U.S. patent application number 12/012627 was filed with the patent office on 2009-10-08 for novel peptide involved in energy homeostasis.
Invention is credited to Andrew A. Butler, James L. Trevaskis.
Application Number | 20090253619 12/012627 |
Document ID | / |
Family ID | 37727967 |
Filed Date | 2009-10-08 |
United States Patent
Application |
20090253619 |
Kind Code |
A1 |
Butler; Andrew A. ; et
al. |
October 8, 2009 |
Novel peptide involved in energy homeostasis
Abstract
The expression of a mRNA encoding a putative 76 amino acid,
secreted protein ("Enho1") was found to negatively correlate with
fasting triglyceride and cholesterol levels. A recombinant
adenovirus was used to increase the expression of Enho1 mRNA in two
mouse models of obesity, KK-A.sup.y and Lep.sup.ob/Lep.sup.ob mice.
Over-expression of Enho1 by adenovirus injection significantly, and
reproducibly, reduced fasting triglyceride and cholesterol levels
in both models. In addition, transgenic mice strains were made that
over express Enho1 protein. Additionally, the expression of a key
gene involved in lipogenesis (fatty acid synthase) and FAS protein
levels were reduced by ENHO1 adenoviral treatment in
Lep.sup.ob/Lep.sup.ob mice. Full-length ENHO1 peptide, or peptide
derivatives, homologues, analogues, or mimetics thereof, delivered
by oral intake, injection, subcutaneous patch, or intranasal
routes, could be used as therapeutic or diagnostic agents for
hypercholesterolemia, hypertriglyceridemia, insulin resistance,
obesity, diabetes, and/or energy imbalance.
Inventors: |
Butler; Andrew A.; (Baton
Rouge, LA) ; Trevaskis; James L.; (San Diego,
CA) |
Correspondence
Address: |
Alan F. Feeney, Esq.;Biomeasure, Incorporated
27 Maple Street
Milford
MA
01757
US
|
Family ID: |
37727967 |
Appl. No.: |
12/012627 |
Filed: |
February 5, 2008 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
PCT/US2006/030686 |
Aug 7, 2006 |
|
|
|
12012627 |
|
|
|
|
60705940 |
Aug 5, 2005 |
|
|
|
Current U.S.
Class: |
514/1.1 ;
435/252.1; 435/255.1; 435/320.1; 435/325; 435/348; 435/410;
435/69.1; 514/44R; 530/324; 530/326; 530/327; 530/387.9; 800/13;
800/18 |
Current CPC
Class: |
C07K 16/18 20130101;
A61K 38/1709 20130101; A61K 38/2264 20130101; A61P 3/06 20180101;
A61K 38/22 20130101; C07K 14/4702 20130101; C07K 14/47 20130101;
A61P 3/04 20180101; G01N 33/68 20130101; A61P 3/10 20180101; A61P
3/00 20180101 |
Class at
Publication: |
514/12 ; 530/324;
530/327; 530/326; 514/14; 514/13; 435/320.1; 435/252.1; 435/255.1;
435/325; 435/348; 435/410; 435/69.1; 514/44.R; 530/387.9; 800/13;
800/18 |
International
Class: |
A61K 38/16 20060101
A61K038/16; C07K 14/435 20060101 C07K014/435; C07K 14/00 20060101
C07K014/00; C07K 7/08 20060101 C07K007/08; A61K 38/10 20060101
A61K038/10; A61P 3/04 20060101 A61P003/04; A61K 38/22 20060101
A61K038/22; C12N 15/63 20060101 C12N015/63; C12N 1/20 20060101
C12N001/20; C12N 1/16 20060101 C12N001/16; C12N 5/06 20060101
C12N005/06; C12N 5/04 20060101 C12N005/04; C12P 21/00 20060101
C12P021/00; A61K 31/7088 20060101 A61K031/7088; C07K 16/18 20060101
C07K016/18; A01K 67/00 20060101 A01K067/00; A01K 67/027 20060101
A01K067/027 |
Claims
1. A purified Enho 1 peptide, and fragment, homologs, analogs and
derivatives thereof, wherein the peptide has the following
characteristics: a. it is a substantially homogenous preparation;
and b. it has at least 70% homology to any one of the sequences set
forth in SEQ ID NOS: 2 and 8-18; wherein c. the peptide modulates
energy metabolism, lipid metabolism, and/or insulin action.
2. A peptide of claim 1, wherein the peptide is a mammalian
peptide.
3. A peptide of claim 1, wherein the peptide is a murine
peptide.
4. A peptide of claim 1, wherein the peptide is a human
peptide.
5. A peptide of claim 1, wherein the peptide is a synthetic
peptide.
6. A peptide of claim 1, wherein said homology to any one of the
sequences set forth in SEQ ID NOS: 2, 10, 11, 12-18 is greater than
85%.
7. A peptide of claim 6, wherein the homology is greater than
95%.
8. A pharmaceutical composition comprising an Enho1 peptide of
claim 1, and a pharmaceutical acceptable carrier.
9. A method for treating or preventing a pathophysiology relating
to homeostasis of body mass, comprising administering to a subject
a therapeutically effective amount of a pharmaceutical composition
comprising a Enho1 peptide according to claim 1, or fragments,
homologs, analogs and derivatives thereof.
10. A method according to claim 9, wherein the Enho1 peptide has at
least 70% homology to any one of the sequences set forth in SEQ ID
NOS: 2 and 10-18.
11. A method according to claim 9, wherein the pathophysiology is
obesity.
12. A method according to claim 9, additionally comprising
administering to a subject a compound selected from the group
consisting of leptin and adiponectin.
13. A method according to claim 9, wherein the pathophysiology is
one related to obesity comprising any one of hyperglycemia,
hyperinsulinemia, insulin resistance, hyperlipidemia, Type II
diabetes mellitus, and non-insulin dependent diabetes mellitus.
14. A method according to claim 9, wherein the step of
administering to a subject comprises intraperitoneal
administration.
15. A vector comprising a least 200 nucleic acids of the open
reading frame of the nucleic acid sequence of SEQ ID NO: 1.
16. A cultured cell that produces a Enho1 peptide according to
claim 1.
17. The cell of claim 16, wherein the cell is selected from the
group consisting of bacteria, yeast, mammalian cells, plant cells,
and insect cells.
18. A method for preparing a Enho1 peptide comprising: a. culturing
a cell containing a nucleic acid corresponding to at least the open
reading frame of SEQ ID NO: 1 under conditions that provide for
expression of the peptide; and b. recovering the expressed
peptide.
19. A pharmaceutical composition comprising at least the open
reading frame of SEQ ID NO: 1, wherein the nucleic acid encodes a
Enho1 peptide, and a pharmaceutical acceptable carrier.
20. An antibody, and fragments, derivatives, homologs and analogs
thereof, which immunospecifically binds to the peptide of claim
1.
21. An antibody of claim 20 labeled with a detectable label.
22. An antibody of claim 20, wherein said antibody is generated
using any one of the peptides of SEQ ID NOS: 2 and 8-18, and
fragments, derivatives, homologs, and analogs of said peptide.
23. An antibody or fragment of claim 20, wherein the antibody is a
polyclonal antibody.
24. An antibody or fragment of claim 20, wherein the antibody is a
monoclonal antibody.
25. A recombinant non-human animal containing a nucleic acid,
wherein the nucleic acid is an isolated nucleic acid comprising a
nucleotide sequence encoding any one of the Enho1 related peptides
of SEQ ID NOS:2 and 8-18, and fragments, derivatives, homologs, and
analogs thereof of those peptides.
26. A method to ameliorate or decrease insulin resistance in a
subject, comprising administering to a subject a therapeutically
effective amount of a Enho1 peptide according to claim 1, and
fragments, derivatives, homologs, and analogs thereof of those
peptides.
27. A method to ameliorate or treat symptoms of diabetes in a
subject, comprising administering to the subject a therapeutically
effective amount of a Enho1 peptide according to claim 1, and
fragments, derivatives, homologs, and analogs thereof of those
peptides.
28. A method to prevent or delay the onset of obesity in a subject,
comprising administering to the subject a therapeutically effective
amount of a Enho1 peptide according to claim 1, and fragments,
derivatives, homologs, and analogs thereof of those peptides.
29. A method to ameliorate or decrease hyperlipidemia in a subject,
comprising administering to the subject a therapeutically effective
amount of a Enho1 peptide according to claim 1, and fragments,
derivatives, homologs, and analogs thereof of those peptides.
30. A method to decrease total cholesterol in the serum in a
subject, comprising administering to the subject a therapeutically
effective amount of a Enho1 peptide according to claim 1, and
fragments, derivatives, homologs, and analogs thereof of those
peptides.
31. A method to decrease serum triglycerides in a subject,
comprising administering to the subject a therapeutically effective
amount of a Enho1 peptide according to claim 1, and fragments,
derivatives, homologs, and analogs thereof of those peptides.
32. A method of any one of claims 28-33, additionally comprising
administering to a subject a compound selected from the group
consisting of leptin and adiponectin.
33. A non-human transgenic animal having cells that carry a
exogenous promoter and a cDNA corresponding to at least the open
reading frame of SEQ ID NO: 1 wherein said cells constitutively
over express a Enho1 peptide with a sequence as given in SEQ ID
NOS:2 and 8-18, and fragments, derivatives, homologs, and analogs
thereof of those peptides.
34. The transgenic animal of claim 33, wherein said exogenous
promoter is an actin promoter.
35. The transgenic animal of claim 33, wherein said non-human
animal is a mouse.
36. A transformation vector comprising at least the open reading
frame of a nucleic acid sequence as recited in SEQ ID NO: 1.
37. A host cell comprising at least the open reading frame of the
nucleic acid sequence as recited in SEQ ID NO: 1.
38. A nucleic acid construct comprising at least the open reading
frame of the nucleic acid sequence as recited in SEQ ID NO: 1,
wherein said sequence is operably linked to a promoter that is
functional in mammals.
39. A nucleic acid construct as recited in claim 38, wherein said
promoter is an actin promoter.
40. An animal transformed with a nucleic acid construct as recited
in claim 39.
41. A purified Enho1 peptide, and fragment, homologs, analogs and
derivatives thereof, wherein the peptide has the following
characteristics: a. it is a substantially homogenous preparation;
and b. it has at least 70% homology to any one of the sequences set
forth in SEQ ID NOS: 10-11; wherein c. the peptide modulates energy
metabolism, lipid metabolism, and/or insulin action.
42. A peptide of claim 41, wherein said homology to any one of the
sequences set forth in SEQ ID NOS: 10-11 is greater than 85%.
Description
[0001] This application is a continuation-in-part of copending
international (PCT) application No. PCT/US20006/030686, filed Aug.
7, 2006, designating the United States, which application claims
priority to U.S. provisional application 60/705,940 filed Aug. 5,
2005.
TECHNICAL FIELD
[0002] This invention pertains to a novel gene and resulting
protein, named "Energy Homeostasis Associated-1" (Enho1) which was
found to be involved in the association of obesity with insulin
resistance and lipidemia.
BACKGROUND ART
[0003] Obesity is an increasingly prevalent global disease and has
reached epidemic proportions. Current estimates suggest that at
least 50% of the Western population is either overweight or obese.
Obesity, particularly abdominal obesity, combined with other
conditions such as insulin resistance, dyslipidemia, hepatic
steatosis, and hypertension is known as the Metabolic, or Insulin
Resistance, Syndrome. The central pathophysiological features of
the dyslipidemia associated with insulin resistance and type 2
diabetes are increased plasma triglycerides (TG) in very low
density lipoproteins (VLDL), and reduced high density lipoprotein
(HDL) cholesterol. Commonly, increased circulating TGs are
hydrolyzed into free fatty acids (FFA) and are taken up by
peripheral tissues including the liver and can lead to hepatic
steatosis, or non-alcoholic fatty liver. Studies of several mutant
mouse models of obesity and metabolic disorders suggest that the
link between insulin resistance and dysregulated TG is complex and
involves both peripheral and central factors.
[0004] Insulin resistance refers to reduced insulin-stimulated
glucose uptake in skeletal muscle and fat, and an impaired
suppression of liver glucose output (2). Hyperglycemia and
hyperlipidemia are both side effects of, and causative agents in,
the pathophysiology of type 2 diabetes. Glucotoxicity and
lipotoxicity further promote insulin resistance and type 2 diabetes
due to suppression of insulin action and secretion from the
.beta.-cell. Hyperinsulinemia is initially successful in
suppressing liver glucose output, however the deleterious effects
of increased insulin offset the gains associated with maintaining
normal blood glucose levels (2). Hyperinsulinemia is thought to be
a factor in a cluster of metabolic abnormalities, including
hypertension, non-alcoholic fatty liver disease (NAFLD) and
coronary heart disease (2). NAFLD disease is commonly associated
with insulin resistance, and requires two transcription factors:
sterol regulatory element binding protein-1c (SREBP1c) and
peroxisome proliferator receptor-.gamma. (PPAR.gamma.) (3-6).
Absence of SREBP1, or PPAR.gamma. signaling in liver inhibits the
development of liver steatosis that occurs in obese insulin
resistant mice (5-7).
[0005] Defining a common mechanism explaining insulin resistance
has been difficult because of the complexity of the insulin
receptor (IR) signaling system, and the realization that it is not
one, but many factors that contribute to the development of this
disorder. The tyrosine phosphorylation of two adaptor proteins,
IRS1 and IRS2, is a critical early step in the stimulation of
glucose uptake by insulin (8-11). IRS1 and IRS2 have no intrinsic
enzymatic activity, and are thought to function as part of a
molecular scaffold that facilitates the formation of complexes of
proteins with kinase, phosphatase or ubiquitin ligase function
(12). Stimulation of phosphoinositide 3' kinase (PI3K) by
association with the IRS is a critical step in insulin-stimulated
glucose uptake. Activation of the p110 catalytic subunit of PI3K
activates the lipid kinase domain, which phosphorylates
phosphatidylinositol-4,5-bisphosphate. Activation of PI3K is
necessary for full stimulation of glucose uptake by insulin,
although other pathways might also be involved (12).
[0006] A metabolic state conducive to the development of insulin
resistance is thought to result from an imbalance of caloric intake
with oxidative metabolism (13,14). Studies suggest that reduced
mitochondrial function in muscle is a factor in the development of
insulin resistance associated with obesity (14,15). Stimulation of
energy expenditure and suppression of appetite both result in
improved glucose metabolism in mouse models of obesity and type 2
diabetes. A well-characterized example of this is the adipocytokine
leptin. Leptin acts in the hypothalamus and hindbrain to suppress
appetite and through stimulation of the autonomic nervous system
increases oxidative metabolism in skeletal muscle (16-20). However,
leptin can also improve hepatic insulin sensitivity independently
of marked effects on food intake or body weight (17).
[0007] Infusion of fatty acids (FA) is associated with rapid
reductions in insulin sensitivity in muscle within 4-6 h (21-23).
The exact mechanism by which FA's reduce insulin-stimulated glucose
uptake remains a matter of debate. Recent data indicate that FA's
interfere with the IR signal transduction pathways that stimulate
glucose uptake (21,22,24). One hypothesis is that an increase in
the intracellular concentration of FA's and diacyl-glycerol leads
to the activation of a serine kinase, protein-kinase C? (PKC?)
(25). Phosphorylation of IRS1 on Ser.sup.307 by PKC? inhibits the
phosphorylation of IRS-1 by the IR, leading to reduced activation
of PI3K and a reduction in the stimulation of glucose uptake by
insulin.
[0008] Abnormal activity of secreted polypeptides as a link between
obesity and insulin resistance. Determining mechanisms linking
obesity with insulin resistance is important for developing new
glucose lowering therapies. Recent research investigating insulin
resistance has focused on adipocytes. Obesity is associated with
aberrant regulation and function of a regulatory network of
polypeptides secreted from adipocytes (adipocytokines).
Adipocytokines such as leptin, adiponectin, and resistin regulate
hepatic glucose production, glucose disposal in muscle, and the
proliferation and storage of lipid in adipocytes (26). Leptin
regulates energy homeostasis through effects on neurons located in
the hypothalamus and hindbrain, regulating ingestive behavior,
autonomic nervous activity, and neuroendocrine system that govern
metabolism (thyroid, adrenals) (16). Leptin resistance or reduced
serum adiponectin associated with obesity are factors that
contribute to insulin resistance, through diminished
insulin-sensitizing actions and by increasing risk for developing
steatosis (intracellular fatty acid accumulation) (27,28).
Non-adipose tissues also secrete peptides that affect energy
metabolism and insulin sensitivity, such as musclin from muscle
(29) and angiopoietin-related growth factor from liver (30). These
factors may also be targets for the treatment of the metabolic
syndrome.
[0009] Melanocortin receptor knockouts for investigating the link
between obesity and insulin resistance: Two melanocortin receptors
expressed in areas of the central nervous system are involved in
energy homeostasis. Targeted deletion of the neuronal
melanocortin-4 receptor (MC4R) gene in mice (Mc4r-/- or Mc4rKO
mice) causes obesity and hyperinsulinemia, and is also associated
with increased hepatic lipogenic gene expression and hepatic
steatosis. Mice deficient for another neuronal melanocortin
receptor (Mc3r-/- or Mc3rKO mice) develop a similar degree of
obesity to Mc4r-/- mice when fed a high fat diet, but do not
exhibit the same level of insulin resistance, hyperlipidemia and
increased hepatic steatosis Work Mc3rKO and Mc4rKO on the C57BL/6J
(B6) strain both exhibit an exaggerated diet-induced obesity,
however the deterioration of insulin sensitivity in Mc4rKO is more
rapid and severe (31,32). FIGS. 1A-1E illustrate some of the known
differences in wild-type mice (C57BL/6J) and the two knockout mice
in terms of body mass as a function of either a low fat diet or a
high fat diet. (31,32) Severe insulin resistance in mice and humans
is associated with hepatomegaly and steatosis, with increased
hepatic lipogenesis (33). Mc4rKO develop hepatic insulin resistance
and hepatomegaly in the obese state, and on a high fat diet (HFD)
exhibit a marked deterioration of glucose homeostasis associated
with severe glucose and insulin intolerance. FIGS. 2A-2E show the
differences in hepatomegaly and steatosis in the two mouse strains,
and also differences in expression of genes involved in lipid
metabolism. (4,17,57) On the other hand, Mc3rKO matched to Mc4rKO
for fat mass (FM) exhibit a very modest impairment of glucose
homeostasis.
[0010] Sequences of cDNA Similar to ENHO1. A sequence and putative
open reading frame of a cDNA encoding a putative protein homologous
to ENHO1 have previously been published by several consortiums
involved in large-scale sequencing of cDNAs. See R. L. Stausberg et
al., "Generation and initial analysis of more than 15,000
full-length human and mouse cDNA sequences," Proc. Natl. Acad. Sci.
U.S.A., vol. 99, pp. 16899-16903 (2002) (Genbank accession number:
BC021944, cDNA with complete coding sequence); and H. F. Clark et
al., "The secreted protein discovery initiative (SPDI), a
large-scale effort to identify novel human secreted and
transmembrane proteins: a bioinformatics assessment," Genome Res.,
vol. 13, pp. 2265-2270 (Genbank accession number: NM.sub.--198573,
cDNA with complete coding sequence). A protein with similar
homology for the first 37 amino acid residues of SEQ ID NO:2 has
been identified. However, the nucleotide and amino acid sequence of
this described protein may be incorrect, due to a single nucleotide
error in the sequencing of the cDNA.
DISCLOSURE OF INVENTION
[0011] We have discovered a novel secreted peptide (Enho1) based on
an investigation using two transgenic murine models of obesity.
Using microarray gene expression analysis and validation by
RealTime quantitative PCR, the expression of an mRNA (genbank
accession number: AK009710) encoding a putative 76 amino acid,
secreted protein was found to be reduced 10-fold in severely
insulin resistant and glucose intolerant Mc4rKO and
Leptin-deficient (Lep.sup.ob/Lep.sup.ob) mice. In contrast, in
obese Mc3rKO mice, which are moderately glucose intolerant but
exhibit a normal response to insulin, there was a modest 30-40%
reduction in the expression of the Enho1 protein. In C57BL/6J mice,
a negative correlation was found in the hepatic expression Enho1
mRNA with fasting glucose levels. The expression of Enho1 in the
hypothalamus also declined with obesity and insulin resistance. We
also confirmed that the mRNA encoded a secreted protein. Based on
the negative effect of diet-induced obesity and insulin resistance
on Enho1 mRNA expression in liver and brain, the gene encoding the
protein was initially designated "Swir1" ("suppressed with insulin
resistance"), but was later renamed "Enho1" ("energy homeostasis
associated-1"). A recombinant adenovirus was used to increase the
expression of ENHO1 in mouse models of obesity. Over-expression of
ENHO1 by adenovirus injection significantly and reproducibly
reduced fasting insulin, triglyceride and cholesterol levels.
Additionally, the expression of a key gene involved in lipogenesis
(fatty acid synthase) and FAS protein levels were reduced by ENHO1
adenoviral treatment in Lep.sup.ob/Lep.sup.ob mice.
[0012] A transgenic FVB/NJ strain of mouse was created which over
expresses the Enho1 open reading frame, using Enho1 DNA (SEQ ID NO:
1) controlled by the human .beta.-actin promoter which is expressed
in all tissues. Female FVB/NJ mice over expressing Enho1 had a
significant reduction in fat mass, and a higher metabolic rate
determined by measuring oxygen consumption (VO2) using indirect
calorimetry (Oxymax, Columbus Instruments, Columbus, Ohio). The
increase in metabolic rate observed in the transgenic mice had been
predicted, based on the results from experiments using recombinant
adenovirus expressing Enho1. Mice infected with recombinant
adenovirus expressing Enho1 lost more weight during an overnight
fast, suggesting an impaired ability to reduce metabolic rate to
compensate during fasting. FVB/NJ Enho1 transgenic mice exhibit the
same exaggerated weight loss during a fast, associated with a
higher metabolic rate. A component of Enho1's anti-diabetic actions
may therefore involve stimulation of pathways involved in oxidative
metabolism. That is, Enho1 may improve the metabolic profile of
obese, insulin resistant individuals partially through normalizing
the balance of kJ consumption with kJ expended through effects on
physical activity, basal metabolic rate, or a combination of
both.
[0013] Full-length Enho1 peptide, or peptide derivatives,
homologues, analogues, or mimetics thereof, delivered by oral
intake, injection, subcutaneous patch, or intranasal routes, could
be used as therapeutic or diagnostic agents for
hypercholesterolemia, hypertriglyceridemia, insulin resistance,
obesity, diabetes, and/or disorders of energy imbalance.
[0014] Antibodies (AB1 (SEQ ID NO:8) and AB2 (SEQ ID NO:9)) were
raised against peptide fragments derived from the open reading
frame predicted for BC021944, and shown in FIG. 5. These antibodies
were used to verify the presence of Enho1-immunoreactivity in human
serum and in rat brain, strongly supporting the conclusion that the
open reading frame predicted for BC021944 encodes a small secreted
peptide. Enho1-immunoreactivity was detected in human plasma. (data
not shown) In rat brain, neurons with Enho1 immunoreactivity have
been identified in the arcuate nucleus of the hypothalamus. The
significance of this observation is that neurons in the arcuate
nucleus of the hypothalamus have been implicated in the regulation
of energy expenditure, through effects on both facultative
thermogenesis and physical activity, and on glucose homeostasis
[Cone R D. Anatomy and regulation of the central melanocortin
system. Nat. Neurosci. 2005 May; 8(5):571-8; Coppari R, Ichinose M,
Lee C E, Pullen A E, Kenny C D, McGovern R A, Tang V, Liu S M,
Ludwig T, Chua S C Jr, Lowell B B, Elmquist J K. The hypothalamic
arcuate nucleus: a key site for mediating leptin's effects on
glucose homeostasis and locomotor activity. Cell Metab. 2005
January; 1(1):63-72.] The increased energy expenditure and physical
activity of the FVB/NJ Enho1 transgenic mice may therefore involve
action in the central nervous system, and more specifically through
actions based on regulating activity of neurons in the arcuate
nucleus of the hypothalamus.
BRIEF DESCRIPTION OF THE DRAWINGS
[0015] FIG. 1A illustrates the differences in body mass in
6-month-old, female mice after 12 weeks feeding either a low-fat
diet (LF) or a high-fat diet (HF) among three different strains,
wild-type (WT), Mc3r -/- deficient mice (Mc3rKO), and Mc4r -/-
deficient mice (Mc4rKO). (Significant effect of diet is indicated
by "*" (p<0.001) or "#" (p<0.05); significant effects within
diet indicated by letters, with groups significantly different
(p<0.05) given different letters; significance based on 2-way
AVOVA)
[0016] FIG. 1B illustrates the differences in body weight gain as a
percent of starting weight in 6-month-old, female mice after 12
weeks feeding either a low-fat diet (LF) or a high-fat diet (HF)
among three different strains, wild-type (WT), Mc3r -/- deficient
mice (Mc3rKO), and Mc4r -/- deficient mice (Mc4rKO). (Significant
effect of diet is indicated by "*" (p<0.001) or "#" (p<0.05);
significant effects within diet indicated by letters, with groups
significantly different (p<0.05) given different letters;
significance based on 2-way AVOVA)
[0017] FIG. 1C illustrates the differences in percent body fat in
6-month-old, female mice after 12 weeks feeding either a low-fat
diet (LF) or a high-fat diet (HF) among three different strains,
wild-type (WT), Mc3r -/- deficient mice (Mc3rKO), and Mc4r -/-
deficient mice (Mc4rKO). (Significant effect of diet is indicated
by "*" (p<0.001) or "#" (p<0.05); significant effects within
diet indicated by letters, with groups significantly different
(p<0.05) given different letters; significance based on 2-way
AVOVA)
[0018] FIG. 1D illustrates the differences in fat mass in
6-month-old, female mice after 12 weeks feeding either a low-fat
diet (LF) or a high-fat diet (HF) among three different strains,
wild-type (WT), Mc3r -/- deficient mice (Mc3rKO), and Mc4r -/-
deficient mice (Mc4rKO). (Significant effect of diet is indicated
by "*" (p<0.001) or "#" (p<0.05); significant effects within
diet indicated by letters, with groups significantly different
(p<0.05) given different letters; significance based on 2-way
AVOVA)
[0019] FIG. 1E illustrates the differences in fat-free mass in
6-month-old, female mice after 12 weeks feeding either a low-fat
diet (LF) or a high-fat diet (HF) among three different strains,
wild-type (WT), Mc3r -/- deficient mice (Mc3rKO), and Mc4r -/-
deficient mice (Mc4rKO). (Significant effect of diet is indicated
by "*" (p<0.001) or "#" (p<0.05); significant effects within
diet indicated by letters, with groups significantly different
(p<0.05) given different letters; significance based on 2-way
AVOVA)
[0020] FIG. 2A illustrates a comparison of liver histology, as
shown in liver cross-sections stained with hemotoxylin and eosin,
from female mice fed a high fat diet among three mice strains,
wild-type (WT), Mc3r -/- deficient mice (Mc3rKO), and Mc4r -/-
deficient mice (Mc4rKO).
[0021] FIG. 2B illustrates the differences in liver weight as a
function of adiposity (percent body fat) in mice fed both low and
high fat diets among three mice strains, wild-type (WT), Mc3r -/-
deficient mice (Mc3rKO), and Mc4r -/- deficient mice (Mc4rKO).
[0022] FIG. 2C illustrates the differences in mean liver weight
(n=5-6/group) of male and female mice fed a moderate high fat diet
among three mice strains, wild-type (WT), Mc3r -/- deficient mice
(Mc3rKO), and Mc4r -/- deficient mice (Mc4rKO). ("*" indicates
p<0.05 versus WT and Mc3rK0 mice).
[0023] FIG. 2D illustrates the differences in expression of
stearoyl-CoA desaturase 1 (SCD1) in liver of mice fed a high fat
diet among three mice strains, wild-type (WT), Mc3r -/- deficient
mice (Mc3rKO), and Mc4r -/- deficient mice (Mc4rKO). Data is
expressed as arbitrary units (a.u.). ("*" indicates p<0.05
versus WT and Mc3rKO mice).
[0024] FIG. 2E illustrates the differences in expression of
apolipoprotein A4 (ApoA4) in liver of mice fed a high fat diet in
three mice strains, wild-type (WT), Mc3r -/- deficient mice
(Mc3rKO), and Mc4r -/- deficient mice (Mc4rKO). ("*" indicates
p<0.05 versus WT and Mc3rKO mice; "#" indicates p<0.05 versus
WT mice, within gender).
[0025] FIG. 3A illustrates the amount of hepatic AK009710 mRNA
expression (given as a percent of WT expression) in wild-type (WT)
mice and in obese Mc3r -/- deficient mice (Mc3rKO).
[0026] FIG. 3B illustrates the amount of hepatic AK009710 mRNA
expression (given as a percent of WT expression) in wild-type mice
(WT), Mc4r -/- deficient mice (Mc4rKO), and leptin-deficient
Lep.sup.ob/Lep.sup.ob mice (two models of obesity).
[0027] FIG. 3C illustrates the amount of hepatic AK009710 mRNA
expression (given as a percent of expression with saline) in
leptin-deficient Lep.sup.ob/Lep.sup.ob mice injected 4 times over 2
days with either saline or leptin (0.5 mg/g).
[0028] FIG. 4 illustrates the nucleic acid sequence of the Enho1
gene (Mouse AK009710; SEQ ID NO:1), with the open reading frame
encoding the Enho1 protein underlined, and its putative amino acid
translation product Enho1 (SEQ ID NO:2).
[0029] FIG. 5 illustrates the alignment of the putative Enho1
protein sequences for mouse (SEQ ID NO:2), human (SEQ ID NO:14),
rat (SEQ ID NO:12), dog (SEQ ID NO:15), pig (SEQ ID NO:16), cow
(SEQ ID NO:17), sheep (SEQ ID NO:18), and chimpanzee (SEQ ID
NO:13), showing the regions of the putative secreted polypeptide
used to generate polyclonal antibodies (pAB1 ((SEQ ID NO:8) and
pAB2 (SEQ ID NO:9)).
[0030] FIG. 6A illustrates the results of a Northern blot analysis
using a radioactive-labeled portion of the AK009710 DNA sequence
encoding Enho1 protein on human tissue samples (Lanes 1-8
represents RNA from heart, brain, placenta, lung, liver, skeletal
muscle, kidney and pancreas, respectively).
[0031] FIG. 6B illustrates the relative intensity of Enho1 mRNA
bands from a Northern blot analysis using the full-length mouse
AK009710 DNA probe on mouse tissue samples.
[0032] FIG. 6C illustrates the results of a Western blot analysis
for FLAG immunoreactivity in media (M) and cell lysates (Pel) from
HEK293 human-kidney derived cells transfected with pCMV-Enho1:Flag,
pCMV-GFP, or in media from HEK293 cells infected with adenoviral
vector expressing Enho1:Flag fusion protein [no transfected DNA
(lanes 1, 2); transfected with a pCMV-Enho1:FLAG construct (lanes
3, 4); transfected with pCMV-Enho1 (lanes 5, 6); or transfected
with pCMV-GFP (lanes 7, 8); infected with Ad5Enho1:FLAG (lane 9);
infected with Ad5Enho1 (lane 10); or infected with Ad5GFP (lane
11)]. To visualize Enho1 protein, a fusion protein was created with
a C-terminal FLAG-epitope tag.
[0033] FIG. 6D illustrates the results of a Western blot analysis
for ENHO1 protein in various tissues (liver, muscle, and brain)
from Mc4r-/- mice injected with Ad5-ENHO1:FLAG 4 days prior to the
assay, along with controls, both positive (HEK293 cells infected
with Ad5-ENHO1:FLAG) and negative (Liver from non injected Mc4r-/-
mice).
[0034] FIG. 7A illustrates the results of a Western blot analysis
using lysate from HEK293 cells infected with recombinant Ad5Enho1
(native protein) or Ad5Enho1:FLAG (C-terminal FLAG-tagged fusion
protein) after incubation with a polyclonal antibody (pAB1) against
the N-terminus of Enho1 (as shown in FIG. 5).
[0035] FIG. 7B illustrates the results of a Western blot analysis
using lysate from HEK293 cells infected with recombinant Ad5Enho1
(native protein) or Ad5Enho1:FLAG (C-terminal FLAG-tagged fusion
protein) after incubation with a polyclonal antibody (pAB2) against
the C-terminus of Enho1 (as shown in FIG. 5).
[0036] FIG. 7C illustrates the treatment protocol used to
administer Ad5Enho1 or Ad5-GFP into the tail vein of various
strains of mice to test the effects of Enho1 treatment on mice
metabolism (results presented in Table 1).
[0037] FIG. 8A illustrates the expression level of fatty acid
synthase (Fasn) mRNA in liver from obese leptin-deficient
(Lep.sup.ob/Lep.sup.ob) mice eight days after injection with either
Ad5-ENHO1 or Ad5-GFP. Data expressed in arbitrary units (AU)
(n=6-8/group; "*" p<0.05).
[0038] FIG. 8B illustrates the expression level of stearoyl-CoA
desaturase (Scd1) protein in liver from obese leptin-deficient
(Lep.sup.ob/Lep.sup.ob) mice eight days after injection with either
Ad5-ENHO1 or Ad5-GFP. Data expressed in arbitrary units (AU)
(n=6-8/group; "*" p<0.05).
[0039] FIG. 8C illustrates the expression level of acetyl CoA
carboxylase (Acc) mRNA in liver from obese leptin-deficient
(Lep.sup.ob/Lep.sup.ob) mice eight days after injection with either
Ad5-ENHO1 or Ad5-GFP. Data expressed in arbitrary units (AU)
(n=6-8/group; "*" p<0.05).
[0040] FIG. 8D illustrates the expression level of a gene involved
in insulin resistance (a suppressor of cytokine signaling) in liver
from obese leptin-deficient (Lep.sup.ob/Lep.sup.ob) mice eight days
after injection with either Ad5-ENHO1 or Ad5-GFP. Data expressed in
arbitrary units (AU) (n=6-8/group; "*" p<0.05).
[0041] FIG. 9A illustrates the construction of the transgene
(BAP-Enho1) used to generate transgenic mouse strains that over
express Enho1.
[0042] FIG. 9B illustrates the amount of Enho1 expression in livers
from transgenic mice pups (produced using the transgene of FIG. 9A)
from FVB/NJ founders at 5 weeks.
[0043] FIG. 9C illustrates the level of fasting triglycerides (TG)
from serum of transgenic mice pups (produced using the transgene of
FIG. 9A) from FVB/NJ founders at 9 weeks.
[0044] FIG. 9D illustrates the body composition as measured by
percent body fat (% body fat; left graph) and fat mass (showing
both free fat mass (FFM) and fat mass (FM); right graph) in
transgenic mice pups (produced using the transgene of FIG. 9A) from
FVB/NJ founders at 5 and 9 weeks as compared with control.
[0045] FIG. 9E illustrates change in fat mass (showing both free
fat mass (FFM) and fat mass (FM)) of transgenic mice pups (produced
using the transgene of FIG. 9A) from FVB/NJ founders after 7 days
on a 60% high fat diet.
[0046] FIG. 10 illustrates the results from a PCR screen for
integration of BAP-Enho1 into the genome of C57BL/6J pups (from
injection of BAP-Enho1 into C57BL/6J oocytes) showing six pups out
of 23 with integration of the transgene into the genome.
[0047] FIG. 11A illustrates the increase in Erk phosphorylation in
3T3-L1 adipocytes 15 minutes after the application of the secreted
portion of protein Enho1 (Enho1.sup.34-76; SEQ ID NO:10).
[0048] FIG. 11B illustrates the increase in Erk phosphorylation in
HepG2 hepatocytes 15 minutes after the application of the secreted
protein Enho1 (Enho1.sup.34-76; SEQ ID NO: 10).
[0049] FIG. 12A illustrates the association between hypothalamic
Enho1 mRNA expression and body weight in six-month-old mice from
three strains (C57BL/6J(WT), Mc3rKO (Mc3r), or Mc4rKO (Mc4r) fed
for three months on one of two diets (LF=10% kJ/fat; HF=60%
kJ/fat).
[0050] FIG. 12B illustrates the association between hypothalamic
Enho1 mRNA expression and HOMA-IR [(fasting
insulin.times.glucose)/22.5] in six-month-old mice from three
strains (C57BL/6J(WT), Mc3rKO (Mc3r), or Mc4rKO (Mc4r) fed for
three months on one of two diets (LF=10% kJ/fat; HF=60%
kJ/fat).
[0051] FIG. 12C illustrates the association between HOMA-IR
[(fasting insulin.times.glucose)/22.5] and hypothalamic Socs3
(suppressor of cytokine signaling 3) mRNA expression in
six-month-old mice from three strains (C57BL/6J(WT), Mc3rKO (Mc3r),
or Mc4rKO (Mc4r) fed for three months on one of two diets (LF=10%
kJ/fat; HF=60% kJ/fat).
[0052] FIG. 13A illustrates the physical activity (measured in beam
breaks/10 min) in wild-type (WT) and BAP-Enho1 transgenic mice (Tg)
over 3 days.
[0053] FIG. 13B illustrates the physical activity (measured in
average number beam breaks/10 min for the period) in dark and light
periods in wild-type (WT) and BAP-Enho1 transgenic mice (Tg) over a
24 hr.
[0054] FIG. 13C illustrates whole body fat oxidation (RER) in dark
and light periods in wild-type (WT) and BAP-Enho1 transgenic mice
(Tg) over a 24 hr.
[0055] FIG. 13D illustrates the metabolic rate (measured as VO2
(ml/h.times.10.sup.3)) in dark and light periods in wild-type (WT)
and BAP-Enho1 transgenic mice (Tg) over a 24 hr.
[0056] FIG. 13E illustrates the metabolic rate as a function of
free fat mass (measured as VO2 (ml/h/gFFM.times.10.sup.3)) in dark
and light periods in wild-type (WT) and BAP-Enho1 transgenic mice
(Tg) over a 24 hr.
[0057] FIG. 13F illustrates the metabolic rate as a function of
body weight (measured as VO2 (ml/h/gBW.times.10.sup.3)) in dark and
light periods in wild-type (WT) and BAP-Enho1 transgenic mice (Tg)
over a 24 hr.
MODES FOR CARRYING OUT THE INVENTION
[0058] The present invention discloses a novel secreted protein
(Enho1) and identifies some of its functions. The sequence of this
protein was found to be highly conserved across several mammalian
species, and the sequences are shown in SEQ ID NOS:2 and 12-18. In
addition the nucleic acids that encode this protein was used to
make mice that over expressed the Enho1 protein, either by
infection with a recombinant adenovirus expressing Enho1 or by
making a transgenic strain using Enho1 DNA controlled by an actin
promoter.
[0059] In one embodiment, the Enho1 protein, fragment, derivative
or analogs are used therapeutically to prevent a pathophysiology
associated with increased body mass, e.g., obesity, hyperglycemia,
hyperinsulinemia, insulin resistance, hyperlipidemia, and
non-insulin dependent (type 2) diabetes mellitus.
[0060] In another embodiment, the purified Enho1 protein, fragment,
derivative or analog is isolated from various mammals, or made
synthetically, or made using cell cultures that express the
protein.
[0061] In another embodiment, antibodies are made to the Enho1
protein, its fragments, derivatives or analogs. These antibodies
can be used in a kit to identify the Enho1 protein from various
samples, including body fluids.
[0062] In another embodiment, transgenic animals are made that over
express the Enho1 protein by linking the Enho1 sequence to an
active promoter, e.g., an actin promoter. In another embodiment, a
transformation vector comprising at least the open reading frame of
SEQ ID NO: 1 (the portion underlined in FIG. 4) are made.
Example 1
Discovery of Enho1 Protein and its Function
[0063] Microarrays analyzing hepatic gene expression in lean and
obese Mc3rKO were performed using arrays printed from libraries of
16,463-18,400 70-mer oligonucleotides (Mouse Array-Ready Oligo Set
Version 2.0, Qiagen Operon, Alameda, Calif.) (34-36). The
microarray data indicated increased expression of genes involved in
lipid metabolism (apoliproteins) and oxidative stress secondary to
obesity. Interestingly, the expression of only three genes was
reduced in liver of Mc3rKO irrespective of age, gender, and
adiposity. Two of the genes encoded proteins with known function:
neuraminidase 3 (neu3), encoding an enzyme that cleaves sialic acid
from glycoproteins and glycolipids, and solute carrier family 21
(slc21a1) which encodes an organic anion transporter. The third
gene (AK009710) was novel and had no assigned function in the
databases.
[0064] Quantitative RealTime PCR confirmed the microarray data
showing a tendency for a modest reduction in the expression of
AK009710 in liver of Mc3rKO (FIG. 3A). Intriguingly, a more
dramatic reduction in the expression of AK009710 was observed in
liver of severely insulin resistant Mc4rKO and leptin-deficient
(Lep.sup.ob/Lep.sup.ob) mice (FIG. 3B). In addition, short term
treatment with leptin (4 injections of 0.5 mg/g leptin over 2 days)
significantly increased Enho1 in the liver of Lep.sup.ob/Lep.sup.ob
mice. (FIG. 3C). Expression of AK009710 in 6 wk old lean Mc4rKO is
normal (data not shown), indicating that the decline in liver
expression of Mc4rKO is secondary to the age-related onset of
obesity, insulin resistance and hepatic steatosis (32). Moreover,
AK009710 expression correlated negatively with fasting glucose in
diet-induced obese B6 mice (n=13, R.sup.2=0.67, P<0.001) (data
not shown).
[0065] Overall, these results indicate the identification of a
small secreted protein whose expression in liver declines with
insulin sensitivity and hepatic steatosis. Based on the observation
that the decline in AK009710 expression in liver correlates with
the severity of hepatic steatosis and insulin resistance, and that
this decline is reversed by an insulin sensitizor, the name
"suppressed with insulin resistance 1" (swirl) was chosen, but
later renamed "energy homeostasis associated-1" (Enho1).
[0066] Oligonucleotide primers targeted to AK009710 mRNA were
utilized to measure AK009710 gene expression in liver cDNA from
various mouse models of obesity and insulin resistance. Sequences
of primers were: sense 5-cctgagggtgctgtctgtcatg-3' (SEQ ID NO:3),
antisense 5'-cagtagcagcaagaagcctacg-3' (SEQ ID NO:4), probe
5'-6FAM-ctctcatcgccatcgtctgca-BHQ-3' (SEQ ID NO:5). In agreement
with the initial microarray result, AK009710 mRNA was down
regulated in the liver of Mc3r-/- mice compared to WT mice (by 55%,
p<0.05; FIG. 3A). Next was examined the AK009710 liver mRNA
expression in two other models of obesity: Mc4r-/- mice and
leptin-deficient Lep.sup.ob/Lep.sup.ob mice. AK009710 mRNA was
expressed at approximately 10-fold lower levels in both of these
models compared to wild-type mice (WT) (FIG. 3B). When all animals
were grouped together negative relationships between AK009710 mRNA
expression and glucose and insulin values were observed (Data not
shown). AK009710 gene expression was not altered in the liver of
young and aged WT mice fed ad libitum, fasted for 16 h, or fasted
for 24 h and re-fed for 4 h. (data not shown) AK009710 is not
thought to be altered by nutritional status.
[0067] In order to determine whether AK009710 mRNA might be
regulated secondary to the development of insulin resistance,
AK009710 mRNA was measured in the liver of young, normoinsulinemic
and older hyperinsulinemic Mc4r-/- mice. AK009710 mRNA was observed
to be similar to the wild-type mice in young Mc4r-/- mice (average
age .about.7 weeks), whereas it was significantly reduced in older
(.about.16 weeks) Mc4r-/- mice. (data not shown). Furthermore,
AK009710 mRNA was also measured in a small number (n=4) of
human-derived hepatocytes from diabetic and non-diabetic subjects.
Although the expression tended to be lower in the diabetic samples,
the difference was not statistically significant (data not
shown).
[0068] Thus, while obesity of Mc3r-/- and Mc4r-/- mice is similar,
insulin resistance and elevated serum lipids (triglyceride,
cholesterol) are known to be far more severe for Mc4r-/- mice. The
reduction in AK009710 gene expression in the liver correlated with
the known severity of insulin resistance and hyperlipidemia in
Mc4r-/- mice.
Example 2
Sequence and Bioinformatics Analysis
[0069] AK009710 is a mouse tongue cDNA clone 1247 bp in length and
belongs to the Unigene cluster Mm.34074, 2310040A07Rik: RIKEN cDNA
2310040A07 gene. It hypothetically could encode a 534 amino acid
protein immediately from the 5' end of the sequence. Given that
this putative protein did not start with a methionine residue, it
was listed as a truncated product. BLAST analysis of AK009710 for
homologous EST or cDNA sequences on the NCBI database revealed a
significant match with NM198573, a human transcript discovered by a
large-scale Secreted Protein Discovery Initiative encoding a
hypothetical protein of 87 aa (UNQ470/GAAI470) (37). The match with
human sequence--NM.sub.--198573 was 85% identity across 392
nucleotides, p=5e.sup.-83. The human sequence encoded an 87 amino
acid protein in one exon. Translation of AK009710 in six frames
revealed an open reading frame encoding a 76 amino acid protein
(SEQ ID NO:2). An alignment between this putative mouse protein and
the human protein encoded by NM.sub.--198573 (GAAI470, or UNQ470)
revealed strong homology over the first 37 residues. UNQ470/GAAI470
maps to chromosome 9p13.2. and is adjacent to the ciliary
neurotrophic factor receptor (CNTFR) gene.
[0070] The sequence of AK009710 was verified using cDNA isolated
from mouse liver. Moreover, an 868 bp cDNA cloned from mouse liver
by the National Institutes of Health Mammalian Gene Collection
(MGC) Program, with the accession number BC021944, recently posted
on the NCBI database agrees with our sequencing data. (FIG. 4, SEQ
ID NO: 1) BLAST analysis revealed that the predicted 76 aa sequence
for mouse (SEQ ID NO:2) is highly conserved in several mammalian
species (FIG. 5; SEQ ID NO:12 (rat), SEQ ID NO:13 (chimpanzee); SEQ
ID NO:14 (human); SEQ ID NO:15 (dog); SEQ ID NO:16 (pig); SEQ ID
NO:17 (cow); SEQ ID NO:18 (sheep)). In FIG. 5, pAB1 (SEQ ID NO: 8)
and pAB2 (SEQ ID NO:9) refer to the regions of the putative
secreted polypeptide used to generate polyclonal antibodies. The
predicted signal sequence is underlined. In addition peptides were
synthesized corresponding to amino acids 34 through 76
(Enho1.sup.34-76; SEQ ID NO:10), and to amino acids 39 through 76
(Enho1.sup.39-76; SEQ ID NO:11) of SEQ ID NO:2, the mouse
protein.
[0071] Further analysis of the putative mouse sequence from
AK009710 and the human GAAI470 sequence revealed a single
nucleotide gap in the human sequence on GenBank. Therefore a mouse
AK009710 PCR product was cloned and sequenced in both directions to
confirm which sequence, either the mouse or the human, was correct.
The sequence-verified AK009710 mouse clone revealed a 76 amino acid
translation product (SEQ ID NO:2) (FIG. 4). A publicly available
Origene clone of human GAAI470 was analyzed and shown not to
contain the nucleotide gap, indicating a sequencing error in the
NM.sub.--198573 sequence on GenBank. Alignment of AK009710 sequence
from different species, including human, revealed a 100% homology
between rat, human, mouse and chimp sequences at the protein level
(FIG. 5).
[0072] Bioinformatics analysis revealed that this protein is highly
likely to be a secreted peptide (87% probability, SignalP 3.0) with
the most likely cleavage site between positions 33 and 34. The
human sequence contains 1 possible serine site, and 1 possible
threonine phosphorylation sites, all 3' to the predicted cleavage
point, as well as 6 possible glycosylation sites, also all 3' to
the cleavage site.
Example 3
Tissue Distribution of Enho1
[0073] In order to examine the tissue distribution of AK009710 mRNA
a Northern blot was performed using the 210 nt sequence containing
the 76 amino acid protein ENHO1 and a human Multiple Tissue
Northern blot (BD Biosciences, Palo Alto, Calif.). As can be seen
in FIG. 6A, a single band of .about.1.35 kb was detected in humans
in brain and liver samples only, with highest levels detected in
the liver. However, as seen in FIG. 6B, Enho1 was found in mice in
the liver, brain, and muscle.
Example 4
Confirmation that Enho1 is a Secreted Polypeptide
[0074] Bioinformatics analysis predicted the presence of a putative
signal sequence suggesting that AK009710 is a secreted peptide. To
test this, the coding sequence of the 76 amino acid protein was
amplified from mouse liver cDNA by PCR using primers with NotI
(5'-ggggcggccgcaccatgggggcagccatctcccaa-3' (SEQ ID NO:6)) and Xho1
(5'-gggctcgagggccagagcccttcagggctgcag-3' (SEQ ID NO:7)) restriction
enzyme sites attached. The product was ligated into a pCMV-Tag1
vector with a FLAG epitope at the C-terminal end (pCMV-Enho1:FLAG),
then transiently transfected into HEK human kidney-derived cells.
This product was also used to create two adenoviral constructs--one
with Enho1 attached to a FLAG epitope (Ad-Enho1:FLAG), and another
without the FLAG epitope (Ad-Enho1).
[0075] HEK293 cells were transfected with pCMV-Enho1, or
pCMVEnho1:FLAG. Media was collected after 16 h, immunoprecipitated,
and then run on a 20% polyacrylamide gel to be visualized by an
anti-FLAG antibody. These experiments were repeated using
recombinant adenovirus (Ad5) expressing native or FLAG-tagged
Enho1.
[0076] When HEK293 cells were untransfected (lanes 1, 2), or
transfected with empty vector (lanes 5, 6), or vector containing
GFP (lanes 7, 8) no FLAG-immunoreactive bands were visualized (FIG.
6C). However, when the pCMV-Enho1:FLAG construct was transfected
into HEK293 cells (lanes 3, 4), FLAG-positive immunoreactivity was
detected in both the media and the cell pellet, indicating that at
least some of the transfected Enho1 product was being actively
secreted by the cells into the media. Similar results were observed
in the media of HEK293 cells infected with Ad-Enho1:FLAG (FIG. 8,
lane 9). Lanes 10 and 11 show no FLAG immunoreactivity in media of
cells infected with adenovirus containing Enho1 without the FLAG
epitope, or with GFP, respectively. Thus the presence of FLAG
immunoreactivity in cultured media of HEK-293 cells transfected
with an expression vector expressing an epitope-tagged fusion
protein (pCMV-Enho1FLAG) confirmed that an undefined portion of the
76 aa protein is secreted.
[0077] Most adenovirus injected in the tail vein infects liver
(38). To test whether tail vein injection of adenovirus leads to
increased expression of ENHO1 mRNA in the liver, as well as other
tissues, three Mc4r-/- mice were injected with Ad5-ENHO1:FLAG
adenovirus and the tissues collected after four days. Analysis by
Western blot revealed the presence of FLAG immunoreactivity in the
liver, muscle and brain tissue indicating the presence of ENHO1 in
these tissues. (FIG. 6D) The distribution of Enho1FLAG
immunoreactivity in tissues of mice infected with Ad5-Enho1 FLAG is
consistent with a polypeptide secreted into the circulatory system
from liver. Both of these tests indicated that Enho1 is a secreted
protein.
Example 5
Treatment of Obese Insulin Resistant Mice with Ad5-Enho1:
Mc4rKO
[0078] Recombinant adenoviral vector-mediated expression has been
used to investigate regulation of liver metabolism and insulin
sensitivity (39-41). Three recombinant adenovirus vectors were
constructed expressing the 76 aa protein (Ad5-Enho1), a C-terminal
FLAG-tagged fusion protein (Ad5-Enho1:FLAG), or green fluorescent
protein for the negative control (Ad5-GFP). Expression of protein
following tail vein injection was confirmed using anti-FLAG
antibody (FIG. 6D and data not shown). Synthesis of Enho1 was
confirmed in HEK293 cells transfected with Ad5-Enho1 using
polyclonal antibodies (pAB1 & pAB2 in FIG. 5) against N- and
C-terminal regions of the putative secreted protein (Sigma Genosys,
The Woodlands, Tex.) (FIG. 7A, B).
[0079] To investigate whether ENHO1 is involved in glucose
metabolism, Ad5-ENHO1 or Ad5-GFP (5.times.10.sup.8 pfu) was
injected into the tail vein of 20-week-old male and female Mc4r-/-
(n=3 of each sex per group). Both groups of animals were matched
for body weight, glucose levels and glucose tolerance before
Ad5-ENHO1 or Ad5-GFP injections. An intraperitoneal glucose
tolerance test (IPGTT) was performed one week prior to injection of
Ad5-ENHO1 or Ad5-GFP, and all mice were observed to be glucose
intolerant. IPGTT were performed on mice after an overnight fast,
with a single intraperitoneal injection of 1 g/kg glucose, and
blood glucose measured with a blood glucose meter and test strips
(Glucometer Elite, Bayer Corp., Elkhart, Ind.) from the tail blood
of the animals at several intervals, as described by W. Fan et al.,
"The Central Melanocortin System Can Directly Regulate Serum
Insulin Levels," Endocrinology, vol. 141, pp. 9 3072-3079
(2000).
[0080] Mice were injected with 5.times.10.sup.8 pfu of Ad5-ENHO1 or
Ad5-GFP in 100 .mu.l of diluent (DMEM) into the tail vein. Animals
were observed and weighed daily throughout the 4-day experiment. On
day 4 animals were given another IPGTT (0.4 mg glucose/g body
weight).
[0081] Four days after injection of Ad5-ENHO1, the mice
demonstrated improved glucose tolerance as measured using IPGTT
(data not shown). There was no change in body weight, blood glucose
or cholesterol levels throughout the experiment. There was a trend
for a decrease in insulin and serum triglyceride levels (Table
1).
TABLE-US-00001 TABLE 1 Characteristics of Mc4r-/- mice 4 days post
adenoviral infusion. Body Cho- Tri- Weight Glucose Insulin lesterol
glycerides Group (g) (mg/dL) (ng/mL) (mg/dL) (ng/mL) Ad5-ENHO1 50.4
.+-. 1.8 184 .+-. 10 5.9 .+-. 1.5 91 .+-. 7 26 .+-. 4 Ad5-GFP 49.5
.+-. 2.2 169 .+-. 16 10.4 .+-. 2.0 82 .+-. 6 38 .+-. 6
Example 6
Treatment of Obese Insulin Resistant Mice with Ad5-Enho1: B6
Ay/a
[0082] A second adenoviral experiment was performed whereby
Ad5-ENHO1 or Ad5-GFP was injected into the tail vein of male C57BL6
Ay/a mice (n=9 per group) that had been maintained on a very high
fat diet for .about.3 months. Mice were given 1 week to recover
from the injections, and then an IPGTT was performed. Then the mice
were given another week to recover, and an insulin tolerance test
(ITT) was performed.
[0083] No differences in body weight (40.3.+-.1.3 g for the
Ad5-ENHO1 mice; 41.4.+-.1.2 g for the Ad5-GFP mice), fasting
insulin (0.97.+-.0.2 ng/mL for the Ad5-ENHO1 mice; 1.13.+-.0.2
ng/mL for the Ad5-GFP mice), or fasting glucose levels (126.+-.7
mg/dL for the Ad5-ENHO1 mice; 139.+-.8 mg/dL for the Ad5-GFP mice)
were observed at 20 days after injection. IPGTT 7 days after
injection revealed a very modest improvement in glucose tolerance
in the Ad5-ENHO1 group at the 30-minute (p=0.06) and 45-minute
(p=0.15) time points. Changes in blood glucose levels 14 days after
injection were significantly different between groups, being
significantly reduced in the Ad5-ENHO1 group (data not shown). An
ITT 14 days post-infection revealed no significant difference in
insulin sensitivity at any time point; however Ki (calculated as
glucose at 30 minutes post insulin injection subtracted from
baseline glucose, divided by 30) was significantly different.
[0084] The lower fasting blood glucose levels observed in these
mice 14 days after infection was not apparent at 21 days after
infection. In agreement with the first adenoviral experiment in
Mc4r-/- mice, there was a trend for a decrease in serum
triglycerides in the Ad5-ENHO1 group (Table 2).
TABLE-US-00002 TABLE 2 Infection with Ad5-Enho1 is associated with
evidence of improved metabolic profile in mouse models of obesity
and insulin resistance. Liver Liver wgt lipid Total Serum Serum BW
pre- BW post- Liver wgt as a % content liver lipid TG TC HOMA-
Strain Treatment injection injection (g) BW (mg/g) (mg) (mg/dL)
(mg/dL) IR OBOB GFP 64.0 .+-. 1.9 64.8 .+-. 2.0 4.7 .+-. 0.2 7.4
.+-. 0.3 142 .+-. 8 654 .+-. 25 63 .+-. 6 173 .+-. 6 308 .+-. 114
Enho1 65.0 .+-. 2.2 64.6 .+-. 2.0 4.3 .+-. 0.2 6.7 .+-. 0.3 128
.+-. 7 552 .+-. 50 38 .+-. 4* 146 .+-. 8* 157 .+-. 18 KKAy GFP 48.0
.+-. 1.9 46.7 .+-. 1.7 2.1 .+-. 0.2 4.7 .+-. 0.3 57 .+-. 10 117
.+-. 24 435 .+-. 53 214 .+-. 13 98 .+-. 19 Enho1 46.6 .+-. 1.2 45.3
.+-. 0.8 1.8 .+-. 0.1 4.3 .+-. 0.1 33 .+-. 2* 58 .+-. 5* 315 .+-.
16* 172 .+-. 9 62 .+-. 11 Ay/a GFP 45.2 .+-. 2.5 44.6 .+-. 2.1 2.2
.+-. 0.2 5.1 .+-. 0.2 119 .+-. 11 282 .+-. 39 71 .+-. 18 79 .+-. 3
40 .+-. 6 Enho1 44.8 .+-. 1.4 44.5 .+-. 1.1 1.8 .+-. 0.2 4.2 .+-.
0.3* 81 .+-. 20 145 .+-. 41* 53 .+-. 4 72 .+-. 2 28 .+-. 4 *P <
0.05 compared to Ad5-GFP treated controls (within strain), n =
5-8/group.
Example 7
Treatment of Obese Insulin Resistant Mice with Ad5-Enho1: Agouti
(KK-A.sup.y) Mice (Genetically Obese and Hyperlipidemic Mice)
[0085] To more specifically address the effect of adenoviral
infusion on measures of blood lipids, the adenoviral constructs
were further purified to remove any contaminating viral particles
and cellular debris. Another adenoviral experiment was then
conducted whereby Ad5-ENHO1 or Ad5-GFPAd5-GFP was injected into the
tail vein of genetically obese and hyperlipidemic KK-A.sup.y mice
(n=6 female per group). Mice were given an IPGTT 5 days post virus
injection, and then sacrificed 2 days later after an overnight
fast.
[0086] IPGTT revealed that glucose tolerance was not significantly
improved by Ad5-ENHO1 treatment compared to Ad5-GFPAd5-GFP
treatment. Statistically significant reductions in circulating
triglycerides (by 28%, p=0.04) and cholesterol (by 20%, p=0.02)
were observed in the Ad5-ENHO1 group compared to Ad5-GFP controls
(Table 1). Liver weight of Ad5-ENHO1 mice tended to be lower than
liver weight of Ad5-GFP controls (Table 2). Body weight, and serum
glucose and insulin levels were not significantly different between
Ad5-ENHO1 and Ad5-GFP controls (Table 2).
TABLE-US-00003 TABLE 3 Characteristics of KK-A.sup.y mice treated
with Ad5-ENHO1 or Ad5-GFP for 8 days. Liver Liver as % Body weight
of body Glucose Insulin Treatment Weight (g) (g) weight (mg/dL)
(ng/mL) Ad5-ENHO1 41.9 .+-. 0.9 1.8 .+-. 0.1 4.3 .+-. 0.1 239 .+-.
19 4.3 .+-. 0.7 Ad5-GFP 44.1 .+-. 1.5 2.1 .+-. 0.2 4.6 .+-. 0.2 246
.+-. 41 5.1 .+-. 0.9
[0087] ENHO1 mRNA was elevated approximately 4-fold in the liver of
KK-A.sup.y Ad5-ENHO1-treated mice compared to Ad5-GFP-treated mice
(data not shown).
Example 8
Treatment of Obese Insulin Resistant Mice with Ad5-Enho1:
Lep.sup.ob/Lep.sup.ob Mice
[0088] To confirm the lipid-lowering effect of adenoviral-mediated
ENHO1 overexpression, another experiment was performed in which
Ad5-ENHO1 or Ad5-GFP was injected into the tail vein of
Lep.sup.ob/Lep.sup.ob (OBOB) mice (n=7-8 male per group), another
mouse model of hyperlipidemia, steatosis and insulin resistance.
The injected mice were not given an IPGTT, but were monitored for
body weight changes, and then sacrificed 7 days post injection
after an overnight fast.
[0089] Ad5-GFP-treated mice gained approximately 1 g of body weight
over the 7-day period. However, Ad5-ENHO1 treatment blocked weight
gain in these obese Lep.sup.ob/Lep.sup.ob mice (data not shown).
Mean body weight was not statistically different between groups,
and food intake was not measured. Similar phenotypic changes to
that observed in KK-A.sup.y mice (See Example 7 above) were also
observed. Serum triglycerides were reduced by 40% in the Ad5-ENHO1
group (Ad5-GFP 63.+-.6 mg/dL (Ad5-GFP); 38.+-.4 mg/dL (Ad5-ENHO1),
p=0.006; Table 2). A 15% reduction in serum cholesterol levels was
also observed (173.+-.6 mg/dL (Ad5-GFP); 146.+-.8 mg/dL
(Ad5-ENHO1), p=0.02; Table 2). A trend for a reduction in liver
weight was observed that was not significant when expressed as a
percentage of body weight (p=0.12). Trends for reduced fasting
blood glucose and insulin levels in the Ad5-ENHO1 group did not
reach statistical significance.
[0090] Purification of the adenoviral constructs and use of larger
sample populations in the experiments using KK-A.sup.y mice and
Lep.sup.ob/Lep.sup.ob mice demonstrated that overexpression of
ENHO1 for 7-8 days lead to reduced circulating triglyceride and
cholesterol levels compared to control mice. (Table 2) Trends for
these effects were observed in previous experiments using
unpurified adenovirus with observations at later time points. ENHO1
gene expression in the liver was elevated in Ad5-ENHO1-treated
group in these experiments, whereas no increase was detectable in
previous experiments at later time points. Without wishing to be
bound by this theory, it is believed that increased gene expression
of ENHO1 leads to increased circulating levels of the ENHO1
protein.
Example 9
Summary of Results of Treatment of Obese Insulin Resistant Mice
with Ad5-Enho1
[0091] In summary, 5.times.10.sup.9 pfu of Ad5-Enho1 or Ad5-GFP was
administered into the tail vein of KKAy, B6 Ay/a, or OBOB mice
purchased from the Jackson Laboratory (Bar Harbor, Me.). The
treatment protocol, shown in FIG. 7C, was based on the pilot
experiments demonstrating peak expression of Ad5-Enho1:FLAG during
this period (data not shown). Animal and food weight were recorded
daily. Ad5-Enho1 infection was well tolerated in mouse strains used
for these experiments. There were no marked differences in the body
weight (Table 2) of mice infected with Ad5-Enho1 compared to
controls infected with Ad5-GFP over the treatment period. A 4-5
fold increase in Enho1 mRNA was observed in mice infected with
Ad5-Enho1, compared to Ad5-GFP treated controls (data not
shown).
[0092] Liver weight and lipid content were consistently reduced in
mice infected with Ad5-Enho1. In KKAy and OBOB mice, significant
reductions (.about.40%) in fasting triglyceride and total
cholesterol were observed. A smaller decline was observed in Ay/a
mice. Meta-analysis of data from several experiments using obese
OBOB, KKAy and Ay/a mice indicated a 40% reduction of HOMA-IR
[(fasting insulin.times.glucose)/22.5] in OBOB, KKAy and Ay/a mice
(Table 4). In Ay/a mice, fasting insulin levels were significantly
reduced with Ad5-Enho1 (2.6.+-.0.4 vs. 3.9.+-.0.3 ng/ml,
P<0.05), with no difference in blood glucose (175.+-.12 vs.
162.+-.11 mg/dL).
TABLE-US-00004 TABLE 4 Meta-analysis of HOMA-IR, calculated by
mutiplying fasting insulin and glucose, from OBOB, KKAy and Ay/a
mice infected with Ad5-GFP or Ad5-Enho1. Ad5-GFP Ad5-Enho1
Student's t-test 100 .+-. 12% 62 .+-. 4% P < 0.005 Data are
expressed as % .+-. SEM of control group.
Example 10
Overexpression of ENHO1 Effects on Genes Involved in Lipid
Biosynthesis
[0093] Reversal of hepatic steatosis by adipocytokines is at least
partially attributable to the suppression of hepatic lipogenesis
and stimulation of fatty acid oxidation (42,43). To investigate the
mechanism by which Enho1 reduced hepatic lipid content, the
expression of genes involved in lipogenesis was measured by
quantitative RT-PCR (FIGS. 8A-8D). There was a coordinate 40-50%
reduction in the expression of several genes involved in
lipogenesis in the liver of OBOB and KKAy mice infected with
Ad5-Enho1. Enho1 may therefore reduce hepatic lipid content, at
least in part, by inhibiting hepatic lipogenesis.
[0094] A significant decrease in fatty acid synthase (Fasn) mRNA in
the Ad5-ENHO1-treated group was observed compared to the Ad5-GFP
controls (FIG. 8A, p=0.02), as well as a decrease in protein levels
(data not shown). Fasn mRNA and protein levels were measured using
quantitative RealTime PCR and western blot, as described in D. C.
Albarado et al., "Impaired Coordination of Nutrient Intake and
Substrate Oxidation in Melanocortin-4 Receptor Knockout Mice,"
Endocrinology, vol. 145, pp. 243-252 (2004). Gene expression of the
fatty acid translocase CD36 was also significantly elevated in the
Ad5-ENHO1 group (p=0.02, not shown). FIG. 8A illustrates the
expression level of fatty acid synthase (Fasn) mRNA in liver from
obese leptin-deficient (Lep.sup.ob/Lep.sup.ob) mice eight days
after injection with either Ad5-ENHO1 or Ad5-GFP. Data expressed in
arbitrary units (AU) (n=6-8/group; "*" p<0.05). Enho1
overexpression caused a decrease in Fasn. FIG. 8B illustrates the
expression level of stearoyl-CoA desaturase (Scd1) protein in liver
from obese leptin-deficient (Lep.sup.ob/Lep.sup.ob) mice eight days
after injection with either Ad5-ENHO1 or Ad5-GFP. Data expressed in
arbitrary units (AU) (n=6-8/group; "*", p<0.05). Again, Enho1
overexpression caused a decrease in Scd1. FIG. 8C illustrates the
expression level of acetyl CoA carboxylase (Acc) mRNA in liver from
obese leptin-deficient (Lep.sup.ob/Lep.sup.ob) mice eight days
after injection with either Ad5-ENHO1 or Ad5-GFP. Data expressed in
arbitrary units (AU) (n=6-8/group; "*" p<0.05). Again, the mice
with Enho1 showed lower levels of liver Acc. FIG. 8D illustrates
the expression level of a gene involved in insulin resistance
(suppressor of cytokine signaling 3 or Socs3) in liver from obese
leptin-deficient (Lep.sup.ob/Lep.sup.ob) mice eight days after
injection with either Ad5-ENHO1 or Ad5-GFP. Data expressed in
arbitrary units (AU) (n=6-8/group; "*" p<0.05). The presence of
Enho1 again decreased the gene express of Socs3.
Example 11
Transgenic Over Expression of Enho1 (BAP-Enho1)
[0095] Transgenic strains over expressing Enho1 were generated
using a construct (BAP-Enho1) containing the human .beta.-actin
promoter, a synthetic exon 1 and intron, and an open reading frame
encoding the 76 aa Enho1 protein (FIG. 9A; see FIG. 4, the open
reading frame is underlined). Eight founders were obtained (2
FVB/NJ, 6 C57BL/6J), with one of the FVB strains
[FVB/NJ.Tg-(BAP-Enho1)AAB20], hereafter referred to as FVB.Tg,
exhibiting an increase in hepatic Enho1 expression at 5-6 wk of age
(FIG. 9B). FIG. 10 illustrates the results of PCR screening the
pups in the first round of injection of BAP-Enho1 into C57BL/6J
oocytes, showing six pups (6, 8, 14, 19, 21, and 22) with
integration of the transgene into the genome.
[0096] At 5-6 wk of age, reductions in serum TG and TC are already
evident in FVB.Tg (Table 5, FIG. 9C). Body weight (Table 5) and FM
(FIG. 9D) of FVB.Tg transgenics was reduced relative to WT
littermate. Weight gain of FVB.Tg mice was also reduced on HFD (60%
kJ/fat), indicating protection from diet-induced obesity (FIG. 9E).
Reduced body weight and fat content was still observed after 1
month on HFD, associated with a tendency for reduced fasting
insulin levels of BAP-Enho1 transgenics compared to WT controls
(180.+-.60 vs. 310.+-.40 pg/ml, 2-tailed Student's t-test
P=0.085).
TABLE-US-00005 TABLE 5 Data from the first 3 litters of FVB.Tg
mice. Body weight Liver weight Liver as % of Glucose Triglyceride
Cholesterol (g) (g) body weight (mg/dL) (mg/dL) (mg/dL) FVB WT 20.5
.+-. 1.1 0.88 .+-. 0.01 4.3 .+-. 0.4 151 .+-. 14 105 .+-. 3 219
.+-. 7 FVB.Tg 17.8 .+-. 0.1* 0.69 .+-. 0.01* 3.9 .+-. 0.2 105 .+-.
6* 82 .+-. 6* 198 .+-. 4* All mice are female aged approximately
4.5 weeks, n = 3-5 per group. *P < 0.05 compared to control
group.
[0097] As shown above, it was observed that over expression of
Enho1 impairs metabolic adaptation to fasting, perhaps indicating
increased energy expenditure. To determine whether Enho1 increases
energy expenditure, VO2 and RER was measured using indirect
calorimetry (15,46,50). The Pennington Biomedical Research Center
has a 16 chamber comprehensive laboratory animal monitoring system
(CLAMS) housed in a temperature controlled incubator. The CLAMS
simultaneously measured oxygen consumption (VO2), respiratory
exchange ratio (RER, an indicator of whole animal substrate
oxidation), physical activity in the X and Z axis, and food intake.
Mice were placed in the CLAMS system, and the parameters indicated
recorded for 72 h. Mice were fed ad libitum for 48 h, with a fast
for final 24 h. The results for FVB.Tg are shown in FIGS. 13A-13F.
Increased weight loss was observed after an overnight fast in obese
KKAy, in obese B6 Ay/a mice expressing Ad5Enho1 (% weight loss
after overnight fast for Ad5-Enho1 vs Ad5-GFP: 5.5.+-.0.4% vs.
3.5.+-.0.4%, P<0.01), and in 9 wk old lean FVB.Tg (13.6.+-.1.1%
vs. 10.0.+-.0.7%, P<0.05). After 1 month of high fat feeding,
measurement of energy metabolism by indirect calorimetry indicated
significantly increased oxygen consumption (VO2 in ml/h: BAP-Enho1
Tg 4551.+-.240, WT FVB 3807.+-.145, P<0.05) and physical
activity during lights off (X beam breaks per hour: BAP-Enho1 Tg
1431.+-.181; WT FVB 2678.+-.327, P<0.01). Increased energy
expenditure may thus be a factor in the amelioration of
diet-induced obesity and insulin resistance by Enho1.
Example 12
Enho1 Effects Adipocytes
[0098] An experiment was conducted to test the use of a recombinant
or synthetic forms of the short secreted polypeptide
Enho1.sup.34-76 (SEQ ID NO:10). A study was conducted where the
response of adipocytes and hepatocytes, two potential sites of
Enho1 action, to synthetic Enho1.sup.34-76 was analyzed with
changes in extracellular regulated kinase (ERK) as the measured
response. ERK1/2 and p38.alpha. are important in the regulation of
lipolysis and thermogenesis in adipocytes.
[0099] Application of 1 .mu.g/ml Enho1.sup.34-76 was associated
with a robust increase in the phosphorylation of Erk1 in fully
differentiated 3T3-L1 adipocytes (FIG. 11A) and in HepG2 cells
(FIG. 11B). These results indicate that functional receptors for
Enho1.sup.34-76 are active in adipocytes and hepatocytes,
indicating that the synthetic peptide is biologically active. In
addition, a shorter, second peptide was synthesized using amino
acids 39 through 76 of SEQ ID NO:2, and called "Enho1.sup.39-76"
(SEQ ID NO:11). Similar results using adipocytes and hepatocytes
were observed with this peptide. The loss of four amino acids did
not appear to affect Enho1 function.
Example 13
Enho1 Function in Hypothalamus
[0100] Hypothalamic Enho1 may be involved in the regulation of
energy homeostasis. Preliminary analysis using pAB1 demonstrated
the presence of Enho1-immunoreactivity in neurons located in the
arcuate nucleus of the hypothalamus (data not shown). It was
predicted that a negative correlation exists between hypothalamic
Enho1 expression and obesity and insulin resistance. In other
words, reduced synthesis of Enho1 in liver and hypothalamus in
situations of obesity may be a factor contributing to obesity and
insulin resistance.
[0101] Enho1 mRNA expression was measured by quantitative RT-PCR in
mediobasal hypothalamic blocks from control (low fat diet) and
diet-induced obese C57BL/6J, Mc3rKO and Mc4rKO mice (FIGS.
12A-12B). As predicted, Enho1 mRNA abundance in the hypothalamus
was reduced in the obese state (FIG. 12A). Enho1 expression was
also low in mice with elevated HOMA-IR values, an indicator of
insulin resistance (FIG. 12B).
[0102] In contrast, Socs3 mRNA expression was elevated in
situations of obesity and insulin resistance (FIG. 11C). This data
indicates that reduced synthesis of Enho1 in situations of obesity
is not be limited to the liver. Reduced Enho1 activity in the
hypothalamus would also contribute to the development of obesity
and insulin resistance.
[0103] In summary, an expression vector was constructed using a
partial cDNA sequence encoding the predicted 76 residues of ENHO1
(between nucleotides 207 and 437 of BC021944), with an epitope-tag
inserted onto the carboxyterminal end to allow visualization of the
protein on western blot using a commercially available antibody.
Using this construct, it was verified that the reported sequences
encoded a secreted protein. This expression vector and an
expression vector encoding the native protein without an epitope
label were then used to construct a recombinant adenovirus
(Ad5-ENHO1) for use in mouse studies. Injections of
5.times.10.sup.8 pfu of the adenovirus into the tail vein resulted
primarily in infection of the liver, and to a lesser extent, the
spleen. Using the adenovirus expressing the epitope-tagged ENHO1,
it was demonstrated that 5 days after injection of the virus, there
was wide spread distribution of ENHO1 protein in liver, brain, and
skeletal muscle. Using this adenovirus expressing the native form
of ENHO1, a new function (reduction of fasting serum triglyceride
and cholesterol) was shown for the secreted protein. A reduction in
liver ENHO1 mRNA expression was observed in obese mice with
hyperlipidemia, with the magnitude of the reduction correlating
with the increase of total cholesterol and triglyceride. Using the
adenovirus expressing the native form of ENHO1, it was shown that
increasing the expression of the mRNA encoding the ENHO1 protein in
mouse models of obesity with high cholesterol and triglycerides was
effective at reducing both cholesterol and triglycerides toward
normal levels. The effects of Ad5-ENHO1 infection to reduce
triglyceride and total cholesterol were reproducible, being
observed in three different mouse strains (Lep.sup.ob/Lep.sup.ob,
KKA.sup.y, and C57BL/6J). In some mice, an improvement in insulin
sensitivity was observed in a trend of lower fasting insulin and
glucose and an improvement in glucose tolerance test results. The
latter observations suggested that ENHO1 may also be effective at
improving insulin sensitivity in an obese, insulin-resistant
patient.
[0104] The data strongly suggest that full-length ENHO1 peptide
(SEQ.ID.NO. 2), or peptide derivatives, homologues, analogues, or
mimetics thereof, delivered by oral intake, injection, subcutaneous
patch, or intranasal routes, could be used as therapeutic or
diagnostic agents for hypercholesterolemia, hypertriglyceridemia,
insulin resistance, obesity, diabetes, and/or energy imbalance. By
methods known in the art, substitutions within the native coding
sequence can be made to make derivatives of ENHO1 with increased
stability and/or biological potency. Moreover, the ENHO1 peptide
can be used to identify its cell receptor which can then be used as
as-yet-unidentified receptor(s) for ENHO1 is (are) a potential drug
target(s) for the development of therapies aimed at reducing total
cholesterol, triglycerides, insulin resistance, obesity, diabetes
and/or energy imbalance.
[0105] A novel secreted protein, Enho1, that is an important factor
in the etiology of insulin resistance and hepatic steatosis in the
obese state has been identified by Microarray analysis of gene
expression in mouse models of moderate- to severe-diabesity. Enho1
significantly reduces HOMA-IR, an index of fasting insulin and
glucose, and serum lipids in mouse models of type 2 diabetes, and
significantly reduces hepatic lipids indicating a reversal of
hepatic steatosis. Transgenic over expression of Enho1 is
associated with a lean phenotype. Enho1 may act in a manner similar
to leptin and adiponectin, improving metabolic profile in the obese
insulin state by stimulating energy expenditure and increasing
oxidative metabolism.
Example 14
Enho1 Treatment Will Reverse Hepatic Insulin Resistance
[0106] Preliminary data from Ad5-Enho1 and BAP-Enho1 transgenics
(shown above) indicate improved insulin action and lipid
metabolism. In FVB.Tg mice, increased oxidative metabolism is a
likely factor explaining these effects. It may not be possible to
dissect the anti-diabetic actions of Enho1 from those secondary to
reductions of FM. Preliminary data using recombinant adenovirus
indicate that Enho1 reduces hyperinsulinemia and hyperlipidemia
independently of effects on obesity. Further experiments using
recombinant adenovirus and synthetic peptide may therefore provide
important information regarding `direct` effects of Enho1 on liver
metabolism and insulin sensitivity.
[0107] Experiments will be conducted to determine whether the
reversal of hepatic steatosis with Ad-Enho1 treatment is associated
with improved insulin sensitivity in liver and skeletal muscle by
measuring insulin receptor signaling. These will include analysis
of insulin receptor substrates 1 and 2 phosphorylation, which are
distal to the insulin receptor tyrosine kinase. Activity of protein
kinase B (PKB)/Akt, a serine/threonine kinase involved in
regulating glucose transport that is downstream of phosphatidyl-3'
kinase (44,45), will also be measured as an indicator of insulin
receptor activation. Pilot data showing significantly greater
weight loss of mice infected with Ad5-Enho1 suggests increased
basal metabolic rate. Whether Ad5-Enho1 increases whole body
metabolic rate during postprandial and fasting states will be
determined using indirect calorimetry, and oxidative metabolism in
tissue lysates from liver, skeletal muscle and brown adipose tissue
shall be determined.
[0108] The basic protocol for adenovirus treatment is shown in FIG.
7C. Briefly, all mice will have 5.times.10.sup.9 pfu of Ad5-ENHO1
or Ad5-GFP injected into the tail vein (n=12/group, 24 total). Mice
shall be allowed 4 d to recover before use in the following
experiments. A liver sample taken at termination will be used to
estimate infection by measuring Enho1 mRNA by RealTime PCR and
Northern blot analysis. In preliminary experiments, a 4-fold
increase in Enho1 mRNA was observed 4-7 d post infection. Enho1
protein shall also be measured either by Western blot, or through
the use of assays (RIA/ELISA) currently under development. Mice
shall be weighed on the day of adenovirus injection, and pre- and
post-fasting. If possible, body composition shall be determined
using nuclear magnetic resonance (NMR) (15,32,46). Mice shall be
acclimated to housing in wire-mesh caging that allows for
measurement of food intake and spillage, as previously described
(15).
[0109] If the sexual dimorphic phenotype of the FVB.Tg is
reproducible and observed in BAP-Enho1 transgenics on the C57BL/6J
background, the Ad5 experiments will be modified to investigate the
response of males and females. Most of the experiments
investigating the response of obese insulin resistant mice to
Ad5-Enho1 treatment used males; it may be that females will exhibit
a different response, perhaps exhibiting weight loss in addition to
improved insulin sensitivity. This would not be unprecedented, for
example sexual dimorphism has been observed in the response of male
and female rats to the anorectic actions of insulin and leptin
(47,48).
[0110] Determine Whether Reversal of Hepatic Steatosis Is
Associated With Increased Insulin Sensitivity. This experiment will
involve KKAy and Ay/a mice, with two groups of twelve within
genotype (Ad5-Enho1, Ad5-GFP controls) (24 KKAy, 24 Ay/a). On day 5
after an overnight fast, six of the Ad5-ENHO1 and Ad5-GFP groups
shall be administered a single intraperitoneal of insulin (1 U/kg),
with the remaining six receiving saline. Mice shall be euthanized
either 10 or 20 minutes (n=3/group) post injection, and tissue
samples collected (liver, quadriceps muscle) and snap frozen on
liquid nitrogen. IRS phosphorylation, PKB activity, and FoxO1
phosphorylation shall be measured as previously described (15,49).
This experiment shall be repeated two more times with only 8 mice
per group to do insulin and glucose tolerance tests.
[0111] It is predicted that the anti-steatotic effect of Ad5-ENHO1
will increase insulin-stimulated activity of the insulin receptor
tyrosine kinase cascade in liver. Ad5-ENHO1 may also improve
insulin signaling in muscle and/or adipose tissue. The initial
studies investigating glucose clearance resulted in mixed results
(data not shown), perhaps due to sub-optimal experimental design
[i.e., small numbers of mice (n=4-5); performed at variable times
(up two two weeks) after adenovirus injection]. It is predicted
that Ad5-Enho1 will improve glucose clearance in response to
glucose/insulin injections.
[0112] Determine Whether Enho1 Increases Whole Body Energy
Expenditure and Oxidative Metabolism. To determine whether hepatic
expression of Enho1 increases energy expenditure, VO2 and RER of
obese Ay/a and lean and diet-induced obese C57BL/6J mice infected
with Ad5-Enho1 or Ad5-GFP (n=8/group) shall be measured using
indirect calorimetry (15,46,50). The Pennington Biomedical Research
Center has a 16 chamber comprehensive laboratory animal monitoring
system (CLAMS) housed in a temperature controlled incubator. The
CLAMS simultaneously measures oxygen consumption (VO2), respiratory
exchange ratio (RER, an indicator of whole animal substrate
oxidation), physical activity in the X and Z axis, and food intake.
Mice shall be placed in the CLAMS system 96 h after adenovirus
injection, and the parameters indicated recorded for 72 h. Mice
shall be allowed to feed ad libitum for 48 h, with a fast for final
24 h. In a separate experiments, fatty acid oxidation
(C.sup.14-palmitate) and mitochondrial enzyme function (citrate
synthase activity, cytochrome c oxidase) will be measured in liver,
gastrocnemius, and brown adipose tissue collected from Ay/a and
C57BL/6J mice infected with Ad5-Enho1 or Ad5-GFP (n=8/group). A
portion of liver shall be collected and snap frozen for measurement
of mRNA and protein expression of transcription factors (i.e.,
SREBP1c, PPAR.gamma.) and enzyme involved in lipogenesis (32).
[0113] The increased weight loss of mice infected with Ad5-Enho1
indicates increased basal metabolic rate, a finding corroborated by
fasting weight loss and indirect calorimetry data from BAP-Enho1
transgenics. (See FIGS. 13A-F) It is predicted that infection with
Ad5-Enho1 will increase VO2, although this may only be evident
during the fasting phase. An increase in mitochondrial oxidative
enzyme activity in liver only would be consistent with Enho1 acting
as an autocrine/paracrine factor. Increased mitochondrial oxidative
enzyme activity in skeletal muscle and brown adipose tissue would
suggest an endocrine function, either acting through the autonomic
nervous system or through receptors expressed in muscle and/or
brown adipose tissue. If Ad5-Enho1 is markedly increasing energy
expenditure (as observed in FVB.Tg) but is not affecting body
weight, then a compensatory increase in food intake would be
predicted. A reduction in the expression of genes involved in
lipogenesis, as observed in OBOB mice treated with Ad5-Enho1, is
also predicted. (FIG. 8A-8D).
Example 15
Transgenic Expression of Enho1 Prevents Obesity and Insulin
Resistance
[0114] Transgenic mice over expressing leptin (51,52) and
adiponectin (53,54) have demonstrated the anti-diabetic action of
over expression of either protein. It is expected that over
expression of Enho1 will have outcomes comparable to that observed
with over expression of adiponectin and leptin; i.e. improved
insulin sensitivity and glucose tolerance, and lower fasting lipids
in situations of diet- and genetically induced obesity. It is also
predicted that Enho1 will increases energy expenditure by
increasing oxidative metabolism in liver, skeletal muscle, and/or
brown adipose tissue. A comprehensive analysis of the physiology of
Enho1 action is important for future experiments that focus on the
mechanism(s) by which this polypeptide regulates energy metabolism
and insulin signaling.
[0115] Transgenics: A sequence encoding the 76 aa protein has been
ligated into a synthetic transgene controlled by the human
.beta.-actin promoter (BAP) (FIG. 9A). Enho1 is a secreted
polypeptide (FIG. 4), and thus tissue-selectivity is not important
for these transgenic studies. Promoters specific for tissues have
not been used where the endogenous gene is abundantly expressed,
because suppression of the endogenous gene may limit efficacy of
over expression (53,54). A comprehensive analysis of mRNA
expression shall be completed using quantitative RT-PCR (qRT-PCR)
as previously described (31,32,46) and Northern blot analysis.
Protein levels shall be measured by Western blot using the two
polyclonal antibodies against the N- and C-terminus of
Enho.sup.34-76 (pAB1, pAB2) (FIG. 5). This may require using
immunoprecitipitation to detect protein. Alternatively, if
antibodies in hand or in development are useful for developing
sensitive and quantitative assays, then these shall be used.
Transgene copy number shall be determined by Southern blot
analysis. A sub-aim of this experiment is therefore a more
comprehensive analysis of Enho1 mRNA expression in mouse tissues
(liver, hypothalamus, forebrain, hindbrain, skeletal and cardiac
muscle, retroperitoneal and inguinal adipose depots, stomach,
intestine, pancreas, kidney). Major organs (heart, kidney, gut,
liver) shall be weighed and inspected histologically for major
morphological changes.
[0116] We have shown that Enho1 is one of a small group of secreted
polypeptides (leptin, adiponectin) that, when over expressed,
improves metabolic profile (i.e. increased insulin sensitivity,
reduced hepatic lipogenesis) in mouse models of obesity and insulin
resistance. The over expression of Enho1 has leptin-like effects on
energy metabolism, protecting against diet-induced obesity and
insulin resistance. Administering Enho1 can reverse insulin
resistance and dyslipidemia associated with diet- and
genetically-induced obesity, and can prevent or delay onset of
diabesity.
[0117] Examples 16 to 25 were carried out using human Enho1, a 76
amino acid peptide having the sequence:
TABLE-US-00006 CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
[0118] Statistical analysis of the results was carried out using
ANOVA analysis tools with post hoc tests. Data are reported as the
mean.+-.standard error (SE).
[0119] Of course, the skilled artisan would know and realize that
experiments similar to those described herein may be carried out to
determine the effect of Enho-1 upon various parameters of
metabolism such as weight loss, hepatic steatosis, lipids and
triglycerides, glucose, insulin levels and the like. For example,
the length of treatment time may be varied, the genetic make up of
the mice or rat strains may be different, different diet regimes
may be applied, etc. These experiments are in no way intended to be
binding and are representative of those which are useful to study
the effects of peptides such as Enho-1 in mammals.
Example 16
Effect of Enho1 on Weight Loss (Short-Term Treatment)
[0120] The effect of Enho-1 upon weight loss was tested over the
course of 3 days using KKAy mice. The mice were fed Breeder Chow
(Purina 5015) and were approximately 12-14 weeks of age at the
start of the experiment. Six control mice received vehicle only
while six test mice each received doses of either 900 nmol/kg/d or
9000 nmol/kg/d. The injections were given as 3 intraperitoneal (ip)
injections at 0600, 1400 and 2000 h on days 1 and 2; over the 3 day
period, the mice received a total of 7 injections. All animals were
euthanized 5 hours after the last injection given the morning of
the third day. Food was removed after the final injection.
[0121] The six control mice had a mean pre-treatment weight of 35.3
g (SE.+-.1.2 g) and a mean post-treatment weight of 33.6 g
(SE.+-.1.0). The difference of -1.7 g (SE.+-.0.3) represents a
-4.8% (SE.+-.0.6) reduction in weight.
[0122] The six test mice which received 900 nmol/kg/d of Enho 1 had
a pre-treatment weight of 35.3 g (SE.+-.1.1) and post-treatment
weight of 33.0 g (SE.+-.1.0). The difference of -2.3 g (SE.+-.0.2)
represents a -6.5% (SE.+-.0.6) reduction in weight.
[0123] The six test mice which received 9000 nmol/kg/d of Enho 1
had a pre-treatment weight of 35.6 g (SE.+-.0.6) and post-treatment
weight of 33.1 g (SE.+-.0.4). The difference of -2.6 g (SE.+-.0.3)
represents a -7.1% (SE.+-.0.8) reduction in weight.
[0124] These results are reported in Table 6.
TABLE-US-00007 TABLE 6 the effect of Enho-1 upon weight loss
Control 900 nmol/kg/d 9000 nmol/kg/d Weight 35.3 .+-. 1.2 g 35.3
.+-. 1.1 35.6 .+-. 0.6 (pre-treatment) Weight 33.6 .+-. 1.0 33.0
.+-. 1.0 33.1 .+-. 0.4 (termination) Delta body weight Grams -1.7
.+-. 0.3 -2.3 .+-. 0.2 -2.6 .+-. 0.3 % -4.8 .+-. 0.6 -6.5 .+-. 0.6
-7.1 .+-. 0.8 P = 0.073 ANOVA
Example 17
Effect of Enho1 on Insulin and Glucose Levels
[0125] The effect of Enho-1 upon insulin and glucose was tested
over the course of 3 days using KKAy mice. The mice were fed
Breeder Chow (Purina 5015) and were approximately 12-14 weeks of
age at the start of the experiment. Six control mice received
vehicle only while five or six test mice each received doses of
either 900 nmol/kg/d or 9000 nmol/kg/d, respectively. The
injections were given as 3 ip injections at 0600, 1400 and 2000 h
on days 1 and 2; over the 3 day period, the mice received a total
of 7 injections. All animals were euthanized 5 hours after the last
injection given the morning of the third day. Food was removed
after the final injection. The HOMA-IR for each treatment was
calculated using the following formula: ((glucose
mg/dL/18).times.(insulin ng/ml.times.25.05))/22.5
[0126] The six control mice demonstrated a post-test mean blood
glucose level of 524 mg/dL (SE.+-.48) and an insulin level of 7.4
ng/ml (SE.+-.0.6); the HOMA-IR value for the control group was
determined to be 234 (SE.+-.16).
[0127] The five test mice which received 900 nmol/kg/d of Enho 1
demonstrated a posttest mean blood glucose level of 474 mg/dL
(SE.+-.29) and an insulin level of 5.7 ng/ml (SE.+-.0.5); the
HOMA-IR value for this group was determined to be 167 (SE.+-.18),
representing a decrease of 29% as compared to the control group.
The blood glucose levels decrease by approximately 10% while the
insulin levels were reduced by about 22%.
[0128] The six test mice which received 9000 nmol/kg/d of Enho 1
demonstrated a posttest mean blood glucose level of 480 mg/dL
(SE.+-.38) and an insulin level of 7.0 ng/ml (SE.+-.0.8); the
HOMA-IR value for this group was determined to be 213 (SE.+-.37),
representing a decrease of 9% as compared to the control group.
[0129] These results are reported in Table 7.
TABLE-US-00008 TABLE 7 the effect of Enho-1 upon insulin and
glucose Control 900 nmol/kg/d 9000 nmol/kg/d Blood glucose 524 .+-.
48 474 .+-. 29 480 .+-. 38 (mg/dL) Insulin 7.4 .+-. 0.6 5.7 .+-.
0.5 7.0 .+-. 0.8 (ng/ml) HOMA-IR 234 .+-. 16 167 .+-. 18 213 .+-.
37 (? 29%) (? 9%)
Example 18
Effect of Enho1 on Hepatic Steatosis
[0130] The effect of Enho-1 upon liver weight, liver lipid content
and liver TG was tested over the course of 3 days using KKAy mice.
The mice were fed Breeder Chow (Purina 5015) and were approximately
12-14 weeks of age at the start of the experiment. Six control mice
received vehicle only while five or six test mice each received
doses of either 900 nmol/kg/d or 9000 nmol/kg/d, respectively. The
injections were given as 3 ip injections at 0600, 1400 and 2000 h
on days 1 and 2; over the 3 day period, the mice received a total
of 7 injections. All animals were euthanized 5 hours after the last
injection given the morning of the third day. Food was removed
after the final injection.
[0131] The six control mice exhibited a mean liver weight of 1.6 g
(SE.+-.0.1), representing 4.6% (SE.+-.0.2) of total body weight.
The mean liver lipid level for the control group was 94 mg/g
(SE.+-.6), with total lipids measuring 147 mg/g (SE.+-.14). Liver
TG for the control group was determined to be 59 mg/g (SE.+-.5;
P<0.05) while the total liver TG was determined to be 92 mg/g
(SE.+-.10; p=0.062).
[0132] The five test mice which received 900 nmol/kg/d of Enho 1
demonstrated a posttest mean liver weight of 1.6 g (SE.+-.0.1),
representing 5.0% (SE.+-.0.2) of body weight. The mean liver lipid
level for this group was determined to be 82 mg/g (SE.+-.9), with
total lipids measuring 137 mg/g (SE.+-.18). Liver TG for this group
was determined to be 40 mg/g (SE.+-.8; P<0.05) while the total
liver TG was determined to be 66 mg/g (SE.+-.13; p=0.062).
[0133] The six test mice which received 9000 nmol/kg/d of Enho 1
demonstrated a posttest mean liver weight of 1.6 g (SE.+-.0.1),
representing 4.9% (SE.+-.0.3) of body weight. The mean liver lipid
level for this group was determined to be 87 mg/g (SE.+-.6), with
total lipids measuring 143 mg/g (SE.+-.17). Liver TG for this group
was determined to be 32 mg/g (SE.+-.5; P<0.05) while the total
liver TG was determined to be 53 mg/g (SE.+-.11; p=0.062).
[0134] These data show that Enho 1 is capable of inducing a
dose-dependent reversal of hepatic steatosis. In mice receiving the
900 nmol/kg/d and the 9000 nmol/kg/d dosage, the livers, the TG was
reduced by 32% and 46%, respectively, as compared to the control
group.
[0135] These results are reported in Table 8.
TABLE-US-00009 TABLE 8 the effect of Enho-1 upon liver weight,
liver lipid content and liver TG Control 900 nmol/kg/d 9000
nmol/kg/d Liver weight (g) 1.6 .+-. 0.1 1.6 .+-. 0.1 1.6 .+-. 0.1 %
body weight 4.6 .+-. 0.2 5.0 .+-. 0.2 4.9 .+-. 0.3 Liver lipid mg/g
94 .+-. 6 82 .+-. 9 87 .+-. 6 total 147 .+-. 14 137 .+-. 18 143
.+-. 17 Liver TG mg/g 59 .+-. 5 40 .+-. 8 32 .+-. 5 P < 0.05
ANOVA P < 0.05 vs control total 92 .+-. 10 66 .+-. 13 53 .+-. 11
P = 0.062 ANOVA
Example 19
Effect of Enho1 on Weight Loss (Short Term) in Obese Mice
[0136] The effect of Enho-1 upon weight loss was tested over the
course of 3 days using diet induced obese (DIO) C57BL/6J mice
(Jackson Laboratories, Bar Harbor, Me.). The mice were fed Research
Diets 12492 (60% kJ/fat) for 12 weeks, resulting in obesity and
moderate hyperglycemia in the animals. The mice were approximately
20-22 weeks of age and 30-50 g in weight at the start of the
experiment. Fasting blood glucose was determined to be
approximately 170-220 mg/dL. Six control mice received vehicle only
while six test mice each received doses of either 90 nmol/kg/d, 900
nmol/kg/d or 9000 nmol/kg/d. The injections were given as 3 ip
injections at 0600, 1400 and 2000 h on days 1 and 2; over the 3 day
period, the mice received a total of 7 injections. All animals were
euthanized 5 hours after the last injection given the morning of
the third day. Food was removed after the final injection.
[0137] The six control mice exhibited mean pre- and post-treatment
weights of 42.7 g (SE.+-.2.4 g) and 41.7 g (SE.+-.2.3),
respectively, representing a 2.4% (SE.+-.0.5) reduction in total
body weight.
[0138] The six test mice receiving 90 nmol/kg/d Enho 1 exhibited
mean pre- and post-treatment weights of 42.9 g (SE.+-.1.2) and 41.7
g (SD.+-.0.9), respectively, representing a 2.9% (SE.+-.0.6)
reduction in total body weight.
[0139] The six test mice receiving 900 nmol/kg/d Enho 1 exhibited
mean pre- and post-treatment weights of 42.8 g (SE.+-.2.9) and 41.3
g (SE.+-.2.7), respectively, representing a 3.5% (SE.+-.0.7)
reduction in total body weight.
[0140] The six test mice receiving 9000 nmol/kg/d Enho 1 exhibited
mean pre- and post-treatment weights of 42.7 g (SE.+-.1.6) and 40.9
g (SE.+-.1.6), respectively, representing a 4.1% (SE.+-.0.6)
reduction in total body weight.
[0141] These results are reported in Table 9.
TABLE-US-00010 TABLE 9 the effect of Enho-1 upon weight loss 9000
Control 90 nmol/kg/d 900 nmol/kg/d nmol/kg/d Weight 42.7 .+-. 2.4
42.9 .+-. 1.2 42.8 .+-. 2.9 42.7 .+-. 1.6 (pre-treatment) Weight
41.7 .+-. 2.3 41.7 .+-. 0.9 41.3 .+-. 2.7 40.9 .+-. 1.6
(termination) Delta body Weight Grams -1.0 .+-. 0.2 -1.3 .+-. 0.3
-1.5 .+-. 0.3 -1.7 .+-. 0.2 % -2.4 .+-. 0.5 -2.9 .+-. 0.6 -3.5 .+-.
0.7 -4.1 .+-. 0.6
Example 20
Effect of Enho1 on Insulin and Glucose Levels
[0142] The effect of Enho-1 upon insulin and glucose was tested
over the course of 3 days using diet induced obese (DIO) C57BL/6J
mice (Jackson Laboratories, Bar Harbor, Me.). The mice were fed
Research Diets 12492 (60% kJ/fat) for 12 weeks, resulting in
obesity and moderate hyperglycemia in the animals. The mice were
approximately 20-22 weeks of age and 30-50 g in weight at the start
of the experiment. Fasting blood glucose was determined to be
approximately 170-220 mg/dL. Six control mice received vehicle only
while six test mice each received doses of either 90 nmol/kg/d, 900
nmol/kg/d or 9000 nmol/kg/d. The injections were given as 3 ip
injections at 0600, 1400 and 2000 h on days 1 and 2; over the 3 day
period, the mice received a total of 7 injections. All animals were
euthanized 5 hours after the last injection given the morning of
the third day. Food was removed after the final injection.
[0143] The HOMA-IR for each treatment was calculated using the
following formula: ((glucose mg/dL/18).times.(insulin
ng/ml.times.25.05))/22.5
[0144] The six control mice demonstrated a post-test mean blood
glucose level of 196 mg/dL (SE.+-.7) and an insulin level of 4.8
ng/ml (SE.+-.0.2); the HOMA-IR value for the control group was
determined to be 59 (SE.+-.3; p=0.065).
[0145] The six test mice which received 90 nmol/kg/d of Enho1
demonstrated a post-test mean blood glucose level of 204 mg/dL
(SE.+-.7) and an insulin level of 3.8 ng/ml (SE.+-.0.4); the
HOMA-IR value for this group was determined to be 50 (SE.+-.5),
representing a decrease of 15% as compared to the control
group.
[0146] The six test mice which received 900 nmol/kg/d of Enho 1
demonstrated a posttest mean blood glucose level of 166 mg/dL
(SE.+-.13; P>0.05) and an insulin level of 4.2 ng/ml
(SE.+-.0.5); the HOMA-IR value for this group was determined to be
42 (SE.+-.3), representing a decrease of 29% (p<0.02) as
compared to the control group. The blood glucose levels decreased
by approximately 15% while the insulin levels were reduced by about
14%.
[0147] The six test mice which received 9000 nmol/kg/d of Enho 1
demonstrated a posttest mean blood glucose level of 198 mg/dL
(SE.+-.9) and an insulin level of 4.2 ng/ml (SE.+-.0.3); the
HOMA-IR value for this group was determined to be 52 (SE.+-.4),
representing a decrease of 12% as compared to the control
group.
[0148] These results are reported in Table 10.
TABLE-US-00011 TABLE 10 the effect of Enho-1 upon insulin and
glucose 9000 Control 90 nmol/kg/d 900 nmol/kg/d nmol/kg/d Blood
glucose 196 .+-. 7 204 .+-. 7 166 .+-. 13 198 .+-. 9 (mg/dL) P <
0.05 vs 90 P < 0.05 ANOVA Insulin 4.8 .+-. 0.2 3.8 .+-. 0.4 4.2
.+-. 0.5 4.2 .+-. 0.3 (ng/ml) HOMA-IR 59 .+-. 3 50 .+-. 5 42 .+-. 3
52 .+-. 4 1-way (? 15%) (? 29%) (? 12%) ANOVA p = 0.065
Example 21
Effect of Enho1 on Hepatic Steatosis
[0149] The effect of Enho-1 upon liver weight, liver lipid content
and liver TG was tested over the course of 3 days using diet
induced obese (DIO) C57BL/6J mice (Jackson Laboratories, Bar
Harbor, Me.). The mice were fed Research Diets 12492 (60% kJ/fat)
for 12 weeks, resulting in obesity and moderate hyperglycemia in
the animals. The mice were approximately 20-22 weeks of age and
30-50 g in weight at the start of the experiment. Fasting blood
glucose was determined to be approximately 170-220 mg/dL. Six
control mice received vehicle only while six test mice each
received doses of either 90 nmol/kg/d, 900 nmol/kg/d or 9000
nmol/kg/d. The injections were given as 3 ip injections at 0600,
1400 and 2000 h on days 1 and 2; over the 3 day period, the mice
received a total of 7 injections. All animals were euthanized 5
hours after the last injection given the morning of the third day.
Food was removed after the final injection.
[0150] The six control mice exhibited a mean liver weight of 1.6 g
(SE.+-.0.2), representing 3.7% (SE.+-.0.2) of total body weight.
The mean liver lipid level for the control group was 155 mg/g
(SE.+-.39), with total lipids measuring 272 mg/g (SE.+-.89). Liver
TG for the control group was determined to be 58 mg/g (SE.+-.11)
while the total liver TG was determined to be 87 mg/g
(SE.+-.15).
[0151] The six test mice which received 90 nmol/kg/d of Enho 1
demonstrated a post-test mean liver weight of 1.5 g (SE.+-.0.0),
representing 3.6% (SE.+-.0.1) of body weight. The mean liver lipid
level for this group was determined to be 126 mg/g (SE.+-.9), with
total lipids measuring 188 mg/g (SE.+-.13). Liver TG for this group
was determined to be 57 mg/g (SE.+-.8) while the total liver TG was
determined to be 86 mg/g (SE.+-.14).
[0152] The six test mice which received 900 nmol/kg/d of Enho 1
demonstrated a posttest mean liver weight of 1.5 g (SE.+-.0.2),
representing 3.5% (SE.+-.0.2) of body weight. The mean liver lipid
level for this group was determined to be 137 mg/g (SE.+-.34), with
total lipids measuring 226 mg/g (SE.+-.77). Liver TG for this group
was determined to be 48 mg/g (SE.+-.12) while the total liver TG
was determined to be 66 mg/g (SE.+-.14).
[0153] The six test mice which received 9000 nmol/kg/d of Enho 1
demonstrated a posttest mean liver weight of 1.4 g (SE.+-.0.2),
representing 3.4% (SE.+-.0.3) of body weight. The mean liver lipid
level for this group was determined to be 139 mg/g (SE.+-.42), with
total lipids measuring 230 mg/g (SE.+-.96). Liver TG for this group
was determined to be 47 mg/g (SE.+-.9) while the total liver TG was
determined to be 63 mg/g (SE.+-.10).
[0154] These data show that Enho1 is capable of inducing a
dose-dependent reversal of hepatic steatosis. In mice receiving the
9000 nmol/kg/d dosage, the livers, the liver TG was reduced by
18-19% while serum TG was reduced by 20% (p<0.05; 1-tailed
t-test) as compared to the control group.
[0155] These results are reported in Table 11.
TABLE-US-00012 TABLE 11 The effect of Enho-1 upon liver weight,
liver lipid content and liver TG Control 90 nmol/kg/d 900 nmol/kg/d
9000 nmol/kg/d Liver weight grams 1.6 .+-. 0.2 1.5 .+-. 0.0 1.5
.+-. 0.2 1.4 .+-. 0.2 % body 3.7 .+-. 0.2 3.6 .+-. 0.1 3.5 .+-. 0.2
3.4 .+-. 0.3 weight Liver lipid mg/g 155 .+-. 39 126 .+-. 8 137
.+-. 34 139 .+-. 42 total 272 .+-. 89 188 .+-. 13 226 .+-. 77 230
.+-. 96 Liver TG mg/g 58 .+-. 11 57 .+-. 8 48 .+-. 12 47 .+-. 9
total 87 .+-. 14 86 .+-. 14 66 .+-. 14 63 .+-. 10
Example 22
Effect of Enho1 on Serum Lipids
[0156] The effect of Enho-1 upon liver serum lipid content was
tested over the course of 8 days using obese (ob/ob) mice. The mice
were fed Research Diets 12450 and were approximately 9-10 weeks of
age at the start of the experiment. Control mice received vehicle
only while test mice each received doses of either 90 nmol/kg/d,
900 nmol/kg/d or 9000 nmol/kg/d. The injections were given as 3 ip
injections at 0800, 1200 and 1600 h for 7 days. On day 8, the mice
were given the 0800 h injection and were sacrificed 1-3 h later, at
which time blood samples were taken.
[0157] Blood glucose levels were measured using an Accu-Chek
glucometer. Insulin levels were measured by ELISA (Mercodia Mouse
Insulin ELISA, ALPCO) while triglycerides were measured using a
Triglyceride L-Type TG H kit (Wako Diagnostics).
[0158] Eight control mice exhibited a mean blood triglyceride level
of 29.6 mg/dL (SE.+-.5.9).
[0159] Eight test mice which received 90 nmol/kg/d of Enho 1
demonstrated a post-test blood TG level of 19.4 mg/dL (SE.+-.2.2),
a decrease of 34% in comparison with the control.
[0160] Seven test mice which received 900 nmol/kg/d of Enho 1
demonstrated a post-test blood TG level of 18.4 mg/dL (SE.+-.2.3),
a decrease of 38% from the control.
[0161] The final group of seven mice which received 9000 nmol/kg/d
of Enho1 demonstrated a post-test blood TG level of 22.0 mg/dL
(SE.+-.2.2), a decrease of 26% from the control.
[0162] These results are reported in Table 12.
TABLE-US-00013 TABLE 12 The effect of Enho-1 upon liver serum lipid
content Control 90 nmol/kg/d 900 nmol/kg/d 9000 nmol/kg/d TG 29.6
.+-. 5.9 19.4 .+-. 2.2 18.4 .+-. 2.3 22.0 .+-. 2.2 (mg/dL) (? 34%)
(? 38%) (? 26%)
Example 23
Effect of Enho1 on Weight Loss
[0163] The effect of Enho-1 upon weight loss was tested over the
course of 7 days using DIO C57BL/6J mice (Charles River
Laboratories). The mice were fed a high fat diet (Research Diets
12492) for 10 weeks prior to the start of the experiment, which was
begun when the mice were 15-16 weeks of age. Control mice received
vehicle only while test mice each received doses of either 90
nmol/kg/d, 900 nmol/kg/d or 9000 nmol/kg/d. The injections were
given as 3 ip injections at 0800, 1200 and 1600 h for 7 days. On
day 8, the mice were given the 0800 h injection and were sacrificed
1-3 h later.
[0164] The eight control mice exhibited mean pre- and
post-treatment weights of 34.2 g (SE.+-.1.5 g) and 32.6 g
(SE.+-.1.0), respectively, representing a 4.5% (SE.+-.1.5)
reduction in total body weight.
[0165] Eight test mice receiving 90 nmol/kg/d Enho 1 exhibited mean
pre- and post-treatment weights of 36.5 g (SE.+-.1.3) and 34.0 g
(SD.+-.0.9), respectively, representing a 6.6% (SE.+-.1.1)
reduction in total body weight.
[0166] Seven test mice receiving 900 nmol/kg/d Enho 1 exhibited
mean pre- and post-treatment weights of 37.9 g (SE.+-.1.4) and 36.0
g (SE.+-.1.2), respectively, representing a 7.1% (SE.+-.1.2)
reduction in total body weight.
[0167] Lastly, seven test mice receiving 9000 nmol/kg/d Enho1
exhibited mean pre- and post-treatment weights of 33.8 g
(SE.+-.10.8) and 31.6 g (SE.+-.0.7), respectively, representing a
6.7% (SE.+-.1.3) reduction in total body weight.
[0168] These results are reported in Table 13.
TABLE-US-00014 TABLE 13 The effect of Enho-1 upon weight loss 9000
Control 90 nmol/kg/d 900 nmol/kg/d nmol/kg/d Weight 34.2 .+-. 1.5
36.5 .+-. 1.3 37.9 .+-. 1.4 33.8 .+-. 0.8 (pre-treatment) Weight
32.6 .+-. 1.0 34.0 .+-. 1.0 36.0 .+-. 1.2 31.6 .+-. 0.7
(termination) Delta body weight Grams -1.6 .+-. 0.6 -2.5 .+-. 0.4
-2.8 .+-. 0.6 -2.3 .+-. 0.5 % -4.5 .+-. 1.5 -6.6 .+-. 1.1 -7.1 .+-.
1.2 -6.7 .+-. 1.3
Example 24
Effect of Enho1 on Insulin and Glucose
[0169] The effect of Enho-1 upon insulin and glucose was tested
over the course of 7 days using DIO C57BL/6J mice (Charles River
Laboratories). The mice were fed a high fat diet (Research Diets
12492) for 10 weeks prior to the start of the experiment, which was
begun when the mice were 15-16 weeks of age. Control mice received
vehicle only while test mice each received doses of either 90
nmol/kg/d, 900 nmol/kg/d or 9000 nmol/kg/d. The injections were
given as 3 ip injections at 0800, 1200 and 1600 h for 7 days. On
day 8, the mice were given the 0800 h injection and were sacrificed
1-3 h later at which time blood samples were collected and levels
of insulin and glucose determined.
[0170] The HOMA-IR for each treatment was calculated using the
following formula: ((glucose mg/dL/18).times.(insulin
ng/ml.times.25.05))/22.5
[0171] Eight control mice demonstrated a post-test mean blood
glucose level of 191 mg/dL (SE.+-.10) and an insulin level of 1.9
ng/ml (SE.+-.0.3); the HOMA-IR value for the control group was
determined to be 22 (SE.+-.4).
[0172] The eight test mice which received 90 nmol/kg/d of Enho 1
demonstrated a posttest mean blood glucose level of 182 mg/dL
(SE.+-.17) and an insulin level of 1.3 ng/ml (SE.+-.0.1); the
HOMA-IR value for this group was determined to be 15 (SE.+-.2),
representing a decrease of 15% as compared to the control
group.
[0173] The seven test mice which received 900 nmol/kg/d of Enho1
demonstrated a post-test mean blood glucose level of 212 mg/dL
(SE.+-.11) and an insulin level of 2.2 ng/ml (SE.+-.0.3); the
HOMA-IR value for this group was determined to be 29 (SE.+-.4),
representing a decrease of 29% (p<0.02) as compared to the
control group.
[0174] The seven test mice which received 9000 nmol/kg/d of Enho 1
demonstrated a post-test mean blood glucose level of 190 mg/dL
(SE.+-.16) and an insulin level of 1.3 ng/ml (SE.+-.0.2); the
HOMA-IR value for this group was determined to be 16 (SE.+-.4),
representing a decrease of 27 as compared to the control group.
[0175] These results are reported in Table 14.
TABLE-US-00015 TABLE 14 The effect of Enho-1 upon insulin and
glucose 9000 Control 90 nmol/kg/d 900 nmol/kg/d nmol/kg/d Blood
glucose 191 .+-. 10 182 .+-. 17 212 .+-. 11 190 .+-. 16 (mg/dL)
Insulin 1.9 .+-. 0.3 1.3 .+-. 0.1 2.2 .+-. 0.3 1.3 .+-. 0.2 (ng/ml)
HOMA-IR 22 .+-. 4 15 .+-. 2 29 .+-. 4 16 .+-. 4 (? 32%) (? 27%)
Example 25
Effect of Enho1 on Blood Lipids
[0176] The effect of Enho-1 upon levels of blood lipids was tested
over the course of 7 days using DIO C57BL/6J mice (Charles River
Laboratories). The mice were fed a high fat diet (Research Diets
12492) for 10 weeks prior to the start of the experiment, which was
begun when the mice were 15-16 weeks of age. Control mice received
vehicle only while test mice each received doses of either 90
nmol/kg/d, 900 nmol/kg/d or 9000 nmol/kg/d. The injections were
given as 3 ip injections at 0800, 1200 and 1600 h for 7 days. On
day 8, the mice were given the 0800 h injection and were sacrificed
1-3 h later at which time blood samples were collected and levels
of trigylcerides determined. Triglycerides were measured using a
Triglyceride L-Type TG H kit (Wako Diagnostics).
[0177] Eight control mice exhibited a mean blood triglyceride level
of 22.9 mg/dL (SE.+-.2.8).
[0178] Eight test mice which received 90 nmol/kg/d of Enho 1
demonstrated a post-test blood TG level of 22.5 mg/dL
(SE.+-.6.0).
[0179] Seven test mice which received 900 nmol/kg/d of Enho 1
demonstrated a post-test blood TG level of 38.0 mg/dL
(SE.+-.12.5).
[0180] The final group of seven mice which received 9000 nmol/kg/d
of Enho 1 demonstrated a post-test blood TG level of 18.5 mg/dL
(SE.+-.1.7), a decrease of 19% from the control.
[0181] These results are reported in Table 15.
TABLE-US-00016 TABLE 15 The effect of Enho-1 upon levels of blood
lipids Control 90 nmol/kg/d 900 nmol/kg/d 9000 nmol/kg/d TG 22.9
.+-. 2.8 22.5 .+-. 6.0 38.0 .+-. 12.5 18.5 .+-. 1.7 (mg/dL) (?
19%)
[0182] Miscellaneous
[0183] An "effective amount" of a Enho1 protein or peptide is an
amount that decreases the level of insulin resistance or of
dyslipidemia, or that prevents, delays or reduces the incidence of
the onset of type 2 diabetes in obese insulin resistant patients by
a statistically significant degree. "Statistical significance" is
determined as the P<0.05 level, or by such other measure of
statistical significance as is commonly used in the art for a
particular type of experimental determination.
[0184] The term "Enho1" used herein and in the claims refers to the
protein Enho1 (SEQ.ID.NO. 2), its functional peptides (e.g.,
Enho1.sup.34-76), derivatives and analogs. The terms "derivatives"
and "analogs" are understood to be proteins that are similar in
structure to Enho1 and that exhibit a qualitatively similar effect
to the unmodified Enho1. The term "functional peptide" refers to a
piece of the Enho1 protein that still binds to the Enho1 receptor
or is able to activate changes inside body cells, e.g., adipocytes
or hepatocytes.
[0185] The administration of Enho1, its functional peptides, its
analogs and derivatives in accordance with the present invention
may be used to reverse insulin resistance and dyslipidemia, to
delay onset to type 2 diabetes in obese insulin resistant subjects,
and to prevent or delay onset of obesity. These compounds can also
be used as therapeutic or diagnostic agents for
hypercholesterolemia, hypertriglyceridemia, insulin resistance,
obesity, and diabetes.
[0186] The term "therapeutically effective amount" as used herein
refers to an amount of Enho1 protein, a fragment, or a derivative
or analog sufficient either increase body energy expenditure,
decrease serum triglyceride, decrease serum cholesterol, decrease
hyperlipidemia, or decrease insulin resistance to a statistically
significant degree (p<0.05). The dosage ranges for the
administration of Enho1 protein are those that produce the desired
effect. Generally, the dosage will vary with the age, weight,
condition, sex of the patient. A person of ordinary skill in the
art, given the teachings of the present specification, may readily
determine suitable dosage ranges. The dosage can be adjusted by the
individual physician in the event of any contraindications. In any
event, the effectiveness of treatment can be determined by
monitoring either the body metabolism, body weight, or the serum
glucose, triglyceride, cholesterol levels by methods well known to
those in the field. Moreover, Enho1 can be applied in
pharmaceutically acceptable carriers known in the art.
[0187] This method of treatment may be used in vertebrates
generally, including human and non-human mammals. Peptides in
accordance with the present invention may be administered to a
patient by any suitable means, including oral, intravenous,
parenteral, subcutaneous, intrapulmonary, and intranasal
administration.
[0188] Parenteral infusions include intramuscular, intravenous,
intraarterial, or intraperitoneal administration. The compound may
also be administered transdermally, for example in the form of a
slow-release subcutaneous implant, or orally in the form of
capsules, powders, or granules. It may also be administered by
inhalation.
[0189] Pharmaceutically acceptable carrier preparations for
parenteral administration include sterile, aqueous or non-aqueous
solutions, suspensions, and emulsions. Examples of non-aqueous
solvents are propylene glycol, polyethylene glycol, vegetable oils
such as olive oil, and injectable organic esters such as ethyl
oleate. Aqueous carriers include water, alcoholic/aqueous
solutions, emulsions or suspensions, including saline and buffered
media. Parenteral vehicles include sodium chloride solution,
Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's,
or fixed oils. The active therapeutic ingredient may be mixed with
excipients that are pharmaceutically acceptable and are compatible
with the active ingredient. Suitable excipients include water,
saline, dextrose, glycerol and ethanol, or combinations thereof.
Intravenous vehicles include fluid and nutrient replenishers,
electrolyte replenishers, such as those based on Ringer's dextrose,
and the like. Preservatives and other additives may also be present
such as, for example, antimicrobials, anti-oxidants, chelating
agents, inert gases, and the like.
[0190] The form may vary depending upon the route of
administration. For example, compositions for injection may be
provided in the form of an ampule, each containing a unit dose
amount, or in the form of a container containing multiple
doses.
[0191] The compound may be formulated into therapeutic compositions
as pharmaceutically acceptable salts. These salts include acid
addition salts formed with inorganic acids, for example
hydrochloric or phosphoric acid, or organic acids such as acetic,
oxalic, or tartaric acid, and the like. Salts also include those
formed from inorganic bases such as, for example, sodium,
potassium, ammonium, calcium or ferric hydroxides, and organic
bases such as isopropylamine, trimethylamine, histidine, procaine
and the like. The compositions may be administered intravenously,
subcutaneously, intramuscularly.
[0192] Controlled delivery may be achieved by admixing the active
ingredient with appropriate macromolecules, for example,
polyesters, polyamino acids, polyvinyl pyrrolidone,
ethylenevinylacetate, methylcellulose, carboxymethylcellulose,
prolamine sulfate, or lactide/glycolide copolymers. The rate of
release of the active compound may be controlled by altering the
concentration of the macromolecule.
[0193] Another method for controlling the duration of action
comprises incorporating the active compound into particles of a
polymeric substance such as a polyester, peptide, hydrogel,
polylactide/glycolide copolymer, or ethylenevinylacetate
copolymers. Alternatively, an active compound may be encapsulated
in microcapsules prepared, for example, by coacervation techniques
or by interfacial polymerization, for example, by the use of
hydroxymethylcellulose or gelatin-microcapsules or
poly(methylmethacrylate) microcapsules, respectively, or in a
colloid drug delivery system. Colloidal dispersion systems include
macromolecule complexes, nanocapsules, microspheres, beads, and
lipid-based systems including oil-in-water emulsions, micelles,
mixed micelles, and liposomes.
[0194] In addition, all or portions of the nucleic acid sequence
(SEQ ID NO: 1) (e.g., the open reading frame underlined in FIG. 4)
can be used to make plasmids or vectors to incorporate the Enho1
gene into organisms to increase the production of the Enho1
protein. It will be understood by those skilled in the art that the
nucleic acid sequence of SEQ ID NO: 1 is not the only sequence that
can be used to produce the Enho1 protein. Also contemplated are
those nucleic acid sequences that encode identical proteins but
that, because of the degeneracy of the genetic code, possess
different nucleotide sequences. The genetic code may be found in
numerous references concerning genetics or biology, including, for
example, FIG. 9.1 on page 214 of B. Lewin, Genes VI (Oxford
University Press, New York, 1997). FIG. 9.3 on page 216 of Lewin
directly illustrates the degeneracy of the genetic code. For
example, the codon for asparagine may be AAT or AAC.
[0195] The invention also encompasses nucleotide sequences encoding
Enho1 proteins having one or more silent amino acid changes in
portions of the molecule not involved with receptor binding or
protein secretion. For example, alterations in the nucleotide
sequence that result in the production of a chemically equivalent
amino acid at a given site are contemplated; thus, a codon for the
amino acid alanine, a hydrophobic amino acid, may be substituted by
a codon encoding another hydrophobic residue, such as glycine, or
may be substituted with a more hydrophobic residue such as valine,
leucine, or isoleucine. Similarly, changes that result in the
substitution of one negatively-charged residue for another, such as
aspartic acid for glutamic acid, or one positively-charged residue
for another, such as lysine for arginine, can also be expected to
produce a biologically equivalent product. See, e.g., FIG. 1.8 on
page 10 of Lewin (1997), showing the nature of the side chains of
the "standard" 20 amino acids encoded by the genetic code. (Note
also a typographical error in that published figure, namely that
the abbreviation for glutamine should be "Gln.")
REFERENCES
[0196] 1. Gunning, P., Leavitt, J., Muscat, G., Ng, S. Y. &
Kedes, L. (1987) A human beta-actin expression vector system
directs high-level accumulation of antisense transcripts. Proc Natl
Acad Sci USA 84: 4831-4835. [0197] 2. Reaven, G. M. (1995)
Pathophysiology of insulin resistance in human disease. Physiol Rev
75: 473-486. [0198] 3. Horton, J. D., Goldstein, J. L. & Brown,
M. S. (2002) SREBPs: activators of the complete program of
cholesterol and fatty acid synthesis in the liver. J Clin Invest
109: 1125-1131. [0199] 4. Shimomura, I., Matsuda, M., Hammer, R.
E., Bashmakov, Y., Brown, M. S. & Goldstein, J. L. (2000)
Decreased IRS-2 and increased SREBP-1c lead to mixed insulin
resistance and sensitivity in livers of lipodystrophic and ob/ob
mice. Mol Cell 6: 77-86. [0200] 5. Gavrilova, O., Haluzik, M.,
Matsusue, K., Cutson, J. J., Johnson, L., Dietz, K. R., Nicol, C.,
Vinson, C., Gonzalez, F. & Reitman, M. L. (2003) Liver
PPARgamma contributes to hepatic steatosis, triglyceride clearance,
and regulation of body fat mass. J Biol. Chem. [0201] 6. Matsusue,
K., Haluzik, M., Lambert, G., Yim, S. H., Gavrilova, O., Ward, J.
M., Brewer, B., Jr., Reitman, M. L. & Gonzalez, F. J. (2003)
Liver-specific disruption of PPARgamma in leptin-deficient mice
improves fatty liver but aggravates diabetic phenotypes. J Clin
Invest 111: 737-747. [0202] 7. Yahagi, N., Shimano, H., Hasty, A.
H., Matsuzaka, T., Ide, T., Yoshikawa, T., Amemiya-Kudo, M.,
Tomita, S., Okazaki, H. et al. (2002) Absence of sterol regulatory
element-binding protein-1 (SREBP-1) ameliorates fatty livers but
not obesity or insulin resistance in Lep(ob)/Lep(ob) mice. J Biol
Chem 277: 19353-19357. [0203] 8. Araki, E., Lipes, M. A., Patti, M.
E., Bruning, J. C., Haag, B., 3rd, Johnson, R. S. & Kahn, C. R.
(1994) Alternative pathway of insulin signalling in mice with
targeted disruption of the IRS-1 gene. Nature 372: 186-190. [0204]
9. Withers, D. J., Gutierrez, J. S., Towery, H., Burks, D. J., Ren,
J. M., Previs, S., Zhang, Y., Bernal, D., Pons, S. et al. (1998)
Disruption of IRS-2 causes type 2 diabetes in mice. Nature 391:
900-904. [0205] 10. Kido, Y., Burks, D. J., Withers, D., Bruning,
J. C., Kahn, C. R., White, M. F. & Accili, D. (2000)
Tissue-specific insulin resistance in mice with mutations in the
insulin receptor, IRS-1, and IRS-2. J Clin Invest 105: 199-205.
[0206] 11. Previs, S. F., Withers, D. J., Ren, J. M., White, M. F.
& Shulman, G. I. (2000) Contrasting effects of IRS-1 versus
IRS-2 gene disruption on carbohydrate and lipid metabolism in vivo.
J Biol Chem 275: 38990-38994. [0207] 12. White, M. F. (2002) IRS
proteins and the common path to diabetes. Am J Physiol Endocrinol
Metab 283: E413-422. [0208] 13. Ravussin, E. & Smith, S. R.
(2002) Increased fat intake, impaired fat oxidation, and failure of
fat cell proliferation result in ectopic fat storage, insulin
resistance, and type 2 diabetes mellitus. Ann N Y Acad Sci 967:
363-378. [0209] 14. Lowell, B. B. & Shulman, G. I. (2005)
Mitochondrial dysfunction and type 2 diabetes. Science 307:
384-387. [0210] 15. Sutton, G. M., Trevaskis, J. L., Hulver, M. W.,
McMillan, R. P., Markward, N. J., Babin, M. J., Meyer, E. A. &
Butler, A. A. (2006) Diet-genotype interactions in the development
of the obese, insulin-resistant phenotype of C57BL/6J mice lacking
melanocortin-3 or -4 receptors. Endocrinology 147: 2183-2196.
[0211] 16. Elmquist, J. K., Coppari, R., Balthasar, N., Ichinose,
M. & Lowell, B. B. (2005) Identifying hypothalamic pathways
controlling food intake, body weight, and glucose homeostasis. J
Comp Neurol 493: 63-71. [0212] 17. Asilmaz, E., Cohen, P.,
Miyazaki, M., Dobrzyn, P., Ueki, K., Fayzikhodjaeva, G., Soukas, A.
A., Kahn, C. R., Ntambi, J. M. et al. (2004) Site and mechanism of
leptin action in a rodent form of congenital lipodystrophy. J Clin
Invest 113: 414-424. [0213] 18. Morton, G. J., Blevins, J. E.,
Williams, D. L., Niswender, K. D., Gelling, R. W., Rhodes, C. J.,
Baskin, D. G. & Schwartz, M. W. (2005) Leptin action in the
forebrain regulates the hindbrain response to satiety signals. J
Clin Invest 115: 703-710. [0214] 19. Coppari, R., Ichinose, M.,
Lee, C. E., Pullen, A. E., Kenny, C. D., McGovern, R. A., Tang, V.,
Liu, S. M., Ludwig, T. et al. (2005) The hypothalamic arcuate
nucleus: A key site for mediating leptin's effects on glucose
homeostasis and locomotor activity. Cell Metabolism 1: 63-72.
[0215] 20. Minokoshi, Y., Kim, Y.-B., Peroni, O. D., Fryer, L. G.
D., Muller, C., Carling, D. & Kahn, B. B. (2002) Leptin
stimulates fatty-acid oxidation by activating AMP-activated protein
kinase. Nature 415: 339-343. [0216] 21. Roden, M., Price, T. B.,
Perseghin, G., Petersen, K. F., Rothman, D. L., Cline, G. W. &
Shulman, G. I. (1996) Mechanism of free fatty acid-induced insulin
resistance in humans. J Clin Invest 97: 2859-2865. [0217] 22.
Dresner, A., Laurent, D., Marcucci, M., Griffin, M. E., Dufour, S.,
Cline, G. W., Slezak, L. A., Andersen, D. K., Hundal, R. S. et al.
(1999) Effects of free fatty acids on glucose transport and
IRS-1-associated phosphatidylinositol 3-kinase activity. J Clin
Invest 103: 253-259. [0218] 23. Kim, Y. B., Shulman, G. I. &
Kahn, B. B. (2002) Fatty acid infusion selectively impairs insulin
action on Akt1 and protein kinase C lambda/zeta but not on glycogen
synthase kinase-3. Biol Chem 277: 32915-32922. [0219] 24. Roden,
M., Krssak, M., Stingl, H., Gruber, S., Hofer, A., Furnsinn, C.,
Moser, E. & Waldhausl, W. (1999) Rapid impairment of skeletal
muscle glucose transport/phosphorylation by free fatty acids in
humans. Diabetes 48: 358-364. [0220] 25. Yu, C., Chen, Y., Cline,
G. W., Zhang, D., Zong, H., Wang, Y., Bergeron, R., Kim, J. K.,
Cushman, S. W. et al. (2002) Mechanism by which fatty acids inhibit
insulin activation of insulin receptor substrate-1
(IRS-1)-associated phosphatidylinositol 3-kinase activity in
muscle. J Biol Chem 277: 50230-50236. [0221] 26. Rajala, M. W.
& Scherer, P. E. (2003) Minireview: The adipocyte--at the
crossroads of energy homeostasis, inflammation, and
atherosclerosis. Endocrinology 144: 3765-3773. [0222] 27. Kadowaki,
T. & Yamauchi, T. (2005) Adiponectin and adiponectin receptors.
Endocr Rev 26: 439-451. [0223] 28. Flier, J. S. (2004) Obesity
wars. Molecular progress confronts an expanding epidemic. Cell 116:
337-350. [0224] 29. Nishizawa, H., Matsuda, M., Yamada, Y., Kawai,
K., Suzuki, E., Makishima, M., Kitamura, T. & Shimomura, I.
(2004) Musclin, a novel skeletal muscle-derived secretory factor. J
Biol Chem 279: 19391-19395. [0225] 30. Oike, Y., Akao, M.,
Yasunaga, K., Yamauchi, T., Morisada, T., Ito, Y., Urano, T.,
Kimura, Y., Kubota, Y. et al. (2005) Angiopoietin-related growth
factor antagonizes obesity and insulin resistance. Nat Med 11:
400-408. [0226] 31. Sutton, G. M., Trevaskis, J. L., Hulver, M. W.,
MacMillan, R. P., Markward, N. J., Meyer, E. A., Babin, M. J. &
Butler, A. A. (2006) Diet-Genotype Interactions in the Development
of the Obese, Insulin Resistant Phenotype of C57BL/6J mice lacking
Melanocortin-3 or -4 Receptors. Endocrinology 147: 2183-2196.
[0227] 32. Albarado, D. C., McClaine, J., Stephens, J. M., Mynatt,
R. L., Ye, J., Bannon, A. W., Richards, W. G. & Butler, A. A.
(2004) Impaired coordination of nutrient intake and substrate
oxidation in melanocortin-4 receptor knockout mice. Endocrinology
145: 243-252. [0228] 33. Browning, J. D. & Horton, J. D. (2004)
Molecular mediators of hepatic steatosis and liver injury. J Clin
Invest 114: 147-152. [0229] 34. Sparks, L. M., Xie, H., Koza, R.
A., Mynatt, R., Hulver, M. W., Bray, G. A. & Smith, S. R.
(2005) A high-fat diet coordinately downregulates genes required
for mitochondrial oxidative phosphorylation in skeletal muscle.
Diabetes 54: 1926-1933. [0230] 35. Teran-Garcia, M., Rankinen, T.,
Koza, R. A., Rao, D. C. & Bouchard, C. (2005) Endurance
training-induced changes in insulin sensitivity and gene
expression. Am J Physiol Endocrinol Metab 288: E1168-1178. [0231]
36. Koza, R. A., Nikonova, L., Hogan, J., Rim, J. S., Mendoza, T.,
Faulk, C., Skaf, J. & Kozak, L. P. (2006) Changes in gene
expression foreshadow diet-induced obesity in genetically identical
mice. PLoS Genet. 2: e81. [0232] 37. Clark, H. F., Gurney, A. L.,
Abaya, E., Baker, K., Baldwin, D., Brush, J., Chen, J., Chow, B.,
Chui, C. et al. (2003) The secreted protein discovery initiative
(SPDI), a large-scale effort to identify novel human secreted and
transmembrane proteins: a bioinformatics assessment. Genome Res 13:
2265-2270. [0233] 38. Kay, M. A., Glorioso, J. C. & Naldini, L.
(2001) Viral vectors for gene therapy: the art of turning
infectious agents into vehicles of therapeutics. Nat Med 7: 33-40.
[0234] 39. Chen, G., Koyama, K., Yuan, X., Lee, Y., Zhou, Y. T.,
O'Doherty, R., Newgard, C. B. & Unger, R. H. (1996)
Disappearance of body fat in normal rats induced by
adenovirus-mediated leptin gene therapy. Proc Natl Acad Sci USA 93:
14795-14799. [0235] 40. Satoh, H., Nguyen, M. T., Trujillo, M.,
Imamura, T., Usui, I., Scherer, P. E. & Olefsky, J. M. (2005)
Adenovirus-mediated adiponectin expression augments skeletal muscle
insulin sensitivity in male Wistar rats. Diabetes 54: 1304-1313.
[0236] 41. Satoh, H., Nguyen, M. T., Miles, P. D., Imamura, T.,
Usui, I. & Olefsky, J. M. (2004) Adenovirus-mediated chronic
"hyper-resistinemia" leads to in vivo insulin resistance in normal
rats. J Clin Invest 114: 224-231. [0237] 42. Xu, A., Wang, Y.,
Keshaw, H., Xu, L. Y., Lam, K. S. & Cooper, G. J. (2003) The
fat-derived hormone adiponectin alleviates alcoholic and
nonalcoholic fatty liver diseases in mice. J Clin Invest 112:
91-100. [0238] 43. Yamauchi, T., Kamon, J., Minokoshi, Y., Ito, Y.,
Waki, H., Uchida, S., Yamashita, S., Noda, M., Kita, S. et al.
(2002) Adiponectin stimulates glucose utilization and fatty-acid
oxidation by activating AMP-activated protein kinase. Nat Med 8:
1288-1295. [0239] 44. George, S., Rochford, J. J., Wolfrum, C.,
Gray, S. L., Schinner, S., Wilson, J. C., Soos, M. A., Murgatroyd,
P. R., Williams, R. M. et al. (2004) A family with severe insulin
resistance and diabetes due to a mutation in AKT2. Science 304:
1325-1328. [0240] 45. Bae, S. S., Cho, H., Mu, J. & Birnbaum,
M. J. (2003) Isoform-specific regulation of insulin-dependent
glucose uptake by Akt/protein kinase B. J Biol Chem 278:
49530-49536. [0241] 46. Trevaskis, J. L. & Butler, A. A. (2005)
Double leptin (Lepob) and melanocortin-4 receptor (Mc4r) gene
mutations have an additive effect on fat mass, and are associated
with reduced effects of leptin on weight loss and food intake.
Endocrinology 146: 4257-4265. [0242] 47. Clegg, D. J., Brown, L.
M., Woods, S. C. & Benoit, S. C. (2006) Gonadal hormones
determine sensitivity to central leptin and insulin. Diabetes 55:
978-987. [0243] 48. Clegg, D. J., Riedy, C. A., Smith, K. A.,
Benoit, S. C. & Woods, S. C. (2003) Differential sensitivity to
central leptin and insulin in male and female rats. Diabetes 52:
682-687. [0244] 49. Butler, A. A., Blakesley, V. A., Koval, A.,
deJong, R., Groffen, J. & LeRoith, D. (1997) In vivo regulation
of CrkII and CrkL proto-oncogenes in the uterus by insulin-like
growth factor-I. Differential effects on tyrosine phosphorylation
and association with paxillin. J Biol Chem 272: 27660-27664. [0245]
50. Butler, A. A. (2006) The melanocortin system and energy
balance. Peptides 27: 301-309. [0246] 51. Aizawa-Abe, M., Ogawa,
Y., Masuzaki, H., Ebihara, K., Satoh, N., Iwai, H., Matsuoka, N.,
Hayashi, T., Hosoda, K. et al. (2000) Pathophysiological role of
leptin in obesity-related hypertension. J Clin Invest 105:
1243-1252. [0247] 52. Ogawa, Y., Masuzaki, H., Hosoda, K.,
Aizawa-Abe, M., Suga, J., Suda, M., Ebihara, K., Iwai, H.,
Matsuoka, N. et al. (1999) Increased glucose metabolism and insulin
sensitivity in transgenic skinny mice overexpressing leptin.
Diabetes 48: 1822-1829. [0248] 53. Combs, T. P., Pajvani, U. B.,
Berg, A. H., Lin, Y., Jelicks, L. A., Laplante, M., Nawrocki, A.
R., Rajala, M. W., Parlow, A. F. et al. (2004) A transgenic mouse
with a deletion in the collagenous domain of adiponectin displays
elevated circulating adiponectin and improved insulin sensitivity.
Endocrinology 145: 367-383. [0249] 54. Yamauchi, T., Kamon, J.,
Waki, H., Imai, Y., Shimozawa, N., Hioki, K., Uchida, S., Ito, Y.,
Takakuwa, K. et al. (2003) Globular adiponectin protected ob/ob
mice from diabetes and ApoE-deficient mice from atherosclerosis. J
Biol Chem 278: 2461-2468. [0250] 55. Collins, S., Martin, T. L.,
Surwit, R. S. & Robidoux, J. (2004) Genetic vulnerability to
diet-induced obesity in the C57BL/6J mouse: physiological and
molecular characteristics. Physiol Behav 81: 243-248. [0251] 56.
Bates, S. H., Kulkarni, R. N., Seifert, M. & Myers, M. G., Jr.
(2005) Roles for leptin receptor/STAT3-dependent and -independent
signals in the regulation of glucose homeostasis. Cell Metab 1:
169-178. [0252] 57. Shimomura, I., Bashmakov, Y. & Horton, J.
D. (1999) Increased levels of nuclear SREBP-1c associated with
fatty livers in two mouse models of diabetes mellitus. J Biol Chem
274: 30028-30032. [0253] 58. Masuzaki, H., Ogawa, Y., Aizawa-Abe,
M., Hosoda, K., Suga, J., Ebihara, K., Satoh, N., Iwai, H., Inoue,
G. et al. (1999) Glucose metabolism and insulin sensitivity in
transgenic mice overexpressing leptin with lethal yellow agouti
mutation: usefulness of leptin for the treatment of
obesity-associated diabetes. Diabetes 48: 1615-1622. [0254] 59.
Heisler, L. K., Jobst, E. E., Sutton, G. M., Zhou, L., Borok, E.,
Thornton-Jones, Z., Liu, H. Y., Zigman, J. M., Balthasar, N. et al.
(2006) Serotonin Reciprocally Regulates Melanocortin Neurons to
Modulate Food Intake. Neuron Jul 20; 51(2):239-249. [0255] 60.
Butler, A. A., Kesterson, R. A., Khong, K., Cullen, M. J.,
Pelleymounter, M. A., Dekoning, J., Baetscher, M. & Cone, R. D.
(2000) A unique metabolic syndrome causes obesity in the
melanocortin-3 receptor-deficient mouse. Endocrinology 141:
3518-3521.
[0256] The complete disclosures of all references cited in this
specification are hereby incorporated by reference. In the event of
an otherwise irreconcilable conflict, however, the present
specification shall control.
Sequence CWU 1
1
181868DNAmus sp. 1cccgttgtcc cggaccctct cgcgggcgcg caccgggctc
aactcaggcc caggactgca 60ggtgggcatc ttccctgcca agaagtcgct gtgtgtggac
aggacagcca ccttggatgg 120ttggccaccc cagagttgtg cctcggcatg
ggccttgccg ctgaggcagc tccactgtct 180gcgctggcct gagggtgctg
tctgtcatgg gggcagccat ctcccaaggg gctctcatcg 240ccatcgtctg
caatggcctc gtaggcttct tgctgctact gctctgggtc attctctgct
300gggcctgcca ttctcgatct gctgacgtcg attctctctc ggaatccagt
cccaactcca 360gccctggccc ctgtcctgag aaggcgccac caccccagaa
gcccagccat gaaggcagct 420acctgctgca gccctgaagg gctctggcct
agcctggagt cctggacctg agtatacctg 480agtcagagcg tggaatcgga
tccaagaagt cagtcggcct ggggtccagt cgatttgaca 540ctggacccag
cagcctagat tgtagccagc ctggctccaa gagaggcctg agtggcccta
600gagagaaagg cctggagggg gggttaggag ttggtgctag ggccagggcc
atctggactc 660tgctccatcc caagggccaa gggctgagtc catgccttcc
ctaggctcag cacatctggg 720ctccctaggt tggggagcaa acgggaaccc
catggcaata atgggagggt gtccaggctg 780ggccccttct ctggtcctcc
cactgtttgt tgggtaataa atggaactat ggcttgcaaa 840aaaaaaaaaa
aaaaaaaaaa aaaaaaaa 868276PRTmus sp. 2Met Gly Ala Ala Ile Ser Gln
Gly Ala Leu Ile Ala Ile Val Cys Asn1 5 10 15Gly Leu Val Gly Phe Leu
Leu Leu Leu Leu Trp Val Ile Leu Cys Trp 20 25 30Ala Cys His Ser Arg
Ser Ala Asp Val Asp Ser Leu Ser Glu Ser Ser 35 40 45Pro Asn Ser Ser
Pro Gly Pro Cys Pro Glu Lys Ala Pro Pro Pro Gln 50 55 60Lys Pro Ser
His Glu Gly Ser Tyr Leu Leu Gln Pro65 70 75322DNAArtificial
sequenceSynthetic primer 3cctgagggtg ctgtctgtca tg
22422DNAArtificial sequenceSynthetic primer 4cagtagcagc aagaagccta
cg 22521DNAArtificial sequenceSynthetic primer 5ctctcatcgc
catcgtctgc a 21635DNAArtificial sequenceSynthetic primer
6ggggcggccg caccatgggg gcagccatct cccaa 35733DNAArtificial
sequenceSynthetic primer 7gggctcgagg gccagagccc ttcagggctg cag
33814PRTMus sp. 8Cys His Ser Arg Ser Ala Asp Val Asp Ser Leu Ser
Glu Ser1 5 10916PRTmus sp. 9Pro Pro Pro Gln Lys Pro Ser His Glu Gly
Ser Tyr Leu Leu Gln Pro1 5 10 151043PRTmus sp. 10Cys His Ser Arg
Ser Ala Asp Val Asp Ser Leu Ser Glu Ser Ser Pro1 5 10 15Asn Ser Ser
Pro Gly Pro Cys Pro Glu Lys Ala Pro Pro Pro Gln Lys 20 25 30Pro Ser
His Glu Gly Ser Tyr Leu Leu Gln Pro 35 401138PRTmus sp. 11Ala Asp
Val Asp Ser Leu Ser Glu Ser Ser Pro Asn Ser Ser Pro Gly1 5 10 15Pro
Cys Pro Glu Lys Ala Pro Pro Pro Gln Lys Pro Ser His Glu Gly 20 25
30Ser Tyr Leu Leu Gln Pro 351276PRTRattus rattus 12Met Gly Ala Ala
Ile Ser Gln Gly Ala Leu Ile Ala Ile Val Cys Asn1 5 10 15Gly Leu Val
Gly Phe Leu Leu Leu Leu Leu Trp Val Ile Leu Cys Trp 20 25 30Ala Cys
His Ser Arg Ser Ala Asp Val Asp Ser Leu Ser Glu Ser Ser 35 40 45Pro
Asn Ser Ser Pro Gly Pro Cys Pro Glu Lys Ala Pro Pro Pro Gln 50 55
60Lys Pro Ser His Glu Gly Ser Tyr Leu Leu Gln Pro65 70 751376PRTPan
troglodytes 13Met Gly Ala Ala Ile Ser Gln Gly Ala Leu Ile Ala Ile
Val Cys Asn1 5 10 15Gly Leu Val Gly Phe Leu Leu Leu Leu Leu Trp Val
Ile Leu Cys Trp 20 25 30Ala Cys His Ser Arg Ser Ala Asp Val Asp Ser
Leu Ser Glu Ser Ser 35 40 45Pro Asn Ser Ser Pro Gly Pro Cys Pro Glu
Lys Ala Pro Pro Pro Gln 50 55 60Lys Pro Ser His Glu Gly Ser Tyr Leu
Leu Gln Pro65 70 751476PRTHomo sapiens 14Met Gly Ala Ala Ile Ser
Gln Gly Ala Leu Ile Ala Ile Val Cys Asn1 5 10 15Gly Leu Val Gly Phe
Leu Leu Leu Leu Leu Trp Val Ile Leu Cys Trp 20 25 30Ala Cys His Ser
Arg Ser Ala Asp Val Asp Ser Leu Ser Glu Ser Ser 35 40 45Pro Asn Ser
Ser Pro Gly Pro Cys Pro Glu Lys Ala Pro Pro Pro Gln 50 55 60Lys Pro
Ser His Glu Gly Ser Tyr Leu Leu Gln Pro65 70 751576PRTCanis
familiaris 15Met Gly Ala Ala Ile Ser Gln Gly Ala Leu Ile Ala Ile
Val Cys Asn1 5 10 15Gly Leu Val Gly Phe Leu Leu Leu Leu Leu Trp Val
Ile Leu Cys Trp 20 25 30Ala Cys His Ser Arg Ser Ala Asp Ile Asp Ser
Leu Ser Glu Ser Ser 35 40 45Pro Asn Ser Ser Pro Gly Pro Cys Pro Glu
Lys Ala Pro Pro Pro Gln 50 55 60Lys Pro Ser His Glu Gly Ser Tyr Leu
Leu Gln Pro65 70 751676PRTSus sp. 16Met Gly Ala Ala Ile Ser Gln Gly
Ala Leu Ile Ala Ile Ile Cys Asn1 5 10 15Gly Leu Val Gly Phe Leu Leu
Leu Leu Leu Trp Val Ile Leu Cys Trp 20 25 30Ala Cys His Ser Arg Ser
Ala Asn Ile Asp Ser Leu Ser Glu Ser Ser 35 40 45Pro Asn Ser Ser Pro
Gly Pro Cys Pro Glu Lys Ala Pro Pro Pro Gln 50 55 60Lys Pro Ser His
Glu Gly Ser Tyr Leu Leu Gln Pro65 70 751776PRTBovidae 17Met Gly Ala
Ala Leu Ser Gln Gly Ala Leu Ile Ala Ile Ile Cys Asn1 5 10 15Gly Leu
Val Gly Phe Leu Leu Leu Leu Leu Trp Val Ile Leu Cys Trp 20 25 30Ala
Cys His Ser Arg Ser Ala Asn Ile Asp Ser Leu Ser Glu Ser Ser 35 40
45Pro Asn Ser Ser Pro Gly Pro Cys Pro Glu Lys Ala Pro Pro Pro Gln
50 55 60Lys Pro Ser His Glu Gly Ser Tyr Leu Leu Gln Pro65 70
751876PRTOvis aries 18Met Gly Ala Ala Leu Ser Gln Gly Ala Leu Ile
Ala Ile Ile Cys Asn1 5 10 15Gly Leu Val Gly Phe Leu Leu Leu Leu Leu
Trp Val Ile Leu Cys Trp 20 25 30Ala Cys His Ser Arg Ser Ala Asn Ile
Asp Ser Leu Ser Glu Ser Ser 35 40 45Pro Asn Ser Ser Pro Gly Pro Cys
Pro Glu Lys Ala Pro Pro Pro Gln 50 55 60Lys Pro Ser His Glu Gly Ser
Tyr Leu Leu Gln Pro65 70 75
* * * * *