent antibody, or antigen-binding
portion thereof, is obtained.
[0493] In a preferred embodiment, the contact positions are
selected from the group consisting of H30, H31, H31B, H32, H33,
H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97, H98, H101,
L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93, L94 and L96
and the other characteristic is selected from 1) preservation of
non-crossreactivity with other proteins or human tissues, 2)
preservation of epitope recognition, i.e. recognizing p40 epitope
preferably in the context of the p70 p40/p35 heterodimer preventing
binding interference from free, soluble p40 and/or 3) to produce an
antibody with a close to germline immunoglobulin sequence.
[0494] In another preferred embodiment, the hypermutation positions
are selected from the group consisting of H30, H31, H31B, H32, H52,
H56, H58, L30, L31, L32, L53 and L93 and the other characteristic
is selected from 1) preservation of non-crossreactivity with other
proteins or human tissues, 2) preservation of epitope recognition,
i.e. recognizing p40 epitope preferably in the context of the p70
p40/p35 heterodimer preventing binding interference from free,
soluble p40 and/or 3) to produce an antibody with a close to
germline immunoglobulin sequence.
[0495] In a more preferred embodiment the residues for selective
mutagenesis are selected from the preferred selective mutagenesis
positions from the group consisting of H30, H31, H31B, H32, H33,
H52, H56, H58, L30, L31, L32, L50, L91, L92, L93, L94 and the other
characteristic is selected from 1) preservation of
non-crossreactivity with other proteins or human tissues, 2)
preservation of epitope recognition, i.e. recognizing p40 epitope
preferably in the context of the p70 p40/p35 heterodimer preventing
binding interference from free, soluble p40 and/or 3) to produce an
antibody with a close to germline immunoglobulin sequence.
[0496] In a more preferred embodiment, the contact positions are
selected from the group consisting of L50 and L94 and the other
characteristic is selected from 1) preservation of
non-crossreactivity with other proteins or human tissues, 2)
preservation of epitope recognition, i.e. recognizing p40 epitope
preferably in the context of the p70 p40/p35 heterodimer preventing
binding interference from free, soluble p40 and/or 3) to produce an
antibody with a close to germline immunoglobulin sequence.
IV. Modifications of Other CDR Residues
[0497] Ultimately, all CDR residues in a given antibody-antigen
pair identified by any means to be required as activity enhancing
amino acid residues and/or required directly or indirectly for
binding to the antigen and/or for retaining other desirable
properties or characteristics of the antibody. Such CDR residues
are referred to as "preferred selective mutagenesis positions". It
should be noted that in specific circumstances that preferred
selective mutagenesis residues can be identified also by other
means including co-crystallization of antibody and antigen and
molecular modeling.
[0498] If the preferred attempts to identify activity enhancing
amino acids focussing on the preferred selective mutagenesis
positions, contact or hypermutation positions described above are
exhausted, or if additional improvements are required, the
remaining CDR residues may be modified as described below. It
should be understood that the antibody could already be modified in
any one or more contact or hypermutation positions according to the
embodiments discussed above but may require further improvements.
Therefore, in another embodiment, the invention provides a method
for improving the activity of an antibody, or antigen-binding
portion thereof, comprising:
[0499] a) providing a parent antibody or antigen-binding portion
thereof;
[0500] b) selecting an amino acid residue within a complementarity
determining region (CDR) for mutation other than H30, H31, H31B,
H32, H33, H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97,
H98, H101, L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93,
L94 and L96;
[0501] c) individually mutating said selected position e.g., to at
least two other amino acid residues to thereby create a mutated
antibody or a panel of mutated antibodies, or antigen-binding
portions thereof;
[0502] d) evaluating the activity of the mutated antibody or the
panel of mutated antibodies, or antigen-binding portions thereof,
relative to the parent antibody or antigen-binding portion thereof
thereby identifying an activity enhancing amino acid residue;
[0503] e) evaluating the mutated antibody or the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof, for changes in
at least one other property or characteristic until an antibody, or
antigen-binding portion thereof, with an improved activity,
relative to the parent antibody, or antigen-binding portion
thereof, is obtained.
[0504] Preferably, the other characteristic or property is selected
from 1) preservation of non-crossreactivity with other proteins or
human tissues, 2) preservation of epitope recognition, i.e.
recognizing p40 epitope preferably in the context of the p70
p40/p35 heterodimer preventing binding interference from free,
soluble p40 and/or 3) to produce an antibody with a close to
germline immunoglobulin sequence
[0505] If mutagenesis of a single residue is not sufficient other
residues can be included; therefore, in another embodiment, the
invention provides a method for improving the activity of an
antibody, or antigen-binding portion thereof, comprising:
[0506] a) providing a parent antibody or antigen-binding portion
thereof;
[0507] b) selecting an amino acid residue within a complementarity
determining region (CDR) for mutation other than H30, H31, H31B,
H32, H33, H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97,
H98, H101, L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93,
L94 and L96;
[0508] c) individually mutating said selected position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof;
[0509] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof, thereby
identifying an activity enhancing amino acid residue;
[0510] e) repeating steps b) through d) for at least one other CDR
position which is neither the position selected under b) nor a
position at H30, H31, H31B, H32, H33, H35, H50, H52, H52A, H53,
H54, H56, H58, H95, H96, H97, H98, H101, L30, L31, L32, L34, L50,
L52, L53, L55, L91, L92, L93, L94 and L96;
[0511] f) combining, in the parent antibody, or antigen-binding
portion thereof, at least two individual activity enhancing amino
acid residues shown to have improved activity, to form combination
antibodies, or antigen-binding portions thereof; and
[0512] g) evaluating the activity of the combination antibodies, or
antigen-binding portions thereof with two activity enhancing amino
acid residues, relative to the parent antibody or antigen-binding
portion thereof until an antibody, or antigen-binding portion
thereof, with an improved activity, relative to the parent
antibody, or antigen-binding portion thereof, is obtained.
[0513] If the preferred attempts to identify activity enhancing
amino acids focussing on the contact or hypermutation positions
described above are exhausted, or if additional improvements are
required, and the antibody in question can not further be optimized
by mutagenesis and phage display (or related ribosome display)
methods the remaining CDR residues may be modified as described
below. It should be understood that the antibody could already be
modified in any one or more preferred selective mutagenesis
position, contact or hypermutation positions according to the
embodiments discussed above but may require further
improvements.
[0514] Therefore, in another embodiment, the invention provides a
method for improving the activity of an antibody, or
antigen-binding portion thereof, comprising:
[0515] a) providing a recombinant parent antibody or
antigen-binding portion thereof; that was obtained by selection in
a phage-display system but whose activity cannot be further
improved by mutagenesis in said phage-display system;
[0516] b) selecting a selecting an amino acid residue within a
complementarity determining region (CDR) for mutation other than
H30, H31, H31B, H32, H33, H35, H50, H52, H52A, H53, H54, H56, H58,
H95, H96, H97, H98, H101, L30, L31, L32, L34, L50, L52, L53, L55,
L91, L92, L93, L94 and;
[0517] c) individually mutating said selected contact or
hypermutation position to at least two other amino acid residues to
thereby create a panel of mutated antibodies, or antigen-binding
portions thereof, and expressing said panel in a non-phage display
system;
[0518] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof thereby
identifying an activity enhancing amino acid residue;
[0519] e) evaluating the panel of mutated antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof, for changes in at least one
other property or characteristic, until an antibody, or
antigen-binding portion thereof, with an improved activity,
relative to the parent antibody, or antigen-binding portion
thereof, is obtained.
[0520] Preferably, the other characteristic or property is selected
from 1) preservation of non-crossreactivity with other proteins or
human tissues, 2) preservation of epitope recognition, i.e.
recognizing p40 epitope preferably in the context of the p70
p40/p35 heterodimer preventing binding interference from free,
soluble p40 and/or 3) to produce an antibody with a close to
germline immunoglobulin sequence.
[0521] If a single mutagenesis is not sufficient to increase the
affinity of the antibody other residues may be included in the
mutagenesis. Therefore, in another embodiment, the invention
provides a method for improving the activity of an antibody, or
antigen-binding portion thereof, comprising:
[0522] a) providing a parent antibody or antigen-binding portion
thereof that was obtained by selection in a phage-display system
but whose activity cannot be further improved by mutagenesis in
said phage-display system;
[0523] b) selecting an amino acid residue within a complementarity
determining region (CDR) for mutation other than H30, H31, H31B,
H32, H33, H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97,
H98, H101, L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93,
L94 and L96;
[0524] c) individually mutating said selected position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof and expression in a
non-phage display system;
[0525] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof thereby
identifying an activity enhancing amino acid residue;
[0526] e) repeating steps b) through d) for at least one other
position which is neither the position selected under b) nor a
position at H30, H31, H31B, H32, H33, H35, H50, H52, H52A, H53,
H54, H56, H58, H95, H96, H97, H98, H101, L30, L31, L32, L34, L50,
L52, L53, L55, L91, L92, L93, L94;
[0527] g) combining, in the parent antibody, or antigen-binding
portion thereof, at least two individual activity enhancing amino
acid residues shown to have improved activity, to form combination
antibodies, or antigen-binding portions thereof; and
[0528] h) evaluating the activity and other property or
characteristic of the combination antibodies, or antigen-binding
portions thereof with two activity enhancing amino acid residues,
relative to the parent antibody or antigen-binding portion
thereof;
until an antibody, or antigen-binding portion thereof, with an
improved activity, relative to the parent antibody, or
antigen-binding portion thereof, is obtained.
[0529] Preferably, the other characteristic or property is selected
from 1) preservation of non-crossreactivity with other proteins or
human tissues, 2) preservation of epitope recognition, i.e.
recognizing p40 epitope preferably in the context of the p70
p40/p35 heterodimer preventing binding interference from free,
soluble p40 and/or 3) to produce an antibody with a close to
germline immunoglobulin sequence
[0530] The preferred attempts to identify activity enhancing amino
acids focussing on the preferred selective mutagenesis positions,
contact or hypermutation positions described may be exhausted, or
additional improvements may be required, and it is important to
retain other properties or characteristics of the antibody.
[0531] Therefore, in another embodiment, the invention provides a
method for improving the activity of an antibody, or
antigen-binding portion thereof, without affecting other
characteristics, comprising:
[0532] a) providing a parent antibody or antigen-binding portion
thereof;
[0533] b) selecting an amino acid residue within a complementarity
determining region (CDR) for mutation other than H30, H31, H31B,
H32, H33, H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97,
H98, H101, L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93,
L94 and L96;
[0534] c) individually mutating said selected position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof;
[0535] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof thereby
identifying an activity enhancing amino acid residue;
[0536] e) evaluating the panel of mutated antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof, for changes in at least one
other property or characteristic until an antibody, or
antigen-binding portion thereof, with an improved activity and
retained other property or characteristic, relative to the parent
antibody, or antigen-binding portion thereof, is obtained.
[0537] Preferably, the other characteristic or property is selected
from 1) preservation of non-crossreactivity with other proteins or
human tissues, 2) preservation of epitope recognition, i.e.
recognizing p40 epitope preferably in the context of the p70
p40/p35 heterodimer preventing binding interference from free,
soluble p40 and/or 3) to produce an antibody with a close to
germline immunoglobulin sequence
[0538] If mutagenesis of a single residue is not sufficient other
residues can be included; therefore, in another embodiment, the
invention provides a method for improving the activity of an
antibody, or antigen-binding portion thereof, comprising:
[0539] a) providing a parent antibody or antigen-binding portion
thereof;
[0540] b) selecting an amino acid residue within a complementarity
determining region (CDR) for mutation other than H30, H31, H31B,
H32, H33, H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97,
H98, H101, L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93,
L94 and L96;
[0541] c) individually mutating said selected position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof;
[0542] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof, thereby
identifying an activity enhancing amino acid residue;
[0543] e.) evaluating the panel of mutated antibodies or
antigen-binding portions thereof, relative to the parent antibody
or antigen-portion thereof, for changes in at least one other
characteristic or property;
[0544] e) repeating steps b) through e) for at least one other CDR
position which is neither the position selected under b) nor a
position at H30, H31, H31B, H32, H33, H35, H50, H52, H52A, H53,
H54, H56, H58, H95, H96, H97, H98, H101, L30, L31, L32, L34, L50,
L52, L53, L55, L91, L92, L93, L94 and L96;
[0545] f) combining, in the parent antibody, or antigen-binding
portion thereof, at least two individual activity enhancing amino
acid residues shown to have improved activity and not affecting at
least one other property or characteristic, to form combination
antibodies, or antigen-binding portions thereof; and
[0546] g) evaluating the activity and the retention of at least one
other property or characteristic of the combination antibodies, or
antigen-binding portions thereof with two activity enhancing amino
acid residues, relative to the parent antibody or antigen-binding
portion thereof until an antibody, or antigen-binding portion
thereof, with an improved activity and at least one retained other
property or characteristic, relative to the parent antibody, or
antigen-binding portion thereof, is obtained.
[0547] Mutagenesis of the preferred selective mutagenesis position,
contact and hypermutation residues may not have increased the
affinity of the antibody sufficiently, and mutagenesis and the
phage display method (or related ribosome display method) may no
longer be useful and at least one other characteristic or property
of the antibody should be retained.
[0548] Therefore, in another embodiment the invention provides a
method to improve the affinity of an antibody or antigen-binding
portion thereof, comprising:
[0549] a) providing a parent antibody or antigen-binding portion
thereof that was obtained by selection in a phage-display system
but whose activity cannot be further improved by mutagenesis in
said phage-display system;
[0550] b) selecting an amino acid residue within a complementarity
determining region (CDR) for mutation other than H30, H31, H31B,
H32, H33, H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97,
H98, H101, L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93,
L94 and L96;
[0551] c) individually mutating said selected position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof and expression in a
non-phage display system;
[0552] d) evaluating the activity of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof thereby
identifying an activity enhancing amino acid residue;
[0553] e) evaluating the panel of mutated antibodies, or
antigen-binding portions thereof, relative to the parent antibody
or antigen-binding portion thereof, for changes in at least one
other property or characteristic until an antibody, or
antigen-binding portion thereof, with an improved activity,
relative to the parent antibody, or antigen-binding portion
thereof, is obtained.
[0554] Preferably, the other characteristic or property is selected
from 1) preservation of non-crossreactivity with other proteins or
human tissues, 2) preservation of epitope recognition, i.e.
recognizing p40 epitope preferably in the context of the p70
p40/p35 heterodimer preventing binding interference from free,
soluble p40 and/or 3) to produce an antibody with a close to
germline immunoglobulin sequence
[0555] If mutagenesis of a single residue is not sufficient other
residues can be included; therefore, in another embodiment, the
invention provides a method for improving the activity of an
antibody, or antigen-binding portion thereof, comprising:
[0556] a) providing a parent antibody or antigen-binding portion
thereof that was obtained by selection in a phage-display system
but whose activity cannot be further improved by mutagenesis in
said phage-display system;
[0557] b) selecting an amino acid residue within a complementarity
determining region (CDR) for mutation other than H30, H31, H31B,
H32, H33, H35, H50, H52, H52A, H53, H54, H56, H58, H95, H96, H97,
H98, H101, L30, L31, L32, L34, L50, L52, L53, L55, L91, L92, L93,
L94 and L96;
[0558] c) individually mutating said selected position to at least
two other amino acid residues to thereby create a panel of mutated
antibodies, or antigen-binding portions thereof and expression in a
non-phage display system;
[0559] d) evaluating the activity and retention of at least one
other property or characteristic of the panel of mutated
antibodies, or antigen-binding portions thereof, relative to the
parent antibody or antigen-binding portion thereof, thereby
identifying an activity enhancing amino acid residue;
[0560] e) repeating steps b) through d) for at least one other CDR
position which is neither the position selected under b) nor a
position at H30, H31, H31B, H32, H33, H35, H50, H52, H52A, H53,
H54, H56, H58, H95, H96, H97, H98, H101, L30, L31, L32, L34, L50,
L52, L53, L55, L91, L92, L93, L94 and L96;
[0561] f) combining, in the parent antibody, or antigen-binding
portion thereof, at least two individual activity enhancing amino
acid residues shown to have improved activity and not to affect at
least one other property or characteristic, to form combination
antibodies, or antigen-binding portions thereof; and
[0562] g) evaluating the activity and retention of at least one
property or characteristic of the combination antibodies, or
antigen-binding portions thereof with two activity enhancing amino
acid residues, relative to the parent antibody or antigen-binding
portion thereof until an antibody, or antigen-binding portion
thereof, with an improved activity and at least one other retained
characteristic or property, relative to the parent antibody, or
antigen-binding portion thereof, is obtained.
V. Expression of Antibodies
[0563] An antibody, or antibody portion, of the invention can be
prepared by recombinant expression of immunoglobulin light and
heavy chain genes in a host cell. To express an antibody
recombinantly, a host cell is transfected with one or more
recombinant expression vectors carrying DNA fragments encoding the
immunoglobulin light and heavy chains of the antibody such that the
light and heavy chains are expressed in the host cell and,
preferably, secreted into the medium in which the host cells are
cultured, from which medium the antibodies can be recovered.
Standard recombinant DNA methodologies are used to obtain antibody
heavy and light chain genes, incorporate these genes into
recombinant expression vectors and introduce the vectors into host
cells, such as those described in Sambrook, Fritsch and Maniatis
(eds), Molecular Cloning; A Laboratory Manual, Second Edition, Cold
Spring Harbor, N.Y., (1989), Ausubel, F. M. et al. (eds.) Current
Protocols in Molecular Biology, Greene Publishing Associates,
(1989) and in U.S. Pat. No. 4,816,397 by Boss et al.
[0564] To obtain a DNA fragment encoding the heavy chain variable
region of Joe 9 wt or a Joe 9 wt-related antibody, antibodies
specific for human IL-12 were screened from human libraries and
mutated, as described in section II. Once DNA fragments encoding
Joe 9 wt or Joe 9 wt-related VH and VL segments are obtained,
mutagenesis of these sequences is carried out by standard methods,
such as PCR site directed mutagenesis (PCR-mediated mutagenesis in
which the mutated nucleotides are incorporated into the PCR primers
such that the PCR product contains the mutations) or other
site-directed mutagenesis methods. Human IL-12 antibodies that
displayed a level of activity and binding specificity/affinity that
was desirable, for example J695, were further manipulated by
standard recombinant DNA techniques, for example to convert the
variable region genes to full-length antibody chain genes, to Fab
fragment genes or to a scFv gene. In these manipulations, a VL- or
VH-encoding DNA fragment is operatively linked to another DNA
fragment encoding another protein, such as an antibody constant
region or a flexible linker. The term "operatively linked", as used
in this context, is intended to mean that the two DNA fragments are
joined such that the amino acid sequences encoded by the two DNA
fragments remain in-frame.
[0565] The isolated DNA encoding the VH region can be converted to
a full-length heavy chain gene by operatively linking the
VH-encoding DNA to another DNA molecule encoding heavy chain
constant regions (CH1, CH2 and CH3). The sequences of human heavy
chain constant region genes are known in the art (see e.g., Kabat,
E. A., et al. (1991) Sequences of Proteins of Immunological
Interest, Fifth Edition, U.S. Department of Health and Human
Services, NIH Publication No. 91-3242) and DNA fragments
encompassing these regions can be obtained by standard PCR
amplification. The heavy chain constant region can be an IgG1,
IgG2, IgG3, IgG4, IgA, IgE, IgM or IgD constant region and any
allotypic variant therein as described in Kabat (, Kabat, E. A., et
al. (1991) Sequences of Proteins of Immunological Interest, Fifth
Edition, U.S. Department of Health and Human Services, NIH
Publication No. 91-3242), but most preferably is an IgG1 or IgG4
constant region. For a Fab fragment heavy chain gene, the
VH-encoding DNA can be operatively linked to another DNA molecule
encoding only the heavy chain CH1 constant region.
[0566] The isolated DNA encoding the VL region can be converted to
a full-length light chain gene (as well as a Fab light chain gene)
by operatively linking the VL-encoding DNA to another DNA molecule
encoding the light chain constant region, CL. The sequences of
human light chain constant region genes are known in the art (see
e.g., Kabat, E. A., et al. (1991) Sequences of Proteins of
Immunological Interest, Fifth Edition, U.S. Department of Health
and Human Services, NIH Publication No. 91-3242) and DNA fragments
encompassing these regions can be obtained by standard PCR
amplification. The light chain constant region can be a kappa or
lambda constant region, but most preferably is a lambda constant
region.
[0567] To create a scFv gene, the VH- and VL-encoding DNA fragments
are operatively linked to another fragment encoding a flexible
linker, e.g., encoding the amino acid sequence
(Gly.sub.4-Ser).sub.3, such that the VH and VL sequences can be
expressed as a contiguous single-chain protein, with the VL and VH
regions joined by the flexible linker (see e.g., Bird et al. (1988)
Science 242:423-426; Huston et al. (1988) Proc. Natl. Acad. Sci.
USA 85:5879-5883; McCafferty et al., Nature (1990)
348:552-554).
[0568] To express the antibodies, or antibody portions of the
invention, DNAs encoding partial or full-length light and heavy
chains, obtained as described above, are inserted into expression
vectors such that the genes are operatively linked to
transcriptional and translational control sequences. In this
context, the term "operatively linked" is intended to mean that an
antibody gene is ligated into a vector such that transcriptional
and translational control sequences within the vector serve their
intended function of regulating the transcription and translation
of the antibody gene. The expression vector and expression control
sequences are chosen to be compatible with the expression host cell
used. The antibody light chain gene and the antibody heavy chain
gene can be inserted into separate vector or, more typically, both
genes are inserted into the same expression vector. The antibody
genes are inserted into the expression vector by standard methods
(e.g., ligation of complementary restriction sites on the antibody
gene fragment and vector, or blunt end ligation if no restriction
sites are present). Prior to insertion of the J695 or J695-related
light or heavy chain sequences, the expression vector may already
carry antibody constant region sequences. For example, one approach
to converting the J695 or J695-related VH and VL sequences to
full-length antibody genes is to insert them into expression
vectors already encoding heavy chain constant and light chain
constant regions, respectively, such that the VH segment is
operatively linked to the CH segment(s) within the vector and the
VL segment is operatively linked to the CL segment within the
vector. Additionally or alternatively, the recombinant expression
vector can encode a signal peptide that facilitates secretion of
the antibody chain from a host cell. The antibody chain gene can be
cloned into the vector such that the signal peptide is linked
in-frame to the amino terminus of the antibody chain gene. The
signal peptide can be an immunoglobulin signal peptide or a
heterologous signal peptide (i.e., a signal peptide from a
non-immunoglobulin protein).
[0569] In addition to the antibody chain genes, the recombinant
expression vectors of the invention carry regulatory sequences that
control the expression of the antibody chain genes in a host cell.
The term "regulatory sequence" is intended to include promoters,
enhancers and other expression control elements (e.g.,
polyadenylation signals) that control the transcription or
translation of the antibody chain genes. Such regulatory sequences
are described, for example, in Goeddel; Gene Expression Technology:
Methods in Enzymology 185, Academic Press, San Diego, Calif.
(1990). It will be appreciated by those skilled in the art that the
design of the expression vector, including the selection of
regulatory sequences may depend on such factors as the choice of
the host cell to be transformed, the level of expression of protein
desired, etc. Preferred regulatory sequences for mammalian host
cell expression include viral elements that direct high levels of
protein expression in mammalian cells, such as promoters and/or
enhancers derived from cytomegalovirus (CMV) (such as the CMV
promoter/enhancer), Simian Virus 40 (SV40) (such as the SV40
promoter/enhancer), adenovirus, (e.g., the adenovirus major late
promoter (AdMLP)) and polyoma. For further description of viral
regulatory elements, and sequences thereof, see e.g., U.S. Pat. No.
5,168,062 by Stinski, U.S. Pat. No. 4,510,245 by Bell et al. and
U.S. Pat. No. 4,968,615 by Schaffner et al., U.S. Pat. No.
5,464,758 by Bujard et al. and U.S. Pat. No. 5,654,168 by Bujard et
al.
[0570] In addition to the antibody chain genes and regulatory
sequences, the recombinant expression vectors of the invention may
carry additional sequences, such as sequences that regulate
replication of the vector in host cells (e.g., origins of
replication) and selectable marker genes. The selectable marker
gene facilitates selection of host cells into which the vector has
been introduced (see e.g., U.S. Pat. Nos. 4,399,216, 4,634,665 and
5,179,017, all by Axel et al.). For example, typically the
selectable marker gene confers resistance to drugs, such as G418,
hygromycin or methotrexate, on a host cell into which the vector
has been introduced. Preferred selectable marker genes include the
dihydrofolate reductase (DHFR) gene (for use in dhfr.sup.- host
cells with methotrexate selection/amplification) and the neo gene
(for G418 selection).
[0571] For expression of the light and heavy chains, the expression
vector(s) encoding the heavy and light chains is transfected into a
host cell by standard techniques. The various forms of the term
"transfection" are intended to encompass a wide variety of
techniques commonly used for the introduction of exogenous DNA into
a prokaryotic or eukaryotic host cell, e.g., electroporation,
calcium-phosphate precipitation, DEAE-dextran transfection and the
like. Although it is theoretically possible to express the
antibodies of the invention in either prokaryotic or eukaryotic
host cells, expression of antibodies in eukaryotic cells, and most
preferably mammalian host cells, is the most preferred because such
eukaryotic cells, and in particular mammalian cells, are more
likely than prokaryotic cells to assemble and secrete a properly
folded and immunologically active antibody. Preferred mammalian
host cells for expressing the recombinant antibodies of the
invention include Chinese Hamster Ovary (CHO cells) (including
dhfr- CHO cells, described in Urlaub and Chasin, (1980) Proc. Natl.
Acad. Sci. USA 77:4216-4220, used with a DHFR selectable marker,
e.g., as described in R. J. Kaufman and P. A. Sharp (1982) Mol.
Biol. 159:601-621), NS0 myeloma cells, COS cells and SP2 cells.
When recombinant expression vectors encoding antibody genes are
introduced into mammalian host cells, the antibodies are produced
by culturing the host cells for a period of time sufficient to
allow for expression of the antibody in the host cells or, more
preferably, secretion of the antibody into the culture medium in
which the host cells are grown. Antibodies can be recovered from
the culture medium using standard protein purification methods.
[0572] Host cells can also be used to produce portions of intact
antibodies, such as Fab fragments or scFv molecules. It will be
understood that variations on the above procedure are within the
scope of the present invention. For example, it may be desirable to
transfect a host cell with DNA encoding either the light chain or
the heavy chain (but not both) of an antibody of this invention.
Recombinant DNA technology may also be used to remove some or all
of the DNA encoding either or both of the light and heavy chains
that is not necessary for binding to hIL-12 The molecules expressed
from such truncated DNA molecules are also encompassed by the
antibodies of the invention. In addition, bifunctional antibodies
may be produced in which one heavy and one light chain are an
antibody of the invention and the other heavy and light chain are
specific for an antigen other than hIL-12 by crosslinking an
antibody of the invention to a second antibody by standard chemical
crosslinking methods.
[0573] In a preferred system for recombinant expression of an
antibody, or antigen-binding portion thereof, of the invention, a
recombinant expression vector encoding both the antibody heavy
chain and the antibody light chain is introduced into dhfr.sup.-
CHO cells by calcium phosphate-mediated transfection. Within the
recombinant expression vector, the antibody heavy and light chain
genes are each operatively linked to enhancer/promoter regulatory
elements (e.g., derived from SV40, CMV, adenovirus and the like,
such as a CMV enhancer/AdMLP promoter regulatory element or an SV40
enhancer/AdMLP promoter regulatory element) to drive high levels of
transcription of the genes. The recombinant expression vector also
carries a DHFR gene, which allows for selection of CHO cells that
have been transfected with the vector using methotrexate
selection/amplification. The selected transformant host cells are
culture to allow for expression of the antibody heavy and light
chains and intact antibody is recovered from the culture medium.
Standard molecular biology techniques are used to prepare the
recombinant expression vector, transfect the host cells, select for
transformants, culture the host cells and recover the antibody from
the culture medium. Antibodies or antigen-binding portions thereof
of the invention can be expressed in an animal (e.g., a mouse) that
is transgenic for human immunoglobulin genes (see e.g., Taylor, L.
D. et al. (1992) Nucl. Acids Res. 20: 6287-6295). Plant cells can
also be modified to create transgenic plants that express the
antibody or antigen binding portion thereof, of the invention.
[0574] In view of the foregoing, another aspect of the invention
pertains to nucleic acid, vector and host cell compositions that
can be used for recombinant expression of the antibodies and
antibody portions of the invention. Preferably, the invention
features isolated nucleic acids that encode CDRs of J695, or the
full heavy and/or light chain variable region of J695. Accordingly,
in one embodiment, the invention features an isolated nucleic acid
encoding an antibody heavy chain variable region that encodes the
J695 heavy chain CDR3 comprising the amino acid sequence of SEQ ID
NO: 25. Preferably, the nucleic acid encoding the antibody heavy
chain variable region further encodes a J695 heavy chain CDR2 which
comprises the amino acid sequence of SEQ ID NO: 27. More
preferably, the nucleic acid encoding the antibody heavy chain
variable region further encodes a J695 heavy chain CDR1 which
comprises the amino acid sequence of SEQ ID NO: 29. Even more
preferably, the isolated nucleic acid encodes an antibody heavy
chain variable region comprising the amino acid sequence of SEQ ID
NO: 31 (the full VH region of J695).
[0575] In other embodiments, the invention features an isolated
nucleic acid encoding an antibody light chain variable region that
encodes the J695 light chain CDR3 comprising the amino acid
sequence of SEQ ID NO: 26. Preferably, the nucleic acid encoding
the antibody light chain variable region further encodes a J695
light chain CDR2 which comprises the amino acid sequence of SEQ ID
NO: 28. More preferably, the nucleic acid encoding the antibody
light chain variable region further encodes a J695 light chain CDR1
which comprises the amino acid sequence of SEQ ID NO: 30. Even more
preferably, the isolated nucleic acid encodes an antibody light
chain variable region comprising the amino acid sequence of SEQ ID
NO: 32 (the full VL region of J695).
[0576] The invention also provides recombinant expression vectors
encoding both an antibody heavy chain and an antibody light chain.
For example, in one embodiment, the invention provides a
recombinant expression vector encoding: [0577] a) an antibody heavy
chain having a variable region comprising the amino acid sequence
of SEQ ID NO: 31; and [0578] b) an antibody light chain having a
variable region comprising the amino acid sequence of SEQ ID NO:
32.
[0579] The invention also provides host cells into which one or
more of the recombinant expression vectors of the invention have
been introduced. Preferably, the host cell is a mammalian host
cell, more preferably the host cell is a CHO cell, an NS0 cell or a
COS cell. Still further the invention provides a method of
synthesizing a recombinant human antibody of the invention by
culturing a host cell of the invention in a suitable culture medium
until a recombinant human antibody of the invention is synthesized.
The method can further comprise isolating the recombinant human
antibody from the culture medium.
VI. Pharmaceutical Compositions and Pharmaceutical
Administration
[0580] The antibodies and antibody-portions of the invention can be
incorporated into pharmaceutical compositions suitable for
administration to a subject. Typically, the pharmaceutical
composition comprises an antibody or antibody portion of the
invention and a pharmaceutically acceptable carrier. As used
herein, "pharmaceutically acceptable carrier" includes any and all
solvents, dispersion media, coatings, antibacterial and antifungal
agents, isotonic and absorption delaying agents, and the like that
are physiologically compatible. Examples of pharmaceutically
acceptable carriers include one or more of water, saline, phosphate
buffered saline, dextrose, glycerol, ethanol and the like, as well
as combinations thereof. In many cases, it will be preferable to
include isotonic agents, for example, sugars, polyalcohols such as
mannitol, sorbitol, or sodium chloride in the composition.
Pharmaceutically acceptable carriers may further comprise minor
amounts of auxiliary substances such as wetting or emulsifying
agents, preservatives or buffers, which enhance the shelf life or
effectiveness of the antibody or antibody portion.
[0581] The antibodies and antibody-portions of the invention can be
incorporated into a pharmaceutical composition suitable for
parenteral administration. Preferably, the antibody or
antibody-portions will be prepared as an injectable solution
containing 0.1-250 mg/ml antibody. The injectable solution can be
composed of either a liquid or lyophilized dosage form in a flint
or amber vial, ampule or pre-filled syringe. The buffer can be
L-histidine (1-50 mM), optimally 5-10 mM, at pH 5.0 to 7.0
(optimally pH 6.0). Other suitable buffers include but are not
limited to, sodium succinate, sodium citrate, sodium phosphate or
potassium phosphate. Sodium chloride can be used to modify the
toxicity of the solution at a concentration of 0-300 mM (optimally
150 mM for a liquid dosage form). Cryoprotectants can be included
for a lyophilized dosage form, principally 0-10% sucrose (optimally
0.5-1.0%). Other suitable cryoprotectants include trehalose and
lactose. Bulking agents can be included for a lyophilized dosage
form, principally 1-10% mannitol (optimally 2-4%). Stabilizers can
be used in both liquid and lyophilized dosage forms, principally
1-50 mM L-Methionine (optimally 5-10 mM). Other suitable bulking
agents include glycine, arginine, can be included as 0-0.05%
polysorbate-80 (optimally 0.005-0.01%). Additional surfactants
include but are not limited to polysorbate 20 and BRIJ
surfactants.
[0582] In a preferred embodiment, the pharmaceutical composition
includes the antibody at a dosage of about 0.01 mg/kg-10 mg/kg.
More preferred dosages of the antibody include 1 mg/kg administered
every other week, or 0.3 mg/kg administered weekly.
[0583] The compositions of this invention may be in a variety of
forms. These include, for example, liquid, semi-solid and solid
dosage forms, such as liquid solutions (e.g., injectable and
infusible solutions), dispersions or suspensions, tablets, pills,
powders, liposomes and suppositories. The preferred form depends on
the intended mode of administration and therapeutic application.
Typical preferred compositions are in the form of injectable or
infusible solutions, such as compositions similar to those used for
passive immunization of humans with other antibodies. The preferred
mode of administration is parenteral (e.g., intravenous,
subcutaneous, intraperitoneal, intramuscular). In a preferred
embodiment, the antibody is administered by intravenous infusion or
injection. In another preferred embodiment, the antibody is
administered by intramuscular or subcutaneous injection.
[0584] Therapeutic compositions typically must be sterile and
stable under the conditions of manufacture and storage. The
composition can be formulated as a solution, microemulsion,
dispersion, liposome, or other ordered structure suitable to high
drug concentration. Sterile injectable solutions can be prepared by
incorporating the active compound (i.e., antibody or antibody
portion) in the required amount in an appropriate solvent with one
or a combination of ingredients enumerated above, as required,
followed by filtered sterilization. Generally, dispersions are
prepared by incorporating the active compound into a sterile
vehicle that contains a basic dispersion medium and the required
other ingredients from those enumerated above. In the case of
sterile, lyophilized powders for the preparation of sterile
injectable solutions, the preferred methods of preparation are
vacuum drying and spray-drying that yields a powder of the active
ingredient plus any additional desired ingredient from a previously
sterile-filtered solution thereof. The proper fluidity of a
solution can be maintained, for example, by the use of a coating
such as lecithin, by the maintenance of the required particle size
in the case of dispersion and by the use of surfactants. Prolonged
absorption of injectable compositions can be brought about by
including in the composition an agent that delays absorption, for
example, monostearate salts and gelatin.
[0585] The antibodies and antibody-portions of the present
invention can be administered by a variety of methods known in the
art, although for many therapeutic applications, the preferred
route/mode of administration is subcutaneous injection, intravenous
injection or infusion. As will be appreciated by the skilled
artisan, the route and/or mode of administration will vary
depending upon the desired results. In certain embodiments, the
active compound may be prepared with a carrier that will protect
the compound against rapid release, such as a controlled release
formulation, including implants, transdermal patches, and
microencapsulated delivery systems. Biodegradable, biocompatible
polymers can be used, such as ethylene vinyl acetate,
polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and
polylactic acid. Many methods for the preparation of such
formulations are patented or generally known to those skilled in
the art. See, e.g., Sustained and Controlled Release Drug Delivery
Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York,
1978.
[0586] In certain embodiments, an antibody or antibody portion of
the invention may be orally administered, for example, with an
inert diluent or an assimilable edible carrier. The compound (and
other ingredients, if desired) may also be enclosed in a hard or
soft shell gelatin capsule, compressed into tablets, or
incorporated directly into the subject's diet. For oral therapeutic
administration, the compounds may be incorporated with excipients
and used in the form of ingestible tablets, buccal tablets,
troches, capsules, elixirs, suspensions, syrups, wafers, and the
like. To administer a compound of the invention by other than
parenteral administration, it may be necessary to coat the compound
with, or co-administer the compound with, a material to prevent its
inactivation.
[0587] Supplementary active compounds can also be incorporated into
the compositions. In certain embodiments, an antibody or antibody
portion of the invention is coformulated with and/or coadministered
with one or more additional therapeutic agents that are useful for
treating disorders in which IL-12 activity is detrimental. For
example, an anti-hIL-12 antibody or antibody portion of the
invention may be coformulated and/or coadministered with one or
more additional antibodies that bind other targets (e.g.,
antibodies that bind other cytokines or that bind cell surface
molecules). Furthermore, one or more antibodies of the invention
may be used in combination with two or more of the foregoing
therapeutic agents. Such combination therapies may advantageously
utilize lower dosages of the administered therapeutic agents, thus
avoiding possible toxicities or complications associated with the
various monotherapies. It will be appreciated by the skilled
practitioner that when the antibodies of the invention are used as
part of a combination therapy, a lower dosage of antibody may be
desirable than when the antibody alone is administered to a subject
(e.g., a synergistic therapeutic effect may be achieved through the
use of combination therapy which, in turn, permits use of a lower
dose of the antibody to achieve the desired therapeutic
effect).
[0588] Interleukin 12 plays a critical role in the pathology
associated with a variety of diseases involving immune and
inflammatory elements. These diseases include, but are not limited
to, rheumatoid arthritis, osteoarthritis, juvenile chronic
arthritis, Lyme arthritis, psoriatic arthritis, reactive arthritis,
spondyloarthropathy, systemic lupus erythematosus, Crohn's disease,
ulcerative colitis, inflammatory bowel disease, insulin dependent
diabetes mellitus, thyroiditis, asthma, allergic diseases,
psoriasis, dermatitis scleroderma, atopic dermatitis, graft versus
host disease, organ transplant rejection, acute or chronic immune
disease associated with organ transplantation, sarcoidosis,
atherosclerosis, disseminated intravascular coagulation, Kawasaki's
disease, Grave's disease, nephrotic syndrome, chronic fatigue
syndrome, Wegener's granulomatosis, Henoch-Schoenlein purpurea,
microscopic vasculitis of the kidneys, chronic active hepatitis,
uveitis, septic shock, toxic shock syndrome, sepsis syndrome,
cachexia, infectious diseases, parasitic diseases, acquired
immunodeficiency syndrome, acute transverse myelitis, Huntington's
chorea, Parkinson's disease, Alzheimer's disease, stroke, primary
biliary cirrhosis, hemolytic anemia, malignancies, heart failure,
myocardial infarction, Addison's disease, sporadic, polyglandular
deficiency type I and polyglandular deficiency type II, Schmidt's
syndrome, adult (acute) respiratory distress syndrome, alopecia,
alopecia greata, seronegative arthopathy, arthropathy, Reiter's
disease, psoriatic arthropathy, ulcerative colitic arthropathy,
enteropathic synovitis, chlamydia, yersinia and salmonella
associated arthropathy, spondyloarthopathy, atheromatous
disease/arteriosclerosis, atopic allergy, autoimmune bullous
disease, pemphigus vulgaris, pemphigus foliaceus, pemphigoid,
linear IgA disease, autoimmune haemolytic anaemia, Coombs positive
haemolytic anaemia, acquired pernicious anaemia, juvenile
pernicious anaemia, myalgic encephalitis/Royal Free Disease,
chronic mucocutaneous candidiasis, giant cell arteritis, primary
sclerosing hepatitis, cryptogenic autoimmune hepatitis, Acquired
Immunodeficiency Disease Syndrome, Acquired Immunodeficiency
Related Diseases, Hepatitis C, common varied immunodeficiency
(common variable hypogammaglobulinaemia), dilated cardiomyopathy,
female infertility, ovarian failure, premature ovarian failure,
fibrotic lung disease, cryptogenic fibrosing alveolitis,
post-inflammatory interstitial lung disease, interstitial
pneumonitis, connective tissue disease associated interstitial lung
disease, mixed connective tissue disease associated lung disease,
systemic sclerosis associated interstitial lung disease, rheumatoid
arthritis associated interstitial lung disease, systemic lupus
erythematosus associated lung disease, dermatomyositis/polymyositis
associated lung disease, Sjogren's disease associated lung disease,
ankylosing spondylitis associated lung disease, vasculitic diffuse
lung disease, haemosiderosis associated lung disease, drug-induced
interstitial lung disease, radiation fibrosis, bronchiolitis
obliterans, chronic eosinophilic pneumonia, lymphocytic
infiltrative lung disease, postinfectious interstitial lung
disease, gouty arthritis, autoimmune hepatitis, type-1 autoimmune
hepatitis (classical autoimmune or lupoid hepatitis), type-2
autoimmune hepatitis (anti-LKM antibody hepatitis), autoimmune
mediated hypoglycemia, type B insulin resistance with acanthosis
nigricans, hypoparathyroidism, acute immune disease associated with
organ transplantation, chronic immune disease associated with organ
transplantation, osteoarthrosis, primary sclerosing cholangitis,
idiopathic leucopenia, autoimmune neutropenia, renal disease NOS,
glomerulonephritides, microscopic vasulitis of the kidneys, lyme
disease, discoid lupus erythematosus, male infertility idiopathic
or NOS, sperm autoimmunity, multiple sclerosis (all subtypes),
insulin-dependent diabetes mellitus, sympathetic ophthalmia,
pulmonary hypertension secondary to connective tissue disease,
Goodpasture's syndrome, pulmonary manifestation of polyarteritis
nodosa, acute rheumatic fever, rheumatoid spondylitis, Still's
disease, systemic sclerosis, Takayasu's disease/arteritis,
autoimmune thrombocytopenia, idiopathic thrombocytopenia,
autoimmune thyroid disease, hyperthyroidism, goitrous autoimmune
hypothyroidism (Hashimoto's disease), atrophic autoimmune
hypothyroidism, primary myxoedema, phacogenic uveitis, primary
vasculitis and vitiligo. The human antibodies, and antibody
portions of the invention can be used to treat autoimmune diseases,
in particular those associated with inflammation, including,
rheumatoid spondylitis, allergy, autoimmune diabetes, autoimmune
uveitis.
[0589] Preferably, the antibodies of the invention or
antigen-binding portions thereof, are used to treat rheumatoid
arthritis, Crohn's disease, multiple sclerosis, insulin dependent
diabetes mellitus and psoriasis, as described in more detail in
section VII.
[0590] A human antibody, or antibody portion, of the invention also
can be administered with one or more additional therapeutic agents
useful in the treatment of autoimmune and inflammatory
diseases.
[0591] Antibodies of the invention, or antigen binding portions
thereof can be used alone or in combination to treat such diseases.
It should be understood that the antibodies of the invention or
antigen binding portion thereof can be used alone or in combination
with an additional agent, e.g., a therapeutic agent, said
additional agent being selected by the skilled artisan for its
intended purpose. For example, the additional agent can be a
therapeutic agent art-recognized as being useful to treat the
disease or condition being treated by the antibody of the present
invention. The additional agent also can be an agent which imparts
a beneficial attribute to the therapeutic composition e.g., an
agent which effects the viscosity of the composition.
[0592] It should further be understood that the combinations which
are to be included within this invention are those combinations
useful for their intended purpose. The agents set forth below are
illustrative for purposes and not intended to be limited. The
combinations which are part of this invention can be the antibodies
of the present invention and at least one additional agent selected
from the lists below. The combination can also include more than
one additional agent, e.g., two or three additional agents if the
combination is such that the formed composition can perform its
intended function.
[0593] Preferred combinations are non-steroidal anti-inflammatory
drug(s) also referred to as NSAIDS which include drugs like
ibuprofen. Other preferred combinations are corticosteroids
including prednisolone; the well known side-effects of steroid use
can be reduced or even eliminated by tapering the steroid dose
required when treating patients in combination with the anti-IL-12
antibodies of this invention. Non-limiting examples of therapeutic
agents for rheumatoid arthritis with which an antibody, or antibody
portion, of the invention can be combined include the following:
cytokine suppressive anti-inflammatory drug(s) (CSAIDs); antibodies
to or antagonists of other human cytokines or growth factors, for
example, TNF, LT, IL-1, IL-2, IL-6, IL-7, IL-8, IL-15, IL-16,
IL-18, EMAP-II, GM-CSF, FGF, and PDGF. Antibodies of the invention,
or antigen binding portions thereof, can be combined with
antibodies to cell surface molecules such as CD2, CD3, CD4, CD8,
CD25, CD28, CD30, CD40, CD45, CD69, CD80 (B7.1), CD86 (B7.2), CD90,
or their ligands including CD154 (gp39 or CD40L).
[0594] Preferred combinations of therapeutic agents may interfere
at different points in the autoimmune and subsequent inflammatory
cascade; preferred examples include TNF antagonists like chimeric,
humanized or human TNF antibodies, D2E7, (U.S. application Ser. No.
08/599,226 filed Feb. 9, 1996), cA2 (Remicade.TM.), CDP 571,
anti-TNF antibody fragments (e.g., CDP870), and soluble p55 or p75
TNF receptors, derivatives thereof, (p75TNFR1gG (Enbrel.TM.) or
p55TNFR1gG (Lenercept), soluble IL-13 receptor (sIL-13), and also
TNF.alpha. converting enzyme (TACE) inhibitors; similarly IL-1
inhibitors (e.g., Interleukin-1-converting enzyme inhibitors, such
as Vx740, or IL-1RA etc.) may be effective for the same reason.
Other preferred combinations include Interleukin II, anti-P7s and
p-selectin glycoprotein ligand (PSGL). Yet another preferred
combination are other key players of the autoimmune response which
may act parallel to, dependent on or in concert with IL-12
function; especially preferred are IL-18 antagonists including
IL-18 antibodies or soluble IL-18 receptors, or IL-18 binding
proteins. It has been shown that IL-12 and IL-18 have overlapping
but distinct functions and a combination of antagonists to both may
be most effective. Yet another preferred combination are
non-depleting anti-CD4 inhibitors. Yet other preferred combinations
include antagonists of the co-stimulatory pathway CD80 (B7.1) or
CD86 (B7.2) including antibodies, soluble receptors or antagonistic
ligands.
[0595] The antibodies of the invention, or antigen binding portions
thereof, may also be combined with agents, such as methotrexate,
6-MP, azathioprine sulphasalazine, mesalazine, olsalazine
chloroquinine/hydroxychloroquine, pencillamine, aurothiomalate
(intramuscular and oral), azathioprine, cochicine, corticosteroids
(oral, inhaled and local injection), beta-2 adrenoreceptor agonists
(salbutamol, terbutaline, salmeteral), xanthines (theophylline,
aminophylline), cromoglycate, nedocromil, ketotifen, ipratropium
and oxitropium, cyclosporin, FK506, rapamycin, mycophenolate
mofetil, leflunomide, NSAIDs, for example, ibuprofen,
corticosteroids such as prednisolone, phosphodiesterase inhibitors,
adensosine agonists, antithrombotic agents, complement inhibitors,
adrenergic agents, agents which interfere with signalling by
proinflammatory cytokines such as TNF.alpha. or IL-1 (e.g. IRAK,
NIK, IKK, p38 or MAP kinase inhibitors), IL-1.beta. converting
enzyme inhibitors (e.g., Vx740), anti-P7s, p-selectin glycoprotein
ligand (PSGL), TNF.alpha. converting enzyme (TACE) inhibitors,
T-cell signalling inhibitors such as kinase inhibitors,
metalloproteinase inhibitors, sulfasalazine, azathioprine,
6-mercaptopurines, angiotensin converting enzyme inhibitors,
soluble cytokine receptors and derivatives thereof (e.g. soluble
p55 or p75 TNF receptors and the derivatives p75TNFRIgG
(Enbrel.TM.) and p55TNFRIgG (Lenercept), sIL-1RI, sIL-1RII, sIL-6R,
soluble IL-13 receptor (sIL-13)) and antiinflammatory cytokines
(e.g. IL-4, IL-10, IL-11, IL-13 and TGF.beta.). Preferred
combinations include methotrexate or leflunomide and in moderate or
severe rheumatoid arthritis cases, cyclosporine.
[0596] Non-limiting examples of therapeutic agents for inflammatory
bowel disease with which an antibody, or antibody portion, of the
invention can be combined include the following: budenoside;
epidermal growth factor; corticosteroids; cyclosporin,
sulfasalazine; aminosalicylates; 6-mercaptopurine; azathioprine;
metronidazole; lipoxygenase inhibitors; mesalamine; olsalazine;
balsalazide; antioxidants; thromboxane inhibitors; IL-1 receptor
antagonists; anti-IL-1.beta. monoclonal antibodies; anti-IL-6
monoclonal antibodies; growth factors; elastase inhibitors;
pyridinyl-imidazole compounds; antibodies to or antagonists of
other human cytokines or growth factors, for example, TNF, LT,
IL-1, IL-2, IL-6, IL-7, IL-8, IL-15, IL-16, IL-18, EMAP-II, GM-CSF,
FGF, and PDGF. Antibodies of the invention, or antigen binding
portions thereof, can be combined with antibodies to cell surface
molecules such as CD2, CD3, CD4, CD8, CD25, CD28, CD30, CD40, CD45,
CD69, CD90 or their ligands. The antibodies of the invention, or
antigen binding portions thereof, may also be combined with agents,
such as methotrexate, cyclosporin, FK506, rapamycin, mycophenolate
mofetil, leflunomide, NSAIDs, for example, ibuprofen,
corticosteroids such as prednisolone, phosphodiesterase inhibitors,
adenosine agonists, antithrombotic agents, complement inhibitors,
adrenergic agents, agents which interfere with signalling by
proinflammatory cytokines such as TNF.alpha. or IL-1 (e.g. IRAK,
NIK, IKK, p38 or MAP kinase inhibitors), IL-1.beta. converting
enzyme inhibitors (e.g., Vx740), anti-P7s, p-selectin glycoprotein
ligand (PSGL), TNF.alpha. converting enzyme inhibitors, T-cell
signalling inhibitors such as kinase inhibitors, metalloproteinase
inhibitors, sulfasalazine, azathioprine, 6-mercaptopurines,
angiotensin converting enzyme inhibitors, soluble cytokine
receptors and derivatives thereof (e.g. soluble p55 or p75 TNF
receptors, sIL-1RI, sIL-1RII, sIL-6R, soluble IL-13 receptor
(sIL-13)) and antiinflammatory cytokines (e.g. IL-4, IL-10, IL-11,
IL-13 and TGF.beta.).
[0597] Preferred examples of therapeutic agents for Crohn's disease
in which an antibody or an antigen binding portion can be combined
include the following: TNF antagonists, for example, anti-TNF
antibodies, D2E7 (U.S. application Ser. No. 08/599,226, filed Feb.
9, 1996), cA2 (Remicade.TM.), CDP 571, anti-TNF antibody fragments
(e.g., CDP870), TNFR-Ig constructs (p75TNFRIgG (Enbrel.TM.) and
p55TNFRIgG (Lenercept)), anti-P7s, p-selectin glycoprotein ligand
(PSGL), soluble IL-13 receptor (sIL-13), and PDE4 inhibitors.
Antibodies of the invention or antigen binding portions thereof,
can be combined with corticosteroids, for example, budenoside and
dexamethasone. Antibodies of the invention or antigen binding
portions thereof, may also be combined with agents such as
sulfasalazine, 5-aminosalicylic acid and olsalazine, and agents
which interfere with synthesis or action of proinflammatory
cytokines such as IL-1, for example, IL-1.beta. converting enzyme
inhibitors (e.g., Vx740) and IL-1ra. Antibodies of the invention or
antigen binding portion thereof may also be used with T cell
signaling inhibitors, for example, tyrosine kinase inhibitors
6-mercaptopurines. Antibodies of the invention or antigen binding
portions thereof, can be combined with IL-11.
[0598] Non-limiting examples of therapeutic agents for multiple
sclerosis with which an antibody, or antibody portion, of the
invention can be combined include the following: corticosteroids;
prednisolone; methylprednisolone; azathioprine; cyclophosphamide;
cyclosporine; methotrexate; 4-aminopyridine; tizanidine;
interferon-.beta.1a (Avonex; Biogen); interferon-.beta.1b
(Betaseron; Chiron/Berlex); Copolymer 1 (Cop-1; Copaxone; Teva
Pharmaceutical Industries, Inc.); hyperbaric oxygen; intravenous
immunoglobulin; clabribine; antibodies to or antagonists of other
human cytokines or growth factors, for example, TNF, LT, IL-1,
IL-2, IL-6, IL-7, IL-8, IL-15, IL-16, IL-18, EMAP-II, GM-CSF, FGF,
and PDGF. Antibodies of the invention, or antigen binding portions
thereof, can be combined with antibodies to cell surface molecules
such as CD2, CD3, CD4, CD8, CD25, CD28, CD30, CD40, CD45, CD69,
CD80, CD86, CD90 or their ligands. The antibodies of the invention,
or antigen binding portions thereof, may also be combined with
agents, such as methotrexate, cyclosporine, FK506, rapamycin,
mycophenolate mofetil, leflunomide, NSAIDs, for example, ibuprofen,
corticosteroids such as prednisolone, phosphodiesterase inhibitors,
adensosine agonists, antithrombotic agents, complement inhibitors,
adrenergic agents, agents which interfere with signalling by
proinflammatory cytokines such as TNF.alpha. or IL-1 (e.g. IRAK,
NIK, IKK, p38 or MAP kinase inhibitors), IL-1.beta. converting
enzyme inhibitors (e.g., Vx740), anti-P7s, p-selectin glycoprotein
ligand (PSGL), TACE inhibitors, T-cell signalling inhibitors such
as kinase inhibitors, metalloproteinase inhibitors, sulfasalazine,
azathioprine, 6-mercaptopurines, angiotensin converting enzyme
inhibitors, soluble cytokine receptors and derivatives thereof
(e.g. soluble p55 or p75 TNF receptors, sIL-1RI, sIL-1RII, sIL-6R,
soluble IL-13 receptor (sIL-13)) and antiinflammatory cytokines
(e.g. IL-4, IL-10, IL-13 and TGF.beta.).
[0599] Preferred examples of therapeutic agents for multiple
sclerosis in which the antibody or antigen binding portion thereof
can be combined to include interferon-.beta., for example,
IFN.beta.1a and IFN.beta.1b; copaxone, corticosteroids, IL-1
inhibitors, TNF inhibitors, and antibodies to CD40 ligand and
CD80.
[0600] The pharmaceutical compositions of the invention may include
a "therapeutically effective amount" or a "prophylactically
effective amount" of an antibody or antibody portion of the
invention. A "therapeutically effective amount" refers to an amount
effective, at dosages and for periods of time necessary, to achieve
the desired therapeutic result. A therapeutically effective amount
of the antibody or antibody portion may vary according to factors
such as the disease state, age, sex, and weight of the individual,
and the ability of the antibody or antibody portion to elicit a
desired response in the individual. A therapeutically effective
amount is also one in which any toxic or detrimental effects of the
antibody or antibody portion are outweighed by the therapeutically
beneficial effects. A "prophylactically effective amount" refers to
an amount effective, at dosages and for periods of time necessary,
to achieve the desired prophylactic result. Typically, since a
prophylactic dose is used in subjects prior to or at an earlier
stage of disease, the prophylactically effective amount will be
less than the therapeutically effective amount.
[0601] Dosage regimens may be adjusted to provide the optimum
desired response (e.g., a therapeutic or prophylactic response).
For example, a single bolus may be administered, several divided
doses may be administered over time or the dose may be
proportionally reduced or increased as indicated by the exigencies
of the therapeutic situation. It is especially advantageous to
formulate parenteral compositions in dosage unit form for ease of
administration and uniformity of dosage. Dosage unit form as used
herein refers to physically discrete units suited as unitary
dosages for the mammalian subjects to be treated; each unit
containing a predetermined quantity of active compound calculated
to produce the desired therapeutic effect in association with the
required pharmaceutical carrier. The specification for the dosage
unit forms of the invention are dictated by and directly dependent
on (a) the unique characteristics of the active compound and the
particular therapeutic or prophylactic effect to be achieved, and
(b) the limitations inherent in the art of compounding such an
active compound for the treatment of sensitivity in
individuals.
[0602] An exemplary, non-limiting range for a therapeutically or
prophylactically effective amount of an antibody or antibody
portion of the invention is 0.01-20 mg/kg, more preferably 1-10
mg/kg, even more preferably 0.3-1 mg/kg. It is to be noted that
dosage values may vary with the type and severity of the condition
to be alleviated. It is to be further understood that for any
particular subject, specific dosage regimens should be adjusted
over time according to the individual need and the professional
judgment of the person administering or supervising the
administration of the compositions, and that dosage ranges set
forth herein are exemplary only and are not intended to limit the
scope or practice of the claimed composition.
VII. Uses of the Antibodies of the Invention
[0603] Given their ability to bind to hIL-12, the anti-hIL-12
antibodies, or portions thereof, of the invention can be used to
detect hIL-12 (e.g., in a biological sample, such as serum or
plasma), using a conventional immunoassay, such as an enzyme linked
immunosorbent assays (ELISA), an radioimmunoassay (RIA) or tissue
immunohistochemistry. The invention provides a method for detecting
hIL-12 in a biological sample comprising contacting a biological
sample with an antibody, or antibody portion, of the invention and
detecting either the antibody (or antibody portion) bound to hIL-12
or unbound antibody (or antibody portion), to thereby detect hIL-12
in the biological sample. The antibody is directly or indirectly
labeled with a detectable substance to facilitate detection of the
bound or unbound antibody. Suitable detectable substances include
various enzymes, prosthetic groups, fluorescent materials,
luminescent materials and radioactive materials. Examples of
suitable enzymes include horseradish peroxidase, alkaline
phosphatase, .beta.-galactosidase, or acetylcholinesterase;
examples of suitable prosthetic group complexes include
streptavidin/biotin and avidin/biotin; examples of suitable
fluorescent materials include umbelliferone, fluorescein,
fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine
fluorescein, dansyl chloride or phycoerythrin; an example of a
luminescent material includes luminol; and examples of suitable
radioactive material include .sup.125I, .sup.131I, .sup.35S or
.sup.3H.
[0604] Alternative to labeling the antibody, hIL-12 can be assayed
in biological fluids by a competition immunoassay utilizing rhIL-12
standards labeled with a detectable substance and an unlabeled
anti-hIL-12 antibody. In this assay, the biological sample, the
labeled rhIL-12 standards and the anti-hIL-12 antibody are combined
and the amount of labeled rhIL-12 standard bound to the unlabeled
antibody is determined. The amount of hIL-12 in the biological
sample is inversely proportional to the amount of labeled rhIL-12
standard bound to the anti-hIL-12 antibody.
[0605] The Y61 and J695 antibodies of the invention can also be
used to detect IL-12 from species other than humans, in particular
IL-12 from primates. For example, Y61 can be used to detect IL-12
in the cynomolgus monkey and the rhesus monkey. J695 can be used to
detect IL-12 in the cynomolgus monkey, rhesus monkey, and baboon.
However, neither antibody cross reacts with mouse or rat IL-12 (see
Example 3, subsection F).
[0606] The antibodies and antibody portions of the invention are
capable of neutralizing hIL-12 activity in vitro (see Example 3)
and in vivo (see Example 4). Accordingly, the antibodies and
antibody portions of the invention can be used to inhibit IL-12
activity, e.g., in a cell culture containing hIL-12, in human
subjects or in other mammalian subjects having IL-12 with which an
antibody of the invention cross-reacts (e.g. primates such as
baboon, cynomolgus and rhesus). In a preferred embodiment, the
invention provides an isolated human antibody, or antigen-binding
portion thereof, that neutralizes the activity of human IL-12, and
at least one additional primate IL-12 selected from the group
consisting of baboon IL-12, marmoset IL-12, chimpanzee IL-12,
cynomolgus IL-12 and rhesus IL-12, but which does not neutralize
the activity of the mouse IL-12. Preferably, the IL-12 is human
IL-12. For example, in a cell culture containing, or suspected of
containing hIL-12, an antibody or antibody portion of the invention
can be added to the culture medium to inhibit hIL-12 activity in
the culture.
[0607] In another embodiment, the invention provides a method for
inhibiting IL-12 activity in a subject suffering from a disorder in
which IL-12 activity is detrimental. IL-12 has been implicated in
the pathophysiology of a wide variety of disorders (Windhagen et
al., (1995) J. Exp. Med. 182: 1985-1996; Morita et al. (1998)
Arthritis and Rheumatism. 41: 306-314; Bucht et al., (1996) Clin.
Exp. Immunol. 103: 347-367; Fais et al. (1994) J. Interferon Res.
14:235-238; Parronchi et al., (1997) Am. J. Path. 150:823-832;
Monteleone et al., (1997) Gastroenterology. 112:1169-1178, and
Berrebi et al., (1998) Am. J. Path 152:667-672; Parronchi et al
(1997) Am. J. Path. 150:823-832). The invention provides methods
for inhibiting IL-12 activity in a subject suffering from such a
disorder, which method comprises administering to the subject an
antibody or antibody portion of the invention such that IL-12
activity in the subject is inhibited. Preferably, the IL-12 is
human IL-12 and the subject is a human subject. Alternatively, the
subject can be a mammal expressing a IL-12 with which an antibody
of the invention cross-reacts. Still further the subject can be a
mammal into which has been introduced hIL-12 (e.g., by
administration of hIL-12 or by expression of an hIL-12 transgene).
An antibody of the invention can be administered to a human subject
for therapeutic purposes (discussed further below). Moreover, an
antibody of the invention can be administered to a non-human mammal
expressing a IL-12 with which the antibody cross-reacts for
veterinary purposes or as an animal model of human disease.
Regarding the latter, such animal models may be useful for
evaluating the therapeutic efficacy of antibodies of the invention
(e.g., testing of dosages and time courses of administration).
[0608] As used herein, the phrase "a disorder in which IL-12
activity is detrimental" is intended to include diseases and other
disorders in which the presence of IL-12 in a subject suffering
from the disorder has been shown to be or is suspected of being
either responsible for the pathophysiology of the disorder or a
factor that contributes to a worsening of the disorder.
Accordingly, a disorder in which IL-12 activity is detrimental is a
disorder in which inhibition of IL-12 activity is expected to
alleviate the symptoms and/or progression of the disorder. Such
disorders may be evidenced, for example, by an increase in the
concentration of IL-12 in a biological fluid of a subject suffering
from the disorder (e.g., an increase in the concentration of IL-12
in serum, plasma, synovial fluid, etc. of the subject), which can
be detected, for example, using an anti-IL-12 antibody as described
above. There are numerous examples of disorders in which IL-12
activity is detrimental. In one embodiment, the antibodies or
antigen binding portions thereof, can be used in therapy to treat
the diseases or disorders described herein. In another embodiment,
the antibodies or antigen binding portions thereof, can be used for
the manufacture of a medicine for treating the diseases or
disorders described herein. The use of the antibodies and antibody
portions of the invention in the treatment of a few non-limiting
specific disorders is discussed further below:
A. Rheumatoid Arthritis:
[0609] Interleukin-12 has been implicated in playing a role in
inflammatory diseases such as rheumatoid arthritis. Inducible IL-12
p40 message has been detected in synovia from rheumatoid arthritis
patients and IL-12 has been shown to be present in the synovial
fluids from patients with rheumatoid arthritis (see e.g., Morita et
al., (1998) Arthritis and Rheumatism 41: 306-314). IL-12 positive
cells have been found to be present in the sublining layer of the
rheumatoid arthritis synovium. The human antibodies, and antibody
portions of the invention can be used to treat, for example,
rheumatoid arthritis, juvenile rheumatoid arthritis, Lyme
arthritis, rheumatoid spondylitis, osteoarthritis and gouty
arthritis. Typically, the antibody, or antibody portion, is
administered systemically, although for certain disorders, local
administration of the antibody or antibody portion may be
beneficial. An antibody, or antibody portion, of the invention also
can be administered with one or more additional therapeutic agents
useful in the treatment of autoimmune diseases.
[0610] In the collagen induced arthritis (CIA) murine model for
rheumatoid arthritis, treatment of mice with an anti-IL-12 mAb (rat
anti-mouse IL-12 monoclonal antibody, C17.15) prior to arthritis
profoundly suppressed the onset, and reduced the incidence and
severity of disease. Treatment with the anti-IL-12 mAb early after
onset of arthritis reduced severity, but later treatment of the
mice with the anti-IL-12 mAb after the onset of disease had minimal
effect on disease severity.
B. Crohn's Disease
[0611] Interleukin-12 also plays a role in the inflammatory bowel
disease, Crohn's disease. Increased expression of IFN-.gamma. and
IL-12 occurs in the intestinal mucosa of patients with Crohn's
disease (see e.g., Fais et al., (1994) J. Interferon Res. 14:
235-238; Parronchi et al., (1997) Amer. J. Pathol. 150: 823-832;
Monteleone et al., (1997) Gastroenterology 112: 1169-1178; Berrebi
et al., (1998) Amer. J. Pathol. 152: 667-672). Anti-IL-12
antibodies have been shown to suppress disease in mouse models of
colitis, e.g., TNBS induced colitis IL-2 knockout mice, and
recently in IL-10 knock-out mice. Accordingly, the antibodies, and
antibody portions, of the invention, can be used in the treatment
of inflammatory bowel diseases.
C. Multiple Sclerosis
[0612] Interleukin-12 has been implicated as a key mediator of
multiple sclerosis. Expression of the inducible IL-12 p40 message
or IL-12 itself can be demonstrated in lesions of patients with
multiple sclerosis (Windhagen et al., (1995) J. Exp. Med. 182:
1985-1996, Drulovic et al., (1997) J. Neurol. Sci. 147: 145-150).
Chronic progressive patients with multiple sclerosis have elevated
circulating levels of IL-12. Investigations with T-cells and
antigen presenting cells (APCs) from patients with multiple
sclerosis revealed a self-perpetuating series of immune
interactions as the basis of progressive multiple sclerosis leading
to a Th1-type immune response. Increased secretion of IFN-.gamma.
from the T cells led to increased IL-12 production by APCs, which
perpetuated the cycle leading to a chronic state of a Th1-type
immune activation and disease (Balashov et al., (1997) Proc. Natl.
Acad. Sci. 94: 599-603). The role of IL-12 in multiple sclerosis
has been investigated using mouse and rat experimental allergic
encephalomyelitis (EAE) models of multiple sclerosis. In a
relapsing-remitting EAE model of multiple sclerosis in mice,
pretreatment with anti-IL-12 mAb delayed paralysis and reduced
clinical scores. Treatment with anti-IL-12 mAb at the peak of
paralysis or during the subsequent remission period reduced
clinical scores. Accordingly, the antibodies or antigen binding
portions thereof of the invention may serve to alleviate symptoms
associated with multiple sclerosis in humans.
D. Insulin-Dependent Diabetes Mellitus
[0613] Interleukin-12 has been implicated as an important mediator
of insulin-dependent diabetes mellitus (IDDM). IDDM was induced in
NOD mice by administration of IL-12, and anti-IL-12 antibodies were
protective in an adoptive transfer model of IDDM. Early onset IDDM
patients often experience a so-called "honeymoon period" during
which some residual islet cell function is maintained. These
residual islet cells produce insulin and regulate blood glucose
levels better than administered insulin. Treatment of these early
onset patients with an anti-IL-12 antibody may prevent further
destruction of islet cells, thereby maintaining an endogenous
source of insulin.
E. Psoriasis
[0614] Interleukin-12 has been implicated as a key mediator in
psoriasis. Psoriasis involves acute and chronic skin lesions that
are associated with a TH1-type cytokine expression profile. (Hamid
et al. (1996) J. Allergy Clin. Immunol. 1:225-231; Turka et al.
(1995) Mol. Med. 1:690-699). IL-12 p35 and p40 mRNAs were detected
in diseased human skin samples. Accordingly, the antibodies or
antigen binding portions thereof of the invention may serve to
alleviate chronic skin disorders such psoriasis.
[0615] The present invention is further illustrated by the
following examples which should not be construed as limiting in any
way. The contents of all cited references, including literature
references, issued patents, and published patent applications, as
cited throughout this application are hereby expressly incorporated
by reference. It should further be understood that the contents of
all the tables attached hereto (see Appendix A) are incorporated by
reference.
TABLE-US-00002 TABLE 1 VH3 Family Germline Amino Acid Sequences
Numbering according to Kabat (Joe9 VH included for comparison) SEQ
ID germline NO: VH 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19
20 21 22 23 24 25 26 27 28 29 30 594 dp-29 E V Q L V E S G G G L V
Q P G G S L R L S C A A S G F T F S 595 DP-30 E V Q L V E S G G G L
V Q P G G S L R L S C A A S G F T F S 596 HC15-7 E V Q L V E S G G
G L V Q P G G S L R L S C A A S G F T F S 597 VHD26 E V Q L L E S G
G G L V Q P G G S L R L S C A A S G F T F S 598 DP-31 E V Q L V E S
G G G L V Q P G R S L R L S C A A S G F T F D 599 DP-32 E V Q L V E
S G G G V V R P G G S L R L S C A A S G F T F D 600 DP-33 E V Q L V
E S G G V V V Q P G G S L R L S C A A S G F T F D 601 dp-35 Q V Q L
V E S G G G L V K P G G S L R L S C A A S G F T F S 602 VH3-8 Q V Q
L L E S G G G L V K P G G S L R L S C A A S G F T F S 603 yac-9 E V
Q L V E S G G G L V Q P G G S L K L S C A A S G F T F S 604 dp-38 E
V Q L V E S G G G L V K P G G S L R L S C A A S G F T F S 605 LSG2
E V Q L V E S G G G L V K P G G S L R L S C A A S G F T F S 606
LSG3 E V Q L V E S G G G L V K P G G S L R L S C A A S G F T F S
607 LSG4 E V Q L V E S G G G L V K P G G S L R L S C A A S G F T F
S 608 LSG6 E V Q L V E S G G G L V K P G G S L R L S C A A S G F T
F S 609 v3-15 E V Q L V E S G G A L V K P G G S L R L S C A A S G F
T F S 610 dp-39 E V Q L V E S G G G L V Q P G G S L R L S C P A S G
F T F S 611 dp-40 E V Q L V E S G G G L V Q P G G S L R L S C A A S
G F T F S 612 dp-59 E V Q L V E S G G G L V Q P G G S L R L S C A A
S G F T F S 613 v3-16p E V Q L V E S G G G L V Q P G G S L R L S C
A A S G F T F S 614 v3-19p T V Q L V E S G G G L V E P G G S L R L
S C A A S G F T F S 615 v3-13 E V H L V E S G G G L V Q P G G A L R
L S C A A S G F T F S 616 DP-42 E V Q L V E T G G G L I Q P G G S L
R L S C A A S G F T V S 617 dp-44 E V Q L V Q S G G G L V H P G G S
L R L S C A G S G F T F S 618 DP-45 E V Q L V Q S G G G L V Q P G G
S L R L S C A G S G F T F S 619 dp-47 E V Q L L E S G G G L V Q P G
G S L R L S C A A S G F T F S 620 flm E V Q L V E S G G G L V Q P G
G S L R L S C S A S G F T F S 621 P1 E V Q L V E S G G G L V Q P G
G S L R L S C S A S G F T F S 622 v3-64 E V Q L V E S G G G L V Q P
G G S L R L S C A A S G F T F S 623 vh26 E V Q L L E S G G G L V Q
P G G S L R L S C A A S G F T F S 624 B25 Q V Q L V E S G G G V V Q
P G R S L R L S C A A S G F T F S 625 b32e Q V Q L V E S G G G V V
Q P G R S L R L S C A A S G F T F S 626 B37 Q V Q L V E S G G G V V
Q P G R S L R L S C A A S G F T F S 627 B43 Q V Q L V E S G G G V V
Q P G R S L R L S C A A S G F T F S 628 B48 Q V Q L V E S G G G V V
Q P G R S L R L S C A A S G F T F S 629 B52 Q V Q L V E S G G G V V
Q P G R S L R L S C A A S G F T F S 630 B54 Q V Q L V E S G G G V V
Q P G R S L R L S C A A S G F T F S 631 cos-8 Q V Q L V E S G G G V
V Q P G R S L R L S C A A S G F T F S 632 dp-46 Q V Q L V E S G G G
V V Q P G R S L R L S C A A S G F T F S 633 F2M Q V Q L V E S G G G
L V Q P G G S L R L S C A A S G F T F S 634 F3 Q V Q L V E S G G G
L V Q P G G S L R L S C A A S G F T F S 635 F7 Q V Q L V E S G G G
V V Q P G R S L R L S C A A S G F T F S 636 hv3005 Q V Q L V E S G
G G V V Q P G R S L R L S C A A S G F T F S 637 P2 Q V Q L V E S G
G G V V Q P G R S L R L S C A A S G F T F S 638 dp-48 E V Q L V E S
G G G L V Q P G G S L R L S C A A S G F T F S 639 dp-58 E V Q L V E
S G G G L V Q P G G S L R L S C A A S G F T F S 640 B1 Q V Q L V E
S G G G V V Q P G R S L R L S C A A S G F T F S 641 B13 Q V Q L V E
S G G G V V Q P G R S L R L S C A A S G F T F S 642 B18 Q V Q L V E
S G G G V V Q P G R S L R L S C A A S G F T F S 643 B26 Q V Q L V E
S G G G V V Q P G R S L R L S C A A S G F T F S 644 B28E Q V Q L V
E S G G G V V Q P G R S L R L S C A A S G F T F S 645 B29E Q V Q L
V E S G G G V V Q P G R S L R L S C A A S G F T F S 646 B29M Q V Q
L V E S G G G V V Q P G R S L R L S C A A S G F T F S 647 B30 Q V Q
L V E S G G G V V Q P G R S L R L S C A A S G F T F S 648 B32M Q V
Q L V E S G G G V V Q P G R S L R L S C A A S G F T F S 649 cos-3 Q
V Q L V E S G G G V V Q P G G S L R L S C A A S G F T F S 650 dp-49
Q V Q L V E S G G G V V Q P G R S L R L S C A A S G F T F S 651
dp-50 Q V Q L V E S G G G V V Q P G R S L R L S C A A S G F T F S
652 P6 Q V Q L V E S G G G V V Q P G R S L R L S C A A S G F T F S
653 P9E Q V Q L V E S G G G V V Q P G R S L R L S C A A S G F T F S
654 v3-30 Q V Q L V E S G G G V V Q P G R S L R L S C A A S G F T F
S 655 v3-33 Q V Q L V E S G G G V V Q P G R S L R L S C A A S G F T
F S 656 dp-51 E V Q L V E S G G G L V Q P G G S L R L S C A A S G F
T F S 657 dp-77 E V Q L V E S G G G L V K P G G S L R L S C A A S G
F T F S 658 HHG4 E V Q L V E S G G G L V K P G G S L R L S C A A S
G F T F S 659 v3-21 E V Q L V E S G G G L V K P G G S L R L S C A A
S G F T F S 660 v3-48 E V Q L V E S G G G L V Q P G G S L R L S C A
A S G F T F S 661 DP-52 E D Q L V E S G G G L V Q P G G S L R L S C
A A S G F T F S 662 cos-6 E V Q L V E S G G G L V Q P G G S L R L S
C A A S G F T F S 663 dp-53 E V Q L V E S G G G L V Q P G G S L R L
S C A A S G F T F S 664 dp-54 E V Q L V E S G G G L V Q P G G S L R
L S C A A S G F T F S 665 dp-87 E V Q L V E S G G G L V Q P G G S L
R L S C A A S G F T F S 666 VH3-11 E V Q L V E S G G G L V Q P G G
S L R L S C A A S G F T F S 667 JOE9 VE Q V Q L V Q S G G G V V Q P
G R S L R L S C A A S G F T F S VH3 Family Germline Amino Acid
Sequences Numbering according to Kabat (Joe9 VH included for
comparison) SEQ ID germline CDR H1 CDR H2 NO: VH 31 32 33 34 35 36
37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 52A 52B 52C 53 594
dp-29 D H Y M D W V R Q A P G K G L E W V G R T R N K A N 595 DP-30
D H Y M S W V R Q A Q G K G L E L V G L I R N K A N 596 HC15-7 D H
Y M S W V R Q A Q G K G L E L V G L I R N K A N 597 VHD26 D H Y M S
W V R Q A Q G K G L E L V G L I R N K A N 598 DP-31 D Y A M H W V R
Q A P G L G L E W V S G I S W . . N 599 DP-32 D Y G M S W V R Q A P
G K G L E W V S G I N W . . N 600 DP-33 D Y T M H W V R Q A P G K G
L E W V S L I S W . . D 601 dp-35 D Y Y M S W I R Q A P G K G L E W
V S Y I . . S S S 602 VH3-8 D Y Y M S W I R Q A P G K G L E W V S Y
I . . S S S 603 yac-9 G S A M H W V R Q A S G K G L E W V G R I R S
K A N 604 dp-38 N A W M S W V R Q A P G K G L E W V G R I K S K T D
605 LSG2 N A W M S W V R Q A P G K G L E W V G R I E S K T D 606
LSG3 N A W H S W V R Q A P G K G L E W V G R I K S K T D 607 LSG4 N
A W M S W V R Q A P G K G L E W V G R I K S K T D 608 LSG6 N A W M
N W V R Q A P G K G L E W V G R I K S K T D 609 v3-15 N A W M S W V
R Q A P G K G L E W V G R I K S K T D 610 dp-39 N H Y M S W V R Q A
P G K G L E W V S Y I . . S G D 611 dp-40 N H Y T S W V R Q A P G K
G L E W V S Y S . . S G N 612 dp-59 N S D M N W V H Q A P G K G L E
W V S G V . . S W N 613 v3-16p N S D M N W A R K A P G K G L E W V
S G V . . S W N 614 v3-19p N S D M N W V R Q A P G K G L E W V S G
V . . S W N 615 v3-13 N Y D M H W V R Q A T G K G L E W V S A N . .
G T A 616 DP-42 S N Y M S W V R Q A P G K G L E W V S V I . Y . . S
617 dp-44 S Y A M H W V R Q A P G K G L E W V S A I . . . G T 618
DP-45 S Y A M H W V R Q A P G K G L E W V S A I . . . G T 619 dp-47
S Y A M S W V R Q A P G K G L E W V S A I . . S G S 620 flm S Y A M
H W V R Q A P G K G L E Y V S A I . . S S N 621 P1 S Y A M H W V R
Q A P G K G L E Y V S A I . . S S N 622 v3-64 S Y A M H W V R Q A P
G K G L E Y V S A I . . S S N 623 vh26 S Y A M S W V R Q A P G K G
L E W V S A I . . S G S 624 B25 S Y A M H W V R Q A P G K G L E W V
A V I . . S Y D 625 b32e S Y A M H W V R Q A P G K G L E W V A V I
. . S Y D 626 B37 S Y A M H W V R Q A P G K G L E W V A V I . . S Y
D 627 B43 S Y A M H W V R Q A P G K G L E W V A V I . . S Y D 628
B48 S Y A M H W V R Q A P G K G L E W V A V I . . S Y D 629 B52 S Y
A M H W V R Q A P G K G L E W V A V I . . S Y D 630 B54 S Y A M H W
V R Q A P G K G L E W V A V I . . S Y D 631 cos-8 S Y A M H W V R Q
A P G K G L E W V A V I . . S Y D 632 dp-46 S Y A M H W V R Q A P G
K G L E W V A V I . . S Y D 633 F2M S Y A M H W V R Q A P G K G L E
Y V S A I . . S S N 634 F3 S Y A M H W V R Q A P G K G L E Y V S A
I . . S S N 635 F7 S Y A M H W V R Q A P G K G L E W V A V I . . S
Y D 636 hv3005 S Y A M H W V R Q A P G K G L E W V A V I . . S Y
D
637 P2 S Y A M H W V R Q A P G K G L E W V A V I . . S Y D 638
dp-48 S Y D M H W V R Q A T G K G L E W V S A I . . G T A 639 dp-58
S Y E M N W V R Q A P G K G L E W V S Y I . . S S S 640 B1 S Y G M
H W V R Q A P G K G L E W V A V I . . S Y D 641 B13 S Y G M H W V R
Q A P G K G L E W V A V I . . S Y D 642 B18 S Y G M H W V R Q A P G
K G L E W V A V I . . S Y D 643 B26 S Y G M H W V R Q A P G K G L E
W V A V I . . S Y D 644 B28E S Y G M H W V R Q A P G K G L E W V A
V I . . S Y D 645 B29E S Y G M H W V R Q A P G K G L E W V A V I .
. S Y D 646 B29M S Y G M H W V R Q A P G K G L E W V A V I . . S Y
D 647 B30 S Y G M H W V R Q A P G K G L E W V A V I . . W Y D 648
B32M S Y G M H W V R Q A P G K G L E W V A V I . . S Y D 649 cos-3
S Y G M H W V R Q A P G K G L E W V A V I . . R Y D 650 dp-49 S Y G
M H W V R Q A P G K G L E W V A V I . . S Y D 651 dp-50 S Y G M H W
V R Q A P G K G L E W V A V I . . W Y D 652 P6 S Y G M H W V R Q A
P G K G L E W V A V I . . W Y D 653 P9E S Y G M H W V R Q A P G K G
L E W V A V I . . S Y D 654 v3-30 S Y G M H W V R Q A P G K G L E W
V A V I . . S Y D 655 v3-33 S Y G M H W V R Q A P G K G L E W V A V
I . . W Y D 656 dp-51 S Y S M N W V R Q A P G K G L E W V S Y I . .
S S S 657 dp-77 S Y S M N W V R Q A P G K G L E W V S S I . . S S S
658 HHG4 S Y S M N W V R Q A P G K G L E W V S S I . . . S S 659
v3-21 S Y S M N W V R Q A P G K G L E W V S S I . . S S S 660 v3-48
S Y S M N W V R Q A P G K G L E W V S Y I . . S S S 661 DP-52 S Y V
L H W V R R A P G K G P E W V S A I G . . . T 662 cos-6 S Y W M H W
V R Q A P G K G L V W V S R I . . N S D 663 dp-53 S Y W M H W V R Q
A P G K G L V W V S R I . . N S D 664 dp-54 S Y W M S W V R Q A P G
K G L E W V A N I . . K Q D 665 dp-87 S Y W M H W V R Q A P G K G L
V W V S R I . . N S D 666 VH3-11 S Y W M S W V R Q A P G K G L E W
V A N I . . K Q D 667 JOE9 VE S Y G M H W V R Q A P G K G L E W V A
F I . . R Y D VH3 Family Germline Amino Acid Sequences Numbering
according to Kabat (Joe9 VH included for comparison) SEQ ID
germline CDR H2 NO: VH 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68
69 70 71 72 73 74 75 76 77 78 594 dp-29 S Y T T E Y A A S V K G R F
T I S R D D S K N S L 595 DP-30 S Y T T E Y A A S V K G R L T I S R
E D S K N T L 596 HC15-7 S Y T T E Y A A S V K G R L T I S R E D S
K N T M 597 VHD26 S Y T T E Y A A S V K G R L T I S R E D S K N T L
598 DP-31 S G S I G Y A D S V K G R F T I S R D N A K N S L 599
DP-32 G G S T G Y A D S V K G R F T I S R D N A K N S L 600 DP-33 G
G S T Y Y A D S V K G R F T I S R D N S K N S L 601 dp-35 G S T I Y
Y A D S V K G R F T I S R D N A K N S L 602 VH3-8 S S Y T N Y A D S
V K G R F T I S R D N A K N S L 603 yac-9 S Y A T A Y A A S V K G R
F T I S R D D S K N T A 604 dp-38 G G T T D Y A A P V K G R F T I S
R D D S K N T L 605 LSG2 G G T T D Y A A P V K G R F T I S R D D S
K N T L 606 LSG3 G G T T D Y A A P V K G R F T I S R D D S K N T L
607 LSG4 G G T T N Y A A P V K G R F T I S R D D S K N T L 608 LSG6
G G T T D Y A A P V K G R F T I S R D D S K N T L 609 V3-15 G G T T
D Y A A P V K G R F T I S R D D S K N T L 610 dp-39 S G Y T N Y A D
S V K G R F T I S R D N A N N S P 611 dp-40 S G Y T N Y A D S V K G
R F T I S R D N A K N S L 612 dp-59 G S R T H Y A D S V K G R F T I
S R D N S R N T L 613 v3-16p G S R T H Y V D S V K R R F I I S R D
N S R N S L 614 v3-19p G S R T H Y A D S V K G R F I I S R D N S R
N F L 615 v3-13 G . D T Y Y P G S V K G R F T I S R E N A K N S L
616 DP-42 G G S T Y Y A D S V K G R F T I S R D N S K N T L 617
dp-44 G G G T Y Y A D S V K G R F T I S R D N A K N S L 618 DP-45 G
G G T Y Y A D S V K G R F T I S R D N A K N S L 619 dp-47 G G S T Y
Y A D S V K G R F T I S R D N S K N T L 620 flm G G S T Y Y A D S V
K G R F T I S R D N S K N T L 621 P1 G G S T Y Y A D S V K G R F T
I S R D N S K N T L 622 v3-64 G G S T Y Y A N S V K G R F T I S R D
N S K N T L 623 vh26 G G S T Y Y G D S V K G R F T I S R D N S K N
T L 624 B25 G S N K Y Y T D S V K G R F T I S R D N S K N T L 625
b32e G S N K Y Y A D S V K G R F T I S R D N S K N T L 626 B37 G S
N K Y Y A D S V K G R F T I S R D N S K N T L 627 B43 G S N K Y Y A
D S V K G R F T I S R D N S K N T L 628 B48 G S N K Y Y A D S V K G
R F T I S R D N S K N T L 629 B52 G S N K Y Y A D S V K G R F T I S
R D N S K N T L 630 B54 G S N K Y Y A D S V K G R F T I S R D N S K
N T L 631 cos-8 G S N K Y Y A D S V K G R F T I S R D N S K N T L
632 dp-46 G S N K Y Y A D S V K G R F T I S R D N S K N T L 633 F2M
G G S T Y Y A D S V K G R F T I S R D N S K N T L 634 F3 G G S T Y
Y A D S V K G R F T I S R D N S K N T L 635 F7 G S N K Y Y A D S V
K G R F A I S R D N S K N T L 636 hv3005 G S N K Y Y A D S V K G R
F T I S R D N S K N T L 637 P2 G S N K Y Y A D S V K G R F T I S R
D N S K N T L 638 dp-48 G . D T Y Y P G S V K G R F T I S R E N A K
N S L 639 dp-58 G S T I Y Y A D S V K G R F T I S R D N A K N S L
640 B1 G S N K Y Y A D S V K G R F T I S R D N S K N T L 641 B13 G
S N K Y Y A D S V K G R F T I S R D N S K N T L 642 B18 G S N K Y Y
A D S V K G R F T I S R D N S K N T L 643 B26 G S N K Y Y A D S V K
G R F T I S R D N S K N T L 644 B28E G S N K Y Y A D S V K G R F T
I S R D N S K N R L 645 B29E G S N K Y Y A D S V K G R F T I S R D
N S K N R L 646 B29M G S N K Y Y A D S V K G R F T I S R D N S K N
T L 647 B30 G S N K Y Y A D S V K G R F T I S R D N S K N T L 648
B32M G S N K Y Y A D S V K G R F T I S R D N S K N T L 649 cos-3 G
S N K Y Y A D S V K G R F T I S R D N S K N T L 650 dp-49 G S N K Y
Y A D S V K G R F T I S R D N S K N T L 651 dp-50 G S N K Y Y A D S
V K G R F T I S R D N S K N T L 652 P6 G S N K Y Y A D S V K G R F
T I S R D N S K N T L 653 P9E G S N K Y Y A D S V K G R F T I S R D
N S K N T L 654 v3-30 G S N K Y Y A D S V K G R F T I S R D N S K N
T L 655 v3-33 G S N K Y Y A D S A K G R F T I S R D N S T N T L 656
dp-51 S S T I Y Y A D S V K G R F T I S R D N A K N S L 657 dp-77 S
S Y I Y Y A D S V K G R F T I S R D N A K N S L 658 HHG4 S S Y I Y
Y A D S V K G R F T I S R D N A K N S L 659 v3-21 S S Y I Y Y A D S
V K G R F T I S R D N A K N S L 660 v3-48 S S T I Y Y A D S V K G R
F T I S R D N A K N S L 661 DP-52 G G D T Y Y A D S V M G R F T I S
R D N A K K S L 662 cos-6 G S S T S Y A D S V K G R F T I S R D N A
K N T L 663 dp-53 G S S T S Y A D S V K G R F T I S R D N A K N T L
664 dp-54 G S E K Y Y V D S V K G R F T I S R D N A K N S L 665
dp-87 G S S T S Y A D S M K G Q F T I S R D N A K N T L 666 VH3-11
G S E K Y Y V D S V K G R F T I S R D N A K N T L 667 JOE9 VE G S N
K Y Y A D S V K G R F T I S R D N S K N T L VH3 Family Germline
Amino Acid Sequences Numbering according to Kabat (Joe9 VH included
for comparison) SEQ ID germline NO VH 79 80 81 82 82A 82B 82C 83 84
85 86 87 88 89 90 91 92 93 94 594 dP-29 Y L Q M N S L K T E D T A V
Y Y C A R 595 DP-30 Y L Q M S S L K T E D L A V Y Y C A R 596
HC15-7 Y L Q M S N L K T E D L A V Y Y C A R 597 VHD26 Y L Q M S S
L K T E D L A V Y Y C A R 598 DP-31 Y L Q M N S L R A E D T A L Y Y
C A K 599 DP-32 Y L Q M N S L R A E D T A L Y K C A R 600 DP-33 Y L
Q M N S L R T E D T A L Y Y C A K 601 dp-35 Y L Q M N S L R A E D T
A V Y Y C A R 602 VH3-8 Y L Q M N S L R A E D T A V Y Y C A R 603
yac-9 Y L Q M N S L K T E D T A V Y Y C T R 604 dp-38 Y L Q M N S L
K T E D T A V Y Y C T T 605 LSG2 Y L Q M N S L K T E D T A V Y Y C
T T 606 LSG3 Y L Q M N S L K T E D T A V Y Y C T T 607 LSG4 Y L Q M
N S L K T E D T A V Y Y C T T
608 LSG6 Y L Q M N S L K T E D T A V Y Y C T T 609 V3-15 Y L Q M N
S L K T E D T A V Y Y C T T 610 dp-39 Y L Q M N S L R A E D T A V Y
Y C V K 611 dp-40 Y L Q M N S L R A E D T A V Y Y C V R 612 dp-59 Y
L Q T N S L R A E D T A V Y Y C V R 613 v3-16p Y L Q K N R R R A E
D M A V Y Y C V R 614 v3-19p Y Q Q M N S L R P E D M A V Y Y C V R
615 v3-13 Y L Q M N S L R A G D T A V Y Y C A R 616 DP-42 Y L Q M N
S L R A E D T A V Y Y C A R 617 dp-44 Y L Q M N S L R A E D M A V Y
Y C A R 618 DP-45 Y L Q M N S L R A E D M A V Y Y C A R 619 dp-47 Y
L Q M N S L R A E D T A V Y Y C A K 620 flm Y V Q M S S L K A E D T
A V Y Y C V K 621 P1 Y V Q M S S L R A E D T A V Y Y C V K 622
v3-64 Y L Q M G S L R A E D M A V Y Y C A R 623 vh26 Y L Q M N S L
R A E D T A V Y Y C A K 624 B25 Y L Q M N S L R A E D T A V Y Y C A
R 625 b32e Y L Q M N S L R A E D T A V Y Y C A R 626 B37 Y L Q M N
S L R A E D T A V Y Y C A R 627 B43 Y L Q M N S L R A E D T A V Y Y
C A R 628 B48 Y L Q M N S L R A E D T A V Y Y C A R 629 B52 Y L Q M
N S L R A E D T A V Y Y C A R 630 B54 Y L Q M N S L R A E D T A V Y
Y C A R 631 cos-8 Y L Q M N S L R A E D T A V Y Y C A R 632 dp-46 Y
L Q M N S L R A E D T A V Y Y C A R 633 F2M Y V Q M S S L R A E D T
A V Y Y C V K 634 F3 Y L Q M N S L R A E D T A V Y Y C A R 635 F7 Y
L Q M N S L R A E D T A V Y Y C A R 636 hv3005 Y L Q M N S L R A E
D T A V Y Y C A R 637 P2 Y L Q M N S L R A E D T A V Y Y C A K 638
dp-48 Y L Q M N S L R A G D T A V Y Y C A R 639 dp-58 Y L Q M N S L
R A E D T A V Y Y C A R 640 B1 Y L Q M N S L R L R A R L C I T V R
E 641 B13 Y L Q M N S L R A E D T A V Y Y C A R 642 B18 Y L Q M N S
L R A E D T A V Y Y C A R 643 B26 Y L Q M N S L R A E D T A V Y Y C
A R 644 B28E Y L Q M N S L R A E D T A V Y Y C A R 645 B29E Y L Q M
N S L R A E D T A V Y Y C A R 646 B29M Y L Q M N S L R A E D T A V
Y Y C A R 647 B30 Y L Q M N S L R A E D T A V Y Y C A R 648 B32M Y
L Q M N S L R A E G T A V Y Y C A R 649 cos-3 Y L Q M N S L R A E D
T A V Y Y C A K 650 dp-49 Y L Q M N S L R A E D T A V Y Y C A K 651
dp-50 Y L Q M N S L R A E D T A V Y Y C A R 652 P6 Y L Q M N S L R
A E D T A V Y Y C A K 653 P9E Y L Q M N S L R A E D T A V R K - - -
654 v3-30 Y L Q M N S L R A E D T A V Y Y C A R 655 v3-33 F L Q M N
S L R A E D T A V Y Y C A R 656 dp-51 Y L Q M N S L R D E D T A V Y
Y C A R 657 dp-77 Y L Q M N S L R A E D T A V Y Y C A R 658 HHG4 Y
L Q M N S L R A E D T A V Y Y C A R 659 v3-21 Y L Q M N S L R A E D
T A V Y Y C A R 660 v3-48 Y L Q M N S L R A E D T A V Y Y C A R 661
DP-52 Y L Q M N S L I A E D M A V Y Y C A R 662 cos-6 Y L Q M N S L
R A E D T A V Y Y C A R 663 dp-53 Y L Q M N S L R A E D T A V Y Y C
A R 664 dp-54 Y L Q M N S L R A E D T A V Y Y C A R 665 dp-87 Y L Q
M N S L R A E D M A V Y Y C T R 666 VH3-11 Y L Q M N S L R A E D T
A V Y Y C A R 667 JOE9 VE Y L Q M K S L R A E D T A V Y Y C T T
V.lamda.1 Family Germline Amino Acid Sequences Numbering according
to Kabat. (Joe9 VL included for comparison) SEQ ID CDR L1 NO: gene*
VL 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 24 25
26 27 27A 27B 27C 668 1b DPL5 Q S V L T Q P P S V S A A P G Q K V T
I S C S G S S S N I 669 1d DPL4 Q S V L T Q P P S V S A A P G Q K V
T I S C S G S S S D M 670 1c DPL2 Q S V L T Q P P S A S G T P G Q R
V T I S C S G S S S N I 671 1g DPL3 Q S V L T Q P P S A S G T P G Q
R V T I S C S G S S S N I 672 1a DPL1 Q S V L T Q P P S V S E A P R
Q R V T I S C S G S S S N I 673 1f DPL9 Q S V L T Q P P S V S G A P
G Q R V T I S C T G S S S N I 674 1e DPL8 Q S V V T Q P P S V S G A
P G Q R V T I S C T G S S S N I 675 JOE9 VL S Y V L T Q P P S V S G
T P G Q R V T I S C S G G R S N I V.lamda.1 Family Germline Amino
Acid Sequences Numbering according to Kabat. (Joe9 VL included for
comparison) SEQ ID CDR L1 CDR L2 NO: gene* VL 28 29 30 31 32 33 34
35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 668 1b DPL5 G N
N Y . V S W Y Q Q L P G T A P K L L I Y D N 669 1d DPL4 G N Y A . V
S W Y Q Q L P G T A P K L L I Y E N 670 1c DPL2 G S N T . V N W Y Q
Q L P G T A P K L L I Y S N 671 1g DPL3 G S N Y . V Y W Y Q Q L P G
T A P K L L I Y R N 672 1a DPL1 G N N . A V N W Y Q Q L P G T A P K
L L I Y Y D 673 1f DPL9 G A G Y V V H W Y Q Q L P G T A P K L L I Y
G N 674 1e DPL8 G A G Y D V H W Y Q Q L P G T A P K L L I Y G N 675
JOE9 VL G S N T . V K W Y Q Q L P G T A P K L L I Y G N V.lamda.1
Family Germline Amino Acid Sequences Numbering according to Kabat.
(Joe9 VL included for comparison) SEQ ID CDR L2 NO: gene* VL 52 53
54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 668
1b DPL5 N K R P S G I P D R F S G S K S G T S A T L G 669 1d DPL4 N
K R P S G I P D R F S G S K S G T S A T L G 670 1c DPL2 N Q R P S G
V P D R F S G S K S G T S A S L A 671 1g DPL3 N Q R P S G V P D R F
S G S K s G T S A S L A 672 1a DPL1 D L L P S G V S D R F S G S K S
G T S A S L A 673 1f DPL9 S N R P S G V P D Q F S G S K S G T S A S
L A 674 1e DPL8 S N R P S G V P D R F S G S K S G T S A S L A 675
JOE9 VL D Q R P S G V P D R F S G S K S G T S A S L A V.lamda.1
Family Germline Amino Acid Sequences Numbering according to Kabat.
(Joe9 VL included for comparison) SEQ ID CDR L3 NO: gene* VL 75 76
77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 95A 95B
668 1b DPL5 I T G L Q T G D E A D Y Y C G T W D S S L S A 669 1d
DPL4 I T G L W P E D E A D Y Y C L A W D T S P R A 670 1c DPL2 I S
G L Q S E D E A D Y Y C A A W D D S L N G 671 1g DPL3 I S G L R S E
D E A D Y Y C A A W D D S L S G 672 1a DPL1 I S G L Q S E D E A D Y
Y C A A W D D S L N G 673 1f DPL9 I T G L Q S E D E A D Y Y C K A W
D N S L N A 674 1e DPL8 I T G L Q A E D E A D Y Y C Q S Y D S S L S
G 675 JOE9 I T G V Q A E D E A D Y Y C Q S Y D S S L R G VL
*Williams, JMB, 1996, 264, 220-232
TABLE-US-00003 TABLE 2 H3 SEQ L3 SEQ RB assay PHA assay IFN gamma
Clone ID NO: H3 ID NO: L3 koff IC50 (M) IC50 (M) IC50 (M) Joe9 wt
77 SGSYDY 110 QSYDSSLRGSRV 1.00E - 01 1.50E - 06 1.00E - 06 Joe9 wt
77 SGSYDY 110 QSYDSSLRGSRV 5.00E - 07 IgG1 70-1 78 HGSHDN 110 Joe9
wt 1.34e - 2 2.00E - 07 70-1 IgG1 78 HGSHDN 110 Joe9 wt 2.00E - 07
70-2 79 HGSYDY 110 Joe9 wt 3.30E - 02 3-5.0E - 7 70-7 80 RRRSNY 110
Joe9 wt 1.29E - 01 3-5.0E - 7 70-13 81 SGSIDY 110 Joe9 wt 7.20E -
02 3-5.0E - 7 78-34 77 wt 111 QSYDRGFTGSRV 1.64e - 2 2.00E - 07
6.00-E - 07 78-25 77 wt 112 QSYDSSLRGSRV 5.00E - 02 78-28 77 wt 112
QSYDSSLRGSRV 4.66E - 02 78-35 77 wt 113 QSYDSSLTGSRV 4.99E - 02
4.00E - 07 79-1 77 wt 114 QSYDSSLWGSRV 2.00E - 07 6.00E - 07 101-14
79 70-2 111 78-34 7.52E - 03 101-9 79 70-2 113 78-35 8.54E - 03
101-19 81 70-13 111 78-34 4.56E - 02 101-8 81 70-13 111 78-34 1.01E
- 02 101-4 81 70-13 113 78-35 9.76E - 03 101-5 81 70-13 113 78-35
4.45E - 02 101-11 (12) 78 70-1 111 78-34 4.5e - 3 3.00E - 08 101-11
IgG1 78 70-1 111 78-34 1.60E - 09 26-1 78 70-1 114 791-1 7.4e - 3
6.00E - 08 (2, 3) 136-9 82 HGSHDD 115 QTYDISESGSRV 3.20E - 03
136-10 82 HGSHDD 116 QSYDRGFTGSRV 1.40E - 03 2.00E - 09 136-14 83
HGSHDN 117 QTYDRGRTGSRV 1.10E - 03 3.00E - 10 1.00E - 07 136-15 83
HGSHDN 118 QTYDKGFTGSSV 7.4e - 4 1.00E - 10 2.00E - 09 136-15 83
HGSHDN 118 QTYDKGFTGSSV 4.60E - 04 6.00E - 09 germline 136-16 83
HGSHDN 119 QSYDRRFTGSRV 6.10E - 04 3.00E - 10 5.00E - 09 136-17 83
HGSHDN 120 QSYDWNETGSRV 2.90E - 05 2.00E - 09 7.00E - 09 136-18 83
HGSHDN 121 QSYDRGFTGSRV 1.10E - 03 8.00E - 10 136-21 83 HGSHDN 122
QSYDNGFTGSRV 4.20E - 04 2.00E - 09 136-24 83 HGSHDN 123
QSYDNAVTASKV 8.90E - 04 1.00E - 09 101-11 84 TT HGSHDN WGQG 124
QSYDRGFTGSRV 4.5 .times. 10 - 3 2X10 - 9 2.00E - 08 136-15m1 85 AK
...... .... 124 QSYDRGFTGSRV 4.00E - 10 149-4 86 .. ...... .S.. 124
............ 1.37 .times. 10 - 3 8 .times. 10 - 11 3.00E - 09 149-5
87 .. .....T .... 125 QSYDSSLWGTRV 1.02 .times. 10 - 3 1.2 .times.
10 - 10 3.00E - 09 149-6 84 .. ...... .... 124 ............ 2.73
.times. 10 - 3 6 .times. 10 - 10 2.00E - 09 149-7 84 .. ...... ....
126 .....D...... 1.13 .times. 10 - 3 9 .times. 10 - 10 3.00E - 09
149-8 88 K. ...... .... 2.33 .times. 10 - 3 3 .times. 10 - 9 149-9
89 K. ...... ..H. 127 ...E......M. 3.54 .times. 10 - 3 1.8 .times.
10 - 10 149-11 90 .. ...... .S.. 128 ....N....A.. 1.43 .times. 10 -
2 2 .times. 10 - 10 4.00E - 09 149-12 84 .. ...... .... 3.73
.times. 10 - 3 neutralising 149-13 84 .. ...... .... 2.22 .times.
10 - 3 5 .times. 10 - 10 6.00E - 09 149-14 91 .. .R..N. .... 1.5
.times. 10 - 10 6.00E - 09 92 TT HGSHDN 124 QSYDRGFTGSRV 156-1 93
.. .....T 126 .....D...... 5.00E - 03 156-2 93 .. .....T 129
.....R...... 156-3 93 .. .....T 128 ....N....A.. 9.00E - 03 156-4
93 .. .....T 127 ...E.....SM. 156-5 93 .. .....T 130 .T..K.....S.
156-6 92 .. ...... 126 .....D...... 3.00E - 03 156-7 92 .. ......
129 .....R...... 156-8 92 .. ...... 128 ....N....A.. 156-9 92 ..
...... 127 ...E.....SM. 156-10 92 .. ...... 130 .T.K......S. 156-11
94 .K ...... 126 .....D...... 156-12 94 .K ...... 129 .....R......
156-13 94 .K ...... 128 ....N....A.. 156-14 94 .K ...... 127
...E.....SM. 156-15 94 .K ...... 130 .T..K....S. 156-16 93 ..
.....T 124 ............ 156-17 92 .. .....T 125 ....SSLW.T.. 6.00E
- 03 156-18 93 .. .....T 125 ....SSLW.T.. 92 TT HGSHDN 124
QSYDRGFTGSRY 103-1 95 .. Q.R... 124 ............ 2.9 .times. 10 - 3
103-2 96 K. R.R... 130 .T..K.....S. 7.3 .times. 10 - 4 1.00E - 09
103-3 97 .. .....K 124 ............ 2.5 .times. 10 - 3 103-6 131
.....D...T.. 4.5 .times. 10 - 4 103-7 98 .. .....D 131 .....D...T..
3.7 .times. 10 - 4 1.40E - 10 1.00E - 09 103-8 99 K. ...... 130
.T..K.....S. 3.3 .times. 10 - 4 6.00E - 11 1.50E - 09 103-14 &
9 100 KT HGSHDN 132 QSYDRGFTGSMV 6.7e - 4 4.00E - 11 1.20E - 09
103-8 & 2 100 KT HGSHDN 133 QTYDKGFTGSSV 5.3e - 4 1.50E - 09
103-4 101 TT HGSHDN 134 QSYDRGFTGARV 1.6e - 4 8.60E - 11 9.00E - 10
103-152 101 TT HGSHDN 135 QSYERGFTGARV 8.60E - 11 102 TT SGSYDY 136
QSYDRGFTGSRVE 170-1 102 .. ...... 137 .........FK.. 2.35E - 03
170-2 102 .. ...... 138 .......VSAY.. 8.80E - 04 170-3 102 ..
...... 139 ......L.VTK.. 1.11E - 03 170-4 102 .. ...... 140
......Y.A.... 8.11E - 04 170-7 102 .. ...... 141 ..........K..
5.30E - 04 170-11 102 .. ...... 142 ......L..F... 4.40E - 04 170-13
102 .. ...... 143 .........YK.. 1.59E - 03 170-15 102 .. ...... 144
......L..Y.L. 4.43E - 03 170-19 103 .. H..H.N 145 ........DYK..
1.00E - 03 170-21 104 .. H..Q.N 146 .........P.L. 3.89E - 03 170-22
102 .. ...... 147 ......L...... 5.60E - 04 170-23 103 .. H..H.N 148
.........A..W 1.00E - 03 2.00E - 10 170-24 104 .. H..Q.N 149
.........Y... 2.80E - 04 5.00E - 10 170-35 105 A. H..Q.N 136
............. 1.00E - 05 170-38 150 .........P... 2.10E - 04 170-39
151 ......M.S.... 2.79E - 03 170-36 83 HGSHDN 152 QSYDRDSTGSRVF
4.00E - 04 2.00E - 10 170-25 106 HGSQDT 153 QSYDSSLRGSRVF 5.00E -
04 5.00E - 11 106 SGSYDY 136 QSYDRGFTGSRVE 73-B1 107 SGSYDY 154
H...SD....... 3.25E - 03 >E - 8 73-B2 107 SGSYDY 155
H.SES........ 2.07E - 03 73-B6 107 SGSYDY 156 H...NR....... 2.51E -
03 >E - 8 73-C1 107 SGSYDY 157 H...SR....... 2.71E - 03 >E -
8 73-C2 107 SGSYDY 158 ....SE....... 3.79E - 03 73-C6 107 SGSYDY
159 ....T........ 3.96E - 03 73-D1 107 SGSYDY 160 H...S........
3.99E - 03 73-D2 107 SSSYDY 161 ....T........ 3.56E - 03 73-D4 107
SGSYDY 162 H...TK....... 5.36E - 03 73-D5 107 SGSYDY 163
H.S.S....,... 3.57E - 03 73-E3 107 SGSYDY 164 ....SD....... 4.98E -
03 73-E6 107 SGSYDY 165 H..ES........ 4.17E - 03 73-F3 107 SGSYDY
166 ....APWS..... 7.08E - 03 73-F5 107 SGSYDY 167 ...DSD....K..
3.74E - 03 73-G2 107 SGSYDY 168 HTN.S........ 3.98E - 03 73-G3 107
SGSYDY 169 H...TR....... 3.50E - 03 73-G4 107 SGSYDY 170
....MR....... 6.58E - 03 73-G5 107 SGSYDY 171 H.S.SDS...... 6.01E -
03 73-G6 107 SGSYDY 172 ...NTD....... 6.30E - 03 73-H2 107 SGSYDY
173 ....S........ 5.93E - 03 73-F6 107 SGSYDY 174 H...M........
5.87E - 03 73-H3 107 SGSYDY 175 H...N........ 6.85E - 03
73-C5 107 SGSYDY 176 H.H..D....... 4.84E - 03 73-B7 108 HGSQDN 177
QSYDSSLRGSRV 2.50E - 03 7.00E - 09 136 QSYDRGFTGSRVF M2 A2 83
HGSHDN 178 ......IH..... 4.00E - 02 M2 A4 83 HGSHDN 179
....S..P..... 8.49E - 03 M2 A5 83 HGSHDN 180 ....I.S...... 4.01E -
02 M2 B1 83 HGSHDN 181 ....S.L...... 7.97E - 03 M2 B3 83 HGSHDN 182
....I.M...... 4.60E - 02 M2 B4 83 HGSHDN 183 ....I.L...... 4.42E -
02 M2 B5 83 HGSHDN 184 ....S.V...... 8.38E - 03 M2 B6 83 HGSHDN 185
......L.A.... 2.81E - 02 M2 C2 83 HGSHDN 181 ....S.L...... 4.85E -
02 M2 C3 83 HGSHDN 186 ....T.L...... 4.62E - 02 M2 C4 83 HGSHDN 181
....S.L...... 8.16E - 03 M2 C5 83 HGSHDN 187 ....TAL...... 4.71E -
02 M2 D1 83 HGSHDN 188 ....IR....... 3.71E - 02 M2 D2 83 HGSHDN 189
....IRS...... 3.85E - 02 M2 D3 83 HGSHDN 190 ....NRL...... 3.33E -
02 M2 D4 83 HGSHDN 191 ...ETS....... 5.81E - 02 M2 D5 83 HGSHDN 192
....SSS...... 5.18E - 02 M2 D6 83 HGSHDN 193 ....S...A.... 5.01E -
02 M2 E1 83 HGSHDN 194 .T..K.....S.. 5.32E - 02 M2 E2 83 HGSHDN 195
....N........ 4.77E - 02 M2 E6 83 HGSHDN 196 ....T...K.... 9.77E -
03 M2 F1 83 HGSHDN 197 ....SDV...... 6.16E - 02 M2 H5 83 HGSHDN 198
....A........ 9.90E - 03 124 QSYDRGFTGSKY A5 83 HGSHDN 199
......THPSML 1.12E - 03 A12 83 HGSHDN 200 ......TTPRPM 1.43E - 03
A4 83 HGSHDN 201 ......RNPALT 1.47E - 03 A6 83 HGSHDN 202
......THPWLH 1.87E - 03 A10 83 HGSHDN 203 ......NSPATV 1.87E - 03
A11 83 HGSHDN 204 ......TFPSPQ 2.07E - 03 C2 83 HGSHDN 205
......LNPSAT 2.23E - 03 A8 83 HGSHDN 206 ......KSNKML 2.37E - 03 B8
83 HGSHDN 207 ......HTAHLY 2.40E - 03 C6 83 HGSHDN 208 ......QTPSIT
2.42E - 03 A3 83 HGSHDN 209 ......YPRNIL 2.51E - 03 B11 83 HGSHDN
210 ......ITPGLA 2.95E - 03 B5 83 HGSHDN 211 ......QPHAVL 3.04E -
03 C10 83 HGSHDN 212 ......NSPIPT 3.10E - 03 C4 83 HGSHDN 213
......TPNNSF 3.23E - 03 C3 83 HGSHDN 214 ....S.VDPGPY 3.34E - 03 B2
83 HGSHDN 215 ......RPRHAL 3.61E - 03 A2 83 HGSHDN 216 ......PYHPIR
3.80E - 03 C5 83 HGSHDN 217 ......PRTQPT 3.91E - 03 A7 83 HGSHDN
218 ......HNNFSP 3.95E - 03 C9 83 HGSHDN 219 ......PTHLPH 3.97E -
03 B3 83 HGSHDN 220 ......TPSYPT 4.12E - 03 C8 83 HGSHDN 221
....S.TSNLLP 5.36E - 03 B7 83 HGSHDN 222 ......DSNHDL 5.45E - 03 A1
83 HGSHDN 223 ......LPRLTH 5.66E - 03 C7 83 HGSHDN 224 ......IPTSYL
5.83E - 03 C @ 83 HGSHDN 225 ......LRVQAP 5.85E - 03 B10 83 HGSHDN
226 ......LSDSPL 6.04E - 03 B6 83 HGSHDN 227 ....S.SLRRIL 7.58E -
03 A9 83 HGSHDN 228 ......PARTSP 7.98E - 03 B9 83 HGSHDN 229
......RAAHPQ 8.66E - 03 124 QSYDRGFTGSRY 177-D7 83 HGSHDN 230
......TQPABI 4.07E - 04 177-G6 83 HGSHDN 231 ......THPTMI 5.50E -
04 177-D9 83 HGSHDN 232 ......RIPABT 6.32E - 04 177-C6 83 HGSHDN
233 ......THPVPA 7.94E - 04 177-H5 83 HGSHDN 234 ......SBPIPA 1.32E
- 03 177-H9 83 HGSHDN 235 ......THPVPA 1.58E - 03 177-H10 83 HGSHDN
236 ......THPTMY 3.44E - 03 144-F1 83 HGSHDN 237 ......HHYTTF 5.80E
- 04 43-E3 83 HGSHDN 238 ......SHPAAE 8.00E - 04 43-E9 83 HGSHDN
239 ......TIPSIE 8.00E - 04 43-G2 83 HGSHDN 240 ......SSPAIM 7.00E
- 04 43-G3 83 HGSHDN 241 ......IWPNLN 9.00E - 04 31-A6 83 HGSHDN
242 ......THPNLN 5.00E - 04 31-B5 83 HGSHDN 243 ......THPSIS 5.00E
- 04 124 QSYDRGFTGSRY Y17 83 HGSHDN 244 QSYDRGSAPMIN 8.90E - 05
4.50E - 10 >1E - 8 Y19 83 HGSHDN 245 QSYDRGHHPAMS 2.26E - 04
3.00E - 11 >1E - 8 Y38 83 HGSHDN 246 ......THPSIT 5.08E - 04
5.50E - 11 2.60E - 09 Y45 83 HGSHDN 247 ......TDPAIV 6.17E - 04
4.00E - 11 4.30E - 09 Y61 83 HGSHDN 248 ......THPALL 2.75e - 4 4E -
11 1.40E - 10 Y61 IgG 83 HGSHDN 248 ......THPALL 1.50E - 04 1.60E -
11 1.30E - 10 Y61 IgG 83 HGSHDN 248 ......THPALL 1.50E - 04 1.60E -
11 1.30E - 10 1.60E - 10 germline Y139 83 HGSHDN 249 ......SHPALT
5.92E - 04 3E - 11 4.50E - 10 Y139 IgG1 83 HGSHDN 249 ......SHPALT
1.00E - 09 Y174 83 HGSHDN 250 ......TTPAPE 7.55E - 04 6E - 11 2.00E
- 09 Y177 83 HGSHDN 251 ......SHPTLI 6.61E - 04 5E - 11 1.00E - 09
A5 83 HGSHDN 252 ......THPSML 4.50E - 04 6.60E - 11 A12 83 HGSHDN
253 ......TTPRPM 5.57E - 04 2.50E - 10 D9 83 HGSHDN 254
......RLPAQT 8.21E - 04 3.5E - 09 >> G6 83 HGSHDN 255
......THPLTI 5.08E - 04 1E - 10 1.00E - 09 G6 IgG1 83 HGSHDN 255
......THPLTI 1.00E - 09 C6 83 HGSHDN 256 QSYDRGQTPSIT 1.07E - 03
3.5E - 10 1.00E - 08 Y55 83 HGSHDN 257 QSYDRGTHFQMY 1.06E - 03
1.40E - 10 >1E - 8 A4 83 HGSHDN 258 QSYDRGRNPALT 6.30E - 04
2.50E - 10 AO3 83 HGSHDN 259 QSYDRGTHPLTM 3.04E - 04 3.00E - 11
4.00E - 10 AO3 IgG1 83 HGSHDN 260 QSYDRGTHPLTM 3.04e - 4 2.90E - 11
3.80E - 10 AO3 IgG 83 HGSHDN 260 QSYDRGTHPLTM 2.50E - 04 3.50E - 11
1.75E - 10 germline 99-B11 83 HGSHDN 261 QSYDSGYTGSRV 5.40E - 03
99-C11 83 HGSHDN 262 QSYDSGFTGSRV 5.70E - 03 99-H4 83 HGSHDN 263
QSYDSRFTGSRV 4.80E - 03 99-E9 83 HGSHDN 262 QSYDSGFTGSRV 5.40E - 03
99-H7 83 HGSHDN 264 QSYPDGTPASRV 3.30E - 03 99-H11 83 HGSHDN 265
QSYSTHMPISRV 4.90E - 03 99-F6 83 HGSHDN 266 QSYDSGSTGSRV 4.90E - 03
99-F7 83 HGSHDN 267 QSYPNSYPISRV 4.80E - 03 99-F8 83 HGSHDN 268
QSYIRAPQQV 3.70E - 03 99-F11 83 HGSHDN 262 QSYDSGFTGSRV 5.40E - 03
99-G7 83 HGSHDN 269 QSYLKSRAFSRV 4.80E - 03 99-G11 83 HGSHDN 270
QSYDSRFTGSRV 4.30E - 03 124 QSYDRGFTGSRY L3.3R3M-B1 83 HGSHDN 271
......FTGSMV 5.46E + 00 L3.3R3M-B3 83 HGSHDN 272 ......FTGSMV 5.51E
+ 00 L3.3R3M-C6 83 HGSHDN 273 ......FTGFDG 6.17E + 00 L3.3R3M-F9 83
HGSHDN 274 ......TAPALS 4.99E + 00 L3.3R3M-G8 83 HGSHDN 275
......SYPALR 5.55E + 00 L3.3R3M-H6 83 HGSHDN 276 ......NWPNSN 5.69E
+ 00 L3.3R3M-H10 83 HGSHDN 277 ......TAPSLL 5.35E + 00 L3.3R3M-A3
83 HGSHDN 278 ......FTGSMV 5.37E + 00 L3.3R3M-F8 83 HGSHDN 279
......TTPRIR 4.99E + 00 L3.3R3M-G1 83 HGSHDN 280 ......FTGSMV 4.21E
+ 00 L3.3R3M-G7 83 HGSHDN 281 ......FTGSMV 4.24E + 00 L3.3R3M-H11
83 HGSHDN 282 ......MIPALT 3.95E + 00 Y61-L94N 109 CKT HGSHDN 283
QSYDRNTHPALL 8.00E - 11 Y61-L94F 109 CKT HGSHDN 284 QSYDRFTHPALL
6.00E - 11 Y61-L94Y 109 CKT HGSHDN 285 QSYDRYTHPALL 2.00E - 11
2.00E - 11
Y61-L94Y 109 CKT HGSHDN 285 QSYDRYTHPALL 1.27E - 04 6.00E - 11
5.00E - 11 4.00E - 11 IgG Y61-L50Y 109 CKT HGSHDN 286 QSYDRGTHPALL
2.00E - 11 2.00E - 11 Y61-L50Y* 109 CKT HGSHDN 286 QSYDRGTHPALL
6.98E - 05 2.00E - 11 3.00E - 11 IgG Y61-L50Y- 109 CKT HGSHDN 286
QSYDRGTHPALL 2.99E - 05 6.00E - 11 2.00E - 11 H31E** IgG Y61-L50Y-
109 CKT HGSHDN 287 QSYDRYTHPALL 4.64E - 05 1.00E - 11 1.00E - 11
H31E-L94Y** IgG J695 (Y61- 109 CKT HGSHDN 287 QSYDRYTHPALL 5.14E -
05 5.00E - 11 1.00E - 11 5.00E - 12 L94Y-L50Y IgG*) *CDR L2: L50G
to Y **CDR L2: L50G to Y; CDR H1: H31S to E
TABLE-US-00004 TABLE 3 CDR H1 CDR H2 Kabat Number 27 28 29 30 31 32
33 34 35 50 51 52 52A 53 54 55 Y61 VH F T F S S Y G M H F I R Y D G
S Contact Positions x x x x x x x x x x Hypermutation Positions x x
x x CDR H2 CDR H3 Kabat Number 56 57 58 59 60 61 62 63 64 65 95 96
97 98 101 102 Y61 VH N K Y Y A D S V K G H G S H D N Contact
Positions x x x x x x x Hypermutation Positions x x CDR L1 CDR L2
Kabat number 24 25 26 27 27A 27B 28 29 30 31 32 33 34 50 51 52 Y61
VL S G G R S N I G S N T V K G N D Contact Positions x x x x x x
Hypermutation Positions x x x CDR L2 CDR L3 Kabat number 53 54 55
56 89 90 91 92 93 94 95 95A 95B 95C 96 97 Y61 VL Q R P S Q S Y D R
G T H P A L L Contact Positions x x x x x x x Hypermutation
Positions x x x contact and/or hypermutation position x contact
and/or hypermutation position mutated in Y61
TABLE-US-00005 TABLE 4 Neutralization Activity in the Presence of
Excess Free IL-12 p40 PHA assay PHA assay PHA assay IC50 IC50 (M)
IC50 (M) SEQ ID NO: Clone (M) p70:p40 1:0 p70:p40 1:20 p70:p40 1:50
VH: 47 136-15 2.00E-09 5.00E-09 4.00E-09 VL: 48 VH: 51 149-5
6.50E-09 7.00E-09 4.00E-09 VL: 52 VH: 53 149-6 9.00E-10 1.00E-09
1.00E-09 VL: 54 VH: 84 149-7 3.50E-09 2.50E-09 4.00E-09 VL: 126 VH:
23 Y61 IgG 1.80E-10 1.80E-10 VL: 24 VH: 65 AO3 IgG1 2.50E-10
2.20E-10 VL: 66 VH: 31 J695 1.00E-11 3.50E-11 VL: 32
EXAMPLES
Example 1
Isolation of Anti-IL-12 Antibodies
A. Screening for IL-12 Binding Antibodies
[0616] Antibodies to hIL-12 were isolated by screening three
separate scFv phage display libraries prepared using human VL and
VH cDNAs from mRNA derived from human tonsils (referred to as scFv
1), tonsil and peripheral blood lymphocytes (PBL) (referred to as
scFv 2), and bone marrow-derived lymphocytes (referred to as BMDL).
Construction of the library and methods for selection are described
in Vaughan et al. (1996) Nature Biotech. 14: 309-314.
[0617] The libraries were screened using the antigens, human IL-12
p70 subunit, human IL-12 p40 subunit, chimaeric IL-12 (mouse
p40/human p35), mouse IL-12, biotinylated human IL-12 and
biotinylated chimaeric IL-12. IL-12 specific antibodies were
selected by coating the antigen onto immunotubes using standard
procedures (Marks et al., (1991) J. Mol. Biol. 222: 581-597). The
scFv library 2 was screened using either IL-12, or
biotinylated-IL-12, and generated a significant number of IL-12
specific binders. Five different clonotypes were selected,
determined by BstN1 enzymatic digestion patterns, and confirmed by
DNA sequencing. The main clonotypes were VHDP58/VLDPL11,
VHDP77/VLDPK31, VHDP47/VL and VHDP77/VLDPK31, all of which
recognized the p40 subunit of IL-12.
[0618] Screening of the BMDL library with IL-12 p70 generated 3
different clonotypes. Two of these were found to be cross-reactive
clones. The dominant clone was sequenced and consisted of
VHDP35/VLDP. This clone recognizes the p40 subunit of IL-12.
Screening of the scFv library 1, using IL-12 p70, did not produce
specific IL-12 antibodies.
[0619] In order to identify IL-12 antibodies which preferentially
bind to the p70 heterodimer or the p35 subunit of IL-12, rather
than the p40 subunit, the combined scFv 1+2 library, and the BMDL
library were used. To select IL-12 antibodies that recognized the
p70 heterodimer or p35 subunit, phage libraries were preincubated
and selected in the presence of free p40. Sequencing of isolated
clones revealed 9 different antibody lineages. Subunit preferences
were further analyzed by `micro-Friguet` titration. The supernatant
containing scFv was titrated on biotin-captured IL-12 in an ELISA
and the ED.sub.50 determined. The concentration of scFv producing
50% ED was preincubated with increasing concentrations of free p70
or p40 (inhibitors). A decrease in the ELISA signal on biotin-IL-12
coated plates was measured and plotted against the concentration of
free p70 or p40. This provided the IC.sub.50 for each clone with
respect to p70 and p40. If the titrations for both subunits
overlaps, then the scFv binds to both p40 and p70. Any variation
from this gives the degree of preference of p70 over p40.
B. Affinity Maturation of Antibody Lineage Specific for IL-12 (Joe
9)
[0620] The clones were tested for their ability to inhibit IL-12
binding to its receptor in an IL-12 receptor binding assay
(referred to as RBA), and for their ability to inhibit IL-12
induced proliferation of PHA stimulated human blast cells (PHA
assay), described in Example 3. Clone Joe 9 had the lowest
IC.sub.50 value in both the RBA and the PHA assay, with an
IC.sub.50 value of 1.times.10.sup.-6 M in both assays. In addition
the heavy chain variable region (VH) of Joe 9 had the least number
of changes compared to the closest germline sequence COS-3,
identified from the VBASE database. Table 1 (see Appendix A) shows
the V.sub.H3 family of germline sequences, of which COS-3 is a
member, as well as members of V.sub..lamda.1 family of germline
sequences. Therefore, Joe 9 was selected for affinity maturation.
The amino acids sequences of VH and VL of the Joe9 wild type (Joe9
wt) antibody are shown in FIG. 1A-1D.
[0621] In order to increase the affinity of Joe 9, various
mutations of the complementarity determining region 3 (CDR3) of
both the heavy and light chains were made. The CDR3 variants were
created by site-directed PCR mutagenesis using degenerate
oligonucleotides specific for either the heavy chain CDR3 (referred
to as "H3") or the light chain CDR3 (referred to as "L3"), with an
average of three base substitutions in each CDR3 (referred to as
"spike"). PCR mutagenesis of the heavy chain CDR3 was performed
using the degenerate heavy chain oligonucleotide containing a
random mixture of all four nucleotides, 5'
TGTCCCTTGGCCCCA(G)(T)(A)(G)(T)(C)(A)(T)(A)(G)(C)(T)(C)(C)(C)(A)(C)(T)
GGTCGTACAGTAATA 3' (SEQ ID NO: 580), and oligonucleotide pUC
Reverse Tag GAC ACC TCG ATC AGC GGA TAA CAA TTTCAC ACA GG (SEQ ID
NO: 581) to generate a repertoire of heavy chain CDR3 mutants. The
parent light chain was amplified using Joe 9 reverse
oligonucleotide (5'TGG GGC CAA GGG ACA3' (SEQ ID NO:582) and the
fdteteseq 24+21 oligonucleotide (5'-ATT CGT CCT ATA CCG TTC TAC TTT
GTC GTC TTT CCA GAC GTT AGT-3' (SEQ ID NO: 583).
[0622] Complementarity between the two PCR products was used to
drive annealing of the two fragments in a PCR assembly reaction and
the full length recombined scFv library was amplified with pUC
Reverse Tag (SEQ ID NO: 581) and fdTag 5'-ATT CGT CCT ATA CCG
TTC-3' (SEQ ID NO: 584). PCR mutagenesis of the light chain was
performed using the light chain oligonucleotide containing a
mixture of all four nucleotides
5'GGTCCCAGTTCCGAAGACCCTCGAACC(C)(C)(T)(C)(A)(G)(G)(C)(T)
(G)(C)(T)(G)(T)(C)ATATGACTGGCAGTAATAGTCAGC 3' (SEQ ID NO: 585), and
Joe 9 reverse oligonucleotide 5'TGG GGC CAA GGG ACA3' (SEQ ID NO:
586) to produce a repertoire of light chain CDR3 mutants. The
parent heavy chain was amplified with pUC Reverse Tag (SEQ ID NO:
581) and HuJH3FOR oligonucleotide 5'TGAAGAGACGGTGACCATTGTCCC3' (SEQ
ID NO: 587). Complementarity between the two PCR products was used
to drive annealing of the two fragments in a PCR assembly reaction
and the full length recombined scFv library was amplified with
Reverse Tag GAC ACC TCG ATC AGC G (SEQ ID NO: 588) and HuJ.lamda.
2-3 FOR NOT oligonucleotide 5'GAG TCA TTC TCG ACT TGC GGC CGC ACC
TAG GAC GGT CAG CTT GGT CCC 3' (SEQ ID NO: 589).
[0623] Heavy chain CDR3 mutants were selected using 1 nM
biotinylated IL-12, and washed for 1 h at room temperature in PBS
containing free IL-12 or p40 at a concentration of 7 nM. Clones
were analyzed by phage ELISA and those that bound to IL-12 were
tested in BIAcore kinetic binding studies using a low density IL-12
chip (see procedure for BIAcore analysis in Example 5). Generally,
BIAcore analysis measures real-time binding interactions between
ligand (recombinant human IL-12 immobilized on a biosensor matrix)
and analyte (antibodies in solution) by surface plasmon resonance
(SPR) using the BIAcore system (Pharmacia Biosensor, Piscataway,
N.J.). The system utilizes the optical properties of SPR to detect
alterations in protein concentrations within a dextran biosensor
matrix. Proteins are covalently bound to the dextran matrix at
known concentrations. Antibodies are injected through the dextran
matrix and specific binding between injected antibodies and
immobilized ligand results in an increased matrix protein
concentration and resultant change in the SPR signal. These changes
in SPR signal are recorded as resonance units (RU) and are
displayed with respect to time along the y-axis of a sensorgram. To
determine the off rate (k.sub.off), on rate (k.sub.on), association
rate (Ka) and dissociation rate (Kd) constants, BIAcore kinetic
evaluation software (version 2.1) was used. Clones that
demonstrated an improvement in the k.sub.off rate were analyzed by
neutralization assays which included inhibition by antibody of
IL-12 binding to its receptor (RBA assay), inhibition of
IL-12-induced proliferation in PHA stimulated human blast cells
(PHA assay), and inhibition of IL-12-induced interferon gamma
production by human blast cells (IFN gamma assay). A summary of the
dissociation rates and/or IC.sub.50 values from neutralization
assays of heavy chain CDR3 spiked clones 70-1 through 70-13 is
presented in Table 2 (see Appendix A). Clone 70-1 displayed a
k.sub.off rate that was better than the parent Joe 9 clone, and had
the lowest IC.sub.50 value of 2.0.times.10.sup.-7 M. Therefore
clone 70-1 was selected for conversion to complete IgG1.
[0624] Light chain CDR3 mutants were selected using 1 nM
biotin-IL-12 and washed with PBS containing 7 nM free p40. Clones
were screened in phage ELISA and those that bound to IL-12 were
tested in BIAcore binding analysis using low density IL-12 chips.
Clones that displayed an off rate which was better than the parent
Joe 9 clone were tested in neutralization assays which measured
either, inhibition of IL-12 receptor binding, or inhibition of PHA
blast cell proliferation. A summary of the dissociation rates
and/or IC.sub.50 values from neutralization assays of light chain
CDR3 mutant clones, 78-34 through 79-1, is presented in Table 2
(see Appendix A).
[0625] Based on the k.sub.off rate, clones 78-34 and 78-35
displayed an improved k.sub.off rate compared to the parent Joe 9.
Both of these clones were selected for combination analysis with
heavy chain mutants.
C. Combination Clones
[0626] Mutant light and heavy chain clones that exhibited the best
binding characteristics were used for combination and assembly of
scFvs. Mutant clones with improved potency characteristics were
combined by PCR overlap extension and pull-through of the mutated
VH and VL segments as described above. Clones 101-14 through 26-1,
shown in Table 2 (see Appendix A), were produced from the
combination of heavy chain mutants (70-2, 70-13 and 70-1) with
light chain mutants (78-34, 78-35 and 79-1). The k.sub.off rates
and/or IC.sub.50 values from neutralization assays for these clones
are presented in Table 2.
[0627] BIAcore binding analysis identified clone 101-11, produced
from the combination of the heavy chain CDR3 mutant clone 70-1 with
the light chain CDR3 mutant clone 78-34, as having an off rate of
0.0045 s.sup.-1. This k.sub.off rate was a significant improvement
compared to the k.sub.off rates for either the heavy chain CDR3
mutant clone 70-1 (0.0134 s.sup.-1), or for the light chain CDR3
mutant clone 78-34 (0.0164 s.sup.-1) alone. Furthermore, clone
101-11 showed a significant improvement in neutralization assays.
Accordingly, clone 101-11 was selected for affinity maturation as
described below.
D. Affinity Maturation of Clone 101-11
[0628] Further affinity maturation of clone 101-11 consisted of
repeat cycles of PCR mutagenesis of both the heavy and light chain
CDR3s of 101-11 using spiked oligonucleotide primers. The clones
were selected with decreasing concentrations of biotinylated IL-12
(bio-IL-12). The binding characteristics of the mutated clones was
assessed by BIAcore binding analysis and RBA, PHA neutralization
assays. The k.sub.off rates and/or IC.sub.50 values for clones
136-9 through 170-25 are presented in Table 2 (see Appendix A).
Clone 103-14 demonstrated an improved IC.sub.50 value in both the
receptor binding assay and the PHA blast assay. Clone 103-14 also
demonstrated a low k.sub.off rate, and accordingly was selected for
further affinity maturation.
E. Generation and Selection of Randomized Libraries of Clone 103-14
Light CDR3
[0629] The light chain CDR3 of clone 103-14 (QSYDRGFTGSMV (SEQ ID
NO: 590)) was systematically randomized in 3 segments using 3
different libraries as outlined below, where X is encoded by a
randomized codon of sequence NNS with N being any nucleotide and S
being either deoxycytosine or deoxyguanidine.
TABLE-US-00006 L3.1 = XXXXXXFTGSMV (SEQ ID NO: 591) L3.2 =
QSYXXXXXXSMV (SEQ ID NO: 592) L3.3 = QSYDRGXXXXXX (SEQ ID NO:
593)
[0630] Randomized mutagenesis of all three light chain CDRs
(referred to as L3.1, L3.2, and L3.3) of clone 103-14 was
performed. The heavy chain CDR3 (referred to as H3) of clone 103-14
was not mutated. Four randomized libraries based on clone 103-14
(H3 and L3.1, L3.2 & L3.3) were constructed and subjected to a
large variety of selection conditions that involved using limiting
antigen concentration and the presence or absence of excess free
antigen (p40 and p70). The outputs from selections (clones 73-BI
through 99-G11) were screened primarily by BIAcore, and on occasion
with RBA and are shown in Table 2 (see Appendix A).
[0631] Random mutagenesis of the light chain CDR of 103-14
generated clone Y61, which exhibited a significant improvement in
IC.sub.50 value compared to the parent clone 103-14. Y61 was
selected for conversion to a whole IgG1. Whole Y61-IgG1 has an
IC.sub.50 value of approximately 130 pM determined by the PHA
assay. The IC.sub.50 value was not affected by a 50 fold molar
excess of free p40, demonstrating that free p40 did not cross-react
with Y61 anti-IL-12 antibody to thereby decrease the antibody
binding to the heterodimer. The full length sequences of Y61 heavy
chain variable region and light chain variable region are shown
below.
TABLE-US-00007 Y61 Heavy Chain Variable Region Peptide Sequence
(SEQ ID NO: 23) CDR H1 QVQLVESGGGVVQPGRSLRLSCAASFTFS SYGMH
WVRQAPGKGLEWVA CDR H2 FIRYDGSNKYYADSVKG
RFTISRDNSKNTLYLQMNSLRAEDTAVYYCKT CDR H3 HGSHDN WGQGTMVTVSS Y61
Light Chain Variable Region Peptide Sequence (SEQ ID NO: 24) CDR L1
QSVLTQPPSVSGAPGQRVTISC SGGRSNIGSNTVK WYQQLPGTAPKLL CDR L2 IYGNDQRPS
GVPDRFSGSKSGTSASLAITGLQAEDEADYYC CDR L3 QSYDRGTHPALL
FGTGTKVTVLG
CDR residues are assigned according to the Kabat definitions.
Example 2
Mutation of Y61 at Hypermutation and Contact Positions
[0632] Typically selection of recombinant antibodies with improved
affinities can be carried out using phage display methods. This is
accomplished by randomly mutating combinations of CDR residues to
generate large libraries containing single-chain antibodies of
different sequences. Typically, antibodies with improved affinities
are selected based on their ability to reach an equilibrium in an
antibody-antigen reaction. However, when Y61 scFV was expressed on
phage surface and incubated with IL-12, selection conditions could
not be found that would allow the system to reach normal
antibody-antigen equilibrium. The scFV-phage remained bound to
IL-12, presumably due to a non-specific interaction, since purified
Y61 scFv exhibits normal dissociation kinetics. Since the usual
methods of phage-display affinity maturation to Y61 (i.e. library
generation and selections by mutagenesis of multiple CDR residues)
could not be utilized, a new strategy was developed in which
individual CDR positions were mutated.
[0633] This strategy involves selection of appropriate CDR
positions for mutation and is based on identification and selection
of amino acids that are preferred selective mutagenesis positions,
contact positions, and/or hypermutation positions. Contact
positions are defined as residues that have a high probability of
contact with an antigen when the antigen interacts with the
antibody, while hypermutation positions are defined as residues
considered to have a high probability for somatic hypermutation
during in vivo affinity maturation of the antibody. Preferred
selective mutagenesis positions are CDR positions that are both
contact and hypermutation positions. The Y61 antibody was already
optimized in the CDR3 regions using the procedure described in
Example 1, therefore it was difficult to further improve the area
which lies at the center of the antibody binding site using
phage-display selection methods. Greater improvements in activity
were obtained by mutation of potential contact positions outside
the CDR3 regions by either removing a detrimental antigen-antibody
contact or, engineering a new contact.
[0634] Amino acids residues of Y61 which were considered contact
points with antigen, and those CDR positions which are sites of
somatic hypermutations during in vivo affinity maturation, are
shown in Table 3 (see Appendix A). For Y61 affinity maturation, 15
residues outside CDR3, 3 residues within the L3 loop, and 5
residues in the H3 loop were selected for PCR mutagenesis.
[0635] Y61 scFv gene was cloned into the pUC119(Sfi) plasmid vector
for mutagenesis. Oligonucleotides were designed and synthesized
with randomized codons to mutate each selected position. Following
PCR mutagenesis, a small number of clones (.about.24) were
sequenced and expressed in a host cell, for example, in a
bacterial, yeast or mammalian host cell. The expressed antibody was
purified and the k.sub.off measured using the BIAcore system.
Clones with improved off-rates, as compared to Y61, were then
tested in neutralization assays. This procedure was repeated for
other CDR positions. Individual mutations shown to have improved
neutralization activity were combined to generate an antibody with
even greater neutralization potency.
[0636] The Y61 CDR positions that were mutated in order to improve
neutralization potency, and the respective amino-acid substitutions
at each position are shown in FIGS. 2A-2H. Off-rates, as determined
by BIAcore analysis, are given. These off rates are also shown in
the histograms to the right of each table.
[0637] Results of these substitutions at positions H30, H32, H33,
H50, H53, H54, H58, H95, H97, H101, L50, L92, L93, demonstrated
that all amino-acid substitutions examined resulted in antibodies
with poorer off-rates than Y61. At positions H52, L32, and L50,
only a one amino acid substitution was found to improve the
off-rate of Y61, all other changes adversely affected activity. For
L50, this single Gly.fwdarw.Tyr change significantly (5-10 times)
improved the neutralization potency of Y61. The results
demonstrated the importance of these positions to Y61 activity, and
suggest that in most cases phage-display was able to select for the
optimal residues. However, at positions H31, H56, L30, and L94,
several substitutions were found to improve Y61 off-rate,
suggesting that these positions were also important for antigen
binding, although the phage display approach did not allow
selection of the optimal residues.
[0638] Selective mutation of contact and hypermutation positions of
Y61 identified amino acid residue L50 in the light chain CDR2, and
residue L94 of the light chain CDR3, which improved the
neutralization ability of Y61. A combination of these mutations
produced an additive effect, generating an antibody, J695, that
exhibited a significant increase in neutralization ability. The
full length sequence of J695 heavy and light chain variable region
sequences is shown below.
TABLE-US-00008 J695 Heavy Chain Variable Region Peptide Sequence
(SEQ ID NO: 31) CDR H1 QVQLVESGGGVVQPGRSLRLSCAASGFTFS SYGMH
WVRQAPGKGLEWV CDR H2 AFIRYDGSNKYYADSVKG
RFTISRDNSKNTLYLQMNSLRAEDTAVYYCK CDR H3 THGSHDN WGQGTMVTVSS J695
Light Chain Variable Region Peptide Sequence (SEQ ID NO: 32) CDR L1
QSVLTQPPSVSGAPGQRVTISC SGSRSNIGSNTVK WYQQLPGTAPKLL CDR L2 IYYNDQRPS
GVPDRFSGSKSGTSASLAITGLQAEDEADYYC CDR L3 QSYDRYTHPALL
FGTGTKVTVLG
CDR residues are assigned according to the Kabat definitions.
[0639] A summary of the heavy and light chain variable region
sequence alignments showing the lineage development of clones that
were on the path from Joe9 to J695 is shown in FIGS. 1A-1D. The
CDRs and residue numbering are according to Kabat.
Example 3
Functional Activity of Anti-hIL-12 Antibodies
[0640] To examine the functional activity of the human anti-human
IL-12 antibodies of the invention, the antibodies were used in
several assays that measure the ability of an antibody to inhibit
IL-12 activity.
A. Preparation of Human PHA-Activated Lymphoblasts
[0641] Human peripheral blood mononuclear cells (PBMC) were
isolated from a leukopac collected from a healthy donor by
Ficoll-Hypaque gradient centrifugation for 45 minutes at 1500 rpm
as described in Current Protocols in Immunology, Unit 7.1. PBMC at
the interface of the aqueous blood solution and the lymphocyte
separation medium were collected and washed three times with
phosphate-buffered saline (PBS) by centrifugation for 15 minutes at
1500 rpm to remove Ficoll-Paque particles.
[0642] The PBMC were then activated to form lymphoblasts as
described in Current Protocols in Immunology, Unit 6.16. The washed
PBMC were resuspended at 0.5-1.times.10.sup.6 cells/ml in RPMI
complete medium (RPMI 1640 medium, 10% fetal bovine serum (FBS),
100 U/ml penicillin, 100 .mu.g/ml streptomycin), supplemented with
0.2% (v/v) PHA-P (Difco, Detroit, Mich.) and cultured for four days
at 37.degree. C. in a 5% CO.sub.2 atmosphere. After four days, cell
cultures were split 1:1 by volume in RPMI complete medium, plus
0.2% (v/v) PHA-P and 50 U/ml recombinant human IL-2. Recombinant
human IL-2 was produced by transfection of an expression vector
carrying the human IL-2 cDNA into COS cells (see Kaufman et al.,
(1991) Nucleic Acids Res. 19, 4484-4490), and purified as described
in PCT/US96/01382. Cell cultures were then incubated for an
additional one to three days. PHA blast cells were harvested,
washed twice with RPMI complete medium and frozen in 95% FBS, 5%
DMSO at 10.times.10.sup.6 cells/ml.
[0643] PHA blast cells to be used for the IL-12 receptor binding
assay (see section B) were collected after one day culture in the
presence of IL-2, whereas PHA blast cells to be used for the PHA
blast proliferation assay (see section C) and the interferon-gamma
induction assay (see section D) were collected after three day
culture in the presence of IL-2.
B. IL-12 Receptor Binding Assay
[0644] The ability of anti-IL-12 antibodies to inhibit binding of
radiolabelled IL-12 to IL-12 receptors on PHA blasts were analyzed
as follows. Various concentrations of anti-IL-12 antibody were
preincubated for 1 hour at 37.degree. C. with 50-100 pM
.sup.125I-hIL-12 (iodinated hIL-12 was prepared using the
Bolton-Hunter labeling method to a specific activity of 20-40
mCi/mg from NEN-Dupont) in binding buffer (RPMI 1640, 5% FBS, 25 mM
Hepes pH 7.4). PHA blast cells isolated as described above, were
washed once and resuspended in binding buffer to a cell density of
2.times.10.sup.7 cells/ml. PHA blasts (1.times.10.sup.6 cells) were
added to the antibody 1-hIL-12 mixture and incubated for two hours
at room temperature. Cell bound radioactivity was separated from
free 1-hIL-12 by centrifugation of the assay mixture for 30 seconds
at room temperature, aspiration of the liquid and a wash with 0.1
ml binding buffer, followed by centrifugation at 4.degree. C. for 4
min at 10,000.times.g. The cell pellet was examined for cell bound
radioactivity using a gamma counter. Total binding was determined
in the absence of antibody and non-specific binding was determined
by inclusion of 25 nM unlabeled IL-12 in the assay. Incubations
were carried out in duplicate.
[0645] In the IL-12 receptor binding assay using the Y61 and J695
human anti-IL-12 antibodies, both antibodies demonstrated a
comparable inhibition of IL-12 receptor binding. Y61 inhibited
IL-12 receptor binding with an IC.sub.50 value of approximately
1.6.times.10.sup.-11M, while J695 had an IC.sub.50 value of
approximately 1.1.times.10.sup.-11M.
C. Human PHA Blast Proliferation Assay
[0646] Anti-IL-12 antibodies were evaluated for their ability to
inhibit PHA blast proliferation (which proliferation is stimulated
by IL-12). Serial dilutions of anti-IL-12 antibody were
preincubated for 1 hour at 37.degree. C., 5% CO.sub.2 with 230
pg/ml hIL-12 in 100 ml RPMI complete medium in a microtiter plate
(U-bottom, 96-well, Costar, Cambridge, Mass.). PHA blast cells
isolated as described above, were washed once and resuspended in
RPMI complete medium to a cell density of 3.times.10.sup.5
cells/ml. PHA blasts (100 ml, 3.times.10.sup.4 cells) were added to
the antibody/hIL-12 mixture, incubated for 3 days at 37.degree. C.,
5% CO.sub.2 and labeled for 4-6 hours with 0.5 mCi/well
(3H)-Thymidine (Amersham, Arlington Heights, Ill.). The culture
contents were harvested onto glass fiber filters by means of a cell
harvester (Tomtec, Orange, Conn.) and (3H)-Thymidine incorporation
into cellular DNA was measured by liquid scintillation counting.
All samples were assayed in duplicate.
[0647] The results of neutralization in the presence of varying
concentrations of p70:p40 (i.e. the ratio of IL-12 heterodimer to
free p40 subunit) is shown in Table 4 (see Appendix A).
[0648] Analysis of the Y61 human anti-IL-12 antibody in the PHA
blast proliferation assay demonstrated that the antibody inhibited
PHA blast proliferation with an IC.sub.50 value of approximately
1.8.times.10.sup.-10 M in the presence of IL-12 p70 alone, without
any excess p40 (p70:p40 ratio of 1:0). In the presence of a 50-fold
excess of free p40 (p70:p40 at a ratio of 1:50), the Y61 antibody
inhibited PHA blast proliferation with an IC.sub.50 value of
approximately 1.8.times.10.sup.-10M. This result demonstrates that
the ability of Y61 to inhibit blast proliferation is not
compromised by the presence of excess p40.
[0649] The human anti-IL-12 antibody, J695 inhibited PHA blast
proliferation with an IC.sub.50 value of approximately
1.0.times.10.sup.-11M in the presence of p70:p40 at a ratio of 1:0.
In the presence of a p70:p40 ratio of 1:50, this antibody inhibited
PHA blast proliferation with an IC.sub.50 value of approximately
5.8.+-.2.8.times.10.sup.-12 M (n=2), demonstrating that the excess
p40 had only a slight inhibitory effect on the antibody. Overall
results demonstrate the improved neutralization activity of J695 in
comparison with Y61 due to the mutations at L50 and L94.
D. Interferon-Gamma Induction Assay
[0650] The ability of anti-IL-12 antibodies to inhibit the
production of IFN.gamma. by PHA blasts (which production is
stimulated by IL-12) was analyzed as follows. Various
concentrations of anti-IL-12 antibody were preincubated for 1 hour
at 37.degree. C., 5% CO.sub.2 with 200-400 pg/ml hIL-12 in 100 ml
RPMI complete medium in a microtiter plate (U-bottom, 96-well,
Costar). PHA blast cells isolated as described above, were washed
once and resuspended in RPMI complete medium to a cell density of
1.times.07 cells/ml. PHA blasts (100 .mu.l of 1.times.10.sup.6
cells) were added to the antibody/hIL-12 mixture and incubated for
18 hours at 37.degree. C. and 5% CO.sub.2. After incubation, 150
.mu.l of cell free supernatant was withdrawn from each well and the
level of human IFN.gamma. produced was measured by ELISA (Endogen
Interferon gamma ELISA, Endogen, Cambridge, Mass.). Each
supernatant was assayed in duplicate.
[0651] Analysis of human anti-hIL-12 antibody, Y61 in this assay
demonstrated that Y61 inhibited human IFN.gamma. production with an
IC.sub.50 value of approximately 1.6.times.10.sup.-10M, while the
human anti-IL-12 antibody, J695, inhibited human IFN.gamma.
production with an IC.sub.50 value of approximately
5.0.+-.2.3.times.10.sup.-12 M (n=3). The result demonstrates the
substantial improvement in the affinity of J695 as a result of the
modifications at L50 and L94.
E. Induction of Non-Human IL-12 from Isolated PBMC
[0652] To examine the cross-reactivity of the human anti-hIL-12
antibodies with IL-12 from other species, non-human IL-12 was
produced as follows. PBMC were separated from fresh heparinized
blood by density gradient centrifugation as described above using
lymphoprep (Nycomed, Oslo, Norway) for cynomolgus monkey, baboon,
and dog, PBMC, Accu-paque (Accurate Chemical & Sci. Corp.,
Westbury, N.Y.) for dog PBMC or Lympholyte-rat (Accurate Chemical
& Sci. Corp., Westbury, N.Y.) for rat PBMC.
[0653] The PBMC were then induced to produce IL-12 as described
(D'Andrea et al., (1992) J. Exp. Med 176, 1387-1398, Villinger et
al., (1995) J. Immunol. 155, 3946-3954, Buettner et al., (1998)
Cytokine 10, 241-248). The washed PBMC were resuspended at
1.times.10.sup.6 cells/ml in RPMI complete medium, supplemented
with 0.0075% (wt/vol) of SAC (Pansorbin; Calbiochem-Behring Co., La
Jolla, Calif.) or 1-5 mg/ml ConA (Sigma Chemical Co., St. Louis,
Mo.) plus 0.0075% SAC and incubated for 18 hours at 37.degree. C.
in a 5% CO.sub.2 atmosphere. Cell-free and SAC-free medium was
collected by centrifugation and filtering through 0.2 mm
filters.
[0654] IL-12 from the rhesus monkey was obtained as recombinant
rhesus IL-12 from Emory University School of Medicine, Atlanta,
Ga.
F. Murine 2D6 Cell Proliferation Assay
[0655] The murine T cell clone 2D6 proliferates in response to
murine IL-2, IL-4, IL-7 and IL-12 (Maruo et al., (1997) J.
Leukocyte Biol. 61, 346-352). A significant proliferation was also
detected in response to rat PBMC supernatants containing rat IL-12.
The cells do not respond to dog, cynomolgus, baboon or human IL-12.
Murine 2D6 cells were propagated in RPMI complete medium
supplemented with 50 mM beta-mercaptoethanol (.beta.ME) and 30
ng/ml murine IL-12. One day prior to the assay, the murine IL-12
was washed out and the cells were incubated overnight in RPMI
complete medium plus .beta.ME.
[0656] Serial dilutions of anti-IL-12 antibody were preincubated
for 1 hour at 37.degree. C., 5% CO.sub.2 with 40 pg/ml murine IL-12
in 100 ml RPMI complete medium plus .beta.ME in a microtiter plate
(U-bottom, 96-well, Costar). 2D6 cells were washed once and
resuspended in RPMI complete medium containing .beta.ME to a cell
density of 1.times.10.sup.5 cells/ml. 2D6 cells (100 .mu.l,
1.times.10.sup.4 cells) were added to the antibody/hIL-12 mixture,
incubated for 3 days at 37.degree. C., 5% CO.sub.2 and labeled for
4-6 hours with 0.5 mCi/well (3H)-Thymidine. The culture contents
were harvested and counted by liquid scintillation counting. All
samples were assayed in duplicate.
G. Species Cross-Reactivity of J695 with Non-Human IL-12
[0657] Species cross-reactivity of J695 with non-human IL-12 was
analyzed using PBMC's isolated from several non-human species. The
presence of non-human IL-12 activity in the rat, dog, cynomolgus
and baboon PBMC supernatants was confirmed using several bioassays
described above, such as the murine 2D6 cell proliferation assay,
the human PHA blast proliferation assay and the interferon-gamma
induction assay by blocking the non-human PBMC induced responses
with rabbit and/or sheep polyclonal antibodies to murine and/or
human IL-12. Cross-reactivity of the human anti-hIL-12 antibodies
Y61 and J695 with non-human IL-12 in PBMC supernatants or purified
murine and rhesus IL-12 was then assessed in the same bioassay(s)
by determining the J695 antibody concentration at which 50%
inhibition of the response was observed. The species
cross-reactivity results are summarized in Table 5. The results
demonstrate that Y61 and J695 are each able to recognize IL-12 from
monkeys (e.g, cynomolgus and rhesus IL-12 for Y61, and cynomolgus,
rhesus and baboon for J695) and that J695 is approximately 35 fold
less active on dog IL-12; neither Y61 nor J695 cross reacts with
mouse or rat IL-12.
H. Human Cytokine Specificity of J695
[0658] The specificity of J695 was tested in a competition ELISA in
which a panel of human cytokines was tested for their ability to
interfere with the binding of soluble J695 to immobilized human
IL-12. The panel of human cytokines included IL-1.alpha. and
IL-1.beta. (Genzyme, Boston, Mass.), IL-2 (Endogen), IL-4, IL-10,
IL-17, IFN-gamma, and TGF-.beta.1 (R&D, Minneapolis, Minn.)
IL-8 (Calbiochem), PDGF, IGF-I, and IGF-II (Boehringer Mannheim
Corp., Indianapolis, Ind.), TNF.alpha. and lymphotoxin, IL-6,
soluble IL-6 receptor, IL-11, IL-12 p70, IL-12 p40, M-CSF, and LIF.
EBI-3, an IL-12 p40 related protein that is induced by Epstein-Barr
virus infection in B lymphocytes (Devergne et
TABLE-US-00009 TABLE 5 Species Cross Reactivity Data IC.sub.50 (M)
Antibody Mouse IL-12 Rat IL-12 Dog IL-12 Cyno IL-12 Rhesus IL-12
Baboon IL-12 Human IL-12 Name Specificity Purified PBMC sup PBMC
sup PBMC sup Purified PBMC sup Purified C17.15 rat-.alpha.muIL12
3.0 .times. 10.sup.-11 R03B03 rabbit-.alpha.muIL12 1.5 .times.
10.sup.-10 6.0 .times. 10.sup.-10 C8.6.2 mouse-.alpha.huIL12 1.2
.times. 10.sup.-10 1.0 .times. 10.sup.-10 2.0 .times. 10.sup.-10
5.0 .times. 10.sup.-11 Y61 human-.alpha.huIL12 Non- 2.2 .times.
10.sup.-10 1.0 .times. 10.sup.-10 1.7 .times. 10.sup.-10
neutralizing J695 human-.alpha.huIL12 Non- Non- 3.5 .times.
10.sup.-10 1.0 .times. 10.sup.-11 1.0 .times. 10.sup.-11 1.5
.times. 10.sup.-11 5.0 .times. 10.sup.-12 neutralizing
neutralizing
al., (1996) J. Virol. 70, 1143-1153) was expressed as a human
IgG-Fc chimera (EBI-3/Fc) Single-stranded salmon sperm DNA (Sigma)
was also tested.
[0659] Flat-bottom ELISA immunoassay microtiter plates (96 well,
high binding, Costar) were coated overnight at 4.degree. C. with
0.1 ml human IL-12 (2 .mu.g/ml in 0.1 M carbonate coating buffer (4
volumes 0.1 M NaHCO.sub.3 plus 8.5 volumes 0.1 M NaHCO.sub.3)). The
plates were washed twice with PBS containing 0.05% Tween 20
(PBS-T), blocked with 200 .mu.l of 1 mg/ml bovine serum albumin
(BSA, Sigma) in PBS-T for 1 hour at room temperature, and again
washed twice with PBS-T. Samples (100 .mu.l) containing IL-12
antibody J695 (100 ng/ml) and each cytokine (2 nM) in PBS-T
containing 50 .mu.g/ml BSA (PBS-T/BSA) were added and incubated for
2 h at room temperature. The plates were washed 4 times and
incubated for 1 h at room temperature with 100 .mu.l mouse
anti-human lambda-HRP (1:500 in PBS-T/BSA, Southern Biotech. Ass.
Inc., Birmingham, Ala.). The plates were washed 4 times and
developed with ABTS (Kirkegaard & Perry Lab., Gaithersburg,
Md.) for 20-30 minutes in the dark. The OD.sub.450 nm was read
using a microplate reader (Molecular Devices, Menlo Park, Calif.).
Percent binding was determined relative to J695 binding to the
IL-12 coated plate in the absence of any soluble cytokine.
[0660] The results demonstrated that J695 binding to immobilized
human IL-12 was blocked only by human IL-12 p70 and to a lesser
extent, by human IL-12 p40 and not by any of the other cytokines
tested.
I. Binding to a Novel IL-12 Molecule
[0661] An alternative IL-12 heterodimer has been described, in
which the p35 subunit is replaced by a novel p19 molecule. P19 was
identified using 3D homology searching for IL-6/IL-12 family
members, and is synthesized by activated dendritic cells. P19 binds
to p40 to form a p19/p40 dimer, which has IL-12-like activity, but
is not as potent as the p35/p40 heterodimer in IFN.gamma.
induction. Antibodies which recognize p40 alone, but preferably in
the context of a p70 molecule (e.g., J695 and Y61, see Example 3H)
are expected to also neutralize both the p35/p40 molecules and the
p19/p40 molecules.
Example 4
In Vivo Activity of Anti-hIL-12 Antibodies
[0662] The in vivo effects of IL-12 antibodies on IL-12 induced
responses were examined in a model modified from one used by Bree
et al. to study the effect of human IL-12 on peripheral hematology
in cynomolgus monkey Bree et al., (1994) Biochem Biophys Res. Comm.
204: 1150-1157. In those previous studies, administration of human
IL-12 at 1 .mu.g/kg/day for a period of 5 days resulted in a
decrease in white blood cell count (WBC), especially in the
lymphocyte and monocyte subsets after 24 hours. A decrease in the
platelet count was observed at 72 hours. Levels of plasma
neopterin, a marker of monocyte activation in response to
IFN-.gamma., began to elevate at 24 hours and were the highest at
72 hours.
[0663] In the first study with human anti-hIL-12 antibodies,
fifteen healthy cynomolgus monkeys with an average weight of 5 kg,
were sedated and divided into 5 groups (n=3). Group 1 received an
intravenous (IV) administration of 10 mg/kg human intravenous
immunoglobulin (IVIG, Miles, Eckhart, Ind., purified using protein
A Sepharose). Group 2 received an intravenous administration of 1
mg/kg C8.6.2 (neutralizing mouse anti-human IL-12 monoclonal
antibody). Group 3 received an intravenous administration of 10
mg/kg C8.6.2. Group 4 received an intravenous administration of 1
mg/kg Y61 (human anti-human IL-12 antibody, purified from CHO cell
conditioned medium). Group 5 received an intravenous administration
of 10 mg/kg Y61.
[0664] One hour after the antibody administration all animals
received a single subcutaneous (SC) injection of human IL-12 (1
.mu.g/kg). Blood samples were taken at the following time points:
baseline, 8, 24, 48, 96 and 216 hours, and analyzed for complete
blood cell counts with differentials and serum chemistry. Serum
human IL-12, C8.6.2 antibody, Y61 antibody, monkey IFN-gamma,
monkey IL-10, monkey IL-6 and plasma neopterin levels were also
measured.
[0665] Animals treated with IL-12 plus IVIG control antibody (Group
1) showed many of the expected hematological changes, including
decreases in WBC, platelets, lymphocyte count and monocyte count.
These decreases were not seen or were less pronounced in the
animals treated with either the C8.6.2 or Y61 antibody at 1 or 10
mg/kg (Groups 2-5).
[0666] Serum or plasma samples were analyzed by ELISA specific for
monkey IFN-gamma and monkey IL-10 (Biosource International,
Camarillo, Calif.), monkey IL-6 (Endogen) and plasma neopterin (ICN
Pharmaceuticals, Orangeburg, N.Y.). IFN-gamma, IL-10 or IL-6 were
not detected in any of the IL-12 treated animals including the
control animals treated with IL-12 plus IVIG. This was probably due
to the low level exposure to IL-12 (only 1 dose of 1 .mu.g/kg).
Nevertheless, plasma neopterin levels increased about three fold in
the IL-12 plus IVIG treated animals but did not change in all
C8.6.2 or Y61 treated animals, including the lower dose (1 mg/kg)
Y61 treated animals, indicating that Y61 was effective in vivo in
blocking this sensitive response to IL-12.
[0667] In a second study, in vivo activity and pharmacodynamics
(PD) of J695 in cynomolgous monkeys were studied by administering
exogenous rhIL-12 and determining if J695 could block or reduce the
responses normally associated with rhIL-12 administration. Male
cynomolgus monkeys (n=3 per group) were administered a single dose
of 0.05, 0.2, or 1.0 mg/kg J695 or 1 mg/kg intravenous
immunoglobulin (IVIG) as a bolus intravenous (IV) injection via a
saphenous vein or subcutaneously (SC) in the dorsal skin. One hour
following the administration of J695 or IVIG, all animals received
a single SC dose of 1 .mu.g/kg rhIL-12 in the dorsal skin. Blood
samples were collected via the femoral vein up to 28 days after
J695 administration. Serum was acquired from each blood sample and
assayed for IL-12, J695, IFN-.gamma., and anti-J695 antibodies by
ELISA. Neopterin was assayed by reverse-phase high performance
liquid chromatography.
[0668] The levels of neopterin, normalized with respect to the
levels of neopterin that were measured before administration of
J695 or rhIL-12, are shown in FIG. 3. To compare the suppression of
neopterin between groups, the area under the curve (AUC) normalized
for neopterin levels was calculated for each animal (Table 6).
Neopterin exposure (AUC) was suppressed in a dose-dependent manner
between approximately 71 and 93% in the IV groups and between 71
and 100% in SC groups, relative to the IVIG control groups. These
results suggest that the dose of J695 necessary for 50% inhibition
of the neopterin response (ED.sub.50) was less than 0.05 mg/kg when
administered by either the IV or SC route.
TABLE-US-00010 TABLE 6 Dose-Dependent Suppression of IL-12 Induced
Neopterin by J695 in Cynomolgus Monkeys AUC of % Reduction of J695
IVIG Normalized Neopterin AUC Route of dosing IVIG Dose Dose
Neopterin Compared with or J695 and rhIL-12 (mg/kg) (mg/kg) Levels
Control Single IV injection -- 1.0 1745 .+-. 845 0 followed 1 hr
later by 0.05 -- 502 .+-. 135 71.3 a dose of 1 .mu.g/kg 0.2 -- 199
.+-. 316 88.6 human IL-12 given SC 1.0 -- 128 .+-. 292 92.7 Single
SC injection -- 1.0 1480 .+-. 604 0 followed 1 hour later 0.05 --
426 .+-. 108 71.2 by a dose of 1 .mu.g/kg 0.2 -- 395 .+-. 45.9 73.3
human IL-12 given SC 1.0 -- 0 .+-. 109 100
[0669] Treatment with J695 also prevented or reduced the changes in
hematology normally associated with rhIL-12 administration
(leukopenia and thrombocytopenia). At 24 hours after rhIL-12
administration lymphocyte counts were reduced by approximately 50%
when compared to baseline values in the control IV and SC IVIG
treated groups. Administration of J695 either SC or IV at all three
dose levels prevented this reduction, resulting in lymphocyte
counts at 24 hours approximately the same as baseline values. At 48
hours after IL-12 administration, platelet counts in the groups
treated with IV and SC IVIG were reduced by approximately 25% when
compared to baseline values.
[0670] An example dose schedule targeted to maintain serum levels
above the 90% effect level would be 1 mg/kg IV and SC given
approximately every other week, or 0.3 mg/kg given approximately
every week, assuming slight accumulation during repeated dosing.
This study demonstrates that antibody can be given safely to
monkeys at such dosages. In independent toxicity studies, it was
further found that up to 100 mg/kg of the antibody can be given
safely to monkeys.
[0671] J695 was also effective in preventing IFN-.gamma. production
in mice treated with a chimeric IL-12, a molecule which combines
the murine p35 subunit with the human IL-12 p40 subunit. In
contrast to human IL-12 which is biologically inactive in mice,
this chimeric IL-12 retains biological function in mice, including
induction of IFN-.gamma.. In addition, the human p40 subunit allows
the molecule to be bound and neutralized by J695. Chimeric IL-12 at
a dose of 0.05 mg/kg i.p. was administered to female C3H/HeJ mice
(10/experimental group) in five daily doses on days 0, 1, 2, 3, and
4. J695 was given on days 0, 2 and 4 at doses of 0.05, 0.01, 0.002,
0.0004, 0.00008, and 0.000016 mg/kg i.p., 30' prior to the IL-12
injections. The control hulgG1.gamma. was given IP. at a dose of
0.05 mg/kg on days 0, 2, and 4. The mice were bled on day 5, and
serum IFN-.gamma. levels were determined by ELISA. The results
demonstrated that J695 caused dose-dependent inhibition of
IFN-.gamma. production with an ED.sub.50 of approximately 0.001
mg/kg. Collectively, these results demonstrate that J695 is a
potent inhibitor of Il-12 activity in VIVO.
Example 5
Kinetic Analysis of Binding of Human Antibodies to Recombinant
Human IL-12 (rhIL-12)
[0672] Real-time binding interactions between captured ligand
(human anti-rhIL-12 antibody J695, captured on a biosensor matrix)
and analyte (rhIL12 in solution) were measured by surface plasmon
resonance (SPR) using the BIAcore system (Biacore AB, Uppsala,
Sweden). The system utilizes the optical properties of SPR to
detect alterations in protein concentration within a dextran
biosensor matrix. Proteins are covalently bound to the dextran
matrix at known concentrations. Antibodies are injected through the
dextran matrix and specific binding between injected antibodies and
immobilized ligand results in an increased matrix protein
concentration and resultant change in the SPR signal. These changes
in SPR signal are recorded as resonance units (RU) and are
displayed with respect to time along the y-axis of a
sensorgram.
[0673] To facilitate immobilization of goat anti-human IgG
(Southern Biotechnology Associates, Cat. No. 2040-01, Birmingham,
Ala.) on the biosensor matrix, goat anti-human IgG is covalently
linked via free amine groups to the dextran matrix by first
activating carboxyl groups on the matrix with 100 mM
N-hydroxysuccinimide (NHS) and 400 mM
N-Ethyl-N'-(3-dimethylaminopropyl)-carbodiimide hydrochloride
(EDC). Next, goat anti-human IgG is injected across the activated
matrix. Thirty-five microliters of goat anti-human IgG (25
.mu.g/ml), diluted in sodium acetate, pH 4.5, is injected across
the activated biosensor and free amines on the protein are bound
directly to the activated carboxyl groups. Unreacted matrix
EDC-esters are deactivated by an injection of 1 M ethanolamine.
Standard amine coupling kits were commercially available (Biacore
AB, Cat. No. BR-1000-50, Uppsala, Sweden).
[0674] J695 was diluted in HBS running buffer (Biacore AB, Cat. No.
BR-1001-88, Uppsala, Sweden) to be captured on the matrix via goat
anti-human IgG. To determine the capacity of rhIL12-specific
antibodies to bind immobilized goat anti-human IgG, a binding assay
was conducted as follows. Aliquots of J695 (25 .mu.g/ml; 25 .mu.l
aliquots) were injected through the goat anti-human IgG polyclonal
antibody coupled dextran matrix at a flow rate of 5 .mu.l/min.
Before injection of the protein and immediately afterward, HBS
buffer alone flowed through each flow cell. The net difference in
signal between the baseline and the point corresponding to
approximately 30 seconds after completion of J695 injection was
taken to represent the amount of IgG1 J695 bound (approximately
1200 RU's). Direct rhIL12 specific antibody binding to soluble
rhIL12 was measured. Cytokines were diluted in HBS running buffer
and 50 .mu.l aliquots were injected through the immobilized protein
matrices at a flow rate of 5 .mu.l/min. The concentrations of
rhIL-12 employed were 10, 20, 25, 40, 50, 80, 100, 150 and 200 nM.
Prior to injection of rhIL-12, and immediately afterwards, HBS
buffer alone flowed through each flow cell. The net difference in
baseline signal and signal after completion of cytokine injection
was taken to represent the binding value of the particular sample.
Biosensor matrices were regenerated using 100 mM HCI before
injection of the next sample. To determine the dissociation
constant (off-rate), association constant (on-rate), BIAcore
kinetic evaluation software (version 2.1) was used.
[0675] Representative results of CHO derived J695 binding to
rhIL-12 as compared to the COS derived J695, are shown in Table
7.
TABLE-US-00011 TABLE 7 Binding of CHO or COS derived J695 to
rhIL-12. rhIL12 bound, Source rhIL12, nM RU's Ab, bound, RU's
rhIL12/AB CHO 200 1112 1613 1.48 CHO 150 1033 1525 1.45 CHO 100 994
1490 1.43 CHO 80 955 1457 1.40 CHO 50 912 1434 1.36 CHO 40 877 1413
1.33 CHO 25 818 1398 1.25 CHO 20 773 1382 1.20 CHO 10 627 1371 0.98
COS 200 1172 1690 1.49 COS 150 1084 1586 1.46 COS 100 1024 1524
1.44 COS 80 985 1489 1.42 COS 50 932 1457 1.37 COS 40 894 1431 1.34
COS 25 833 1409 1.27 COS 20 783 1394 1.20 COS 10 642 1377 1.00
[0676] Molecular kinetic interactions between captured J695 and
soluble rhIL-12 were quantitatively analyzed using BIAcore
technology. Several independent experiments were performed and the
results were analyzed by the available BIAcore mathematical
analysis software to derive kinetic rate constants, as shown in
Table 8.
TABLE-US-00012 TABLE 8 Apparent kinetic rate and affinity constants
of J695 for rhIL-12. On-rate (M-1s-1), Off-rate (s-1), Kd (M),
Antibody Source Avg. Avg. Avg. J695 CHO 3.52E+05 4.72E-05 1.34E-10
J695 COS 3.40E+05 2.61E-05 9.74E-11
[0677] There was a small difference between the calculated apparent
constant (Kd) for the interaction between CHO derived J695
(Kd=1.34.sup.-10M.sup.-1) and COS derived J695
(Kd=9.74.times.10.sup.-11M.sup.-1) antibodies. The apparent
dissociation constant (Kd) between J695 and rhIL12 was estimated
from the observed rate constants by the formula:
Kd=off-rate/on-rate.
[0678] To determine the apparent association and dissociation rate
constant for the interaction between J695 and rhIL-12, several
binding reactions were performed using a fixed amount of J695 (2
.mu.g/ml) and varying concentrations of rhIL-12. Real-time binding
interaction sensorgrams between captured J695 and soluble rhIL12
showed that both forms of antibody were very similar for both the
association and dissociation phase.
[0679] To further evaluate the capacity of captured IgG1 J695 mAb
to bind soluble recombinant cytokine, a direct BIAcore method was
used. In this method, goat anti-human IgG (25 .mu.g/ml) coupled
carboxymethyl dextran sensor surface was coated with IgG1 J695 (2
.mu.g/ml) and recombinant cytokine was then added. When soluble
rhIL12 was injected across a biosensor surface captured with CHO or
COS derived IgG1 J695, the amount of signal increased as the
concentration of cytokine in the solution increased. No binding was
observed with rmIL12 (R&D Systems, Cat. No. 419-ML,
Minneapolis, Minn.) or rh IL12 any concentration tested up to 1000
nM. These results support the conclusion that IgG1 J695 antibodies
recognize a distinct determinant on rhIL-12.
[0680] Table 9 shows the results of an experiment using BIAcore to
demonstrate human IgG1 J695 mAb binding to only soluble rhIL12 and
none of the other recombinant cytokines.
TABLE-US-00013 TABLE 9 Epitope mapping of J695 using BIAcore
technology. Captured ligand Captured ligand Soluble analyte COS
J695 CHO J695 rec. human IL12 Positive Positive rec. murine IL12
Negative Negative
Example 6
Further Studies of J695 Affinity for IL-12
[0681] Molecular kinetic interactions between J695 antibody and
human IL-12 were quantitatively analyzed using BIAcore plasmon
resonance technology, and apparent kinetic rate constants were
derived.
[0682] BIAcore technology was used to measure the binding of
soluble rhIL-12 to solid phase captured J695. A goat anti-human IgG
antibody was immobilized on the biosensor chips, then a fixed
amount of J695 was injected and captured on the surface. Varying
concentrations of rhIL-12 were applied, and the binding of IL-12 at
different concentrations to J695 was measured as a function of
time. Apparent dissociation and association rate constants were
calculated, assuming zero-order dissociation and first order
association kinetics, as well as a simple one-to-one molecular
interaction between J695 and IL-12. Three independent experiments
were performed, and the values shown are averages for the three
experiments. From these measurements, the apparent dissociation
(k.sub.d) and association (k.sub.a) rate constants were derived and
used to calculate a K.sub.d value for the interaction (see Table
10). The results indicated that J695 has a high affinity for
rhIL-12.
TABLE-US-00014 TABLE 10 Kinetic Parameters for the Interaction
Between J695 and Human IL-12 Kinetic Parameter Value k.sub.d 3.71
.+-. 0.40 .times. 10.sup.-5 s.sup.-1 k.sub.a 3.81 .+-. 0.48 .times.
10.sup.5 M.sup.-1s.sup.-1 K.sub.d 9.74 .times. 10.sup.-11 M (14
ng/mL)
Example 7
Characteristics and Neutralization Activity of C17.15, a Rat
Monoclonal Antibody to Murine Interleukin-12
[0683] To assess the relevance of IL-12 treatment studies in mouse
models of inflammation and autoimmunity using monoclonal antibodies
specific for murine IL-12 to similar approaches in human disease,
the interaction of C17.15, a rat anti-murine IL-12 monoclonal
antibody with murine IL-12, was examined. The ability of C17.15 to
neutralize murine IL-12 activity in a PHA blast proliferation
assay, and to block murine IL-12 binding to cell surface receptors,
was assessed, as were the kinetics of the C17.15-murine IL-12
binding interaction.
[0684] In a human PHA blast proliferation assay (See Example 3),
serial dilutions of C17.15 or rat IgG2a (a control antibody) were
preincubated with 230 pg/mL murine IL-12 for 1 hr at 37.degree. C.
PHA-stimulated blast cells were added to the antibody-IL-12
mixtures and incubated for 3 days at 37.degree. C. The cells were
subsequently labeled for 6 h with 1 .mu.Ci/well
[.sup.3H]-thymidine. The cultures were harvested and
[.sup.3H]-thymidine incorporation was measured. Background
non-specific proliferation was measured in the absence of added
murine IL-12. All samples were assayed in duplicate. The IC.sub.50
(M) of C17.15 for recombinant murine IL-12 in this assay was found
to be 1.4.times.10.sup.-11, as compared to the IC.sub.50 value of
5.8.times.10.sup.-2 observed for J695 for recombinant human IL-12
under the same conditions (see Table 11).
TABLE-US-00015 TABLE 11 Comparison of the properties of anti-human
IL-12 monoclonal antibody J695 and the rat anti-mouse IL-12
monoclonal antibody C17.15 Receptor Biomolecular Interaction Assay
Binding PHA blast k.sub.a, on-rate k.sub.d, off-rate Assay Assay
Antibody Epitope (M.sup.-1s.sup.-1) (s.sup.-1) K.sub.d (M)
IC.sub.50 (M) IC.sub.50 (M) J695 Hu p40 3.81 .times. 10.sup.5 3.71
.times. 10.sup.-5 9.74 .times. 10.sup.-11 1.1 .times. 10.sup.-11
5.8 .times. 10.sup.-12 C17.15 Mu p40 3.80 .times. 10.sup.5 1.84
.times. 10.sup.-4 4.80 .times. 10.sup.-10 1.5 .times. 10.sup.-10
1.4 .times. 10.sup.-11
[0685] The ability of C17.15 to inhibit the binding of murine IL-12
to cellular receptors was also measured. Serial dilutions of C17.15
were pre-incubated for 1 hr at 37.degree. C. with 100 pM
[.sup.125I]-murine IL-12 in binding buffer. The 2D6 cells
(2.times.10.sup.6) were added to the antibody/[.sup.125I]-murine
IL-12 mixture and incubated for 2 hours at room temperature.
Cell-bound radioactivity was separated from free [.sup.125I]-IL-12,
and the remaining cell-bound radioactivity was determined. Total
binding of the labeled murine IL-12 to receptors on 2D6 cells was
determined in the absence of antibody, and non-specific binding was
determined by the inclusion of 25 nM unlabelled murine IL-12 in the
assay. Specific binding was calculated as the total binding minus
the non-specific binding. Incubations were carried out in
duplicate. The results showed that C17.15 has an IC.sub.50 (M) of
1.5.times.10.sup.-10 for inhibition of binding of murine IL-12 to
cellular receptors.
[0686] The affinity of C17.15 for recombinant murine IL-12 was
assessed by biomolecular interaction analysis. A goat anti-rat IgG
antibody was immobilized on the biosensor chips, followed by an
injection of a fixed amount of the C17.15 antibody, resulting in
capture of C17.15 on the surface of the chip. Varying
concentrations of recombinant murine IL-12 were applied to the
C17.15 surface, and the binding of murine IL-12 to the immobilized
C17.15 was measured as a function of time. Apparent dissociation
and association rate constants were calculated, assuming a zero
order dissociation and first order association kinetics as well as
a simple one to one molecular interaction between the immobilized
C17.15 and murine IL-12. From these measurements, the apparent
dissociation (k.sub.d, off-rate) and association (k.sub.a, on-rate)
rate constants were calculated. These results were used to
calculate a K.sub.d value for the interaction. An on-rate of
3.8.times.10.sup.5 M.sup.-1s.sup.-1, an off-rate of
1.84.times.10.sup.-4 s.sup.-1, and a K.sub.d of
4.8.times.10.sup.-10 was observed for the recombinant murine
IL-12-C17.15 interaction.
[0687] The observed activities of C17.15 in neutralizing murine
IL-12 activity and binding to cell surface receptors, as well as
the kinetics of binding of C17.15 to murine IL-12 correlate with
similar measurements for the J695-rhIL-12 interaction. This
indicates that the modes of action of the rat anti-mouse IL-12
antibody C17.15 and anti-human IL-12 antibody J695 are nearly
identical based upon on-rate, off-rate, K.sub.d, IC.sub.50, and the
PHA blast assay. Therefore, C17.15 was used as a homologous
antibody to J695 in murine models of inflammation and autoimmune
disease to study the effects of IL-12 blockade on the initiation or
progression of disease in these model animals (see Example 8).
Example 8
Treatment of Autoimmune or Inflammation-Based Diseases in Mice by
.alpha.-Murine IL-12 Antibody Administration
[0688] A. Suppression of Collagen-Induced Arthritis in Mice by the
.alpha.-Il-12 antibody C17.15
[0689] A correlation between IL-12 levels and rheumatoid arthritis
(RA) has been demonstrated. For example, elevated levels of IL-12
p70 have been detected in the synovia of RA patients compared with
healthy controls (Morita et al (1998) Arthritis and Rheumatism. 41:
306-314). Therefore, the ability of C17.15, a rat anti-mouse IL-12
antibody, to suppress collagen-induced arthritis in mice was
assessed.
[0690] Male DBA/1 mice (10/group) were immunized with type II
collagen on Day 0 and treated with C17.15, or control rat IgG, at
10 mg/kg intraperitoneally on alternate days from Day -1 (1 day
prior to collagen immunization) to Day 12. The animals were
monitored clinically for the development of arthritis in the paws
until Day 90. The arthritis was graded as: 0--normal; 1--arthritis
localized to one joint; 2--more than one joint involved but not
whole paw; 3--whole paw involved; 4--deformity of paw; 5--ankylosis
of involved joints. The arthritis score of a mouse was the sum of
the arthritic grades in each individual paw of the mouse (max=20).
The results are expressed as mean.+-.SEM in each group.
[0691] The results, as shown in FIG. 4, indicate that an arthritic
score was measurable in the C17.15-treated mice only after day 50
post-treatment, and that the peak mean arthritic score obtained
with the C17.15-treated mice was at least 5-fold lower than that
measured in the IgG-treated mice. This demonstrated that the rat
anti-mouse IL-12 antibody C17.15 prevented the development of
collagen-induced arthritis in mice.
B. Suppression of Colitis in Mice by the Rat .alpha.-Murine IL-12
Antibody C17.15
[0692] IL-12 has also been demonstrated to play a role in the
development/pathology of colitis. For example, anti-IL-12
antibodies have been shown to suppress disease in mouse models of
colitis, e.g., TNBS induced colitis IL-2 knockout mice (Simpson et
al. (1998) J. Exp. Med. 187(8): 1225-34). Similarly, anti-IL-2
antibodies have been demonstrated to suppress colitis formation in
IL-10 knock-out mice. The ability of the rat anti-mouse IL-12
antibody, C17.15, to suppress TNBS colitis in mice was assessed in
two studies (Davidson et al. (1998) J. Immunol. 161(6):
3143-9).
[0693] In the first study, colitis was induced in pathogen free SJL
mice by the administration of a 150 .mu.L 50% ethanol solution
containing 2.0 mg TNBS delivered via a pediatric umbilical artery
catheter into the rectum. Control animals were treated with a 150
.mu.L 50% ethanol solution only. A single dose of 0.75, 0.5, 0.25,
or 0.1 mg C17.15 or 0.75 mg control rat IgG2a was given
intravenously via the tail vein at day 11, and the therapeutic
effect of the treatment was assessed by weighing the animals on
days 11 and 17, and histological scoring at day 17. The weight of
the mice treated with C17.15 increased within 48 hours of antibody
treatment and normalized on day 6 after treatment. The effect of
treatment with C17.15 was confirmed histologically. Further,
assessments of IFN-.gamma. secretion by CD4.sup.+ T-cells from
spleen and colon of the treated mice, as well as IL-12 levels from
spleen or colon-derived macrophages from the treated mice were also
made (see Table 12).
[0694] In the second study, the dosing was optimized and the mice
were treated with a total dose of 0.1 mg or 0.5 mg C17.15 or 0.1 mg
control IgG2a, respectively, split between days 12 and 14. It was
found that the administration of C17.15 in a single dose at the
dosage of 0.1 mg/mouse or 0.25 mg/mouse led to only partial
improvement in TNBS-induced colitis and did not result in a
significant reduction in the CD4.sup.+ T cell production of
IFN-.gamma. in vitro, but did result in a significant decrease in
secretion of IL-12, compared to untreated controls. At a single
dose of 0.5 mg/mouse or greater a response was observed. Taking the
lowest dose of antibody tested and administering it in two divided
injections (at days 12 and 14) improved the dosing regimen,
indicating that multiple low doses can be more effective than a
single bolus dose. The data obtained are shown in Table 12.
TABLE-US-00016 TABLE 12 Anti-mouse Il-12 mAb C17.15 Suppresses
Established Colitis in Mice IFN-.gamma. spleen Disease CD4.sup.+
IL-12 spleen Induction Treatment Weight (g) cells macrophages Day 0
Day 11 Day 11 Day 17 (U/mL) (pg/ml) TNBS + Control IgG2a 16.0 15.26
3326 300 Ethanol 0.75 mg TNBS + C17.15 0.75 mg 16.0 20.21 1732 0
Ethanol TNBS + C17.15 0.5 mg 16.36 19.94 1723 0 Ethanol TNBS +
C17.15 0.25 mg 16.28 17.7 3618 7 Ethanol TNBS + C17.15 0.1 mg 16.2
17.98 3489 22 Ethanol Ethanol -- 20.76 21.16 1135 0 control
[0695] Administration of C17.15 monoclonal anti-IL-12 in two
divided doses spaced one day apart totaling 0.1 mg/mouse or 0.05
mg/mouse led to complete reversal of colitis as assessed by wasting
and macroscopic appearance of the colon. In addition, this dose
schedule led to significant down-regulation of lamina propria
T-cell production of IFN-.gamma. and macrophage production of
IL-12, so that the latter were comparable to levels seen in control
ethanol-treated mice without TNBS-colitis. Thus, C17.15
administration to mouse models for TNBS colitis reversed the
progression of the disease in a dose-dependent manner.
C. Suppression of Experimental Autoimmune Encephalomyelitis (EAE)
in Mice by .alpha.-IL-12 Antibodies
[0696] It is commonly believed that IL-12 plays a role in the
pathogenesis of multiple sclerosis (MS). The inducible IL-12 p40
message has been shown to be expressed in acute plaques of MS
patients but not in inflammatory brain infarct lesions (Windhagen,
A. et al. (1995) J. Exp. Med. 182: 1985-1996). T cells from MS
patients (but not control T cells) stimulate IL-12 production from
antigen-presenting cells through unregulated CD40L expression
(Balashov, K. E. et al. (1997) Proc. Natl. Acad. Sci. USA 94:
599-603). MS patients have enhanced IFN-.gamma. secretion that can
be blocked with .alpha.-IL-12 antibodies in vitro (Balashov, K. E.
et al. (1997) Proc. Natl. Acad. Sci. USA 94: 599-603). Elevated
levels of serum IL-12 are detected in MS patients, but not in other
neurological diseases (Nicoletti, F. et al. (1996) J. Neuroimmunol.
70: 87-90). Increased IL-12 production has been shown to correlate
with disease activity in MS patients (Cormabella, M. et al. (1998)
J. Clin. Invest. 102: 671-678). The role of IL-12 in the
pathogenesis of a murine model of multiple sclerosis, experimental
autoimmune encephalomyelitis (EAE), has been studied (Leonard, J.
P. et al. (1995) J. Exp. Med. 181: 281-386; Banerjee, S. et al.
(1998) Arthritis Rheum. (1998) 41: S33; and Segal, B. M. et al.
(1998) J. Exp. Med. 187: 537-546). The disease in this model is
known to be induced by T cells of the TH1 subset. Therefore, the
ability of .alpha.-IL-12 antibodies to prevent the onset of acute
EAE was assessed.
[0697] An .alpha.-IL-12 antibody was found to be able to inhibit
the onset of acute EAE, to suppress the disease after onset, and to
decrease the severity of relapses in mice immunized with the
autoantigen, myelin basic protein (Banerjee, S. et al. (1998)
Arthritis Rheum. (1998) 41: S33). The beneficial effects of
.alpha.-IL-12 antibody treatment in the mice persisted for over two
months after stopping treatment. It has also been demonstrated that
anti-IL-12 antibodies suppress the disease in mice that are
recipients of encephalitogenic T cells by adoptive transfer
(Leonard, J. P. et al. (1995) J. Exp. Med. 181: 281-386).
Example 9
Clinical Pharmacology of J695
[0698] In a double blind, crossover study, 64 healthy, human male
subjects were administered ascending doses of J695 or placebo.
Measurement of complement fragment C3a prior to and 0.25 h after
dosing did not demonstrate activation of the complement system. CRP
and fibrinogen levels were only increased in subjects in whom
symptoms of concurrent infections were observed.
[0699] All subjects survived and the overall tolerability of J695
was very good. In no case did treatment have to be stopped because
of adverse events (AEs). The most commonly observed AEs were
headache and common cold/bronchitis, neither of which were
categorized as severe.
[0700] One of the study subjects, a 33-year-old single male, was
suffering from psoriasis guttata at the start of the study.
According to the randomized study design, this subject by chance
received 5 mg/kg J695 by SC administration. Ten days prior to
administration of the antibody, the subject showed only small
discrete papular lesions on the arms and legs. At the time of the
antibody administration, the subject displayed increased reddening,
thickness of the erythematous plaques, and increased
hyperkaratosis. One week after J695 administration, the subject
reported an improvement in skin condition, including flattening of
the lesions and a decrease in scaling. Shortly after the second
administration of J695 (5 mg/kg IV), the subject's skin was totally
cleared of psoriatic lesions, in the absence of any local
treatment. Erythematous plaques covered with white scales
reappeared concomitant with the expected clearance of J695 after
the second administration of antibody.
Example 10
Comparison of J695 Produced by Two CHO Cell Lines
[0701] For recombinant expression of J695, a recombinant expression
vector encoding both the antibody heavy chain and the antibody
light chain is introduced into dhfr- CHO cells (Urlaub, G. and
Chasin, L. A. (1980) Proc. Natl. Acad. Sci. USA 77:4216-4220) by
calcium phosphate-mediated transfection. Within the recombinant
expression vector, the antibody heavy and light chain genes are
each operatively linked to enhancer/promoter regulatory elements
(e.g., derived from SV40, CMV, adenovirus and the like, such as a
CMV enhancer/AdMLP promoter regulatory element or an SV40
enhancer/AdMLP promoter regulatory element) to drive high levels of
transcription of the genes. The recombinant expression vector also
carries a DHFR gene, which allows for selection of CHO cells that
have been transfected with the vector using methotrexate
selection/amplification.
[0702] One hundred and fifty micrograms of an expression vector
encoding the peptide sequences of the human antibody J695 were
dissolved in 2.7 ml water in a 50 ml conical tube. Three hundred
.mu.L of 2.5 M CaCl.sub.2 were added and this DNA mixture was added
dropwise to 3 ml of 2.times.HEPES buffered saline in a 50 ml
conical tube. After vortexing for 5 sec and incubating at room
temperature for 20 min, 1 mL was distributed evenly over each plate
(still in F12 medium), and the plates were incubated at 37.degree.
C. for 4 h. Liquid was removed by aspiration and 2 ml of 10% DMSO
in F12 were added to each plate. The DMSO shock continued for 1
min, after which the DMSO was diluted by the addition of 5 ml PBS
to each plate. Plates were washed twice in PBS, followed by the
addition of 10 ml of alpha MEM, supplemented with H/T and 5% FBS
(selective for cells expressing DHFR) and overnight incubation at
37.degree. C. Cells were seeded into 96-well plates at a density of
100 cells per well, and plates were incubated at 37.degree. C., 5%
CO.sub.2 for two weeks, with one change of medium per week.
[0703] Five days after the final medium change, culture
supernatants were diluted 1:50 and tested using an ELISA specific
for human IgG gamma chain. The clones yielding the highest ELISA
signal were transferred from the 96-well plates to 12-well plates
in 1.5 ml/well of Alpha MEM+5% dialyzed serum. After 3 days,
another ELISA specific for human IgG gamma chain was performed, and
the 12 clones with the greatest activity were split into the alpha
MEM+5% dialyzed serum and 20 nM MTX. Cell line 031898 218 grew in
the presence of 20 nM MTX without any apparent cell death or
reduction in growth rate, produced 1.8 .mu.g/ml hIgG in a three-day
assay. T-25 cultures of 031898 218, growing in medium containing
MTX, produced an average of 11.9 .mu.g/ml of J695. The line,
designated ALP903, was adapted to growth in suspension under
serum-free conditions, where it produced 7.5 pg J695/cell/24 h.
[0704] ALP903 cells, after initial selection in alpha MEM/5% FBS/20
nM MTX medium, were passed again in 20 nM MTX. The cells were
cultured under 100 nM MTX selection, followed by passaging in 500
nM MTX twice in the next 30 days. At that time the culture was
producing 32 .mu.g J695/mL/24 h. The culture was subcloned by
limiting dilution. Subclone 218-22 produced 16.5 .mu.g/mL in a
96-well plate in 2 days and 50.3 .mu.g/mL of J695 in a 12-well dish
in 2 days. Clone 218-22 was cultured in alpha MEM/5% dialyzed
FBS/500 nM MTX for 38 days, followed by adaptation to serum-free
spinner culture, as above. The average cell-specific productivity
of the serum-free suspension culture, designated ALP 905, was 58
pg/cell/24 h.
[0705] The first cell line used to produce J695 (ALP 903) resulted
in lower yields of the antibody from culture than a second cell
line, ALP 905. To assure that the ALP 905-produced J695 was
functionally identical to that produced from ALP 903, both batches
of antibodies were assessed for IL-12 affinity, for the ability to
block IL-12 binding to cellular receptors, for the ability to
inhibit IFN-.gamma. induction by IL-12, and for the ability to
inhibit IL-12-mediated PHA blast proliferation.
[0706] The affinities of J695 batches ALP 903 and ALP 905 for IL-12
were determined by measuring the kinetic rate constants of binding
to IL-12 by surface plasmon resonance studies (BIAcore analyses).
The off-rate constant (k.sub.d) and the on-rate constant (k.sub.a)
of antibody batches ALP903 and ALP905 for binding to rhIL-12 were
determined in three experiments (as described in Example 3). The
affinity, K.sub.d, of binding to IL-12 was calculated by dividing
the off-rate constant by the on-rate constant. K.sub.d was
calculated for each separate experiment and then averaged. The
results showed that the determined kinetic parameters and affinity
of binding to rhIL-12 were very similar for J695 batches ALP 903
and ALP 905: the calculated K.sub.d was
1.19.+-.0.22.times.10.sup.-10 M for batch ALP 903 and
1.49.+-.0.47.times.10.sup.-10 M for batch ALP 905 (see Table
13).
[0707] The ability of J695 derived from both ALP 903 and ALP 905 to
block binding of rhIL-12 to IL-12 receptors on human PHA-activated
T-lymphoblasts was assessed (see Example 3). Each sample of J695
was tested at a starting concentration of 1.times.10.sup.-8 with
10-fold serial dilutions. The antibody was preincubated for 1 hour
at 37.degree. C. with 50 pM [.sup.125I]-human IL-12 in binding
buffer. PHA blast cells were added to the
antibody/[.sup.125I]-human IL-12 mixture and incubated for 2 h at
room temperature. Cell bound radioactivity was separated from free
[.sup.125 I]-IL-12 by centrifugation and washing steps, and %
inhibition was calculated. The IC.sub.50 values for J695 were
determined from the inhibition curves using 4-parameter curve
fitting and were confirmed by two independent experiments.
Incubations were carried out in duplicate. The results for the two
batches of J695 were very similar (see Table 13).
[0708] The ability of J695 from both ALP 903 and ALP 905 cells to
inhibit rhIL-12-induced IFN-.gamma. production by human
PHA-activated lymphoblasts in vitro was assessed. Serial dilutions
of J695 were preincubated with 200 pg/mL rhIL-12 for 1 h at
37.degree. C. PHA lymphoblast cells were added and incubated for 18
hours at 37.degree. C. After incubation, cell free supernatant was
withdrawn and the level of human IFN-.gamma. determined by ELISA.
The IC.sub.50 values from the inhibition curves were plotted
against the antibody concentration using 4-parameter curve fitting.
The results demonstrate that the ability of the two batches to
inhibit IFN-.gamma. production is very similar.
[0709] The in vitro PHA blast cell proliferation assay was used to
measure the neutralization capacity of ALP 903 and ALP 905 J695 for
rhIL-12. Serial dilutions of J695 of each type were preincubated
with 230 pg/mL human IL-12 for 1 h at 37.degree. C. Next PHA blast
cells were added and incubated for 3 days at 37.degree. C. The
cells were then labeled for 6 hours with 1 .gamma.Ci/well
[.sup.3H]-thymidine. The cultures were harvested and
[.sup.3H]-thymidine incorporation measured. Non-specific
proliferation (background) was measured in the absence of rhIL-12.
The IC.sub.50 values for ALP 903 and ALP 905 J695 were found to be
very similar and are set forth in Table 13.
[0710] The activity of the J695 antibodies in neutralizing rhIL-12
activity, in blocking IL-12 binding to cell surface receptors, and
in binding to rhIL-12 did not significantly differ from batch ALP
903 to batch ALP 905, and thus the antibodies produced from these
two different cell types were equivalent.
TABLE-US-00017 TABLE 13 Comparison of the Properties of J695 lots
ALP 903 and ALP 905 PHA blast IFN-.gamma. k.sub.a, On-rate k.sub.d,
Off-rate RB assay Assay IC.sub.50 Assay IC.sub.50 Antibody
(M.sup.-1, s.sup.-1) (s.sup.-1) K.sub.d (M) IC.sub.50 (M) (M) (M)
J695 3.75 .times. 10.sup.5 4.46 .times. 10.sup.-5 1.19 .times.
10.sup.-5 3.4 .times. 10.sup.-11 5.5 .times. 10.sup.-12 5.8 .times.
10.sup.-12 ALP 903 J695 3.91 .times. 10.sup.5 5.59 .times.
10.sup.-5 1.49 .times. 10.sup.-10 3.0 .times. 10.sup.-11 4.4
.times. 10.sup.-12 4.3 .times. 10.sup.-12 ALP 905
EQUIVALENTS
[0711] Those skilled in the art will recognize, or be able to
ascertain using no more than routine experimentation, many
equivalents to the specific embodiments of the invention described
herein. Such equivalents are intended to be encompassed by the
following claims.
Sequence CWU 1
1
67516PRTHomo sapiensMISC_FEATURE(1)..(1)Xaa at position 1 could be
either His or Ser 1Xaa Gly Ser Xaa Asp Xaa1 5212PRTHomo
sapiensMISC_FEATURE(2)..(2)Xaa at position 2 could be either Ser or
Thr 2Gln Xaa Tyr Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa1 5
10317PRTHomo sapiens 3Phe Ile Arg Tyr Asp Gly Ser Asn Lys Tyr Tyr
Ala Asp Ser Val Lys1 5 10 15Gly47PRTHomo
sapiensMISC_FEATURE(1)..(1)Xaa at position 1 could be either Gly or
Tyr 4Xaa Asn Xaa Xaa Arg Pro Ser1 559PRTHomo
sapiensMISC_FEATURE(5)..(5)Xaa represents either Ser or Glu 5Phe
Thr Phe Ser Xaa Tyr Gly Met His1 5613PRTHomo
sapiensMISC_FEATURE(1)..(1)Xaa at position 1 could be either Ser or
Thr 6Xaa Gly Xaa Xaa Ser Asn Ile Xaa Xaa Xaa Xaa Val Xaa1 5
107115PRTHomo sapiensMISC_FEATURE(6)..(6)Xaa at position 6 could be
either Gln or Glu 7Gln Val Gln Leu Val Xaa Ser Gly Gly Gly Val Val
Gln Pro Gly Xaa1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe
Thr Phe Ser Xaa Tyr20 25 30Gly Met His Trp Val Arg Gln Ala Pro Gly
Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly Ser Asn
Lys Tyr Tyr Ala Asp Ser Asx50 55 60Lys Gly Arg Phe Thr Ile Ser Arg
Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Xaa Ser Leu
Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Xaa Xaa Xaa Gly Ser
Xaa Asp Xaa Trp Gly Gln Gly Thr Met Val Thr100 105 110Val Ser
Ser1158112PRTHomo sapiensMISC_FEATURE(1)..(1)Xaa at position 1
could be either Ser or Gln 8Xaa Xaa Val Leu Thr Gln Pro Pro Ser Val
Ser Gly Xaa Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Xaa Gly Xaa
Xaa Ser Asn Ile Xaa Xaa Xaa20 25 30Xaa Val Xaa Trp Tyr Gln Gln Leu
Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Xaa Asn Xaa Xaa Arg
Pro Ser Gly Val Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser Gly Thr
Ser Ala Ser Leu Ala Ile Thr Gly Xaa Gln65 70 75 80Ala Glu Asp Glu
Ala Asp Tyr Tyr Cys Gln Xaa Tyr Xaa Xaa Xaa Xaa85 90 95Xaa Xaa Xaa
Xaa Xaa Phe Gly Thr Gly Thr Lys Val Thr Val Leu Gly100 105
11096PRTHomo sapiensMISC_FEATURE(2)..(2)Xaa at position 2 could be
either Gly, Val, Cys or His 9His Xaa Xaa Xaa Xaa Xaa1 51012PRTHomo
sapiensMISC_FEATURE(4)..(4)Xaa at position 4 could be either Asp or
Ser 10Gln Ser Tyr Xaa Xaa Xaa Thr His Pro Ala Leu Leu1 5
101117PRTHomo sapiensMISC_FEATURE(1)..(1)Xaa at position 1 could be
either Phe, Thr or Tyr 11Xaa Ile Xaa Tyr Xaa Xaa Ser Xaa Lys Xaa
Tyr Ala Asp Ser Val Lys1 5 10 15Gly127PRTHomo
sapiensMISC_FEATURE(1)..(1)Xaa at position 1 could be either Gly,
Tyr, Ser, Thr, Asn or Gln 12Xaa Asn Asp Gln Arg Pro Ser1
5139PRTHomo sapiensMISC_FEATURE(4)..(5)Xaa at position 4 and 5
represents any amino acid 13Phe Thr Phe Xaa Xaa Xaa Xaa Met His1
51413PRTHomo sapiensMISC_FEATURE(9)..(9)Xaa at position 9 could be
either Ser, Cys, Arg, Asn, Asp or Thr 14Ser Gly Gly Arg Ser Asn Ile
Gly Xaa Xaa Xaa Val Lys1 5 1015114PRTHomo
sapiensMISC_FEATURE(5)..(5)Xaa at position 5 could be either Gln or
Glu 15Gln Val Gln Val Xaa Ser Gly Gly Gly Val Val Gln Pro Gly Arg
Ser1 5 10 15Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Xaa
Tyr Gly20 25 30Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val Ala35 40 45Phe Ile Arg Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala
Asp Ser Val Lys50 55 60Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys
Asn Thr Leu Tyr Leu65 70 75 80Gln Met Xaa Ser Leu Arg Ala Glu Asp
Thr Ala Val Tyr Tyr Cys Lys85 90 95Thr His Gly Ser His Asp Asn Trp
Gly Gln Gly Thr Met Val Thr Val100 105 110Ser Ser16112PRTHomo
sapiensMISC_FEATURE(1)..(1)Xaa at position 1 could be either Ser or
Gln 16Xaa Xaa Val Leu Thr Gln Pro Pro Ser Val Ser Gly Xaa Pro Gly
Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser Gly Xaa Arg Ser Asn Ile Gly
Ser Asn20 25 30Thr Val Lys Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro
Lys Leu Leu35 40 45Ile Tyr Xaa Asn Asp Gln Arg Pro Ser Gly Val Pro
Asp Arg Phe Ser50 55 60Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala
Ile Thr Gly Xaa Gln65 70 75 80Ala Glu Asp Glu Ala Asp Tyr Tyr Cys
Gln Ser Tyr Asp Arg Xaa Thr85 90 95His Pro Ala Leu Leu Phe Gly Thr
Gly Thr Lys Val Thr Val Leu Gly100 105 110176PRTHomo sapiens 17His
Gly Ser His Asp Asn1 51812PRTHomo sapiens 18Gln Ser Tyr Asp Arg Gly
Thr His Pro Ala Leu Leu1 5 101917PRTHomo sapiens 19Phe Ile Arg Tyr
Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly207PRTHomo sapiens 20Gly Asn Asp Gln Arg Pro Ser1 5219PRTHomo
sapiens 21Phe Thr Phe Ser Ser Tyr Gly Met His1 52213PRTHomo sapiens
22Ser Gly Gly Arg Ser Asn Ile Gly Ser Asn Thr Val Lys1 5
1023115PRTHomo sapiens 23Gln Val Gln Leu Val Gln Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Lys
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Lys Thr His
Gly Ser His Asp Asn Trp Gly Gln Gly Thr Met Val Thr100 105 110Val
Ser Ser11524112PRTHomo sapiens 24Ser Tyr Val Leu Thr Gln Pro Pro
Ser Val Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser
Gly Gly Arg Ser Trp Ile Gly Ser Asn20 25 30Thr Val Lys Trp Tyr Gln
Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Gly Asn Asp
Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser
Gly Thr Ser Ala Ser Leu Ala Ile Thr Gly Val Gln65 70 75 80Ala Glu
Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Arg Gly Thr85 90 95His
Pro Ala Leu Leu Phe Gly Thr Gly Thr Lys Val Thr Val Leu Gly100 105
110256PRTHomo sapiens 25His Gly Ser His Asp Asn1 52612PRTHomo
sapiens 26Gln Ser Tyr Asp Arg Tyr Thr His Pro Ala Leu Leu1 5
102717PRTHomo sapiens 27Phe Ile Arg Tyr Asp Gly Ser Asn Lys Tyr Tyr
Ala Asp Ser Val Lys1 5 10 15Gly287PRTHomo sapiens 28Tyr Asn Asp Gln
Arg Pro Ser1 5299PRTHomo sapiens 29Phe Thr Phe Ser Ser Tyr Gly Met
His1 53013PRTHomo sapiens 30Ser Gly Ser Arg Ser Asn Ile Gly Ser Asn
Thr Val Lys1 5 1031115PRTHomo sapiens 31Gln Val Gln Leu Val Glu Ser
Gly Gly Gly Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val
Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile Arg
Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg
Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu
Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90
95Lys Thr His Gly Ser His Asp Asn Trp Gly Gln Gly Thr Met Val
Thr100 105 110Val Ser Ser11532112PRTHomo sapiens 32Gln Ser Val Leu
Thr Gln Pro Pro Ser Val Ser Gly Ala Pro Gly Gln1 5 10 15Arg Val Thr
Ile Ser Cys Ser Gly Ser Arg Ser Asn Ile Gly Ser Asn20 25 30Thr Val
Lys Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile
Tyr Tyr Asn Asp Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser50 55
60Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Thr Gly Leu Gln65
70 75 80Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Arg Tyr
Thr85 90 95His Pro Ala Leu Leu Phe Gly Thr Gly Thr Lys Val Thr Val
Leu Gly100 105 11033115PRTHomo sapiens 33Gln Val Gln Leu Val Gln
Ser Gly Gly Gly Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile
Arg Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75
80Leu Gln Met Lys Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85
90 95Thr Thr Ser Gly Ser Tyr Asp Tyr Trp Gly Gln Gly Thr Met Val
Thr100 105 110Val Ser Ser11534112PRTHomo sapiens 34Ser Tyr Val Leu
Thr Gln Pro Pro Ser Val Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr
Ile Ser Cys Ser Gly Gly Arg Ser Asn Ile Gly Ser Asn20 25 30Thr Val
Lys Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile
Tyr Gly Asn Asp Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser50 55
60Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Thr Gly Val Gln65
70 75 80Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Ser Ser
Leu85 90 95Arg Gly Ser Arg Val Phe Gly Thr Gly Thr Lys Val Thr Val
Leu Gly100 105 11035115PRTHomo sapiens 35Gln Val Gln Leu Val Glu
Ser Gly Gly Gly Val Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile
Arg Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85
90 95Ala Lys Ser Gly Ser Tyr Asp Tyr Trp Gly Gln Gly Thr Met Val
Thr100 105 110Val Ser Ser11536112PRTHomo
sapiensMISC_FEATURE(32)..(32)Xaa at position 32 represents either
Gly or Tyr 36Gln Ser Val Leu Thr Gln Pro Pro Ser Val Ser Gly Ala
Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Thr Gly Ser Ser Ser Asn
Ile Gly Ala Xaa20 25 30Asp Val His Trp Tyr Gln Gln Leu Pro Gly Thr
Ala Pro Lys Leu Leu35 40 45Ile Tyr Gly Asn Ser Asn Arg Pro Ser Gly
Val Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser Gly Thr Ser Ala Ser
Leu Ala Ile Thr Gly Leu Gln65 70 75 80Ala Glu Asp Glu Ala Asp Tyr
Tyr Cys Gln Ser Tyr Asp Ser Ser Leu85 90 95Ser Gly Ser Arg Val Phe
Gly Thr Gly Thr Lys Val Thr Val Leu Gly100 105 11037115PRTHomo
sapiens 37Gln Val Gln Leu Val Gln Ser Gly Gly Gly Val Val Gln Pro
Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe
Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala Pro Gly Lys Gly
Leu Glu Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly Ser Asn Lys Tyr
Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn
Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Lys Ser Leu Arg Ala
Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Thr Thr His Gly Ser His Asp
Asn Trp Gly Gln Gly Thr Met Val Thr100 105 110Val Ser
Ser11538112PRTHomo sapiens 38Ser Tyr Val Leu Thr Gln Pro Pro Ser
Val Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser Gly
Gly Arg Ser Asn Ile Gly Ser Asn20 25 30Thr Val Lys Trp Tyr Gln Gln
Leu Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Gly Asn Asp Gln
Arg Pro Ser Gly Val Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser Gly
Thr Ser Ala Ser Leu Ala Ile Thr Gly Val Gln65 70 75 80Ala Glu Asp
Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Ser Ser Leu85 90 95Arg Gly
Ser Arg Val Phe Gly Thr Gly Thr Lys Val Thr Val Leu Gly100 105
11039115PRTHomo sapiens 39Gln Val Gln Leu Val Gln Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Lys
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Thr Thr Ser
Gly Ser Tyr Asp Tyr Trp Gly Gln Gly Thr Met Val Thr100 105 110Val
Ser Ser11540112PRTHomo sapiens 40Ser Tyr Val Leu Thr Gln Pro Pro
Ser Val Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser
Gly Gly Arg Ser Asn Ile Gly Ser Asn20 25 30Thr Val Lys Trp Tyr Gln
Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Gly Asn Asp
Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser
Gly Thr Ser Ala Ser Leu Ala Ile Thr Gly Val Gln65 70 75 80Ala Glu
Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Arg Gly Phe85 90 95Thr
Gly Ser Arg Val Phe Gly Thr Gly Thr Lys Val Thr Val Leu Gly100 105
11041115PRTHomo sapiens 41Gln Val Gln Leu Val Gln Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Lys
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Thr Thr Ser
Gly Ser Tyr Asp Tyr Trp Gly Gln Gly Thr Met Val Thr100 105 110Val
Ser Ser11542112PRTHomo sapiens 42Ser Tyr Val Leu Thr Gln Pro Pro
Ser Val Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser
Gly Gly Arg Ser Asn Ile Gly Ser Asn20 25 30Thr Val Lys Trp Tyr Gln
Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Gly Asn Asp
Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser
Gly Thr Ser Ala Ser Leu Ala Ile Thr Gly Val Gln65 70 75 80Ala Glu
Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Ser Ser Leu85 90 95Trp
Gly Ser Arg Val Phe Gly Thr Gly Thr Lys Val Thr Val Leu Gly100 105
11043115PRTHomo sapiens 43Gln Val Gln Leu Val Gln Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly
Ser Asn Lys Tyr
Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn
Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Lys Ser Leu Arg Ala
Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Thr Thr His Gly Ser His Asp
Asn Trp Gly Gln Gly Thr Met Val Thr100 105 110Val Ser
Ser11544112PRTHomo sapiens 44Ser Tyr Val Leu Thr Gln Pro Pro Ser
Val Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser Gly
Gly Arg Ser Asn Ile Gly Ser Asn20 25 30Thr Val Lys Trp Tyr Gln Gln
Leu Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Gly Asn Asp Gln
Arg Pro Ser Gly Val Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser Gly
Thr Ser Ala Ser Leu Ala Ile Thr Gly Val Gln65 70 75 80Ala Glu Asp
Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Arg Gly Phe85 90 95Thr Gly
Ser Arg Val Phe Gly Thr Gly Thr Lys Val Thr Val Leu Gly100 105
11045115PRTHomo sapiens 45Gln Val Gln Leu Val Gln Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Lys
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Thr Thr His
Gly Ser His Asp Asn Trp Gly Gln Gly Thr Met Val Thr100 105 110Val
Ser Ser11546112PRTHomo sapiens 46Ser Tyr Val Leu Thr Gln Pro Pro
Ser Val Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser
Gly Gly Arg Ser Asn Ile Gly Ser Asn20 25 30Thr Val Lys Trp Tyr Gln
Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Gly Asn Asp
Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser
Gly Thr Ser Ala Ser Leu Ala Ile Thr Gly Val Gln65 70 75 80Ala Glu
Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Ser Ser Leu85 90 95Trp
Gly Ser Arg Val Phe Gly Thr Gly Thr Lys Val Thr Val Leu Gly100 105
11047115PRTHomo sapiens 47Gln Val Gln Leu Val Gln Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Lys
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Lys Thr His
Gly Ser His Asp Asn Trp Gly Gln Gly Thr Met Val Thr100 105 110Val
Ser Ser11548112PRTHomo sapiens 48Ser Tyr Val Leu Thr Gln Pro Pro
Ser Val Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser
Gly Ser Arg Ser Asn Ile Gly Ser Asn20 25 30Thr Val Lys Trp Tyr Gln
Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Gly Asn Asp
Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser
Gly Thr Ser Ala Ser Leu Ala Ile Thr Gly Val Gln65 70 75 80Ala Glu
Asp Glu Ala Asp Tyr Tyr Cys Gln Thr Tyr Asp Lys Gly Phe85 90 95Thr
Gly Ser Ser Val Phe Gly Thr Gly Thr Lys Val Thr Val Leu Gly100 105
11049115PRTHomo sapiens 49Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Lys Thr His
Gly Ser His Asp Asn Trp Gly Gln Gly Thr Met Val Thr100 105 110Val
Ser Ser11550112PRTHomo sapiens 50Gln Ser Val Leu Thr Gln Pro Pro
Ser Val Ser Gly Ala Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser
Gly Ser Arg Ser Asn Ile Gly Ser Asn20 25 30Thr Val Lys Trp Tyr Gln
Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Gly Asn Asp
Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser
Gly Thr Ser Ala Ser Leu Ala Ile Thr Gly Leu Gln65 70 75 80Ala Glu
Asp Glu Ala Asp Tyr Tyr Cys Gln Thr Tyr Asp Lys Gly Phe85 90 95Thr
Gly Ser Ser Val Phe Gly Thr Gly Thr Lys Val Thr Val Leu Gly100 105
11051115PRTHomo sapiens 51Gln Val Gln Leu Val Gln Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Lys
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Thr Thr His
Gly Ser His Asp Thr Trp Gly Gln Gly Thr Met Val Thr100 105 110Val
Ser Ser11552112PRTHomo sapiens 52Ser Tyr Val Leu Thr Gln Pro Pro
Ser Val Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser
Gly Gly Arg Ser Asn Ile Gly Ser Asn20 25 30Thr Val Lys Trp Tyr Gln
Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Gly Asn Asp
Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser
Gly Thr Ser Ala Ser Leu Ala Ile Thr Gly Val Gln65 70 75 80Ala Glu
Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Ser Ser Leu85 90 95Trp
Gly Thr Arg Val Phe Gly Thr Gly Thr Lys Val Thr Val Leu Gly100 105
11053115PRTHomo sapiens 53Gln Val Gln Leu Val Gln Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Lys
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Thr Thr His
Gly Ser His Asp Asn Trp Gly Gln Gly Thr Met Val Thr100 105 110Val
Ser Ser11554112PRTHomo sapiens 54Ser Tyr Val Leu Thr Gln Pro Pro
Ser Val Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser
Gly Gly Arg Ser Asn Ile Val Ser Asn20 25 30Thr Val Lys Trp Tyr Gln
Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Gly Asn Asp
Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser
Gly Thr Ser Ala Ser Leu Ala Ile Thr Gly Val Gln65 70 75 80Ala Glu
Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Arg Gly Phe85 90 95Thr
Gly Ser Arg Val Phe Gly Thr Gly Thr Lys Val Thr Val Leu Gly100 105
11055115PRTHomo sapiens 55Gln Val Gln Leu Val Gln Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Lys
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Thr Thr His
Gly Ser His Asp Asn Trp Gly Gln Gly Thr Met Val Thr100 105 110Val
Ser Ser11556112PRTHomo sapiens 56Ser Tyr Val Leu Thr Gln Pro Pro
Ser Val Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser
Gly Gly Arg Ser Asn Ile Val Ser Asn20 25 30Thr Val Lys Trp Tyr Gln
Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Gly Asn Asp
Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser
Gly Thr Ser Ala Ser Leu Ala Ile Thr Gly Val Gln65 70 75 80Ala Glu
Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Arg Gly Phe85 90 95Thr
Gly Ala Arg Val Phe Gly Thr Gly Thr Lys Val Thr Val Leu Gly100 105
11057115PRTHomo sapiens 57Gln Val Gln Leu Val Gln Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Lys
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Lys Thr His
Gly Ser His Asp Asn Trp Gly Gln Gly Thr Met Val Thr100 105 110Val
Ser Ser11558112PRTHomo sapiens 58Ser Tyr Val Leu Thr Gln Pro Pro
Ser Val Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser
Gly Gly Arg Ser Asn Ile Gly Ser Asn20 25 30Thr Val Lys Trp Tyr Gln
Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Gly Asn Asp
Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser
Gly Thr Ser Ala Ser Leu Ala Ile Thr Gly Val Gln65 70 75 80Ala Glu
Asp Glu Ala Asp Tyr Tyr Cys Gln Thr Tyr Asp Lys Gly Phe85 90 95Thr
Gly Ser Ser Val Phe Gly Thr Gly Thr Lys Val Thr Val Leu Gly100 105
11059115PRTHomo sapiens 59Gln Val Gln Leu Val Gln Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Lys
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Lys Thr His
Gly Ser His Asp Asn Trp Gly Gln Gly Thr Met Val Thr100 105 110Val
Ser Ser11560112PRTHomo sapiens 60Ser Tyr Val Leu Thr Gln Pro Pro
Ser Val Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser
Gly Gly Arg Ser Asn Ile Gly Ser Asn20 25 30Thr Val Lys Trp Tyr Gln
Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Gly Asn Asp
Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser
Gly Thr Ser Ala Ser Leu Ala Ile Thr Gly Val Gln65 70 75 80Ala Glu
Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Glu Arg Gly Phe85 90 95Thr
Gly Ser Met Val Phe Gly Thr Gly Thr Lys Val Thr Val Leu Gly100 105
11061115PRTHomo sapiens 61Gln Val Gln Leu Val Gln Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Lys
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Lys Thr His
Gly Ser His Asp Asn Trp Gly Gln Gly Thr Met Val Thr100 105 110Val
Ser Ser11562112PRTHomo sapiens 62Ser Tyr Val Leu Thr Gln Pro Pro
Ser Val Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser
Gly Gly Arg Ser Asn Ile Gly Ser Asn20 25 30Thr Val Lys Trp Tyr Gln
Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Gly Asn Asp
Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser
Gly Thr Ser Ala Ser Leu Ala Ile Thr Gly Val Gln65 70 75 80Ala Glu
Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Arg Gly Thr85 90 95His
Pro Leu Thr Ile Phe Gly Thr Gly Thr Lys Val Thr Val Leu Gly100 105
11063115PRTHomo sapiens 63Gln Val Gln Leu Val Gln Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Lys
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Lys Thr His
Gly Ser His Asp Asn Trp Gly Gln Gly Thr Met Val Thr100 105 110Val
Ser Ser11564112PRTHomo sapiens 64Ser Tyr Val Leu Thr Gln Pro Pro
Ser Val Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser
Gly Gly Arg Ser Asn Ile Gly Ser Asn20 25 30Thr Val Lys Trp Tyr Gln
Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Gly Asn Asp
Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser
Gly Thr Ser Ala Ser Leu Ala Ile Thr Gly Val Gln65 70 75 80Ala Glu
Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Arg Gly Ser85 90 95His
Pro Ala Leu Thr Phe Gly Thr Gly Thr Lys Val Thr Val Leu Gly100 105
11065115PRTHomo sapiens 65Gln Val Gln Leu Val Gln Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Lys
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Lys Thr His
Gly Ser His Asp Asn Trp Gly Gln Gly Thr Met Val Thr100 105 110Val
Ser Ser11566112PRTHomo sapiens 66Ser Tyr Val Leu Thr Gln Pro Pro
Ser Val Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser
Gly Gly Arg Ser Asn Ile Gly Ser Asn20 25
30Thr Val Lys Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu35
40 45Ile Tyr Gly Asn Asp Gln Arg Pro Ser Gly Val Pro Asp Arg Phe
Ser50 55 60Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Thr Gly
Val Gln65 70 75 80Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr
Asp Arg Gly Thr85 90 95His Pro Leu Thr Met Phe Gly Thr Gly Thr Lys
Val Thr Val Leu Gly100 105 11067115PRTHomo sapiens 67Gln Val Gln
Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg1 5 10 15Ser Leu
Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly
Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val35 40
45Ala Phe Ile Arg Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu
Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val
Tyr Tyr Cys85 90 95Lys Thr His Gly Ser His Asp Asn Trp Gly Gln Gly
Thr Met Val Thr100 105 110Val Ser Ser11568112PRTHomo sapiens 68Gln
Ser Val Leu Thr Gln Pro Pro Ser Val Ser Gly Ala Pro Gly Gln1 5 10
15Arg Val Thr Ile Ser Cys Ser Gly Ser Arg Ser Asn Ile Gly Ser Asn20
25 30Thr Val Lys Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro Lys Leu
Leu35 40 45Ile Tyr Gly Asn Asp Gln Arg Pro Ser Gly Val Pro Asp Arg
Phe Ser50 55 60Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Thr
Gly Leu Gln65 70 75 80Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Gln Ser
Tyr Asp Arg Gly Thr85 90 95His Pro Leu Thr Met Phe Gly Thr Gly Thr
Lys Val Thr Val Leu Gly100 105 11069115PRTHomo sapiens 69Gln Val
Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg1 5 10 15Ser
Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr20 25
30Gly Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val35
40 45Ala Phe Ile Arg Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser
Val50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr
Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala
Val Tyr Tyr Cys85 90 95Lys Thr His Gly Ser His Asp Asn Trp Gly Gln
Gly Thr Met Val Thr100 105 110Val Ser Ser11570112PRTHomo sapiens
70Gln Ser Val Leu Thr Gln Pro Pro Ser Val Ser Gly Ala Pro Gly Gln1
5 10 15Arg Val Thr Ile Ser Cys Ser Gly Ser Arg Ser Asn Ile Gly Ser
Asn20 25 30Thr Val Lys Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro Lys
Leu Leu35 40 45Ile Tyr Gly Asn Asp Gln Arg Pro Ser Gly Val Pro Asp
Arg Phe Ser50 55 60Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile
Thr Gly Leu Gln65 70 75 80Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Gln
Ser Tyr Asp Arg Gly Thr85 90 95His Pro Ala Leu Leu Phe Gly Thr Gly
Thr Lys Val Thr Val Leu Gly100 105 11071115PRTHomo sapiens 71Gln
Val Gln Leu Val Gln Ser Gly Gly Gly Val Val Gln Pro Gly Arg1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Glu Tyr20
25 30Gly Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp
Val35 40 45Ala Phe Ile Arg Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp
Ser Val50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn
Thr Leu Tyr65 70 75 80Leu Gln Met Lys Ser Leu Arg Ala Glu Asp Thr
Ala Val Tyr Tyr Cys85 90 95Lys Thr His Gly Ser His Asp Asn Trp Gly
Gln Gly Thr Met Val Thr100 105 110Val Ser Ser11572112PRTHomo
sapiens 72Gln Ser Val Leu Thr Gln Pro Pro Ser Val Ser Gly Ala Pro
Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser Gly Ser Arg Ser Asn Ile
Gly Ser Asn20 25 30Thr Val Lys Trp Tyr Gln Gln Leu Pro Gly Thr Ala
Pro Lys Leu Leu35 40 45Ile Tyr Gly Asn Asp Gln Arg Pro Ser Gly Val
Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu
Ala Ile Thr Gly Leu Gln65 70 75 80Ala Glu Asp Glu Ala Asp Tyr Tyr
Cys Gln Ser Tyr Asp Arg Gly Thr85 90 95His Pro Ala Leu Leu Phe Gly
Thr Gly Thr Lys Val Thr Val Leu Gly100 105 11073115PRTHomo sapiens
73Gln Val Gln Leu Val Gln Ser Gly Gly Gly Val Val Gln Pro Gly Arg1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser
Tyr20 25 30Gly Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala
Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys
Asn Thr Leu Tyr65 70 75 80Leu Gln Met Lys Ser Leu Arg Ala Glu Asp
Thr Ala Val Tyr Tyr Cys85 90 95Lys Thr His Gly Ser His Asp Asn Trp
Gly Gln Gly Thr Met Val Thr100 105 110Val Ser Ser11574112PRTHomo
sapiens 74Gln Ser Val Leu Thr Gln Pro Pro Ser Val Ser Gly Ala Pro
Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser Gly Ser Arg Ser Asn Ile
Gly Ser Asn20 25 30Thr Val Lys Trp Tyr Gln Gln Leu Pro Gly Thr Ala
Pro Lys Leu Leu35 40 45Ile Tyr Tyr Asn Asp Gln Arg Pro Ser Gly Val
Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu
Ala Ile Thr Gly Leu Gln65 70 75 80Ala Glu Asp Glu Ala Asp Tyr Tyr
Cys Gln Ser Tyr Asp Arg Gly Thr85 90 95His Pro Ala Leu Leu Phe Gly
Thr Gly Thr Lys Val Thr Val Leu Gly100 105 11075115PRTHomo sapiens
75Gln Val Gln Leu Val Gln Ser Gly Gly Gly Val Val Gln Pro Gly Arg1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser
Tyr20 25 30Gly Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala
Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys
Asn Thr Leu Tyr65 70 75 80Leu Gln Met Lys Ser Leu Arg Ala Glu Asp
Thr Ala Val Tyr Tyr Cys85 90 95Lys Thr His Gly Ser His Asp Asn Trp
Gly Gln Gly Thr Met Val Thr100 105 110Val Ser Ser11576112PRTHomo
sapiens 76Gln Ser Val Leu Thr Gln Pro Pro Ser Val Ser Gly Ala Pro
Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser Gly Ser Arg Ser Asn Ile
Gly Ser Asn20 25 30Thr Val Lys Trp Tyr Gln Gln Leu Pro Gly Thr Ala
Pro Lys Leu Leu35 40 45Ile Tyr Gly Asn Asp Gln Arg Pro Ser Gly Val
Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu
Ala Ile Thr Gly Leu Gln65 70 75 80Ala Glu Asp Glu Ala Asp Tyr Tyr
Cys Gln Ser Tyr Asp Arg Tyr Thr85 90 95His Pro Ala Leu Leu Phe Gly
Thr Gly Thr Lys Val Thr Val Leu Gly100 105 110776PRTHomo sapiens
77Ser Gly Ser Tyr Asp Tyr1 5786PRTHomo sapiens 78His Gly Ser His
Asp Asn1 5796PRTHomo sapiens 79His Gly Ser Tyr Asp Tyr1 5806PRTHomo
sapiens 80Arg Arg Arg Ser Asn Tyr1 5816PRTHomo sapiens 81Ser Gly
Ser Ile Asp Tyr1 5826PRTHomo sapiens 82His Gly Ser His Asp Asp1
5836PRTHomo sapiens 83His Gly Ser His Asp Asn1 58412PRTHomo sapiens
84Thr Thr His Gly Ser His Asp Asn Trp Gly Gln Gly1 5 108512PRTHomo
sapiens 85Ala Lys His Gly Ser His Asp Asn Trp Gly Gln Gly1 5
108612PRTHomo sapiens 86Thr Thr His Gly Ser His Asp Asn Trp Ser Gln
Gly1 5 108712PRTHomo sapiens 87Thr Thr His Gly Ser His Asp Thr Trp
Gly Gln Gly1 5 108812PRTHomo sapiens 88Lys Thr His Gly Ser His Asp
Asn Trp Gly Gln Gly1 5 108912PRTHomo sapiens 89Lys Thr His Gly Ser
His Asp Asn Trp Gly His Gly1 5 109012PRTHomo sapiens 90Thr Thr His
Gly Ser His Asp Asn Trp Ser Gln Gly1 5 109112PRTHomo sapiens 91Thr
Thr His Arg Ser His Asn Asn Trp Gly Gln Gly1 5 10928PRTHomo sapiens
92Thr Thr His Gly Ser His Asp Asn1 5938PRTHomo sapiens 93Thr Thr
His Gly Ser His Asp Thr1 5948PRTHomo sapiens 94Thr Lys His Gly Ser
His Asp Asn1 5958PRTHomo sapiens 95Thr Thr Gln Gly Arg His Asp Asn1
5968PRTHomo sapiens 96Lys Thr Arg Gly Arg His Asp Asn1 5978PRTHomo
sapiens 97Thr Thr His Gly Ser His Asp Lys1 5988PRTHomo sapiens
98Thr Thr His Gly Ser His Asp Asp1 5998PRTHomo sapiens 99Lys Thr
His Gly Ser His Asp Asn1 51008PRTHomo sapiens 100Lys Thr His Gly
Ser His Asp Asn1 51018PRTHomo sapiens 101Thr Thr His Gly Ser His
Asp Asn1 51028PRTHomo sapiens 102Thr Thr Ser Gly Ser Tyr Asp Tyr1
51038PRTHomo sapiens 103Thr Thr His Gly Ser His Asp Asn1
51048PRTHomo sapiens 104Thr Thr His Gly Ser Gln Asp Asn1
51058PRTHomo sapiens 105Ala Thr His Gly Ser Gln Asp Asn1
51066PRTHomo sapiens 106His Gly Ser Gln Asp Thr1 51076PRTHomo
sapiens 107Ser Gly Ser Tyr Asp Tyr1 51086PRTHomo sapiens 108His Gly
Ser Gln Asp Asn1 51099PRTHomo sapiens 109Cys Lys Thr His Gly Ser
His Asp Asn1 511012PRTHomo sapiens 110Gln Ser Tyr Asp Ser Ser Leu
Arg Gly Ser Arg Val1 5 1011112PRTHomo sapiens 111Gln Ser Tyr Asp
Arg Gly Phe Thr Gly Ser Arg Val1 5 1011212PRTHomo sapiens 112Gln
Ser Tyr Asp Ser Ser Leu Arg Gly Ser Arg Val1 5 1011312PRTHomo
sapiens 113Gln Ser Tyr Asp Ser Ser Leu Thr Gly Ser Arg Val1 5
1011412PRTHomo sapiens 114Gln Ser Tyr Asp Ser Ser Leu Trp Gly Ser
Arg Val1 5 1011512PRTHomo sapiens 115Gln Thr Tyr Asp Ile Ser Glu
Ser Gly Ser Arg Val1 5 1011612PRTHomo sapiens 116Gln Ser Tyr Asp
Arg Gly Phe Thr Gly Ser Arg Val1 5 1011712PRTHomo sapiens 117Gln
Thr Tyr Asp Arg Gly Phe Thr Gly Ser Arg Val1 5 1011812PRTHomo
sapiens 118Gln Thr Tyr Asp Lys Gly Phe Thr Gly Ser Ser Val1 5
1011912PRTHomo sapiens 119Gln Ser Tyr Asp Arg Arg Phe Thr Gly Ser
Arg Val1 5 1012012PRTHomo sapiens 120Gln Ser Tyr Asp Trp Asn Phe
Thr Gly Ser Arg Val1 5 1012112PRTHomo sapiens 121Gln Ser Tyr Asp
Arg Gly Phe Thr Gly Ser Arg Val1 5 1012212PRTHomo sapiens 122Gln
Ser Tyr Asp Asn Gly Phe Thr Gly Ser Arg Val1 5 1012312PRTHomo
sapiens 123Gln Ser Tyr Asp Asn Ala Val Thr Ala Ser Lys Val1 5
1012412PRTHomo sapiens 124Gln Ser Tyr Asp Arg Gly Phe Thr Gly Ser
Arg Val1 5 1012512PRTHomo sapiens 125Gln Ser Tyr Asp Ser Ser Leu
Trp Gly Thr Arg Val1 5 1012612PRTHomo sapiens 126Gln Ser Tyr Asp
Arg Asp Phe Thr Gly Ser Arg Val1 5 1012712PRTHomo sapiens 127Gln
Ser Tyr Glu Arg Gly Phe Thr Gly Ser Met Val1 5 1012812PRTHomo
sapiens 128Gln Ser Tyr Asp Asn Gly Phe Thr Gly Ala Arg Val1 5
1012912PRTHomo sapiens 129Gln Ser Tyr Asp Arg Arg Phe Thr Gly Ser
Arg Val1 5 1013012PRTHomo sapiens 130Gln Thr Tyr Asp Lys Gly Phe
Thr Gly Ser Ser Val1 5 1013112PRTHomo sapiens 131Gln Ser Tyr Asp
Arg Asp Phe Thr Gly Thr Arg Val1 5 1013212PRTHomo sapiens 132Gln
Ser Tyr Asp Arg Gly Phe Tyr Gly Ser Met Val1 5 1013312PRTHomo
sapiens 133Gln Thr Tyr Asp Lys Gly Phe Thr Gly Ser Ser Val1 5
1013412PRTHomo sapiens 134Gln Ser Tyr Asp Arg Gly Phe Thr Gly Ala
Arg Val1 5 1013512PRTHomo sapiens 135Gln Ser Tyr Glu Arg Gly Phe
Thr Gly Ala Arg Val1 5 1013613PRTHomo sapiens 136Gln Ser Tyr Asp
Arg Gly Phe Thr Gly Ser Arg Val Phe1 5 1013713PRTHomo sapiens
137Gln Ser Tyr Asp Arg Gly Phe Thr Gly Phe Lys Val Phe1 5
1013813PRTHomo sapiens 138Gln Ser Tyr Asp Arg Gly Phe Val Ser Ala
Tyr Val Phe1 5 1013913PRTHomo sapiens 139Gln Ser Tyr Asp Arg Gly
Leu Thr Val Thr Lys Val Phe1 5 1014013PRTHomo sapiens 140Gln Ser
Tyr Asp Arg Gly Tyr Thr Ala Ser Arg Val Phe1 5 1014113PRTHomo
sapiens 141Gln Ser Tyr Asp Arg Gly Phe Thr Gly Ser Lys Val Phe1 5
1014213PRTHomo sapiens 142Gln Ser Tyr Asp Arg Gly Leu Thr Gly Phe
Arg Val Phe1 5 1014313PRTHomo sapiens 143Gln Ser Tyr Asp Arg Gly
Phe Thr Gly Tyr Lys Val Phe1 5 1014413PRTHomo sapiens 144Gln Ser
Tyr Asp Arg Gly Leu Thr Gly Tyr Arg Leu Phe1 5 1014513PRTHomo
sapiens 145Gln Ser Tyr Asp Arg Gly Phe Thr Asp Tyr Lys Val Phe1 5
1014613PRTHomo sapiens 146Gln Ser Tyr Asp Arg Gly Phe Thr Gly Pro
Arg Leu Phe1 5 1014713PRTHomo sapiens 147Gln Ser Tyr Asp Arg Gly
Leu Thr Gly Ser Arg Val Phe1 5 1014813PRTHomo sapiens 148Gln Ser
Tyr Asp Arg Gly Phe Thr Gly Ala Arg Val Trp1 5 1014913PRTHomo
sapiens 149Gln Ser Tyr Asp Arg Gly Phe Thr Gly Tyr Arg Val Phe1 5
1015013PRTHomo sapiens 150Gln Ser Tyr Asp Arg Gly Phe Thr Gly Pro
Arg Val Phe1 5 1015113PRTHomo sapiens 151Gln Ser Tyr Asp Arg Gly
Met Thr Ser Ser Arg Val Phe1 5 1015213PRTHomo sapiens 152Gln Ser
Tyr Asp Arg Asp Ser Thr Gly Ser Arg Val Phe1 5 1015313PRTHomo
sapiens 153Gln Ser Tyr Asp Ser Ser Leu Arg Gly Ser Arg Val Phe1 5
1015413PRTHomo sapiens 154His Ser Tyr Asp Ser Asp Phe Thr Gly Ser
Arg Val Phe1 5 1015513PRTHomo sapiens 155His Ser Ser Glu Ser Gly
Phe Thr Gly Ser Arg Val Phe1 5 1015613PRTHomo sapiens 156His Ser
Tyr Asp Asn Arg Phe Thr Gly Ser Arg Val Phe1 5 1015713PRTHomo
sapiens 157His Ser Tyr Asp Ser Arg Phe Thr Gly Ser Arg Val Phe1 5
1015813PRTHomo sapiens 158Gln Ser Tyr Asp Ser Glu Phe Thr Gly Ser
Arg Val Phe1 5 1015913PRTHomo sapiens 159Gln Ser Tyr Asp Thr Gly
Phe Thr Gly Ser Arg Val Phe1 5 1016013PRTHomo sapiens 160His Ser
Tyr Asp Ser Gly Phe Thr Gly Ser Arg Val Phe1 5 1016113PRTHomo
sapiens 161Gln Ser Tyr Asp Thr Gly Phe Thr Gly Ser Arg Val Phe1 5
1016213PRTHomo sapiens 162His Ser Tyr Asp Thr Lys Phe Thr Gly Ser
Arg Val Phe1 5 1016313PRTHomo sapiens 163His Ser Ser Asp Ser Gly
Phe Thr Gly Ser Arg Val Phe1 5 1016413PRTHomo sapiens 164Gln Ser
Tyr Asp Ser Asp Phe Thr Gly Ser Arg Val Phe1 5 1016513PRTHomo
sapiens 165His Ser Tyr Glu Ser Gly Phe Thr Gly Ser Arg Val Phe1 5
1016613PRTHomo sapiens 166Gln Ser Tyr Asp Ala Pro Trp Ser Gly Ser
Arg Val Phe1 5 1016713PRTHomo sapiens 167Gln Ser Tyr Asp Ser Asp
Phe Thr Gly Ser Lys Val Phe1 5 1016813PRTHomo sapiens 168His Thr
Asn Asp Ser Gly Phe Thr Gly Ser Arg Val Phe1 5 1016913PRTHomo
sapiens 169His Ser Tyr Asp Thr Arg Phe Thr Gly Ser Arg Val Phe1 5
1017013PRTHomo sapiens 170Gln Ser Tyr Asp Met Arg Phe Thr Gly Ser
Arg Val Phe1 5 1017113PRTHomo sapiens 171His Ser Ser Asp Ser Asp
Ser Thr Gly Ser Arg Val Phe1 5 1017213PRTHomo sapiens 172Gln Ser
Tyr Asn Thr Asp Phe Thr Gly Ser Arg Val Phe1 5 1017313PRTHomo
sapiens 173Gln Ser Tyr Asp Ser Gly Phe Thr Gly Ser
Arg Val Phe1 5 1017413PRTHomo sapiens 174His Ser Tyr Asp Met Gly
Phe Thr Gly Ser Arg Val Phe1 5 1017513PRTHomo sapiens 175His Ser
Tyr Asp Asn Gly Phe Thr Gly Ser Arg Val Phe1 5 1017613PRTHomo
sapiens 176His Ser His Asp Arg Asp Phe Thr Gly Ser Arg Val Phe1 5
1017712PRTHomo sapiens 177Gln Ser Tyr Asp Ser Ser Leu Arg Gly Ser
Arg Val1 5 1017813PRTHomo sapiens 178Gln Ser Tyr Asp Arg Gly Ile
His Gly Ser Arg Val Phe1 5 1017913PRTHomo sapiens 179Gln Ser Tyr
Asp Ser Gly Phe Pro Gly Ser Arg Val Phe1 5 1018013PRTHomo sapiens
180Gln Ser Tyr Asp Ile Gly Ser Thr Gly Ser Arg Val Phe1 5
1018113PRTHomo sapiens 181Gln Ser Tyr Asp Ser Gly Leu Thr Gly Ser
Arg Val Phe1 5 1018213PRTHomo sapiens 182Gln Ser Tyr Asp Ile Gly
Met Thr Gly Ser Arg Val Phe1 5 1018313PRTHomo sapiens 183Gln Ser
Tyr Asp Ile Gly Leu Thr Gly Ser Arg Val Phe1 5 1018413PRTHomo
sapiens 184Gln Ser Tyr Asp Ser Gly Val Thr Gly Ser Arg Val Phe1 5
1018513PRTHomo sapiens 185Gln Ser Tyr Asp Arg Gly Leu Thr Ala Ser
Arg Val Phe1 5 1018613PRTHomo sapiens 186Gln Ser Tyr Asp Thr Gly
Leu Thr Gly Ser Arg Val Phe1 5 1018713PRTHomo sapiens 187Gln Ser
Tyr Asp Thr Ala Leu Thr Gly Ser Arg Val Phe1 5 1018813PRTHomo
sapiens 188Gln Ser Tyr Asp Ile Arg Phe Thr Gly Ser Arg Val Phe1 5
1018913PRTHomo sapiens 189Gln Ser Tyr Asp Ile Arg Ser Thr Gly Ser
Arg Val Phe1 5 1019013PRTHomo sapiens 190Gln Ser Tyr Asp Asn Arg
Leu Thr Gly Ser Arg Val Phe1 5 1019113PRTHomo sapiens 191Gln Ser
Tyr Glu Thr Ser Phe Thr Gly Ser Arg Val Phe1 5 1019213PRTHomo
sapiens 192Gln Ser Tyr Asp Ser Ser Ser Thr Gly Ser Arg Val Phe1 5
1019313PRTHomo sapiens 193Gln Ser Tyr Asp Ser Gly Phe Thr Ala Ser
Arg Val Phe1 5 1019413PRTHomo sapiens 194Gln Thr Tyr Asp Lys Gly
Phe Thr Gly Ser Ser Val Phe1 5 1019513PRTHomo sapiens 195Gln Ser
Tyr Asp Asn Gly Phe Thr Gly Ser Arg Val Phe1 5 1019613PRTHomo
sapiens 196Gln Ser Tyr Asp Thr Gly Phe Thr Lys Ser Arg Val Phe1 5
1019713PRTHomo sapiens 197Gln Ser Tyr Asp Ser Asp Val Thr Gly Ser
Arg Val Phe1 5 1019813PRTHomo sapiens 198Gln Ser Tyr Asp Ala Gly
Phe Thr Gly Ser Arg Val Phe1 5 1019912PRTHomo sapiens 199Gln Ser
Tyr Asp Arg Gly Thr His Pro Ser Met Leu1 5 1020012PRTHomo sapiens
200Gln Ser Tyr Asp Arg Gly Thr Thr Pro Arg Pro Met1 5
1020112PRTHomo sapiens 201Gln Ser Tyr Asp Arg Gly Arg Asn Pro Ala
Leu Thr1 5 1020212PRTHomo sapiens 202Gln Ser Tyr Asp Arg Gly Thr
His Pro Trp Leu His1 5 1020312PRTHomo sapiens 203Gln Ser Tyr Asp
Arg Gly Asn Ser Pro Ala Thr Val1 5 1020412PRTHomo sapiens 204Gln
Ser Tyr Asp Arg Gly Thr Phe Pro Ser Pro Gln1 5 1020512PRTHomo
sapiens 205Gln Ser Tyr Asp Arg Gly Leu Asn Pro Ser Ala Thr1 5
1020612PRTHomo sapiens 206Gln Ser Tyr Asp Arg Gly Lys Ser Asn Lys
Met Leu1 5 1020712PRTHomo sapiens 207Gln Ser Tyr Asp Arg Gly His
Thr Ala His Leu Tyr1 5 1020812PRTHomo sapiens 208Gln Ser Tyr Asp
Arg Gly Gln Thr Pro Ser Ile Thr1 5 1020912PRTHomo sapiens 209Gln
Ser Tyr Asp Arg Gly Tyr Pro Arg Asn Ile Leu1 5 1021012PRTHomo
sapiens 210Gln Ser Tyr Asp Arg Gly Ile Thr Pro Gly Leu Ala1 5
1021112PRTHomo sapiens 211Gln Ser Tyr Asp Arg Gly Gln Pro His Ala
Val Leu1 5 1021212PRTHomo sapiens 212Gln Ser Tyr Asp Arg Gly Asn
Ser Pro Ile Pro Thr1 5 1021312PRTHomo sapiens 213Gln Ser Tyr Asp
Arg Gly Thr Pro Asn Asn Ser Phe1 5 1021412PRTHomo sapiens 214Gln
Ser Tyr Asp Ser Gly Val Asp Pro Gly Pro Tyr1 5 1021512PRTHomo
sapiens 215Gln Ser Tyr Asp Arg Gly Arg Pro Arg His Ala Leu1 5
1021612PRTHomo sapiens 216Gln Ser Tyr Asp Arg Gly Pro Tyr His Pro
Ile Arg1 5 1021712PRTHomo sapiens 217Gln Ser Tyr Asp Arg Gly Pro
His Thr Gln Pro Thr1 5 1021812PRTHomo sapiens 218Gln Ser Tyr Asp
Arg Gly His Asn Asn Phe Ser Pro1 5 1021912PRTHomo sapiens 219Gln
Ser Tyr Asp Arg Gly Pro Thr His Leu Pro His1 5 1022012PRTHomo
sapiens 220Gln Ser Tyr Asp Arg Gly Thr Pro Ser Tyr Pro Thr1 5
1022112PRTHomo sapiens 221Gln Ser Tyr Asp Ser Gly Thr Ser Asn Leu
Leu Pro1 5 1022212PRTHomo sapiens 222Gln Ser Tyr Asp Arg Gly Asp
Ser Asn His Asp Leu1 5 1022312PRTHomo sapiens 223Gln Ser Tyr Asp
Arg Gly Leu Pro Arg Leu Thr His1 5 1022412PRTHomo sapiens 224Gln
Ser Tyr Asp Arg Gly Ile Pro Thr Ser Tyr Leu1 5 1022512PRTHomo
sapiens 225Gln Ser Tyr Asp Arg Gly Leu Arg Val Gln Ala Pro1 5
1022612PRTHomo sapiens 226Gln Ser Tyr Asp Arg Gly Leu Ser Asp Ser
Pro Leu1 5 1022712PRTHomo sapiens 227Gln Ser Tyr Asp Ser Gly Ser
Leu Arg Arg Ile Leu1 5 1022812PRTHomo sapiens 228Gln Ser Tyr Asp
Arg Gly Pro Ala Arg Thr Ser Pro1 5 1022912PRTHomo sapiens 229Gln
Ser Tyr Asp Arg Gly Arg Ala Ala His Pro Gln1 5 1023012PRTHomo
sapiens 230Gln Ser Tyr Asp Arg Gly Thr Gln Pro Ala Asx Ile1 5
1023112PRTHomo sapiens 231Gln Ser Tyr Asp Arg Gly Thr His Pro Thr
Met Ile1 5 1023212PRTHomo sapiens 232Gln Ser Tyr Asp Arg Gly Arg
Ile Pro Ala Asx Thr1 5 1023312PRTHomo sapiens 233Gln Ser Tyr Asp
Arg Gly Thr His Pro Val Pro Ala1 5 1023412PRTHomo sapiens 234Gln
Ser Tyr Asp Arg Gly Ser Asx Pro Ile Pro Ala1 5 1023512PRTHomo
sapiens 235Gln Ser Tyr Asp Arg Gly Thr His Pro Val Pro Ala1 5
1023612PRTHomo sapiens 236Gln Ser Tyr Asp Arg Gly Thr His Pro Thr
Met Tyr1 5 1023712PRTHomo sapiens 237Gln Ser Tyr Asp Arg Gly His
His Tyr Thr Thr Phe1 5 1023812PRTHomo sapiens 238Gln Ser Tyr Asp
Arg Gly Ser His Pro Ala Ala Glu1 5 1023912PRTHomo sapiens 239Gln
Ser Tyr Asp Arg Gly Thr Ile Pro Ser Ile Glu1 5 1024012PRTHomo
sapiens 240Gln Ser Tyr Asp Arg Gly Ser Ser Pro Ala Ile Met1 5
1024112PRTHomo sapiens 241Gln Ser Tyr Asp Arg Gly Ile Trp Pro Asn
Leu Asn1 5 1024212PRTHomo sapiens 242Gln Ser Tyr Asp Arg Gly Thr
His Pro Asn Leu Asn1 5 1024312PRTHomo sapiens 243Gln Ser Tyr Asp
Arg Gly Thr His Pro Ser Ile Ser1 5 1024412PRTHomo sapiens 244Gln
Ser Tyr Asp Arg Gly Ser Ala Pro Met Ile Asn1 5 1024512PRTHomo
sapiens 245Gln Ser Tyr Asp Arg Gly His His Pro Ala Met Ser1 5
1024612PRTHomo sapiens 246Gln Ser Tyr Asp Arg Gly Thr His Pro Ser
Ile Thr1 5 1024712PRTHomo sapiens 247Gln Ser Tyr Asp Arg Gly Thr
Asp Pro Ala Ile Val1 5 1024812PRTHomo sapiens 248Gln Ser Tyr Asp
Arg Gly Thr His Pro Ala Leu Leu1 5 1024912PRTHomo sapiens 249Gln
Ser Tyr Asp Arg Gly Ser His Pro Ala Leu Thr1 5 1025012PRTHomo
sapiens 250Gln Ser Tyr Asp Arg Gly Thr Thr Pro Ala Pro Glu1 5
1025112PRTHomo sapiens 251Gln Ser Tyr Asp Arg Gly Ser His Pro Thr
Leu Ile1 5 1025212PRTHomo sapiens 252Gln Ser Tyr Asp Arg Gly Thr
His Pro Ser Met Leu1 5 1025312PRTHomo sapiens 253Gln Ser Tyr Asp
Arg Gly Thr Thr Pro Arg Pro Met1 5 1025412PRTHomo sapiens 254Gln
Ser Tyr Asp Arg Gly Arg Leu Pro Ala Gln Thr1 5 1025512PRTHomo
sapiens 255Gln Ser Tyr Asp Arg Gly Thr His Pro Leu Thr Ile1 5
1025612PRTHomo sapiens 256Gln Ser Tyr Asp Arg Gly Gln Thr Pro Ser
Ile Thr1 5 1025712PRTHomo sapiens 257Gln Ser Tyr Asp Arg Gly Thr
His Phe Gln Met Tyr1 5 1025812PRTHomo sapiens 258Gln Ser Tyr Asp
Arg Gly Arg Asn Pro Ala Leu Thr1 5 1025912PRTHomo sapiens 259Gln
Ser Tyr Asp Arg Gly Thr His Pro Leu Thr Met1 5 1026012PRTHomo
sapiens 260Gln Ser Tyr Asp Arg Gly Thr His Pro Leu Thr Met1 5
1026112PRTHomo sapiens 261Gln Ser Tyr Asp Ser Gly Tyr Thr Gly Ser
Arg Val1 5 1026212PRTHomo sapiens 262Gln Ser Tyr Asp Ser Gly Phe
Thr Gly Ser Arg Val1 5 1026312PRTHomo sapiens 263Gln Ser Tyr Asp
Ser Arg Phe Thr Gly Ser Arg Val1 5 1026412PRTHomo sapiens 264Gln
Ser Tyr Pro Asp Gly Thr Pro Ala Ser Arg Val1 5 1026512PRTHomo
sapiens 265Gln Ser Tyr Ser Thr His Met Pro Ile Ser Arg Val1 5
1026612PRTHomo sapiens 266Gln Ser Tyr Asp Ser Gly Ser Thr Gly Ser
Arg Val1 5 1026712PRTHomo sapiens 267Gln Ser Tyr Pro Asn Ser Tyr
Pro Ile Ser Arg Val1 5 1026810PRTHomo sapiens 268Gln Ser Tyr Ile
Arg Ala Pro Gln Gln Val1 5 1026912PRTHomo sapiens 269Gln Ser Tyr
Leu Lys Ser Arg Ala Phe Ser Arg Val1 5 1027012PRTHomo sapiens
270Gln Ser Tyr Asp Ser Arg Phe Thr Gly Ser Arg Val1 5
1027112PRTHomo sapiens 271Gln Ser Tyr Asp Arg Gly Phe Thr Gly Ser
Met Val1 5 1027212PRTHomo sapiens 272Gln Ser Tyr Asp Arg Gly Phe
Thr Gly Ser Met Val1 5 1027312PRTHomo sapiens 273Gln Ser Tyr Asp
Arg Gly Phe Thr Gly Phe Asp Gly1 5 1027412PRTHomo sapiens 274Gln
Ser Tyr Asp Arg Gly Thr Ala Pro Ala Leu Ser1 5 1027512PRTHomo
sapiens 275Gln Ser Tyr Asp Arg Gly Ser Tyr Pro Ala Leu Arg1 5
1027612PRTHomo sapiens 276Gln Ser Tyr Asp Arg Gly Asn Trp Pro Asn
Ser Asn1 5 1027712PRTHomo sapiens 277Gln Ser Tyr Asp Arg Gly Thr
Ala Pro Ser Leu Leu1 5 1027812PRTHomo sapiens 278Gln Ser Tyr Asp
Arg Gly Phe Thr Gly Ser Met Val1 5 1027912PRTHomo sapiens 279Gln
Ser Tyr Asp Arg Gly Thr Thr Pro Arg Ile Arg1 5 1028012PRTHomo
sapiens 280Gln Ser Tyr Asp Arg Gly Phe Thr Gly Ser Met Val1 5
1028112PRTHomo sapiens 281Gln Ser Tyr Asp Arg Gly Phe Thr Gly Ser
Met Val1 5 1028212PRTHomo sapiens 282Gln Ser Tyr Asp Arg Gly Met
Ile Pro Ala Leu Thr1 5 1028312PRTHomo sapiens 283Gln Ser Tyr Asp
Arg Asn Thr His Pro Ala Leu Leu1 5 1028412PRTHomo sapiens 284Gln
Ser Tyr Asp Arg Phe Thr His Pro Ala Leu Leu1 5 1028512PRTHomo
sapiens 285Gln Ser Tyr Asp Arg Tyr Thr His Pro Ala Leu Leu1 5
1028612PRTHomo sapiens 286Gln Ser Tyr Asp Arg Gly Thr His Pro Ala
Leu Leu1 5 1028712PRTHomo sapiens 287Gln Ser Tyr Asp Arg Tyr Thr
His Pro Ala Leu Leu1 5 102889PRTHomo sapiens 288Phe Thr Phe Glu Ser
Tyr Gly Met His1 52899PRTHomo sapiens 289Phe Thr Phe Ser Ser Tyr
Gly Met His1 52909PRTHomo sapiens 290Phe Thr Phe Tyr Ser Tyr Gly
Met His1 52919PRTHomo sapiens 291Phe Thr Phe His Ser Tyr Gly Met
His1 52929PRTHomo sapiens 292Phe Thr Phe Lys Ser Tyr Gly Met His1
52939PRTHomo sapiens 293Phe Thr Phe Arg Ser Tyr Gly Met His1
52949PRTHomo sapiens 294Phe Thr Phe Asn Ser Tyr Gly Met His1
52959PRTHomo sapiens 295Phe Thr Phe Thr Ser Tyr Gly Met His1
52969PRTHomo sapiens 296Phe Thr Phe Gly Ser Tyr Gly Met His1
52979PRTHomo sapiens 297Phe Thr Phe Val Ser Tyr Gly Met His1
52989PRTHomo sapiens 298Phe Thr Phe Ile Ser Tyr Gly Met His1
52999PRTHomo sapiens 299Phe Thr Phe Trp Ser Tyr Gly Met His1
53009PRTHomo sapiens 300Phe Thr Phe Ser Glu Tyr Gly Met His1
53019PRTHomo sapiens 301Phe Thr Phe Ser Cys Tyr Gly Met His1
53029PRTHomo sapiens 302Phe Thr Phe Ser Ser Tyr Gly Met His1
53039PRTHomo sapiens 303Phe Thr Phe Ser Tyr Tyr Gly Met His1
53049PRTHomo sapiens 304Phe Thr Phe Ser His Tyr Gly Met His1
53059PRTHomo sapiens 305Phe Thr Phe Ser Arg Tyr Gly Met His1
53069PRTHomo sapiens 306Phe Thr Phe Ser Asn Tyr Gly Met His1
53079PRTHomo sapiens 307Phe Thr Phe Ser Gln Tyr Gly Met His1
53089PRTHomo sapiens 308Phe Thr Phe Ser Thr Tyr Gly Met His1
53099PRTHomo sapiens 309Phe Thr Phe Ser Ala Tyr Gly Met His1
53109PRTHomo sapiens 310Phe Thr Phe Ser Ile Tyr Gly Met His1
53119PRTHomo sapiens 311Phe Thr Phe Ser Ser Glu Gly Met His1
53129PRTHomo sapiens 312Phe Thr Phe Ser Ser Cys Gly Met His1
53139PRTHomo sapiens 313Phe Thr Phe Ser Ser Ser Gly Met His1
53149PRTHomo sapiens 314Phe Thr Phe Ser Ser Tyr Gly Met His1
53159PRTHomo sapiens 315Phe Thr Phe Ser Ser His Gly Met His1
53169PRTHomo sapiens 316Phe Thr Phe Ser Ser Arg Gly Met His1
53179PRTHomo sapiens 317Phe Thr Phe Ser Ser Asn Gly Met His1
53189PRTHomo sapiens 318Phe Thr Phe Ser Ser Thr Gly Met His1
53199PRTHomo sapiens 319Phe Thr Phe Ser Ser Ala Gly Met His1
53209PRTHomo sapiens 320Phe Thr Phe Ser Ser Val Gly Met His1
53219PRTHomo sapiens 321Phe Thr Phe Ser Ser Leu Gly Met His1
53229PRTHomo sapiens 322Phe Thr Phe Ser Ser Ile Gly Met His1
53239PRTHomo sapiens 323Phe Thr Phe Ser Ser Tyr Asp Met His1
53249PRTHomo sapiens 324Phe Thr Phe Ser Ser Tyr Glu Met His1
53259PRTHomo sapiens 325Phe Thr Phe Ser Ser Tyr Cys Met His1
53269PRTHomo sapiens 326Phe Thr Phe Ser Ser Tyr Ser Met His1
53279PRTHomo sapiens 327Phe Thr Phe Ser Ser Tyr Tyr Met His1
53289PRTHomo sapiens 328Phe Thr Phe Ser Ser Tyr Asn Met His1
53299PRTHomo sapiens 329Phe Thr Phe Ser Ser Tyr Gly Met His1
53309PRTHomo sapiens 330Phe Thr Phe Ser Ser Tyr Ala Met His1
53319PRTHomo sapiens 331Phe Thr Phe Ser Ser Tyr Val Met His1
53329PRTHomo sapiens 332Phe Thr Phe Ser Ser Tyr Met Met His1
53339PRTHomo sapiens 333Phe Thr Phe Ser Ser Tyr Ile Met His1
53349PRTHomo sapiens 334Phe Thr Phe Ser Ser Tyr Pro Met His1
533517PRTHomo sapiens 335Glu Ile Arg Tyr Asp Gly Ser Asn Lys Tyr
Tyr Ala Asp Ser Val Lys1 5 10 15Gly33617PRTHomo sapiens 336Cys Ile
Arg Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly33717PRTHomo sapiens 337Tyr Ile Arg Tyr Asp Gly Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly33817PRTHomo sapiens 338His
Ile Arg Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly33917PRTHomo sapiens 339Lys Ile Arg Tyr Asp Gly Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly34017PRTHomo sapiens 340Asn
Ile Arg Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly34117PRTHomo sapiens 341Gln Ile Arg Tyr Asp Gly Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly34217PRTHomo sapiens 342Thr
Ile Arg Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly34317PRTHomo sapiens 343Leu Ile Arg Tyr Asp Gly Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly34417PRTHomo sapiens 344Phe
Ile Arg Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly34517PRTHomo sapiens 345Phe Ile Glu Tyr Asp Gly Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly34617PRTHomo sapiens 346Phe
Ile Ser Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly34717PRTHomo sapiens 347Phe Ile Tyr Tyr Asp Gly Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly34817PRTHomo sapiens 348Phe
Ile His Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly34917PRTHomo sapiens 349Phe Ile Lys Tyr Asp Gly Ser Asn
Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly35017PRTHomo sapiens 350Phe
Ile Arg Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly35117PRTHomo sapiens 351Phe Ile Gln Tyr Asp Gly Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly35217PRTHomo sapiens 352Phe
Ile Thr Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly35317PRTHomo sapiens 353Phe Ile Gly Tyr Asp Gly Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly35417PRTHomo sapiens 354Phe
Ile Ala Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly35517PRTHomo sapiens 355Phe Ile Val Tyr Asp Gly Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly35617PRTHomo sapiens 356Phe
Ile Leu Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly35717PRTHomo sapiens 357Phe Ile Trp Tyr Asp Gly Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly35817PRTHomo sapiens 358Phe
Ile Arg Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly35917PRTHomo sapiens 359Phe Ile Arg Tyr Glu Gly Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly36017PRTHomo sapiens 360Phe
Ile Arg Tyr Ser Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly36117PRTHomo sapiens 361Phe Ile Arg Tyr Tyr Gly Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly36217PRTHomo sapiens 362Phe
Ile Arg Tyr Lys Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly36317PRTHomo sapiens 363Phe Ile Arg Tyr Arg Gly Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly36417PRTHomo sapiens 364Phe
Ile Arg Tyr Asn Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly36517PRTHomo sapiens 365Phe Ile Arg Tyr Gln Gly Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly36617PRTHomo sapiens 366Phe
Ile Arg Tyr Thr Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly36717PRTHomo sapiens 367Phe Ile Arg Tyr Ala Gly Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly36817PRTHomo sapiens 368Phe
Ile Arg Tyr Val Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly36917PRTHomo sapiens 369Phe Ile Arg Tyr Leu Gly Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly37017PRTHomo sapiens 370Phe
Ile Arg Tyr Ile Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly37117PRTHomo sapiens 371Phe Ile Arg Tyr Phe Gly Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly37217PRTHomo sapiens 372Phe
Ile Arg Tyr Asp Asp Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly37317PRTHomo sapiens 373Phe Ile Arg Tyr Asp Glu Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly37417PRTHomo sapiens 374Phe
Ile Arg Tyr Asp Ser Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly37517PRTHomo sapiens 375Phe Ile Arg Tyr Asp Tyr Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly37617PRTHomo sapiens 376Phe
Ile Arg Tyr Asp Lys Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly37717PRTHomo sapiens 377Phe Ile Arg Tyr Asp Arg Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly37817PRTHomo sapiens 378Phe
Ile Arg Tyr Asp Asn Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly37917PRTHomo sapiens 379Phe Ile Arg Tyr Asp Gln Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly38017PRTHomo sapiens 380Phe
Ile Arg Tyr Asp Thr Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly38117PRTHomo sapiens 381Phe Ile Arg Tyr Asp Gly Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly38217PRTHomo sapiens 382Phe
Ile Arg Tyr Asp Val Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly38317PRTHomo sapiens 383Phe Ile Arg Tyr Asp Phe Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly38417PRTHomo sapiens 384Phe
Ile Arg Tyr Asp Gly Ser Ser Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly38517PRTHomo sapiens 385Phe Ile Arg Tyr Asp Gly Ser Tyr Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly38617PRTHomo sapiens 386Phe
Ile Arg Tyr Asp Gly Ser His Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly38717PRTHomo sapiens 387Phe Ile Arg Tyr Asp Gly Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly38817PRTHomo sapiens 388Phe
Ile Arg Tyr Asp Gly Ser Thr Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly38917PRTHomo sapiens 389Phe Ile Arg Tyr Asp Gly Ser Gly Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly39017PRTHomo sapiens 390Phe
Ile Arg Tyr Asp Gly Ser Met Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly39117PRTHomo sapiens 391Phe Ile Arg Tyr Asp Gly Ser Leu Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly39217PRTHomo sapiens 392Phe
Ile Arg Tyr Asp Gly Ser Ile Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly39317PRTHomo sapiens 393Phe Ile Arg Tyr Asp Gly Ser Pro Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly39417PRTHomo sapiens 394Phe
Ile Arg Tyr Asp Gly Ser Phe Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly39517PRTHomo sapiens 395Phe Ile Arg Tyr Asp Gly Ser Asn Lys
Glu Tyr Ala Asp Ser Val Lys1 5 10 15Gly39617PRTHomo sapiens 396Phe
Ile Arg Tyr Asp Gly Ser Asn Lys Ser Tyr Ala Asp Ser Val Lys1 5 10
15Gly39717PRTHomo sapiens 397Phe Ile Arg Tyr Asp Gly Ser Asn Lys
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly39817PRTHomo sapiens 398Phe
Ile Arg Tyr Asp Gly Ser Asn Lys Asn Tyr Ala Asp Ser Val Lys1 5 10
15Gly39917PRTHomo sapiens 399Phe Ile Arg Tyr Asp Gly Ser Asn Lys
Val Tyr Ala Asp Ser Val Lys1 5 10 15Gly40017PRTHomo sapiens 400Phe
Ile Arg Tyr Asp Gly Ser Asn Lys Leu Tyr Ala Asp Ser Val Lys1 5 10
15Gly40117PRTHomo sapiens 401Phe Ile Arg Tyr Asp Gly Ser Asn Lys
Ile Tyr Ala Asp Ser Val Lys1 5 10 15Gly40217PRTHomo sapiens 402Phe
Ile Arg Tyr Asp Gly Ser Asn Lys Pro Tyr Ala Asp Ser Val Lys1 5 10
15Gly40317PRTHomo sapiens 403Phe Ile Arg Tyr Asp Gly Ser Asn Lys
Phe Tyr Ala Asp Ser Val Lys1 5 10 15Gly4046PRTHomo sapiens 404Glu
Gly Ser His Asp Asn1 54056PRTHomo sapiens 405Ser Gly Ser His Asp
Asn1 54066PRTHomo sapiens 406His Gly Ser His Asp Asn1 54076PRTHomo
sapiens 407Lys Gly Ser His Asp Asn1 54086PRTHomo sapiens 408Gln Gly
Ser His Asp Asn1 54096PRTHomo sapiens 409Thr Gly Ser His Asp Asn1
54106PRTHomo sapiens 410Ala Gly Ser His Asp Asn1 54116PRTHomo
sapiens 411Leu Gly Ser His Asp Asn1 54126PRTHomo sapiens 412Pro Gly
Ser His Asp Asn1 54136PRTHomo sapiens 413Phe Gly Ser His Asp Asn1
54146PRTHomo sapiens 414His Asp Ser His Asp Asn1 54156PRTHomo
sapiens 415His Cys Ser His Asp Asn1 54166PRTHomo sapiens 416His His
Ser His Asp Asn1 54176PRTHomo sapiens 417His Arg Ser His Asp Asn1
54186PRTHomo sapiens 418His Thr Ser His Asp Asn1 54196PRTHomo
sapiens 419His Gly Ser His Asp Asn1 54206PRTHomo sapiens 420His Val
Ser His Asp Asn1 54216PRTHomo sapiens 421His Met Ser His Asp Asn1
54226PRTHomo sapiens 422His Leu Ser His Asp Asn1 54236PRTHomo
sapiens 423His Ile Ser His Asp Asn1 54246PRTHomo sapiens 424His Pro
Ser His Asp Asn1 54256PRTHomo sapiens 425His Trp Ser His Asp Asn1
54266PRTHomo sapiens 426His Gly Asp His Asp Asn1 54276PRTHomo
sapiens 427His Gly Ser His Asp Asn1 54286PRTHomo sapiens 428His Gly
Tyr His Asp Asn1 54296PRTHomo sapiens 429His Gly His His Asp Asn1
54306PRTHomo sapiens 430His Gly Arg His Asp Asn1 54316PRTHomo
sapiens 431His Gly Asn His Asp Asn1 54326PRTHomo sapiens 432His Gly
Thr His Asp Asn1 54336PRTHomo sapiens 433His Gly Gly His Asp Asn1
54346PRTHomo sapiens 434His Gly Ala His Asp Asn1 54356PRTHomo
sapiens 435His Gly Ile His Asp Asn1 54366PRTHomo sapiens 436His Gly
Pro His Asp Asn1 54376PRTHomo sapiens 437His Gly Trp His Asp Asn1
54386PRTHomo sapiens 438His Gly Phe His Asp Asn1 54396PRTHomo
sapiens 439His Gly Ser His Asp Asn1 54406PRTHomo sapiens 440His Gly
Ser Arg Asp Asn1 54416PRTHomo sapiens 441His Gly Ser Thr Asp Asn1
54426PRTHomo sapiens 442His Gly Ser Ala Asp Asn1 54436PRTHomo
sapiens 443His Gly Ser Val Asp Asn1 54446PRTHomo sapiens 444His Gly
Ser Leu Asp Asn1 54456PRTHomo sapiens 445His Gly Ser Ile Asp Asn1
54466PRTHomo sapiens 446His Gly Ser Phe Asp Asn1 54476PRTHomo
sapiens 447His Gly Ser His Asp Asn1 54486PRTHomo sapiens 448His Gly
Ser His Ser Asn1 54496PRTHomo sapiens 449His Gly Ser His Tyr Asn1
54506PRTHomo sapiens 450His Gly Ser His His Asn1 54516PRTHomo
sapiens 451His Gly Ser His Arg Asn1 54526PRTHomo sapiens 452His Gly
Ser His Asn Asn1 54536PRTHomo sapiens 453His Gly Ser His Gly Asn1
54546PRTHomo sapiens 454His Gly Ser His Ala Asn1 54556PRTHomo
sapiens 455His Gly Ser His Val Asn1 54566PRTHomo sapiens 456His Gly
Ser His Ile Asn1 54576PRTHomo sapiens 457His Gly Ser His Asp Ser1
54586PRTHomo sapiens 458His Gly Ser His Asp His1 54596PRTHomo
sapiens 459His Gly Ser His Asp Lys1 54606PRTHomo sapiens 460His Gly
Ser His Asp Arg1 54616PRTHomo sapiens 461His Gly Ser His Asp Asn1
54626PRTHomo sapiens 462His Gly Ser His Asp Thr1 54636PRTHomo
sapiens 463His Gly Ser His Asp Gly1 54646PRTHomo sapiens 464His Gly
Ser His Asp Ala1 54656PRTHomo sapiens 465His Gly Ser His Asp Leu1
54666PRTHomo sapiens 466His Gly Ser His Asp Ile1 54676PRTHomo
sapiens 467His Gly Ser His Asp Pro1 54686PRTHomo sapiens 468His Gly
Ser His Asp Trp1 54696PRTHomo sapiens 469His Gly Ser His Asp Phe1
547013PRTHomo sapiens 470Ser Gly Gly Arg Ser Asn Ile Gly Asp Asn
Thr Val Lys1 5 1047113PRTHomo sapiens 471Ser Gly Gly Arg Ser Asn
Ile Gly Cys Asn Thr Val Lys1 5 1047213PRTHomo sapiens 472Ser Gly
Gly Arg Ser Asn Ile Gly Ser Asn Thr Val Lys1 5 1047313PRTHomo
sapiens 473Ser Gly Gly Arg Ser Asn Ile Gly Tyr Asn Thr Val Lys1 5
1047413PRTHomo sapiens 474Ser Gly Gly Arg Ser Asn Ile Gly Lys Asn
Thr Val Lys1 5 1047513PRTHomo sapiens 475Ser Gly Gly Arg Ser Asn
Ile Gly Arg Asn Thr Val Lys1 5 1047613PRTHomo sapiens 476Ser Gly
Gly Arg Ser Asn Ile Gly Asn Asn Thr Val Lys1 5 1047713PRTHomo
sapiens 477Ser Gly Gly Arg Ser Asn Ile Gly Thr Asn Thr Val Lys1 5
1047813PRTHomo sapiens 478Ser Gly Gly Arg Ser Asn Ile Gly Pro Asn
Thr Val Lys1 5 1047913PRTHomo sapiens 479Ser Gly Gly Arg Ser Asn
Ile Gly Ser Asp Thr Val Lys1 5 1048013PRTHomo sapiens 480Ser Gly
Gly Arg Ser Asn Ile Gly Ser Glu Thr Val Lys1 5 1048113PRTHomo
sapiens 481Ser Gly Gly Arg Ser Asn Ile Gly Ser Ser Thr Val Lys1 5
1048213PRTHomo sapiens 482Ser Gly Gly Arg Ser Asn Ile Gly Ser Tyr
Thr Val Lys1 5 1048313PRTHomo sapiens 483Ser Gly Gly Arg Ser Asn
Ile Gly Ser His Thr Val Lys1 5 1048413PRTHomo sapiens 484Ser Gly
Gly Arg Ser Asn Ile Gly Ser Lys Thr Val Lys1 5 1048513PRTHomo
sapiens 485Ser Gly Gly Arg Ser Asn Ile Gly Ser Asn Thr Val Lys1 5
1048613PRTHomo sapiens 486Ser Gly Gly Arg Ser Asn Ile Gly Ser Gln
Thr Val Lys1 5 1048713PRTHomo sapiens 487Ser Gly Gly Arg Ser Asn
Ile Gly Ser Thr Thr Val Lys1 5 1048813PRTHomo sapiens 488Ser Gly
Gly Arg Ser Asn Ile Gly Ser Gly Thr Val Lys1 5 1048913PRTHomo
sapiens 489Ser Gly Gly Arg Ser Asn Ile Gly Ser Met Thr Val Lys1 5
1049013PRTHomo sapiens 490Ser Gly Gly Arg Ser Asn Ile Gly Ser Ile
Thr Val Lys1 5 1049113PRTHomo sapiens 491Ser Gly Gly Arg Ser Asn
Ile Gly Ser Asn Asp Val Lys1 5 1049213PRTHomo sapiens 492Ser Gly
Gly Arg Ser Asn Ile Gly Ser Asn Cys Val Lys1 5 1049313PRTHomo
sapiens 493Ser Gly Gly Arg Ser Asn Ile Gly Ser Asn Ser Val Lys1 5
1049413PRTHomo sapiens 494Ser Gly Gly Arg Ser Asn Ile Gly Ser Asn
Tyr Val Lys1 5 1049513PRTHomo sapiens 495Ser Gly Gly Arg Ser Asn
Ile Gly Ser Asn His Val Lys1 5 1049613PRTHomo sapiens 496Ser Gly
Gly Arg Ser Asn Ile Gly Ser Asn Lys Val Lys1 5 1049713PRTHomo
sapiens 497Ser Gly Gly Arg Ser Asn Ile Gly Ser Asn Arg Val Lys1 5
1049813PRTHomo sapiens 498Ser Gly Gly Arg Ser Asn Ile Gly Ser Asn
Asn Val Lys1 5 1049913PRTHomo sapiens 499Ser Gly Gly Arg Ser Asn
Ile Gly Ser Asn Gln Val Lys1 5 1050013PRTHomo sapiens 500Ser Gly
Gly Arg Ser Asn Ile Gly Ser Asn Thr Val Lys1 5 1050113PRTHomo
sapiens 501Ser Gly Gly Arg Ser Asn Ile Gly Ser Asn Ala Val Lys1 5
1050213PRTHomo sapiens 502Ser Gly Gly Arg Ser Asn Ile Gly Ser Asn
Val Val Lys1 5 1050313PRTHomo sapiens 503Ser Gly Gly Arg Ser Asn
Ile Gly Ser Asn Leu Val Lys1 5 1050413PRTHomo sapiens 504Ser Gly
Gly Arg Ser Asn Ile Gly Ser Asn Ile Val Lys1 5 1050513PRTHomo
sapiens 505Ser Gly Gly Arg Ser Asn Ile Gly Ser Asn Pro Val Lys1 5
105067PRTHomo sapiens 506Asp Asn Asp Gln Arg Pro Ser1 55077PRTHomo
sapiens 507Glu Asn Asp Gln Arg Pro Ser1 55087PRTHomo sapiens 508Cys
Asn Asp Gln Arg Pro Ser1 55097PRTHomo sapiens 509Ser Asn Asp Gln
Arg Pro Ser1 55107PRTHomo sapiens 510Tyr Asn Asp Gln Arg Pro Ser1
55117PRTHomo sapiens 511His Asn Asp Gln Arg Pro Ser1 55127PRTHomo
sapiens 512Lys Asn Asp Gln Arg Pro Ser1 55137PRTHomo sapiens 513Arg
Asn Asp Gln Arg Pro Ser1 55147PRTHomo sapiens 514Asn Asn Asp Gln
Arg Pro Ser1 55157PRTHomo sapiens 515Gln Asn Asp Gln Arg Pro Ser1
55167PRTHomo sapiens 516Thr Asn Asp Gln Arg Pro Ser1 55177PRTHomo
sapiens 517Gly Asn Asp Gln Arg Pro Ser1 55187PRTHomo sapiens 518Ala
Asn Asp Gln Arg Pro Ser1 55197PRTHomo sapiens 519Val Asn Asp Gln
Arg Pro Ser1 55207PRTHomo sapiens 520Met Asn Asp Gln Arg Pro Ser1
55217PRTHomo sapiens 521Leu Asn Asp Gln Arg Pro Ser1 55227PRTHomo
sapiens 522Ile Asn Asp Gln Arg Pro Ser1 55237PRTHomo sapiens 523Pro
Asn Asp Gln Arg Pro Ser1 55247PRTHomo sapiens 524Trp Asn Asp Gln
Arg Pro Ser1 55257PRTHomo sapiens 525Phe Asn Asp Gln Arg Pro
Ser1
55267PRTHomo sapiens 526Gly Asn Asp Ser Arg Pro Ser1 55277PRTHomo
sapiens 527Gly Asn Asp Tyr Arg Pro Ser1 55287PRTHomo sapiens 528Gly
Asn Asp Arg Arg Pro Ser1 55297PRTHomo sapiens 529Gly Asn Asp Gln
Arg Pro Ser1 55307PRTHomo sapiens 530Gly Asn Asp Thr Arg Pro Ser1
55317PRTHomo sapiens 531Gly Asn Asp Ala Arg Pro Ser1 55327PRTHomo
sapiens 532Gly Asn Asp Ile Arg Pro Ser1 55337PRTHomo sapiens 533Gly
Asn Asp Pro Arg Pro Ser1 553412PRTHomo sapiens 534Gln Ser Tyr Asp
Arg Gly Thr His Pro Ala Leu Leu1 5 1053512PRTHomo sapiens 535Gln
Ser Tyr Cys Arg Gly Thr His Pro Ala Leu Leu1 5 1053612PRTHomo
sapiens 536Gln Ser Tyr Ser Arg Gly Thr His Pro Ala Leu Leu1 5
1053712PRTHomo sapiens 537Gln Ser Tyr Tyr Arg Gly Thr His Pro Ala
Leu Leu1 5 1053812PRTHomo sapiens 538Gln Ser Tyr Asn Arg Gly Thr
His Pro Ala Leu Leu1 5 1053912PRTHomo sapiens 539Gln Ser Tyr Gln
Arg Gly Thr His Pro Ala Leu Leu1 5 1054012PRTHomo sapiens 540Gln
Ser Tyr Thr Arg Gly Thr His Pro Ala Leu Leu1 5 1054112PRTHomo
sapiens 541Gln Ser Tyr Gly Arg Gly Thr His Pro Ala Leu Leu1 5
1054212PRTHomo sapiens 542Gln Ser Tyr Ala Arg Gly Thr His Pro Ala
Leu Leu1 5 1054312PRTHomo sapiens 543Gln Ser Tyr Leu Arg Gly Thr
His Pro Ala Leu Leu1 5 1054412PRTHomo sapiens 544Gln Ser Tyr Ile
Arg Gly Thr His Pro Ala Leu Leu1 5 1054512PRTHomo sapiens 545Gln
Ser Tyr Trp Arg Gly Thr His Pro Ala Leu Leu1 5 1054612PRTHomo
sapiens 546Gln Ser Tyr Phe Arg Gly Thr His Pro Ala Leu Leu1 5
1054712PRTHomo sapiens 547Gln Ser Tyr Asp Asp Gly Thr His Pro Ala
Leu Leu1 5 1054812PRTHomo sapiens 548Gln Ser Tyr Asp Cys Gly Thr
His Pro Ala Leu Leu1 5 1054912PRTHomo sapiens 549Gln Ser Tyr Asp
Ser Gly Thr His Pro Ala Leu Leu1 5 1055012PRTHomo sapiens 550Gln
Ser Tyr Asp Tyr Gly Thr His Pro Ala Leu Leu1 5 1055112PRTHomo
sapiens 551Gln Ser Tyr Asp Arg Gly Thr His Pro Ala Leu Leu1 5
1055212PRTHomo sapiens 552Gln Ser Tyr Asp Asn Gly Thr His Pro Ala
Leu Leu1 5 1055312PRTHomo sapiens 553Gln Ser Tyr Asp Gln Gly Thr
His Pro Ala Leu Leu1 5 1055412PRTHomo sapiens 554Gln Ser Tyr Asp
Thr Gly Thr His Pro Ala Leu Leu1 5 1055512PRTHomo sapiens 555Gln
Ser Tyr Asp Gly Gly Thr His Pro Ala Leu Leu1 5 1055612PRTHomo
sapiens 556Gln Ser Tyr Asp Ala Gly Thr His Pro Ala Leu Leu1 5
1055712PRTHomo sapiens 557Gln Ser Tyr Asp Val Gly Thr His Pro Ala
Leu Leu1 5 1055812PRTHomo sapiens 558Gln Ser Tyr Asp Met Gly Thr
His Pro Ala Leu Leu1 5 1055912PRTHomo sapiens 559Gln Ser Tyr Asp
Leu Gly Thr His Pro Ala Leu Leu1 5 1056012PRTHomo sapiens 560Gln
Ser Tyr Asp Ile Gly Thr His Pro Ala Leu Leu1 5 1056112PRTHomo
sapiens 561Gln Ser Tyr Asp Pro Gly Thr His Pro Ala Leu Leu1 5
1056212PRTHomo sapiens 562Gln Ser Tyr Asp Trp Gly Thr His Pro Ala
Leu Leu1 5 1056312PRTHomo sapiens 563Gln Ser Tyr Asp Arg Asp Thr
His Pro Ala Leu Leu1 5 1056412PRTHomo sapiens 564Gln Ser Tyr Asp
Arg Cys Thr His Pro Ala Leu Leu1 5 1056512PRTHomo sapiens 565Gln
Ser Tyr Asp Arg Ser Thr His Pro Ala Leu Leu1 5 1056612PRTHomo
sapiens 566Gln Ser Tyr Asp Arg Tyr Thr His Pro Ala Leu Leu1 5
1056712PRTHomo sapiens 567Gln Ser Tyr Asp Arg His Thr His Pro Ala
Leu Leu1 5 1056812PRTHomo sapiens 568Gln Ser Tyr Asp Arg Arg Thr
His Pro Ala Leu Leu1 5 1056912PRTHomo sapiens 569Gln Ser Tyr Asp
Arg Asn Thr His Pro Ala Leu Leu1 5 1057012PRTHomo sapiens 570Gln
Ser Tyr Asp Arg Gln Thr His Pro Ala Leu Leu1 5 1057112PRTHomo
sapiens 571Gln Ser Tyr Asp Arg Thr Thr His Pro Ala Leu Leu1 5
1057212PRTHomo sapiens 572Gln Ser Tyr Asp Arg Gly Thr His Pro Ala
Leu Leu1 5 1057312PRTHomo sapiens 573Gln Ser Tyr Asp Arg Ala Thr
His Pro Ala Leu Leu1 5 1057412PRTHomo sapiens 574Gln Ser Tyr Asp
Arg Val Thr His Pro Ala Leu Leu1 5 1057512PRTHomo sapiens 575Gln
Ser Tyr Asp Arg Leu Thr His Pro Ala Leu Leu1 5 1057612PRTHomo
sapiens 576Gln Ser Tyr Asp Arg Ile Thr His Pro Ala Leu Leu1 5
1057712PRTHomo sapiens 577Gln Ser Tyr Asp Arg Pro Thr His Pro Ala
Leu Leu1 5 1057812PRTHomo sapiens 578Gln Ser Tyr Asp Arg Trp Thr
His Pro Ala Leu Leu1 5 1057912PRTHomo sapiens 579Gln Ser Tyr Asp
Arg Phe Thr His Pro Ala Leu Leu1 5 1058048DNAArtificial
SequenceSynthetic construct 580tgtcccttgg ccccagtagt catagctccc
actggtcgta cagtaata 4858135DNAArtificial SequenceSynthetic
construct 581gacacctcga tcagcggata acaatttcac acagg
3558215DNAArtificial SequenceSynthetic construct 582tggggccaag
ggaca 1558345DNAArtificial SequenceSynthetic construct
583attcgtccta taccgttcta ctttgtcgtc tttccagacg ttagt
4558418DNAArtificial SequenceSynthetic construct 584attcgtccta
taccgttc 1858566DNAArtificial SequenceSynthetic construct
585ggtcccagtt ccgaagaccc tcgaacccct caggctgctg tcatatgact
ggcagtaata 60gtcagc 6658615DNAArtificial SequenceSynthetic
construct 586tggggccaag ggaca 1558724DNAArtificial
SequenceSynthetic construct 587tgaagagacg gtgaccattg tccc
2458816DNAArtificial SequenceSynthetic construct 588gacacctcga
tcagcg 1658948DNAArtificial SequenceSynthetic construct
589gagtcattct cgacttgcgg ccgcacctag gacggtcagc ttggtccc
4859012PRTHomo sapiens 590Gln Ser Tyr Asp Arg Gly Phe Thr Gly Ser
Met Val1 5 1059112PRTHomo sapiensMISC_FEATURE(1)..(6)Xaa is encoded
by a randomized codon of sequence NNS with N being any nucleotide
and S being either deoxycytosine or deoxyguanidine 591Xaa Xaa Xaa
Xaa Xaa Xaa Phe Thr Gly Ser Met Val1 5 1059212PRTHomo
sapiensMISC_FEATURE(4)..(9)Xaa is encoded by a randomized codon of
sequence NNS with N being any nucleotide and S being either
deoxycytosine or deoxyguanidine 592Gln Ser Tyr Xaa Xaa Xaa Xaa Xaa
Xaa Ser Met Val1 5 1059312PRTHomo sapiensMISC_FEATURE(7)..(12)Xaa
is encoded by a randomized codon of sequence NNS with N being any
nucleotide and S being either deoxycytosine or deoxyguanidine
593Gln Ser Tyr Asp Arg Gly Xaa Xaa Xaa Xaa Xaa Xaa1 5
10594100PRTHomo sapiens 594Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Asp His20 25 30Tyr Met Asp Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Gly Arg Thr Arg Asn Lys Ala
Asn Ser Tyr Thr Thr Glu Tyr Ala Ala50 55 60Ser Val Lys Gly Arg Phe
Thr Ile Ser Arg Asp Asp Ser Lys Asn Ser65 70 75 80Leu Tyr Leu Gln
Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr85 90 95Tyr Cys Ala
Arg100595100PRTHomo sapiens 595Glu Val Gln Leu Val Glu Ser Gly Gly
Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Phe Thr Phe Ser Asp His20 25 30Tyr Met Ser Trp Val Arg Gln
Ala Gln Gly Lys Gly Leu Glu Leu Val35 40 45Gly Leu Ile Arg Asn Lys
Ala Asn Ser Tyr Thr Thr Glu Tyr Ala Ala50 55 60Ser Val Lys Gly Arg
Leu Thr Ile Ser Arg Glu Asp Ser Lys Asn Thr65 70 75 80Leu Tyr Leu
Gln Met Ser Ser Leu Lys Thr Glu Asp Leu Ala Val Tyr85 90 95Tyr Cys
Ala Arg100596100PRTHomo sapiens 596Glu Val Gln Leu Val Glu Ser Gly
Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala
Ala Ser Gly Phe Thr Phe Ser Asp His20 25 30Tyr Met Ser Trp Val Arg
Gln Ala Gln Gly Lys Gly Leu Glu Leu Val35 40 45Gly Leu Ile Arg Asn
Lys Ala Asn Ser Tyr Thr Thr Glu Tyr Ala Ala50 55 60Ser Val Lys Gly
Arg Leu Thr Ile Ser Arg Glu Asp Ser Lys Asn Thr65 70 75 80Met Tyr
Leu Gln Met Ser Asn Leu Lys Thr Glu Asp Leu Ala Val Tyr85 90 95Tyr
Cys Ala Arg100597100PRTHomo sapiens 597Glu Val Gln Leu Leu Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Phe Thr Phe Ser Asp His20 25 30Tyr Met Ser Trp Val
Arg Gln Ala Gln Gly Lys Gly Leu Glu Leu Val35 40 45Gly Leu Ile Arg
Asn Lys Ala Asn Ser Tyr Thr Thr Glu Tyr Ala Ala50 55 60Ser Val Lys
Gly Arg Leu Thr Ile Ser Arg Glu Asp Ser Lys Asn Thr65 70 75 80Leu
Tyr Leu Gln Met Ser Ser Leu Lys Thr Glu Asp Leu Ala Val Tyr85 90
95Tyr Cys Ala Arg10059898PRTHomo sapiens 598Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Thr Phe Asp Asp Tyr20 25 30Ala Met His Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ser Gly Ile
Ser Trp Asn Ser Gly Ser Ile Gly Tyr Ala Asp Ser Val50 55 60Lys Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Leu Tyr Tyr Cys85
90 95Ala Lys59998PRTHomo sapiens 599Glu Val Gln Leu Val Glu Ser Gly
Gly Gly Val Val Arg Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala
Ala Ser Gly Phe Thr Phe Asp Asp Tyr20 25 30Gly Met Ser Trp Val Arg
Gln Ala Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ser Gly Ile Asn Trp
Asn Gly Gly Ser Thr Gly Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe
Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln
Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Leu Tyr His Cys85 90 95Ala
Arg60098PRTHomo sapiens 600Glu Val Gln Leu Val Glu Ser Gly Gly Val
Val Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Asp Asp Tyr20 25 30Thr Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ser Leu Ile Ser Trp Asp Gly
Gly Ser Thr Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Thr Glu Asp Thr Ala Leu Tyr Tyr Cys85 90 95Ala
Lys60198PRTHomo sapiens 601Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Lys Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Asp Tyr20 25 30Tyr Met Ser Trp Ile Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ser Tyr Ile Ser Ser Ser Gly
Ser Thr Ile Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg60298PRTHomo sapiens 602Gln Val Gln Leu Leu Glu Ser Gly Gly Gly
Leu Val Lys Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Asp Tyr20 25 30Tyr Met Ser Trp Ile Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ser Tyr Ile Ser Ser Ser Ser
Ser Tyr Thr Asn Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg603100PRTHomo sapiens 603Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Lys Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Gly Ser20 25 30Ala Met His Trp Val Arg Gln Ala
Ser Gly Lys Gly Leu Glu Trp Val35 40 45Gly Arg Ile Arg Ser Lys Ala
Asn Ser Tyr Ala Thr Ala Tyr Ala Ala50 55 60Ser Val Lys Gly Arg Phe
Thr Ile Ser Arg Asp Asp Ser Lys Asn Thr65 70 75 80Ala Tyr Leu Gln
Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr85 90 95Tyr Cys Thr
Arg100604100PRTHomo sapiens 604Glu Val Gln Leu Val Glu Ser Gly Gly
Gly Leu Val Lys Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Phe Thr Phe Ser Asn Ala20 25 30Trp Met Ser Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val35 40 45Gly Arg Ile Lys Ser Lys
Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala50 55 60Pro Val Lys Gly Arg
Phe Thr Ile Ser Arg Asp Asp Ser Lys Asn Thr65 70 75 80Leu Tyr Leu
Gln Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr85 90 95Tyr Cys
Thr Thr100605100PRTHomo sapiens 605Glu Val Gln Leu Val Glu Ser Gly
Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala
Ala Ser Gly Phe Thr Phe Ser Asn Ala20 25 30Trp Met Ser Trp Val Arg
Gln Ala Pro Gly Lys Gly Leu Glu Trp Val35 40 45Gly Arg Ile Glu Ser
Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala50 55 60Pro Val Lys Gly
Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Asn Thr65 70 75 80Leu Tyr
Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr85 90 95Tyr
Cys Thr Thr100606100PRTHomo sapiens 606Glu Val Gln Leu Val Glu Ser
Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala20 25 30Trp Met Ser Trp Val
Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val35 40 45Gly Arg Ile Lys
Ser Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala50 55 60Pro Val Lys
Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Asn Thr65 70 75 80Leu
Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr85 90
95Tyr Cys Thr Thr100607100PRTHomo sapiens 607Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala20 25 30Trp Met Ser
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val35 40 45Gly Arg
Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr Asn Tyr Ala Ala50 55 60Pro
Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Asn Thr65 70 75
80Leu Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr85
90 95Tyr Cys Thr Thr100608100PRTHomo sapiens 608Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala20 25 30Trp Met Asn
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val35 40 45Gly Arg
Ile Lys Ser Lys Thr Asp Gly Gly Thr Thr Asp Tyr Ala Ala50 55 60Pro
Val Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asp Ser Lys Asn Thr65 70 75 80Leu Tyr Leu Gln Met Asn Ser Leu Lys
Thr Glu Asp Thr Ala Val Tyr85 90 95Tyr Cys Thr Thr100609100PRTHomo
sapiens 609Glu Val Gln Leu Val Glu Ser Gly Gly Ala Leu Val Lys Pro
Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe
Ser Asn Ala20 25 30Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly
Leu Glu Trp Val35 40 45Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr
Thr Asp Tyr Ala Ala50 55 60Pro Val Lys Gly Arg Phe Thr Ile Ser Arg
Asp Asp Ser Lys Asn Thr65 70 75 80Leu Tyr Leu Gln Met Asn Ser Leu
Lys Thr Glu Asp Thr Ala Val Tyr85 90 95Tyr Cys Thr
Thr10061098PRTHomo sapiens 610Glu Val Gln Leu Val Glu Ser Gly Gly
Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Pro Ala
Ser Gly Phe Thr Phe Ser Asn His20 25 30Tyr Met Ser Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ser Tyr Ile Ser Gly Asp
Ser Gly Tyr Thr Asn Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr
Ile Ser Arg Asp Asn Ala Asn Asn Ser Pro Tyr65 70 75 80Leu Gln Met
Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Val
Lys61198PRTHomo sapiens 611Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Asn His20 25 30Tyr Thr Ser Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ser Tyr Ser Ser Gly Asn Ser
Gly Tyr Thr Asn Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Val
Lys61298PRTHomo sapiens 612Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Asn Ser20 25 30Asp Met Asn Trp Val His Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ser Gly Val Ser Trp Asn Gly
Ser Arg Thr His Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Ile Ile
Ser Arg Asp Asn Ser Arg Asn Thr Leu Tyr65 70 75 80Leu Gln Thr Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Val
Arg61398PRTHomo sapiens 613Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Asn Ser20 25 30Asp Met Asn Trp Ala Arg Lys Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ser Gly Val Ser Trp Asn Gly
Ser Arg Thr His Tyr Val Asp Ser Val50 55 60Lys Arg Arg Phe Ile Ile
Ser Arg Asp Asn Ser Arg Asn Ser Leu Tyr65 70 75 80Leu Gln Lys Asn
Arg Arg Arg Ala Glu Asp Met Ala Val Tyr Tyr Cys85 90 95Val
Arg61498PRTHomo sapiens 614Thr Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Glu Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Asn Ser20 25 30Asp Met Asn Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ser Gly Val Ser Trp Asn Gly
Ser Arg Thr His Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Ile Ile
Ser Arg Asp Asn Ser Arg Asn Phe Leu Tyr65 70 75 80Gln Gln Met Asn
Ser Leu Arg Pro Glu Asp Met Ala Val Tyr Tyr Cys85 90 95Val
Arg61597PRTHomo sapiens 615Glu Val His Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ala Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Asn Tyr20 25 30Asp Met His Trp Val Arg Gln Ala
Thr Gly Lys Gly Leu Glu Trp Val35 40 45Ser Ala Asn Gly Thr Ala Gly
Asp Thr Tyr Tyr Pro Gly Ser Val Lys50 55 60Gly Arg Phe Thr Ile Ser
Arg Glu Asn Ala Lys Asn Ser Leu Tyr Leu65 70 75 80Gln Met Asn Ser
Leu Arg Ala Gly Asp Thr Ala Val Tyr Tyr Cys Ala85 90
95Arg61697PRTHomo sapiens 616Glu Val Gln Leu Val Glu Thr Gly Gly
Gly Leu Ile Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Phe Thr Val Ser Ser Asn20 25 30Tyr Met Ser Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ser Val Ile Tyr Ser Gly
Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys50 55 60Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu65 70 75 80Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala85 90
95Arg61797PRTHomo sapiens 617Glu Val Gln Leu Val Gln Ser Gly Gly
Gly Leu Val His Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Gly
Ser Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met His Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ser Ala Ile Gly Thr Gly
Gly Gly Thr Tyr Tyr Ala Asp Ser Val Lys50 55 60Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr Leu65 70 75 80Gln Met Asn
Ser Leu Arg Ala Glu Asp Met Ala Val Tyr Tyr Cys Ala85 90
95Arg61897PRTHomo sapiens 618Glu Val Gln Leu Val Gln Ser Gly Gly
Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Gly
Ser Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met His Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ser Ala Ile Gly Thr Gly
Gly Gly Thr Tyr Tyr Ala Asp Ser Val Lys50 55 60Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr Leu65 70 75 80Gln Met Asn
Ser Leu Arg Ala Glu Asp Met Ala Val Tyr Tyr Cys Ala85 90
95Arg61998PRTHomo sapiens 619Glu Val Gln Leu Leu Glu Ser Gly Gly
Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met Ser Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ser Ala Ile Ser Gly Ser
Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr
Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met
Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Lys62098PRTHomo sapiens 620Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ser Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Tyr Val35 40 45Ser Ala Ile Ser Ser Asn Gly
Gly Ser Thr Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Val Gln Met Ser
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Val
Lys62198PRTHomo sapiens 621Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ser Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Tyr Val35 40 45Ser Ala Ile Ser Ser Asn Gly
Gly Ser Thr Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Val Gln Met Ser
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Val
Lys62298PRTHomo sapiens 622Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Tyr Val35 40 45Ser Ala Ile Ser Ser Asn Gly
Gly Ser Thr Tyr Tyr Ala Asn Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Gly
Ser Leu Arg Ala Glu Asp Met Ala Val Tyr Tyr Cys85 90 95Ala
Arg62398PRTHomo sapiens 623Glu Val Gln Leu Leu Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met Ser Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ser Ala Ile Ser Gly Ser Gly
Gly Ser Thr Tyr Tyr Gly Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Lys62498PRTHomo sapiens 624Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Thr Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg62598PRTHomo sapiens 625Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg62698PRTHomo sapiens 626Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Ser
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg62798PRTHomo sapiens 627Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg62898PRTHomo sapiens 628Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg62998PRTHomo sapiens 629Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg63098PRTHomo sapiens 630Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg63198PRTHomo sapiens 631Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg63298PRTHomo sapiens 632Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg63398PRTHomo sapiens 633Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ser Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Tyr Val35 40 45Ser Ala Ile Ser Ser Asn Gly
Gly Ser Thr Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Val Gln Met Ser
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Val
Lys63498PRTHomo sapiens 634Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ser Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Tyr Val35 40 45Ser Ala Ile Ser Ser Asn Gly
Gly Ser Thr Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg63598PRTHomo sapiens 635Gln Val Gln Leu Val Glu Ser Gly Gly
Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Ala Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg63698PRTHomo sapiens 636Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg63798PRTHomo sapiens 637Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Ala Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Lys63897PRTHomo sapiens 638Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Asp Met His Trp Val Arg Gln Ala
Thr Gly Lys Gly Leu Glu Trp Val35 40 45Ser Ala Ile Gly Thr Ala Gly
Asp Thr Tyr Tyr Pro Gly Ser Val Lys50 55 60Gly Arg Phe Thr Ile Ser
Arg Glu Asn Ala Lys Asn Ser Leu Tyr Leu65 70 75 80Gln Met Asn Ser
Leu Arg Ala Gly Asp Thr Ala Val Tyr Tyr Cys Ala85 90
95Arg63998PRTHomo sapiens 639Glu Val Gln Leu Val Glu Ser Gly Gly
Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Phe Thr Phe Ser Ser Tyr20 25 30Glu Met Asn Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ser Tyr Ile Ser Ser Ser
Gly Ser Thr Ile Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr
Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met
Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg64098PRTHomo sapiens 640Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Leu Arg Ala Arg Leu Cys Ile Thr Val85 90 95Arg
Glu64198PRTHomo sapiens 641Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg64298PRTHomo sapiens 642Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg64398PRTHomo sapiens 643Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg64498PRTHomo sapiens 644Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg64598PRTHomo sapiens 645Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Arg Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg64698PRTHomo sapiens 646Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg64798PRTHomo sapiens 647Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Trp Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg64898PRTHomo sapiens 648Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Gly Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg64998PRTHomo sapiens 649Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Lys65098PRTHomo sapiens 650Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Lys65198PRTHomo sapiens 651Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Trp Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg65298PRTHomo sapiens 652Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Trp Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Lys65395PRTHomo sapiens 653Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Arg Lys85 90 9565498PRTHomo
sapiens 654Gln Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro
Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe
Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala Pro Gly Lys Gly
Leu Glu Trp Val35 40 45Ala Val Ile Ser Tyr Asp Gly Ser Asn Lys Tyr
Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn
Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala
Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala Arg65598PRTHomo sapiens
655Gln Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser
Tyr20 25 30Gly Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val35 40 45Ala Val Ile Trp Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala
Asp Ser Ala50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Thr
Asn Thr Leu Phe65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp
Thr Ala Val Tyr Tyr Cys85 90 95Ala Arg65698PRTHomo sapiens 656Glu
Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr20
25 30Ser Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp
Val35 40 45Ser Tyr Ile Ser Ser Ser Ser Ser Thr Ile Tyr Tyr Ala Asp
Ser Val50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn
Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Asp Glu Asp Thr
Ala Val Tyr Tyr Cys85 90 95Ala Arg65798PRTHomo sapiens 657Glu Val
Gln Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15Ser
Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr20 25
30Ser Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val35
40 45Ser Ser Ile Ser Ser Ser Ser Ser Tyr Ile Tyr Tyr Ala Asp Ser
Val50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser
Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala
Val Tyr Tyr Cys85 90 95Ala Arg65897PRTHomo sapiens 658Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15Ser Leu
Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr20 25 30Ser
Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val35 40
45Ser Ser Ile Ser Ser Ser Ser Tyr Ile Tyr Tyr Ala Asp Ser Val Lys50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr
Leu65 70 75 80Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr
Tyr Cys Ala85 90 95Arg65998PRTHomo sapiens 659Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr20 25 30Ser Met Asn
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ser Ser
Ile Ser Ser Ser Ser Ser Tyr Ile Tyr Tyr Ala Asp Ser Val50 55 60Lys
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85
90 95Ala Arg66098PRTHomo sapiens 660Glu Val Gln Leu Val Glu Ser Gly
Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala
Ala Ser Gly Phe Thr Phe Ser Ser Tyr20 25 30Ser Met Asn Trp Val Arg
Gln Ala Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ser Tyr Ile Ser Ser
Ser Ser Ser Thr Ile Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe
Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln
Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg66197PRTHomo sapiens 661Glu Asp Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Pro Ser Cys Ala Ala Ser
Gly Phe Ala Phe Ser Ser Tyr20 25 30Val Leu His Trp Val Arg Arg Ala
Pro Gly Lys Gly Pro Glu Trp Val35 40 45Ser
Ala Ile Gly Thr Gly Gly Asp Thr Tyr Tyr Ala Asp Ser Val Met50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Lys Ser Leu Tyr Leu65
70 75 80Gln Met Asn Ser Leu Ile Ala Glu Asp Met Ala Val Tyr Tyr Cys
Ala85 90 95Arg66298PRTHomo sapiens 662Glu Val Gln Leu Val Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr20 25 30Trp Met His Trp Val
Arg Gln Ala Pro Gly Lys Gly Leu Val Trp Val35 40 45Ser Arg Ile Asn
Ser Asp Gly Ser Ser Thr Ser Tyr Ala Asp Ser Val50 55 60Lys Gly Arg
Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr65 70 75 80Leu
Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90
95Ala Arg66398PRTHomo sapiens 663Glu Val Gln Leu Val Glu Ser Gly
Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala
Ala Ser Gly Phe Thr Phe Ser Ser Tyr20 25 30Trp Met His Trp Val Arg
Gln Ala Pro Gly Lys Gly Leu Val Trp Val35 40 45Ser Arg Ile Asn Ser
Asp Gly Ser Ser Thr Ser Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe
Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr65 70 75 80Leu Gln
Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg66498PRTHomo sapiens 664Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Trp Met Ser Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Asn Ile Lys Gln Asp Gly
Ser Glu Lys Tyr Tyr Val Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg66598PRTHomo sapiens 665Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Trp Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Val Trp Val35 40 45Ser Arg Ile Asn Ser Asp Gly
Ser Ser Thr Ser Tyr Ala Asp Ser Met50 55 60Lys Gly Gln Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Met Ala Val Tyr Tyr Cys85 90 95Thr
Arg66698PRTHomo sapiens 666Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Trp Met Ser Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Asn Ile Lys Gln Asp Gly
Ser Glu Lys Tyr Tyr Val Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Ala
Arg66798PRTHomo sapiens 667Gln Val Gln Leu Val Gln Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val35 40 45Ala Phe Ile Arg Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Lys
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys85 90 95Thr
Thr66898PRTHomo sapiens 668Gln Ser Val Leu Thr Gln Pro Pro Ser Val
Ser Ala Ala Pro Gly Gln1 5 10 15Lys Val Thr Ile Ser Cys Ser Gly Ser
Ser Ser Asn Ile Gly Asn Asn20 25 30Tyr Val Ser Trp Tyr Gln Gln Leu
Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Asp Asn Asn Lys Arg
Pro Ser Gly Ile Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser Gly Thr
Ser Ala Thr Leu Gly Ile Thr Gly Leu Gln65 70 75 80Thr Gly Asp Glu
Ala Asp Tyr Tyr Cys Gly Thr Trp Asp Ser Ser Leu85 90 95Ser
Ala66998PRTHomo sapiens 669Gln Ser Val Leu Thr Gln Pro Pro Ser Val
Ser Ala Ala Pro Gly Gln1 5 10 15Lys Val Thr Ile Ser Cys Ser Gly Ser
Ser Ser Asp Met Gly Asn Tyr20 25 30Ala Val Ser Trp Tyr Gln Gln Leu
Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Glu Asn Asn Lys Arg
Pro Ser Gly Ile Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser Gly Thr
Ser Ala Thr Leu Gly Ile Thr Gly Leu Trp65 70 75 80Pro Glu Asp Glu
Ala Asp Tyr Tyr Cys Leu Ala Trp Asp Thr Ser Pro85 90 95Arg
Ala67098PRTHomo sapiens 670Gln Ser Val Leu Thr Gln Pro Pro Ser Ala
Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser Gly Ser
Ser Ser Asn Ile Gly Ser Asn20 25 30Thr Val Asn Trp Tyr Gln Gln Leu
Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Ser Asn Asn Gln Arg
Pro Ser Gly Val Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser Gly Thr
Ser Ala Ser Leu Ala Ile Ser Gly Leu Gln65 70 75 80Ser Glu Asp Glu
Ala Asp Tyr Tyr Cys Ala Ala Trp Asp Asp Ser Leu85 90 95Asn
Gly67198PRTHomo sapiens 671Gln Ser Val Leu Thr Gln Pro Pro Ser Ala
Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser Gly Ser
Ser Ser Asn Ile Gly Ser Asn20 25 30Tyr Val Tyr Trp Tyr Gln Gln Leu
Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Arg Asn Asn Gln Arg
Pro Ser Gly Val Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser Gly Thr
Ser Ala Ser Leu Ala Ile Ser Gly Leu Arg65 70 75 80Ser Glu Asp Glu
Ala Asp Tyr Tyr Cys Ala Ala Trp Asp Asp Ser Leu85 90 95Ser
Gly67298PRTHomo sapiens 672Gln Ser Val Leu Thr Gln Pro Pro Ser Val
Ser Glu Ala Pro Arg Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser Gly Ser
Ser Ser Asn Ile Gly Asn Asn20 25 30Ala Val Asn Trp Tyr Gln Gln Leu
Pro Gly Lys Ala Pro Lys Leu Leu35 40 45Ile Tyr Tyr Asp Asp Leu Leu
Pro Ser Gly Val Ser Asp Arg Phe Ser50 55 60Gly Ser Lys Ser Gly Thr
Ser Ala Ser Leu Ala Ile Ser Gly Leu Gln65 70 75 80Ser Glu Asp Glu
Ala Asp Tyr Tyr Cys Ala Ala Trp Asp Asp Ser Leu85 90 95Asn
Gly67399PRTHomo sapiens 673Gln Ser Val Leu Thr Gln Pro Pro Ser Val
Ser Gly Ala Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Thr Gly Ser
Ser Ser Asn Ile Gly Ala Gly20 25 30Tyr Val Val His Trp Tyr Gln Gln
Leu Pro Gly Thr Ala Pro Lys Leu35 40 45Leu Ile Tyr Gly Asn Ser Asn
Arg Pro Ser Gly Val Pro Asp Gln Phe50 55 60Ser Gly Ser Lys Ser Gly
Thr Ser Ala Ser Leu Ala Ile Thr Gly Leu65 70 75 80Gln Ser Glu Asp
Glu Ala Asp Tyr Tyr Cys Lys Ala Trp Asp Asn Ser85 90 95Leu Asn
Ala67499PRTHomo sapiens 674Gln Ser Val Val Thr Gln Pro Pro Ser Val
Ser Gly Ala Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Thr Gly Ser
Ser Ser Asn Ile Gly Ala Gly20 25 30Tyr Asp Val His Trp Tyr Gln Gln
Leu Pro Gly Thr Ala Pro Lys Leu35 40 45Leu Ile Tyr Gly Asn Ser Asn
Arg Pro Ser Gly Val Pro Asp Arg Phe50 55 60Ser Gly Ser Lys Ser Gly
Thr Ser Ala Ser Leu Ala Ile Thr Gly Leu65 70 75 80Gln Ala Glu Asp
Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Ser Ser85 90 95Leu Ser
Gly67598PRTHomo sapiens 675Ser Tyr Val Leu Thr Gln Pro Pro Ser Val
Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser Gly Gly
Arg Ser Asn Ile Gly Ser Asn20 25 30Thr Val Lys Trp Tyr Gln Gln Leu
Pro Gly Thr Ala Pro Lys Leu Leu35 40 45Ile Tyr Gly Asn Asp Gln Arg
Pro Ser Gly Val Pro Asp Arg Phe Ser50 55 60Gly Ser Lys Ser Gly Thr
Ser Ala Ser Leu Ala Ile Thr Gly Val Gln65 70 75 80Ala Glu Asp Glu
Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Ser Ser Leu85 90 95Arg Gly
* * * * *