U.S. patent application number 12/392412 was filed with the patent office on 2009-10-01 for directed evolution method.
This patent application is currently assigned to Medical Research Council. Invention is credited to Farid Ghadessy, Phillipp Holliger, Jennifer Lee Ong.
Application Number | 20090246853 12/392412 |
Document ID | / |
Family ID | 27255886 |
Filed Date | 2009-10-01 |
United States Patent
Application |
20090246853 |
Kind Code |
A1 |
Holliger; Phillipp ; et
al. |
October 1, 2009 |
DIRECTED EVOLUTION METHOD
Abstract
We describe a method of selecting an enzyme having replicase
activity, the method comprising the steps of: (a) providing a pool
of nucleic acids comprising members each encoding a replicase or a
variant of the replicase; (b) subdividing the pool of nucleic acids
into compartments, such that each compartment comprises a nucleic
acid member of the pool together with the replicase or variant
encoded by the nucleic acid member; (c) allowing nucleic acid
replication to occur; and (d) detecting amplification of the
nucleic acid member by the replicase. Methods for selecting agents
capable of modulating replicase activity, and for selecting
interacting polypeptides are also disclosed.
Inventors: |
Holliger; Phillipp;
(Cambridge, GB) ; Ghadessy; Farid; (Cambridge,
GB) ; Ong; Jennifer Lee; (Cambridge, GB) |
Correspondence
Address: |
EDWARDS ANGELL PALMER & DODGE LLP
P.O. BOX 55874
BOSTON
MA
02205
US
|
Assignee: |
Medical Research Council
London
GB
|
Family ID: |
27255886 |
Appl. No.: |
12/392412 |
Filed: |
February 25, 2009 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
10387387 |
Mar 13, 2003 |
7514210 |
|
|
12392412 |
|
|
|
|
PCT/GB01/04108 |
Sep 13, 2001 |
|
|
|
10387387 |
|
|
|
|
60283771 |
Apr 13, 2001 |
|
|
|
60285501 |
Apr 20, 2001 |
|
|
|
Current U.S.
Class: |
435/193 |
Current CPC
Class: |
C07K 2319/00 20130101;
C12N 15/1058 20130101; C12N 15/1075 20130101; C12Q 1/6867 20130101;
C12N 9/1252 20130101 |
Class at
Publication: |
435/193 |
International
Class: |
C12N 9/10 20060101
C12N009/10 |
Foreign Application Data
Date |
Code |
Application Number |
Sep 13, 2000 |
GB |
0022458.4 |
Claims
1. A nucleic acid processing (NAP) enzyme identified by a method
comprising the steps of: (a) providing a pool of nucleic acids
comprising members encoding a NAP enzyme or a variant of a NAP
enzyme; (b) subdividing the pool of nucleic acids into
compartments, such that each compartment comprises a nucleic acid
member of the pool together with the NAP enzyme or variant encoded
by the nucleic acid member; (c) allowing nucleic acid processing to
occur; and (d) detecting processing of the nucleic acid member by
the NAP enzyme, whereby a NAP enzyme is selected.
2. The NAP enzyme of claim 1, wherein said NAP enzyme is a variant
of a known NAP enzyme, and wherein said variant has greater
thermostability than said known NAP enzyme.
3. The NAP enzyme of claim 1, wherein said NAP enzyme is a variant
of a known NAP enzyme, and wherein said variant is inhibited to a
lesser extent by heparin than is said known NAP enzyme.
4. The NAP enzyme of claim 3 which is a Taq polymerase active at a
concentration of 0.083 units/.mu.l or more of heparin.
5. The NAP enzyme of claim 1 which is a Taq polymerase active at a
concentration of 0.083 units/.mu.l or more of heparin.
6. The NAP enzyme of claim 1 which is a replicase enzyme that
extends a primer having a 3' mismatch.
7. The NAP enzyme of claim 1 which is a replicase enzyme that
extends a primer having a 3' unnatural base.
8. The NAP enzyme of claim 7 which is capable of extending a primer
having a 3' terminal base comprising 5-nitroindole or
3-carboxyamide-5-nitroindole.
9. The NAP enzyme of claim 1 which is a replicase enzyme variant of
a known replicase enzyme, wherein said variant incorporates
.alpha.-thio dNTPs as nucleotide substrates more efficiently than
said known replicase enzyme.
10. The NAP enzyme of claim 1 which is a replicase enzyme variant
of a known replicase enzyme, wherein said variant replicates a
substrate 23 kb in size in the absence of processivity factors or a
3'-5' exonuclease proof-reading domain.
11. The NAP enzyme of claim 6 in which the 3' mismatch is a 3'
purine-purine mismatch or a 3' pyrimidine-pyrimidine mismatch.
12. The NAP enzyme of claim 6 in which the 3' mismatch is an A-G
mismatch or in which the 3' mismatch is a C-C mismatch.
13. A Taq polymerase mutant comprising a mutation selected from the
group consisting of G84A, D144G, K314R, E520G, A608V and E742G.
14. A Taq polymerase mutant comprising G84A, D144G, K314R, E520G,
A608V and E742G mutations.
Description
[0001] This application is a divisional of U.S. Ser. No.
10/387,387, filed Mar. 13, 2003, which is a continuation-in-part of
international application PCT/GB01/04108, filed Sep. 13, 2001,
which claims the priority of each of Great Britain application GB
0022458.4, filed Sep. 13, 2000, U.S. provisional application
60/283,771, filed Apr. 13, 2001 and U.S. provisional application
60/285,501, filed Apr. 20, 2001. Each of these priority documents
is expressly incorporated herein in its entirety, including tables
and drawings.
FIELD OF THE INVENTION
[0002] The present invention relates to methods for use in in vitro
evolution of molecular libraries. In particular, the present
invention relates to methods of selecting nucleic acids encoding
gene products in which the nucleic acid and the activity of the
encoded gene product are linked by compartmentalisation.
BACKGROUND TO THE INVENTION
[0003] Evolution requires the generation of genetic diversity
(diversity in nucleic acid) followed by the selection of those
nucleic acids which encode beneficial characteristics. Because the
activity of the nucleic acids and their encoded gene product are
physically linked in biological organisms (the nucleic acids
encoding the molecular blueprint of the cells in which they are
confined), alterations in the genotype resulting in an adaptive
change(s) of phenotype produce benefits for the organism resulting
in increased survival and offspring. Multiple rounds of mutation
and selection can thus result in the progressive enrichment of
organisms (and the encoding genotype) with increasing adaptation to
a given selection condition. Systems for rapid evolution of nucleic
acids or proteins in vitro must mimic this process at the molecular
level in that the nucleic acid and the activity of the encoded gene
product must be linked and the activity of the gene product must be
selectable.
[0004] In vitro selection technologies are a rapidly expanding
field and often prove more powerful than rational design to obtain
biopolymers with desired properties. In the past decade selection
experiments, using e.g. phage display or SELEX technologies have
yielded many novel polynucleotide and polypeptide ligands.
Selection for catalysis has proved harder. Strategies have included
binding of transition state analogues, covalent linkage to suicide
inhibitors, proximity coupling and covalent product linkage.
Although these approaches focus only on a particular part of the
enzymatic cycle, there have been some successes. Ultimately however
it would be desirable to select directly for catalytic turnover.
Indeed, simple screening for catalytic turnover of fairly small
mutant libraries has been rather more successful than the various
selection approaches and has yielded some catalysts with greatly
improved catalytic rates.
[0005] While polymerases are a prerequisite for technologies that
define molecular biology, i.e. site-directed mutagenesis, cDNA
cloning and in particular Sanger sequencing and PCR, they often
suffer from serious shortcomings due to the fact that they are made
to perform tasks for which nature has not optimized them. Few
attempts appear to have been made to improve the properties of
polymerases available from nature and to tailor them for specific
applications by protein engineering. Technical advances have been
largely peripheral, and include the use of polymerases from a wider
range of organisms, buffer and additive systems as well as enzyme
blends.
[0006] Attempts to improve the properties of polymerases have
traditionally relied on protein engineering. For example, variants
of Taq polymerase (for example, Stoffel fragment and Klentaq) have
been generated by full or partial deletion of its 5'-3' exonuclease
domain and show improved thermostability and fidelity although at
the cost of reduced processivity (Barnes 1992, Gene 112, 29-35,
Lawyer et al., 1993, PCR Methods and Applications 2, 275). In
addition, the availability of high-resolution structures for
proteins has allowed the rational design of mutants with improved
properties (for example, Taq mutants with improved properties of
dideoxynucleotide incorporation for cycle sequencing, Li et al.,
1999, Proc. Natl. Acad. Sci. USA 96, 9491). In vivo genetic
approaches have also been used for protein design, for example by
complementation of a polA strain to select for active polymerases
from repertoires of mutant polymerases (Suzuki et al., 1996 Proc.
Natl. Acad. Sci. USA 93, 9670). However, the genetic
complementation approach is limited in the properties that can be
selected for.
[0007] Recent advances in molecular biology have allowed some
molecules to be co-selected in vitro according to their properties
along with the nucleic acids that encode them. The selected nucleic
acids can subsequently be cloned for further analysis or use, or
subjected to additional rounds of mutation and selection. Common to
these methods is the establishment of large libraries of nucleic
acids. Molecules having the desired characteristics (activity) can
be isolated through selection regimes that select for the desired
activity of the encoded gene product, such as a desired biochemical
or biological activity, for example binding activity.
[0008] WO99/02671 describes a method for isolating one or more
genetic elements encoding a gene product having a desired activity.
Genetic elements are first compartmentalised into microcapsules,
and then transcribed and/or translated to produce their respective
gene products (RNA or protein) within the microcapsules.
Alternatively, the genetic elements are contained within a host
cell in which transcription and/or translation (expression) of the
gene product takes place and the host cells are first
compartmentalised into microcapsules. Genetic elements which
produce gene product having desired activity are subsequently
sorted. The method described in WO99/02671 relies on the gene
product catalytically modifying the microcapsule or the genetic
element (or both), so that enrichment of the modified entity or
entities enables selection of the desired activity.
SUMMARY OF THE INVENTION
[0009] According to a first aspect of the present invention, we
provide a method of selecting a nucleic acid-processing (NAP)
enzyme, the method comprising the steps of: (a) providing a pool of
nucleic acids comprising members encoding a NAP enzyme or a variant
of the NAP enzyme; (b) subdividing the pool of nucleic acids into
compartments, such that each compartment comprises a nucleic acid
member of the pool together with the NAP enzyme or variant encoded
by the nucleic acid member; (c) allowing nucleic acid processing to
occur; and (d) detecting processing of the nucleic acid member by
the NAP enzyme.
[0010] There is provided, according to a second aspect of the
present invention, a method of selecting an agent capable of
modifying the activity of a NAP enzyme, the method comprising the
steps of: (a) providing a NAP enzyme; (b) providing a pool of
nucleic acids comprising members encoding one or more candidate
agents; (c) subdividing the pool of nucleic acids into
compartments, such that each compartment comprises a nucleic acid
member of the pool, the agent encoded by the nucleic acid member,
and the NAP enzyme; and (d) detecting processing of the nucleic
acid member by the NAP enzyme.
[0011] Preferably, the agent is a promoter of NAP enzyme activity.
The agent may be an enzyme, preferably a kinase or a phosphorylase,
which is capable of acting on the NAP enzyme to modify its
activity. The agent may be a chaperone involved in the folding or
assembly of the NAR enzyme or required for the maintenance of
replicase function (e.g. telomerase, HSP 90). Alternatively, the
agent may be a polypeptide or polynucleotide involved in a
metabolic pathway, the pathway having as an end product a substrate
which is involved in a replication reaction. The agent may moreover
be any enzyme which is capable of catalysing a reaction that
modifies an inhibiting agent (natural or unnatural) of the NAP
enzyme in such a way as to reduce or abolish its inhibiting
activity. Finally the agent may promote NAP activity in a
non-catalytic way, e.g. by association with the NAP enzyme or its
substrate etc. (e.g. processivity factors in the case of DNA
polymerases, e.g. T7 DNA polymerase & thioredoxin).
[0012] We provide, according to a third aspect of the present
invention, a method of selecting a pair of polypeptides capable of
stable interaction, the method comprising: (a) providing a first
nucleic acid and a second nucleic acid, the first nucleic acid
encoding a first fusion protein comprising a first subdomain of a
NAP enzyme fused to a first polypeptide, the second nucleic acid
encoding a second fusion protein comprising a second subdomain of a
NAP enzyme fused to a second polypeptide; in which stable
interaction of the first and second NAP enzyme subdomains generates
NAP enzyme activity, and in which at least one of the first and
second nucleic acids is provided in the form of a pool of nucleic
acids encoding variants of the respective first and/or second
polypeptide(s); (b) subdividing the pool or pools of nucleic acids
into compartments, such that each compartment comprises a first
nucleic acid and a second nucleic acid together with respective
fusion proteins encoded by the first and second nucleic acids; (c)
allowing the first polypeptide to bind to the second polypeptide,
such that binding of the first and second polypeptides leads to
stable interaction of the NAP enzyme subdomains to generate NAP
enzyme activity; and (d) detecting processing of at least one of
the first and second nucleic acids by the NAP enzyme.
[0013] Moreover, the NAP enzyme domains referred to in (a) above
may be replaced with domains of a polypeptide capable of modifying
the activity of NAP enzymes, as discussed in the second aspect of
the present invention, and NAP enzyme activity used to select such
modifying polypeptides having desired properties.
[0014] Preferably, each of the first and second nucleic acids is
provided from a pool of nucleic acids.
[0015] Preferably, the first and second nucleic acids are linked
either covalently (e.g. as part of the same template molecule) or
non-covalently (e.g. by tethering onto beads etc.).
[0016] NAP enzymes may for example be polypeptide or ribonucleic
acid enzyme molecules. In a highly preferred embodiment, the NAP
enzyme according to the invention is a replicase enzyme, i.e. an
enzyme, which is capable of amplifying nucleic acid from a
template, such as for example a polymerase enzyme (or ligase). The
invention is described herein below with specific reference to
replicases; however, it will be understood by those skilled in the
art that the invention is equally applicable to other NAP enzymes,
such as telomerases and helicases, as further set out below, which
process nucleic acids in ways not limited to amplification but
which are nevertheless selectable by detecting nucleic acid
amplification, i.e. which promote replication indirectly.
[0017] In a preferred embodiment of the invention, amplification of
the nucleic acid results from more than one round of nucleic acid
replication. Preferably, the amplification of the nucleic acid is
an exponential amplification.
[0018] The amplification reaction is preferably selected from the
following: a polymerase chain reaction (PCR), a reverse
transcriptase-polymerase chain reaction (RT-PCR), a nested PCR, a
ligase chain reaction (LCR), a transcription-based amplification
system (TAS), a self-sustaining sequence replication (3SR), NASBA,
a transcription-mediated amplification reaction (TMA), and a
strand-displacement amplification (SDA).
[0019] In a highly preferred embodiment, the post-amplification
copy number of the nucleic acid member is substantially
proportional to the activity of the replicase, the activity of a
requisite agent, or the binding affinity and/or binding kinetics of
the first and second polypeptides.
[0020] Nucleic acid replication may be detected by assaying the
copy number of the nucleic acid member. Alternatively, or in
addition, nucleic acid replication may be detected by determining
the activity of a polypeptide encoded by the nucleic acid
member.
[0021] In a highly preferred embodiment, the conditions in the
compartment are adjusted to select for a replicase or agent active
under such conditions, or a pair of polypeptides capable of stable
interaction under such conditions.
[0022] The replicase preferably has polymerase, reverse
transcriptase or ligase activity.
[0023] The polypeptide may be provided from the nucleic acid by in
vitro transcription and translation. Alternatively, the polypeptide
may be provided from the nucleic acid in vivo in an expression
host.
[0024] In a preferred embodiment, the compartments consist of the
encapsulated aqueous component of a water-in-oil emulsion. The
water-in-oil emulsion is preferably produced by emulsifying an
aqueous phase with an oil phase in the presence of a surfactant
comprising 4.5% v/v Span 80, 0.4% v/v Tween 80 and 0.1% v/v Triton
X100, or a surfactant comprising Span 80, Tween 80 and Triton X100
in substantially the same proportions. Preferably, the water:oil
phase ratio is 1:2, which leads to adequate droplet size. Such
emulsions have a higher thermal stability than more oil-rich
emulsions.
[0025] As a fourth aspect of the present invention, there is
provided a replicase enzyme identified by a method according to any
preceding claim. Preferably, the replicase enzyme has a greater
thermostability than a corresponding unselected enzyme. More
preferably, the replicase enzyme is a Taq polymerase having more
than 10 times increased half-life at 97.5.degree. C. when compared
to wild-type Taq polymerase.
[0026] The replicase enzyme may have a greater tolerance to heparin
than a corresponding unselected enzyme. Preferably, the replicase
enzyme is a Taq polymerase active at a concentration of 0.083
units/.mu.l or more of heparin.
[0027] The replicase enzyme may be capable of extending a primer
having a 3' mismatch. Preferably, the 3' mismatch is a 3
purine-purine mismatch or a 3' pyrimidine-pyrimidine mismatch. More
preferably, the 3' mismatch is an A-G mismatch or the 3' mismatch
is a C-C mismatch.
[0028] We provide, according to a fifth aspect of the present
invention, a Taq polymerase mutant comprising the mutations (amino
acid substitutions): F73S, R205K, K219E, M236T, E434D and
A608V.
[0029] The present invention, in a sixth aspect, provides a Taq
polymerase mutant comprising the mutations (amino acid
substitutions): K225E, E388V, K540R, D578G, N583S and M747R.
[0030] The present invention, in a seventh aspect, provides a Taq
polymerase mutant comprising the mutations (amino acid
substitutions): G84A, D144G, K314R, E520G, A608V, E742G.
[0031] The present invention, in a eighth aspect, provides a Taq
polymerase mutant comprising the mutations (amino acid
substitutions): D58G, R74P, A109T, L245R, R343G, G370D, E520G,
N583S, E694K, A743P.
[0032] In a ninth aspect of the present invention, there is
provided a water-in-oil emulsion obtainable by emulsifying an
aqueous phase with an oil phase in the presence of a surfactant
comprising 4.5% v/v Span 80, 0.4% v/v Tween 80 and 0.1% v/v Triton
X100, or a surfactant comprising Span 80, Tween 80 and Triton X100
in substantially the same proportions. Preferably, the water:oil
phase ratio is 1:2. This ratio appears to permit diffusion of dNTPs
(and presumably other small molecules) between compartments at
higher temperatures, which is beneficial for some applications but
not for others. Diffusion can be controlled by increasing water:oil
phase ratio to 1:4.
[0033] In another aspect, the NAP enzyme is a replicase enzyme that
has an enhanced capability to replicate substrates 23 kb in size or
greater in the absence of processivity factors or a 3'-5'
exonuclease proof-reading domain.
[0034] As used herein, the phrase "variant of a nucleic acid
processing enzyme" means a NAP enzyme with an amino acid sequence
(for polypeptide enzymes) or nucleotide sequence (for ribozymes)
differs from a naturally occurring sequence of that NAP enzyme by
at least one amino acid (for polypeptide enzymes) or nucleotide
(for ribozymes). A variant NAP enzyme catalyzes a reaction
catalyzed by the corresponding wild-type NAP enzyme.
[0035] As used herein, the phrase "modifying the activity of a NAP
enzyme" means causing the activity of a NAP enzyme to increase or
decrease, or changing another aspect of the enzyme's activity, such
as substrate identity or substrate specificity, the reaction
catalyzed, cofactor dependence, optimal salt, buffer or temperature
conditions, temperature stability, proofreading capacity,
interaction with other proteins or enzymes, or sensitivity to
inhibition.
[0036] As used herein, the phrase "enhancing the activity of a NAP
enzyme" or "increasing the activity of a NAP enzyme" means
increasing the amount of a product of a reaction catalyzed by a NAP
enzyme in the presence of an enhancing stimulus under a particular
set of conditions by at least 10% relative to the amount formed
under similar conditions in the absence of the enhancing
stimulus.
[0037] As used herein, the phrase "promoter of NAP enzyme activity"
refers to an agent that increases the activity of a given NAP
enzyme.
[0038] As used herein, the phrase "polypeptide that produces a
substrate in a nucleic acid processing reaction" means a
polypeptide enzyme that catalyzes a reaction resulting in the
production of a substrate for a NAP enzyme. A non-limiting example
of a polypeptide that produces a substrate in a nucleic acid
processing reaction is a nucleoside diphosphate kinase, which
catalyzes the phosphorylation of deoxynucleoside diphosphates to
deoxynucleoside triphosphates, which are substrates for NAP enzymes
such as DNA polymerases.
[0039] As used herein, the phrase "polypeptide that consumes an
inhibitor in a nucleic acid processing reaction" means a
polypeptide enzyme that catalyzes a reaction resulting in the
inactivation of an inhibitor of a NAP enzyme reaction. A
non-limiting example of a polypeptide that consumes an inhibitor in
a nucleic acid processing reaction is a heparinase. Heparin is an
inhibitor of polymerase activity, and heparinase enzymes break down
heparin, thereby consuming the inhibitor molecule.
[0040] As used herein, the phrase "polypeptide that modifies a
nucleotide primer or nucleoside triphosphate substrate used in a
nucleic acid processing reaction" means a polypeptide enzyme that
catalyzes a chemical modification of a nucleotide primer or a
nucleoside triphosphate substrate for a NAP enzyme, the
modification permitting the nucleotide primer or nucleoside
triphosphate to participate in a reaction catalyzed by the NAP
enzyme.
[0041] As used herein, the phrase "substrate appendage added to a
nucleotide primer or nucleoside triphosphate" means a chemical
moiety, added to a nucleotide primer or nucleoside triphosphate,
that is acted upon by an enzyme that "modifies a nucleotide primer
or nucleoside triphosphate" as that term is defined herein above.
Most often, such a "substrate portion" is inhibitory to the
activity of a NAP enzyme on that primer or nucleoside
triphosphate.
[0042] As used herein, the phrase "stable interaction" means a
physical interaction between two polypeptides. As the term is used
herein, a "stable interaction" between two polypeptide sequences
fused to respective, separate NAP enzyme subdomain polypeptides is
an interaction that permits the respective NAP enzyme subdomains
that do not alone catalyze a reaction catalyzed by the intact NAP
enzyme to together catalyze a reaction that is catalyzed by the
intact NAP enzyme.
[0043] As used herein, the phrase "subdomain of a NAP enzyme" means
a portion of a NAP enzyme polypeptide, which portion, separate and
on its own does not have catalytic activity, but which, when
brought into physical contact with another polypeptide comprising
another portion of that NAP enzyme, reconstitutes a functional NAP
enzyme capable of catalyzing a reaction catalyzed by the intact NAP
enzyme that is not catalyzed by either portion of the NAP enzyme on
its own. Non-limiting examples of subdomains of a NAP enzyme are
described by Vainshtein et al., 1996, Protein Science 5: 1785.
[0044] As used herein, the phrase "stable interaction of first and
second NAP subdomains generates processing activity" means that the
physical interaction of two separate subdomains of a NAP enzyme, as
the term is defined herein, reconstitutes a catalytic activity of
the intact NAP enzyme that is not possessed by either the first or
second NAP subdomains on their own.
[0045] As used herein, the phrase "subdomain of a polypeptide that
enhances the activity of a NAP enzyme" means a portion of a
polypeptide that, when intact, enhances the activity of a NAP
enzyme. As it is used herein, the "subdomain" of such a polypeptide
is a portion that does not, on its own, enhance the activity of a
NAP enzyme, but when in physical contact with another portion of
that enhancing polypeptide, reconstitutes NAP activity
enhancement.
[0046] As used herein, the phrase "stable folding" means that a
polypeptide assumes a tertiary structure that exhibits a sigmoidal
thermal denaturation curve. A "a non-folded or improperly folded
polypeptide" is non-functional relative to a properly folded
polypeptide and tends to aggregate and precipitate.
[0047] As used herein, the phrase "poorly folding polypeptide"
means a polypeptide that tends to aggregate and precipitate unless
it is permitted to fold in the presence of a chaperone. Fusion of a
"poorly folding polypeptide" will inhibit the activity of a NAP
enzyme unless the fusion polypeptide is folded in the presence of a
chaperone.
[0048] As used herein, the phrase "replication of a nucleic acid
member" means the template-directed addition of at least one
nucleotide to a nucleic acid substrate of a NAP enzyme. That is,
"replication" as the term is used herein encompasses
template-directed replication of an entire nucleic acid molecule,
as well template-directed replication of less than an entire
nucleic acid molecule.
[0049] As used herein, the term "proportional" refers to a direct
numerical relationship between two measurable quantities, such as
the activity of an enzyme and the amount of product of the reaction
catalyzed by that enzyme. The phrase "substantially proportional"
encompasses a proportional relationship between two measurable
quantities as well as a relationship that varies from direct
proportion by 20% or less. For example, where a doubling of the
rate of enzyme activity would result in a doubling of the amount of
product produced per unit time in a directly proportional
relationship (100% increase in each of enzyme activity and product
produced), an increase of 80% to 120% would be considered
"substantially proportional."
[0050] As used herein, the phrase "tagging of the nucleic acid
member" means covalently or non-covalently appending a detectable
moiety to a nucleic acid. Non-limiting examples of tags include
radiolabels, fluorescent moieties, antibodies and stretches of
nucleotide sequence that permit detection with a nucleic acid
probe, antibody, specific binding partner or enzyme.
[0051] As used herein, the phrase "unnatural 3' base" means a
nitrogenous base structure, comprised by the 3' nucleotide of a
nucleic acid, that does not occur on a nucleotide in nature.
[0052] As used herein, the phrase "enhanced capability to replicate
substrates 23 kb in size" means that a mutated replicase enzyme
replicates a substrate 23 kb in size at least 10% more efficiently
than the non-mutated version of that replicase enzyme.
[0053] As used herein, the term "processivity factor" means a
polypeptide that increases the amount of polymerization catalyzed
by a polymerase each time the polymerase initiates. Processivity
factors are well known in the art. Non-limiting examples of
processivity factors include thioredoxin (increases processivity of
bacteriophage T7 polymerase), PCNA (increases processivity of
eukaryotic Pol .delta.) and the .beta. subunit of DNA Pol III
(DnaN; increases the processivity of bacterial Pol III).
BRIEF DESCRIPTION OF THE DRAWINGS
[0054] FIG. 1A is a diagram showing an embodiment of a method
according to the present invention as applied to selection of a
self-evolving polymerase, in which gene copy number is linked to
enzymatic turnover.
[0055] FIG. 1B is a diagram showing a general scheme of
compartmentalised self-replication (CSR): 1) A repertoire of
diversified polymerase genes is cloned and expressed in E. coli.
Spheres represent active polymerase molecules. 2) Bacterial cells
containing the polymerase and encoding gene are suspended in
reaction buffer containing flanking primers and nucleotide
triphosphates (dNTPs) and segregated into aqueous compartments. 3)
The polymerase enzyme and encoding gene are released from the cell
allowing self-replication to proceed. Poorly active polymerases
(white hexagon) fail to replicate their encoding gene. 4) The
"offspring" polymerase genes are released, rediversified and
recloned for another cycle of CSR.
[0056] FIG. 2 is a diagram showing aqueous compartments of the
heat-stable emulsion containing E. coli cells expressing green
fluorescent protein (GFP) prior to (A, B), and after thermocycling
(C), as imaged by light microscopy. (A, B) represent the same
frame. (A) is imaged at 535 nm for GFP fluorescence and (B) in
visible light to visualize bacterial cells within compartments.
Smudging of the fluorescent bacteria in (A) is due to Brownian
motion during exposure. Average compartment dimensions as
determined by laser diffraction are given below.
[0057] FIG. 3A is a diagram showing crossover between emulsion
compartments. Two standard PCR reactions, differing in template
size (PCR1 (0.9 kb), PCR2 (0.3 kb)) and presence of Taq (PCR1:
+Taq, PCR 2: no enzyme), are amplified individually or combined.
When combined in solution, both templates are amplified. When
emulsified separately, prior to mixing, only PCR1 is amplified. M:
.phi.X174 HaeIII marker.
[0058] FIG. 3B is a diagram showing crossover between emulsion
compartments. Bacterial cells expressing wild-type Taq polymerase
(2.7 kb) or the Taq polymerase Stoffel fragment (poorly active
under the buffer conditions) (1.8 kb) are mixed 1:1 prior to
emulsification. In solution, the shorter Stoffel fragment is
amplified preferentially. In emulsion, there is predominantly
amplification of the wt Taq gene and only weak amplification of the
Stoffel fragment (arrow). M: .lamda.HindIII marker.
[0059] FIG. 4 is a diagram showing details of an embodiment of a
method according to the present invention as applied to selection
of a self-evolving polymerase.
[0060] FIG. 5 is a diagram showing details of an embodiment of a
method according to the present invention to select for
incorporation of novel or unusual substrates.
[0061] FIG. 6 is a diagram showing selection of RNA having
(intermolecular) catalytic activity using the methods of our
invention.
[0062] FIG. 7 is a diagram showing a model of a Taq-DNA
complex.
[0063] FIG. 8: A: General scheme of a cooperative CSR reaction.
[0064] Nucleoside diphosphate kinase (ndk) is expressed from a
plasmid and converts deoxinucleoside diphosphates which are not
substrates for Taq polymerase into deoxinucleoside triphosphates
which are. As soon as ndk has produced sufficient amounts of
substrate, Taq can replicate the ndk gene. [0065] B: Bacterial
cells expressing wild-type ndk (0.8 kb) or an inactive truncated
fragment (0.5 kb) are mixed 1:1 prior to emulsification. In
solution, the shorter truncated fragment is amplified
preferentially. In emulsion, there is predominantly amplification
of the wt ndk gene and only weak amplification of the truncated
fragment (arrow) indicating that in emulsion only active ndk genes
producing substrate are amplified. M: HaeIII .phi.X174 marker.
DETAILED DESCRIPTION OF THE INVENTION
[0066] The practice of the present invention will employ, unless
otherwise indicated, conventional techniques of chemistry,
molecular biology, microbiology, recombinant DNA and immunology,
which are within the capabilities of a person of ordinary skill in
the art. Such techniques are explained in the literature. See,
e.g., J. Sambrook, E. F. Fritsch, and T. Maniatis, 1989, Molecular
Cloning: A Laboratory Manual, Second Edition, Books 1-3, Cold
Spring Harbor Laboratory Press; B. Roe, J. Crabtree, and A. Kahn,
1996, DNA Isolation and Sequencing: Essential Techniques, John
Wiley & Sons; J. M. Polak and James O'D. McGee, 1990, In situ
Hybridization: Principles and Practice; Oxford University Press; M.
J. Gait (Editor), 1984, Oligonucleotide Synthesis: A Practical
Approach, Irl Press; and, D. M. J. Lilley and J. E. Dablberg, 1992,
Methods of Enzymology: DNA Structure Part A: Synthesis and Physical
Analysis of DNA Methods in Enzymology, Academic Press. Each of
these general texts are herein incorporated by reference.
Compartmentalised Self Replication
[0067] Our invention describes a novel selection technology, which
we call CSR (compartmentalised self-replication). It has the
potential to be expanded into a generic selection system for
catalysis as well as macromolecular interactions.
[0068] In its simplest form CSR involves the segregation of genes
coding for and directing the production of DNA polymerases within
discrete, spatially separated, aqueous compartments of a novel
heat-stable water-in-oil emulsion. Provided with nucleotide
triphosphates and appropriate flanking primers, polymerases
replicate only their own genes. Consequently, only genes encoding
active polymerases are replicated, while inactive variants that
cannot copy their genes disappear from the gene pool. By analogy to
biological systems, among differentially adapted variants, the most
active (the fittest) produce the most "offspring", hence directly
correlating post-selection copy number with enzymatic turnover.
[0069] CSR is not limited to polymerases but can be applied to a
wide variety of enzymatic transformations, built around the
"replicase engine". For example, an enzyme "feeding" a polymerase
which in turn replicates its gene may be selected. More complicated
coupled cooperative reaction schemes can be envisioned in which
several enzymes either produce replicase substrates or consume
replicase inhibitors.
[0070] Polymerases occupy a central role in genome maintenance,
transmission and expression of genetic information. Polymerases are
also at the heart of modern biology, enabling core technologies
such as mutagenesis, cDNA libraries, sequencing and the polymerase
chain reaction (PCR). However, commonly used polymerases frequently
suffer from serious shortcomings as they are used to perform tasks
for which nature had not optimized them. Indeed, most advances have
been peripheral, including the use of polymerases from different
organisms, improved buffer and additive systems as well as enzyme
blends. CSR is a novel selection system ideally suited for the
isolation of "designer" polymerases for specific applications. Many
features of polymerase function are open to "improvement" (e.g.
processivity, substrate selection etc.). Furthermore, CSR is a tool
to study polymerase function, e.g. to probe immutable regions,
study components of the replisome etc. Moreover, CSR may be used
for shotgun functional cloning of polymerases, straight from
diverse, uncultured microbial populations.
[0071] CSR represents a novel principle of repertoire selection of
polypeptides. Previous approaches have featured various "display"
methods in which phenotype and genotype (polypeptide and encoding
gene) are linked as part of a "genetic package" containing the
encoding gene and displaying the polypeptide on the "outside".
Selection occurs via a step of affinity purification after which
surviving clones are grown (amplified) in cells for further rounds
of selection (with resulting biases in growth distorting
selections). Further distortions result from differences in the
display efficiencies between different polypeptides.
[0072] In another set of methods both polypeptide and encoding
gene(s) are "packaged" within a cell. Selection occurs in vivo
through the polypeptide modifying the cell in such a way that it
acquires a novel phenotype, e.g. growth in presence of an
antibiotic. As the selection pressure is applied on whole cells,
such approaches tend to be prone to the generation of false
positives. Furthermore, in vivo complementation strategies are
limited in that selection conditions, and hence selectable
phenotypes, cannot be freely chosen and are further constrained by
limits of host viability.
[0073] In CSR, there is no direct physical linkage (covalent or
non-covalent) between polypeptide and encoding gene. More copies of
successful genes are "grown" directly and in vitro as part of the
selection process.
[0074] CSR is applicable to a broad spectrum of DNA and RNA
polymerases, indeed to all polypeptides (or polynucleotides)
involved in replication or gene expression. CSR can also be applied
to DNA and RNA ligases assembling their genes from oligonucleotide
fragments.
[0075] CSR is the only selection system in which the turnover rate
of an enzyme is directly linked to the post-selection copy-number
of its encoding gene.
[0076] There is great interest in polynucleotide polymers with
altered bases, altered sugars or even backbone chemistries.
However, solid-phase synthesis can usually only provide relatively
short polymers and naturally occurring polymerases unsurprisingly
incorporate most analogues poorly. CSR is ideally suited for the
selection of polymerases more tolerant of unnatural substrates in
order to prepare polynucleotide polymers with novel properties for
chemistry, biology and nanotechnology (e.g. DNA wires).
[0077] Finally, the heat-stable emulsion developed for CSR has
applications on its own. With >10.sup.9 microcompartments/ml,
emulsion PCR (ePCR) offers the possibility of parallel PCR
multiplexing on a unprecedented scale with potential applications
from gene linkage analysis to genomic repertoire construction
directly from single cells. It may also have applications for
large-scale diagnostic PCR applications like "Digital PCR"
(Vogelstein and Kinzler, 1999, PNAS 96, 9236-9241).
Compartmentalizing individual reactions can also even out
competition among different gene segments that are amplified in
either multiplex or random primed PCR and leads to a less biased
distribution of amplification products. ePCR may thus provide an
alternative to whole genome DOP-PCR (and related methodologies) or
indeed be used to make DOP-PCR (and related methodologies) more
effective.
[0078] The selection system according to our invention is based on
self-replication in a compartmentalised system. Our invention
relies on the fact that active replicases are able to replicate
nucleic acids (in particular their coding sequences), while
inactive replicases cannot. Thus, in the methods of our invention,
we provide a compartmentalised system where a replicase in a
compartment is substantially unable to act on any template other
than the templates within that compartment; in particular, it
cannot act to replicate a template within any other compartment. In
highly preferred embodiments, the template nucleic acid within the
compartment encodes the replicase. Thus, the replicase cannot
replicate anything other than its coding sequence; the replicase is
therefore "linked" to its coding sequence. As a result, in highly
preferred embodiments of our invention, the final concentration of
the coding sequence (i.e. copy number) is dependent on the activity
of the enzyme encoded by it.
[0079] Our selection system as applied to selection of replicases
has the advantage in that it links catalytic turnover
(k.sub.cat/K.sub.m) to the post-selection copy-number of the gene
encoding the catalyst. Thus, compartmentalisation offers the
possibility of linking genotype and phenotype of a replicase
enzyme, as described in further detail below, by a coupled
enzymatic reaction involving the replication of the gene or genes
of the enzyme(s) as one of its steps.
[0080] The methods of our invention preferably make use of nucleic
acid libraries, the nature and construction of which will be
explained in greater detail below. The nucleic acid library
comprises a pool of different nucleic acids, members of that encode
variants of a particular entity (the entity to be selected). Thus,
for example, as used to select for replicases, the methods of our
invention employ a nucleic acid library or pool having members,
which encode the replicase or variants of the replicase. Each of
the entities encoded by the various members of the library will
have different properties, e.g., varying tolerance to heat or to
the presence of inhibitory small molecules, or tolerance for base
pair mismatches (as explained in further detail below). The
population of nucleic acid variants therefore provides a starting
material for selection, and is in many ways analogous to variation
in a natural population of organisms caused by mutation.
[0081] According to our invention, the different members of the
nucleic acid library or pool are sorted or compartmentalised into
many compartments or microcapsules. In preferred embodiments, each
compartment contains substantially one nucleic acid member of the
pool (in one or several copies). In addition, the compartment also
comprises the polypeptide or polynucleotide (in one or preferably
several copies) encoded by that nucleic acid member (whether it is
a replicase, an agent, a polypeptide, etc. as discussed below). The
nature of these compartments is such that minimal or substantially
no interchange of macromolecules (such as nucleic acids and
polypeptides) occurs between different compartments. As explained
in further detail below, highly preferred embodiments of our
invention make use of aqueous compartments within water-in-oil
emulsions. As explained above, any replicase activity present in
the compartment (whether exhibited by the replicase, modified by an
agent, or exhibited by the polypeptide acting in conjunction with
another polypeptide) can only act on the template within the
compartment.
[0082] The conditions within the compartments may be varied in
order to select for polypeptides active under these conditions. For
example, where replicases are selected, the compartments may have
an increased temperature to select for replicases with higher
thermal stability. Furthermore, using the selection methods
described here on fusion proteins comprising thermostable replicase
and a protein of interest will allow the selection of thermally
stable proteins.
[0083] A method for the incorporation of thermal stability into
otherwise labile proteins of commercial importance is desirable
with regards to their large-scale production and distribution. A
reporter system has been described to improve protein folding by
expressing proteins as fusions with green fluorescent protein (GFP)
(Waldo et al., 1999, Nat. Biotechnol. 17, 691-695). The function of
the latter is related to the productive folding of the fused
protein influencing folding and/or functionality of the GFP,
enabling the directed evolution of variants with improved folding
and expression. According to this aspect of our invention, proteins
are fused to a thermostable replicase (or an agent promoting
replicase activity) and selecting for active fusions in emulsion as
a method for evolving proteins with increased thermostability
and/or solubility. Unstable variants of the fusion partner are
expected to aggregate and precipitate prior to or during thermal
cycling, thus compromising replicase activity within respective
compartments. Viable fusions will allow for self-amplification in
emulsion, with the turnover rate being linked to the stability of
the fusion partner.
[0084] In a related approach, novel or increased chaperonin
activity may be evolved by coexpression of a library of chaperones
together with a polymerase-polypeptide fusion protein, in which the
protein moiety misfolds (under the selection conditions).
Replication of the gene(s) encoding the chaperonin can only proceed
after chaperonin activity has rescued polymerase activity in the
polymerase-polypeptide fusion protein.
[0085] Thermostability of an enzyme may be measured by conventional
means as known in the art. For example, the catalytic activity of
the native enzyme may be assayed at a certain temperature as a
benchmark. Enzyme assays are well known in the art, and standard
assays have been established over the years. For example,
incorporation of nucleotides by a polymerase is measured, by for
example, use of radiolabeled dNTPs such as dATP and filter binding
assays as known in the art. The enzyme whose thermostability is to
be assayed is preincubated at an elevated temperature and then its
activity retained (for example, polymerase activity in the case of
polymerases) is measured at a lower, optimum temperature and
compared to the benchmark. In the case of Taq polymerase, the
elevated temperature is 97.5.degree. C.; the optimum temperature is
72.degree. C. Thermostability may be expressed in the form of
half-life at the elevated temperature (i.e. time of incubation at
higher temperature over which polymerase loses 50% of its
activity). For example, the thermostable replicases, fusion
proteins or agents selected by our invention may have a half-life
that is 2.times., 3.times., 4.times., 5.times., 6.times., 7.times.,
8.times., 9.times., 10.times. or more than the native enzyme. Most
preferably, the thermostable replicases etc. have a half-life that
is 11.times. or more when compared this way. Preferably, selected
polymerases are preincubated at 95.degree. C. or more, 97.5.degree.
C. or more, 100.degree. C. or more, 105.degree. C. or more, or
110.degree. C. or more. Thus, in a highly preferred embodiment of
our invention, we provide polymerases with increased
thermostability which display a half life at 97.5.degree. C. that
is 11.times. or more than the corresponding wild-type (native)
enzyme.
[0086] Resistance to an inhibitory agent, such as heparin in the
case of polymerases, may also be assayed and measured as above.
Resistance to inhibition may be expressed in terms of the
concentration of the inhibitory factor. For example, in preferred
embodiments of the invention, we provide heparin resistant
polymerases that are active in up to a concentration of heparin
between 0.083 units/.mu.l to 0.33 units/.mu.l. For comparison, our
assays indicate that the concentration of heparin which inhibits
native (wild-type) Taq polymerase is in the region of between
0.0005 to 0.0026 units/.mu.l.
[0087] Resistance is conveniently expressed in terms of the
inhibitor concentration, which is found to inhibit the activity of
the selected replicase, fusion protein or agent, compared to the
concentration, which is found to inhibit the native enzyme. Thus,
the resistant replicases, fusion proteins, or agents selected by
our invention may have 10.times., 20.times., 30.times., 40.times.,
50.times., 60.times., 70.times., 80.times., 90.times., 100.times.,
110.times., 120.times., 130.times., 140.times., 150.times.,
160.times., 170.times., 180.times., 190.times., 200.times., or more
resistance compared to the native enzyme. Most preferably, the
resistant replicases etc. have 130.times. or more fold increased
resistance when compared this way. The selected replicases etc.
preferably have 50% or more, 60% or more, 70% or more, 80% or more,
90% or more, or even 100% activity at the concentration of the
inhibitory factor. Furthermore, the compartments may contain
amounts of an inhibitory agent such as heparin to select for
replicases having activity under such conditions.
[0088] As explained below, the methods of our invention may be used
to select for a pair of interacting polypeptides, and the
conditions within the compartments may be altered to choose
polypeptides capable of acting under these conditions (for example,
high salt, or elevated temperature, etc.). The methods of our
invention may also be used to select for the folding, stability
and/or solubility of a fused polypeptide acting under these
conditions (for example, high salt, or elevated temperature,
chaotropic agents etc.).
[0089] The method of selection of our present invention may be used
to select for various replicative activities, for example, for
polymerase activity. Here, the replicase is a polymerase, and the
catalytic reaction is the replication by the polymerase of its own
gene. Thus, defective polymerases or polymerases which are inactive
under the conditions under which the reaction is carried out (the
selection conditions) are unable to amplify their own genes.
Similarly, polymerases which are less active will replicate their
coding sequences within their compartments more slowly.
Accordingly, these genes will be under-represented, or even
disappear from the gene pool.
[0090] Active polymerases, on the other hand, are able to replicate
their own genes, and the resulting copy number of these genes will
be increased. In a preferred embodiment of the invention, the copy
number of a gene within the pool will be bear a direct relation to
the activity of the encoded polypeptide under the conditions under
which the reaction is carried out. In this preferred embodiment,
the most active polymerase will be most represented in the final
pool (i.e., its copy number within the pool will be highest). As
will be appreciated, this enables easy cloning of active
polymerases over inactive ones. The method of our invention
therefore is able to directly link the turnover rate of the enzyme
to the resulting copy-number of the gene encoding it.
[0091] As an example, the method may be applied to the isolation of
active polymerases (DNA-, RNA-polymerases and reverse
transcriptases) from thermophilic organisms. Briefly, a
thermostable polymerase is expressed intracellularly in bacterial
cells and these are compartmentalised (e.g. in a water-oil
emulsion) in appropriate buffer together with appropriate amounts
of the four dNTPs and oligonucleotides priming at either end of the
polymerase gene or on plasmid sequences flanking the polymerase
gene. The polymerase and its gene are released from the cells by a
temperature step that lyses the cells and destroys enzymatic
activities associated with the host cell. Polymerases from
mesophilic organisms (or less thermostable polymerases) may be
expressed in an analogous way except cell lysis should either
proceed at ambient temperature (e.g. by expression of a lytic
protein (e.g. derived from lytic bacteriophages, by detergent
mediated lysis (e.g. Bugbuster.TM., commercially available) or
lysis may proceed at elevated temperature in the presence of a
polymerase stabilizing agent (e.g. high concentrations of proline
(see example 27) in the case of Klenow or trehalose in the case of
RT). In such cases background polymerase activity of the host
strain may interfere with selections and it may be preferable to
make use of mutant strains (e.g. polA.sup.-).
[0092] Alternatively, polymerase genes (either as plasmids or
linear fragments) may be compartmentalised as above and the
polymerase expressed in situ within the compartments using in vitro
transcription translation (ivt), followed by a temperature step to
destroy enzymatic activities associated with the in vitro
translation extract. Polymerases from mesophilic organisms (or less
thermostable polymerases) may be expressed in situ in an analogous
way except in order to avoid enzymatic activities associated with
the in vitro translation extract it may be preferable to use a
translation extract reconstituted from defined purified components
like the PURE system (Shimizu et al., 2001, Nat. Biotech. 19,
751).
[0093] PCR thermocycling then leads to the amplification of the
polymerase genes by the polypeptides they encode, i.e. only genes
encoding active polymerases, or polymerases active under the chosen
conditions will be amplified. Furthermore, the copy number of a
polymerase gene X after self-amplification will be directly
proportional to the catalytic activity of the polymerase X it
encodes. (see FIGS. 1A and 1B).
[0094] By varying the selection conditions within the compartment,
polymerases or other replicases with desired properties may be
selected using the methods of our invention. Thus, by exposing
repertoires of polymerase genes (diversified through targeted or
random mutation) to self-amplification and by altering the
conditions under which self-amplification can occur, the system can
be used for the isolation and engineering of polymerases with
altered, enhanced or novel properties. Such enhanced properties may
include increased thermostability, increased processivity,
increased accuracy (better proofreading), increased incorporation
of unfavorable substrates (e.g., ribonucleotides, dye-modified,
general bases such as 5-nitroindole, or other unusual substrates
such as pyrene nucleotides (Matray and Kool, 1999, Nature 399,
704-708) (FIG. 3) or resistance to inhibitors (e.g. Heparin in
clinical samples). Novel properties may be the incorporation of
unnatural substrates (e.g. ribonucleotides), bypass reading of
damaged sites (e.g. abasic sites (Paz-Elizur T. et al., 1997,
Biochemistry 36, 1766), thymidine-dimers (Wood R. D., 1999, Nature
399, 639), hydantoin-bases (Duarte V. et al., 199, Nucleic Acids
Res. 27, 496) and possibly even novel chemistries (e.g. novel
backbones such as PNA (Nielsen P. E., 1999, Curr. Opin. Biotechnol.
10 (1), 71-5) or sulfone (Benner S. A. et al., 1998 Feb., Pure
Appl. Chem. 70 (2), 263-6) or altered sugar chemistries (A.
Eschenmoser, 1999, Science 284, 2118-24)). It may also be used to
isolate or evolve factors that enhance or modify polymerase
function such as processivity factors (like thioredoxin in the case
of T7 DNA polymerase (Doublie S. et al., 1998, Nature 391,
251).
[0095] However, other enzymes besides replicases, such as
telomerases, helicases etc. may also be selected according to our
invention. Thus, telomerase is expressed in situ (in compartments)
by for example in vitro translation together with Telomerase-RNA
(either added or transcribed in situ as well; e.g. Bachand et al.,
2000, RNA 6, 778-784).
[0096] Compartments also contain Taq Pol and dNTPs and telomere
specific primers. At low temperature Taq is inactive but active
telomerase will append telomeres to its own encoding gene (a linear
DNA fragment with appropriate ends). After the telomerase reaction,
thermocycling only amplifies active telomerase encoding genes.
Diversity can be introduced in telomerase gene or RNA (or both) and
could be targeted or random. As applied to selection of helicases,
the selection method is essentially the same as described for
telomerases, but helicase is used to unwind strands rather than
heat denaturation.
[0097] The methods of our invention may also be used to select for
DNA repair enzymes or translesion polymerases such as E. coli Pol
IV and Pol V. Here, damage is introduced into primers (targeted
chemistry) or randomly by mutagen treatment (e.g. UV, mutagenic
chemicals etc.). This allows for selection for enzymes able to
repair primers required for replication or own gene sequence
(information retrieval) or, resulting in improved "repairases" for
gene therapy etc.
[0098] The methods of our invention may also be used in its various
embodiments for selecting agents capable of directly or indirectly
modulating replicase activity. In addition, the invention may be
used to select for a pair of polypeptides capable of interacting,
or for selection of catalytic nucleic acids such as catalytic RNA
(ribozymes). These and other embodiments will be explained in
further detail below.
Nucleic Acid Processing Enzymes
[0099] As referred to herein, a nucleic acid processing enzyme is
any enzyme, which may be a protein enzyme or a nucleic acid enzyme,
which is capable of modifying, extending (such as by at least one
nucleotide), amplifying or otherwise influencing nucleic acids such
as to render the nucleic acid selectable by amplification in
accordance with the present invention. Such enzymes therefore
possess an activity which results in, for example, amplification,
stabilisation, destabilisation, hybridisation or denaturation,
replication, protection or deprotection of nucleic acids, or any
other activity on the basis of which a nucleic acid can be selected
by amplification. Examples include helicases, telomerases, ligases,
recombinases, integrases and replicases. Replicases are
preferred.
Replicase/Replication
[0100] As used here, the term "replication" refers to the
template-dependent copying of a nucleic acid sequence. Nucleic
acids are discussed and exemplified below. In general, the product
of the replication is another nucleic acid, whether of the same
species, or of a different species. Thus, included are the
replication of DNA to produce DNA, replication of DNA to produce
RNA, replication of RNA to produce DNA and replication of RNA to
produce RNA. "Replication" is therefore intended to encompass
processes such as DNA replication, polymerisation, ligation of
oligonucleotides or polynucleotides (e.g. tri-nucleotide (triplet)
5'triphosphates) to form longer sequences, transcription, reverse
transcription, etc.
[0101] The term "replicase" is intended to mean an enzyme having
catalytic activity, which is capable of joining nucleotide,
building blocks together to form nucleic acid sequences. Such
nucleotide building blocks include, but are not limited to,
nucleosides, nucleoside triphosphates, deoxynucleosides,
deoxynucleoside triphosphates, nucleotides (comprising a
nitrogen-containing base such as adenine, guanine, cytosine,
uracil, thymine, etc., a 5-carbon sugar and one or more phosphate
groups), nucleotide triphosphates, deoxynucleotides such as
deoxyadenosine, deoxythymidine, deoxycytidine, deoxyuridine,
deoxyguanidine, deoxynucleotides triphosphates (dNTPs), and
synthetic or artificial analogues of these. Building blocks also
include oligomers or polymers of any of the above, for example,
trinucleotides (triplets), oligonucleotides and
polynucleotides.
[0102] Thus, a replicase may extend a pre-existing nucleic acid
sequence (primer) by incorporating nucleotides or deoxynucleotides.
Such an activity is known in the art as "polymerisation", and the
enzymes, which carry this out, are known as "polymerases". An
example of such a polymerase replicase is DNA polymerase, which is
capable of replicating DNA. The primer may be the same chemically,
or different from, the extended sequence (for example, mammalian
DNA polymerase is known to extend a DNA sequence from an RNA
primer). The term replicase also includes those enzymes which join
together nucleic acid sequences, whether polymers or oligomers to
form longer nucleic acid sequences. Such an activity is exhibited
by the ligases, which ligate pieces of DNA or RNA.
[0103] The replicase may consist entirely of replicase sequence, or
it may comprise a replicase sequence linked to a heterologous
polypeptide or other molecule such as an agent by chemical means or
in the form of a fusion protein or be assembled from two or more
constituent parts.
[0104] Preferably, the replicase according to the invention is a
DNA polymerase, RNA polymerase, reverse transcriptase, DNA ligase,
or RNA ligase.
[0105] Preferably, the replicase is a thermostable replicase. A
"thermostable" replicase as used here is a replicase, which
demonstrates significant resistance to thermal denaturation at
elevated temperatures, typically above body temperature (37.degree.
C.). Preferably, such a temperature is in the range 42.degree. C.
to 160.degree. C., more preferably, between 60 to 100.degree. C.,
most preferably, above 90.degree. C. Compared to a non-thermostable
replicase, the thermostable replicase displays a significantly
increased half-life (time of incubation at elevated temperature
that results in 50% loss of activity). Preferably, the thermostable
replicase retains 30% or more of its activity after incubation at
the elevated temperature, more preferably, 40%, 50%, 60%, 70% or
80% or more of its activity. Yet more preferably, the replicase
retains 80% activity. Most preferably, the activity retained is
90%, 95% or more, even 100%. Non-thermostable replicases would
exhibit little or no retention of activity after similar
incubations at the elevated temperature.
Polymerase
[0106] An example of a replicase is DNA polymerase. DNA polymerase
enzymes are naturally occurring intracellular enzymes, and are used
by a cell to replicate a nucleic acid strand using a template
molecule to manufacture a complementary nucleic acid strand.
Enzymes having DNA polymerase activity catalyze the formation of a
bond between the 3' hydroxyl group at the growing end of a nucleic
acid primer and the 5' phosphate group of a nucleotide
triphosphate. These nucleotide triphosphates are usually selected
from deoxyadenosine triphosphate (A), deoxythymidine triphosphate
(T), deoxycytidine triphosphate (C) and deoxyguanosine triphosphate
(G). However, DNA polymerases may incorporate modified or altered
versions of these nucleotides. The order in which the nucleotides
are added is dictated by base pairing to a DNA template strand;
such base pairing is accomplished through "canonical"
hydrogen-bonding (hydrogen-bonding between A and T nucleotides and
G and C nucleotides of opposing DNA strands), although
non-canonical base pairing, such as G:U base pairing, is known in
the art. See e.g., Adams et al., The Biochemistry of the Nucleic
Acids 14-32 (11th ed. 1992). The in-vitro use of enzymes having DNA
polymerase activity has in recent years become more common in a
variety of biochemical applications including cDNA synthesis and
DNA sequencing reactions (see Sambrook et al., (2nd ed. Cold Spring
Harbor Laboratory Press, 1989) hereby incorporated by reference
herein), and amplification of nucleic acids by methods such as the
polymerase chain reaction (PCR) (Mullis et al., U.S. Pat. Nos.
4,683,195, 4,683,202, and 4,800,159, hereby incorporated by
reference herein) and RNA transcription-mediated amplification
methods (e.a., Kacian et al., PCT Publication No. WO91/01384).
[0107] Methods such as PCR make use of cycles of primer extension
through the use of a DNA polymerase activity, followed by thermal
denaturation of the resulting double-stranded nucleic acid in order
to provide a new template for another round of primer annealing and
extension. Because the high temperatures necessary for strand
denaturation result in the irreversible inactivations of many DNA
polymerases, the discovery and use of DNA polymerases able to
remain active at temperatures above about 37.degree. C. to
42.degree. C. (thermostable DNA polymerase enzymes) provides an
advantage in cost and labor efficiency. Thermostable DNA
polymerases have been discovered in a number of thermophilic
organisms including, but not limited to Thermus aquaticus, Thermus
thermophilus, and species of the Bacillus, Thermococcus,
Sulfolobus, Pyrococcus genera. DNA polymerases can be purified
directly from these thermophilic organisms. However, substantial
increases in the yield of DNA polymerase can be obtained by first
cloning the gene encoding the enzyme in a multicopy expression
vector by recombinant DNA technology methods, inserting the vector
into a host cell strain capable of expressing the enzyme, culturing
the vector-containing host cells, then extracting the DNA
polymerase from a host cell strain which has expressed the
enzyme.
[0108] The bacterial DNA polymerases that have been characterized
to date have certain patterns of similarities and differences which
has led some to divide these enzymes into two groups: those whose
genes contain introns/inteins (Class B DNA polymerases), and those
whose DNA polymerase genes are roughly similar to that of E. coli
DNA polymerase I and do not contain introns (Class A DNA
polymerases).
[0109] Several Class A and Class B thermostable DNA polymerases
derived from thermophilic organisms have been cloned and expressed.
Among the class A enzymes: Lawyer et al., 1989, J. Biol. Chem. 264,
6427-6437, and Gelfund et al., U.S. Pat. No. 5,079,352, report the
cloning and expression of a full length thermostable DNA polymerase
derived from Thermus aquaticus (Taq). Lawyer et al., 1993, PCR
Methods and Applications 2, 275-287, and Barnes, PCT Publication
No. WO92/06188 (1992), disclose the cloning and expression of
truncated versions of the same DNA polymerase, while Sullivan, EPO
Publication No. 0482714A1 (1992), reports cloning a mutated version
of the Taq DNA polymerase. Asakura et al., 1993, J. Ferment.
Bioeng. (Japan) 74, 265-269, have reportedly cloned and expressed a
DNA polymerase from Thermus thermophilus. Gelfund et al., PCT
Publication No. WO92/06202 (1992), have disclosed a purified
thermostable DNA polymerase from Thermosipho africanus. A
thermostable DNA polymerase from Thermus flavus is reported by
Akhmetzjanov and Vakhitov, 1992, Nucleic Acids Res. 20, 5839.
Uemori et al., 1993, J. Biochem. 113, 401-410 and EPO Publication
No. 0517418A2 (1992) have reported cloning and expressing a DNA
polymerase from the thermophilic bacterium Bacillus caldotenax.
Ishino et al., Japanese Patent Application No. HEI 4[1992]-1 31400
(publication date Nov. 19, 1993) report cloning a DNA polymerase
from Bacillus stearothermophilus. Among the Class B enzymes: A
recombinant thermostable DNA polymerase from Thermococcus litoralis
is reported by Comb et al., EPO Publication No. 0 455 430 A3
(1991), Comb et al., EPO Publication No. 0547920A2 (1993), and
Perler et al., 1992, Proc. Natl. Acad. Sci. USA 89, 5577-5581. A
cloned thermostable DNA polymerase from Sulfolobus solofatarius is
disclosed in Pisani et al., 1992, Nucleic Acids Res. 20, 2711-2716
and in PCT Publication WO93/25691 (1993). The thermostable enzyme
of Pyrococcus furiosus is disclosed in Uemori et al., 1993, Nucleic
Acids Res. 21, 259-265, while a recombinant DNA polymerase is
derived from Pyrococcus sp. as disclosed in Comb et al., EPO
Publication No. 0547359A1 (1993).
[0110] Many thermostable DNA polymerases possess activities
additional to a DNA polymerase activity; these may include a 5'-3'
exonuclease activity and/or a 3'-5' exonuclease activity. The
activities of 5'-3' and 3'-5' exonucleases are well known to those
of ordinary skill in the art. The 3'-5' exonuclease activity
improves the accuracy of the newly-synthesized strand by removing
incorrect bases that may have been incorporated; DNA polymerases in
which such activity is low or absent, reportedly including Taq DNA
polymerase (see Lawyer et al., J. Biol. Chem. 264, 6427-6437), have
elevated error rates in the incorporation of nucleotide residues
into the primer extension strand. In applications such as nucleic
acid amplification procedures in which the replication of DNA is
often geometric in relation to the number of primer extension
cycles, such errors can lead to serious artifactual problems such
as sequence heterogeneity of the nucleic acid amplification product
(amplicon). Thus, a 3'-5' exonuclease activity is a desired
characteristic of a thermostable DNA polymerase used for such
purposes.
[0111] By contrast, the 5'-3' exonuclease activity often present in
DNA polymerase enzymes is often undesired in a particular
application since it may digest nucleic acids, including primers,
that have an unprotected 5' end. Thus, a thermostable DNA
polymerase with an attenuated 5'-3' exonuclease activity, or in
which such activity is absent, is also a desired characteristic of
an enzyme for biochemical applications. Various DNA polymerase
enzymes have been described where a modification has been
introduced in a DNA polymerase, which accomplishes this object. For
example, the Klenow fragment of E. coli DNA polymerase I can be
produced as a proteolytic fragment of the holoenzyme in which the
domain of the protein controlling the 5'-3' exonuclease activity
has been removed. The Klenow fragment still retains the polymerase
activity and the 3'-5' exonuclease activity. Barnes, supra, and
Gelfund et al., U.S. Pat. No. 5,079,352 have produced 5'-3'
exonuclease-deficient recombinant Taq DNA polymerases. Ishino et
al., EPO Publication No. 0517418A2, have produced a 5'-3'
exonuclease-deficient DNA polymerase derived from Bacillus
caldotenax. On the other hand, polymerases lacking the 5'-3'
exonuclease domain often have reduced processivity.
Ligase
[0112] DNA strand breaks and gaps are generated transiently during
replication, repair and recombination. In mammalian cell nuclei,
rejoining of such strand breaks depends on several different DNA
polymerases and DNA ligase enzymes. The mechanism for joining of
DNA strand interruptions by DNA ligase enzymes has been widely
described. The reaction is initiated by the formation of a covalent
enzyme-adenylate complex. Mammalian and viral DNA ligase enzymes
employ ATP as cofactor, whereas bacterial DNA ligase enzymes use
NAD to generate the adenylyl group. In the case of ATP-utilising
ligases, the ATP is cleaved to AMP and pyrophosphate with the
adenylyl residue linked by a phosphoramidate bond to the
.epsilon.-amino group of a specific lysine residue at the active
site of the protein (Gumport, R. I. et al., 1971, PNAS 68,
2559-63). Reactivated AMP residue of the DNA ligase-adenylate
intermediate is transferred to the 5' phosphate terminus of a
single strand break in double stranded DNA to generate a covalent
DNA-AMP complex with a 5'-5' phosphoanhydride bond. This reaction
intermediate has also been isolated for microbial and mammalian DNA
ligase enzymes, but is shorter lived than the adenylylated enzyme.
In the final step of DNA ligation, unadenylylated DNA ligase
enzymes required for the generation of a phosphodiester bond
catalyze displacement of the AMP residue through attack by the
adjacent 3'-hydroxyl group on the adenylylated site.
[0113] The occurrence of three different DNA ligase enzymes, DNA
Ligase I, II and III, is established previously by biochemical and
immunological characterization of purified enzymes (Tonikinson, A.
E. et al., 1991, J. Biol. Chem. 266, 21728-21735, and Roberts, E.
et al., 1994, J. Biol. Chem. 269, 3789-3792).
Amplification
[0114] The methods of our invention involve the templated
amplification of desired nucleic acids. "Amplification" refers to
the increase in the number of copies of a particular nucleic acid
fragment (or a portion of this) resulting either from an enzymatic
chain reaction (such as a polymerase chain reaction, a ligase chain
reaction, or a self-sustained sequence replication) or from the
replication of all or part of the vector into which it has been
cloned. Preferably, the amplification according to our invention is
an exponential amplification, as exhibited by for example the
polymerase chain reaction.
[0115] Many target and signal amplification methods have been
described in the literature, for example, general reviews of these
methods in Landegren, U. et al., 1988, Science 242, 229-237, and
Lewis, R., 1990, Genetic Engineering News 10:1, 54-55. These
amplification methods may be used in the methods of our invention,
and include polymerase chain reaction (PCR), PCR in situ, ligase
amplification reaction (LAR), ligase hybridization, Q bacteriophage
replicase, transcription-based amplification system (TAS), genomic
amplification with transcript sequencing (GAWTS), nucleic acid
sequence-based amplification (NASBA) and in situ hybridization.
[0116] Polymerase Chain Reaction (PCR)
[0117] PCR is a nucleic acid amplification method described inter
alia in U.S. Pat. Nos. 4,683,195 and 4,683,202. PCR consists of
repeated cycles of DNA polymerase generated primer extension
reactions. The target DNA is heat denatured and two
oligonucleotides, which bracket the target sequence on opposite
strands of the DNA to be amplified, are hybridized. These
oligonucleotides become primers for use with DNA polymerase. The
DNA is copied by primer extension to make a second copy of both
strands. By repeating the cycle of heat denaturation, primer
hybridization and extension, the target DNA can be amplified a
million fold or more in about two to four hours. PCR is a molecular
biology tool, which must be used in conjunction with a detection
technique to determine the results of amplification. An advantage
of PCR is that it increases sensitivity by amplifying the amount of
target DNA by 1 million to 1 billion fold in approximately 4
hours.
[0118] The polymerase chain reaction may be used in the selection
methods of our invention as follows. For example, PCR may be used
to select for variants of Taq polymerase having polymerase
activity. As described in further detail above, a library of
nucleic acids each encoding a replicase or a variant of the
replicase, for example, Taq polymerase, is generated and subdivided
into compartments. Each compartment comprises substantially one
member of the library together with the replicase or variant
encoded by that member.
[0119] The polymerase or variant may be expressed in vivo within a
transformed bacterium or any other suitable expression host, for
example yeast or insect or mammalian cells, and the expression host
encapsulated within a compartment. Heat or other suitable means is
applied to disrupt the host and to release the polymerase variant
and its encoding nucleic acid within the compartment. In the case
of a bacterial host, timed expression of a lytic protein, for
example protein E from .PHI.X174, or use of an inducible .lamda.
lysogen, may be employed for disrupting the bacterium.
[0120] It will be clear that the polymerase or other enzyme need
not be a heterologous protein expressed in that host (e.g., a
plasmid), but maybe expressed from a gene forming part of the host
genome. Thus, the polymerase may be for example an endogenous or
native bacterial polymerase. We have shown that in the case of
nucleotide diphosphate kinase (ndk), endogenous (uninduced)
expression of ndk is sufficient to generate dNTPs for its own
replication. Thus, the methods of selection according to our
invention may be employed for the direct functional cloning of
polymerases and other enzymes from diverse (and uncultured)
microbial populations.
[0121] Alternatively, the nucleic acid library may be
compartmentalised together with components of an in vitro
transcription/translation system (as described in further detail in
this document), and the polymerase variant expressed in vitro
within the compartment.
[0122] Each compartment also comprises components for a PCR
reaction, for example, nucleotide triphosphates (dNTPs), buffer,
magnesium, and oligonucleotide primers. The oligonucleotide primers
may have sequences corresponding to sequences flanking the
polymerase gene (i.e., within the genomic or vector DNA) or to
sequences within the polymerase gene. PCR thermal cycling is then
initiated to allow any polymerase variant having polymerase
activity to amplify the nucleic acid sequence.
[0123] Active polymerases will amplify their corresponding nucleic
acid sequences, while nucleic acid sequences encoding weakly active
or inactive polymerases will be weakly replicated or not be
replicated at all. In general, the final copy number of each member
of the nucleic acid library will be expected to be proportional to
the level of activity of the polymerase variant encoded by it.
Nucleic acids encoding active polymerases will be over-represented,
and nucleic acids encoding inactive or weakly active polymerases
will be under-represented. The resulting amplified sequences may
then be cloned and sequenced, etc., and replication ability of each
member assayed.
[0124] As described in further detail elsewhere, the conditions
within each compartment may be altered to select for polymerases
active under these conditions. For example, heparin may be added to
the reaction mix to choose polymerases, which are resistant to
heparin. The temperature at which PCR takes place may be elevated
to select for heat resistant variants of polymerase. Furthermore,
polymerases may be selected which are capable of extending DNA
sequences such as primers with altered 3' ends or altered parts of
the primer sequence. The altered 3' ends or other alterations can
include unnatural bases (altered sugar or base moieties), modified
bases (e.g. blocked 3' ends) or even primers with altered backbone
chemistries (e.g. PNA primers).
[0125] Reverse Transcriptase-PCR
[0126] RT-PCR is used to amplify RNA targets. In this process, the
reverse transcriptase enzyme is used to convert RNA to
complementary DNA (cDNA), which can then be amplified using PCR.
This method has proven useful for the detection of RNA viruses.
[0127] The methods of our invention may employ RT-PCR. Thus, the
pool of nucleic acids encoding the replicase or its variants may be
provided in the form of an RNA library. This library could be
generated in vivo in bacteria, mammalian cells, yeast etc., which
are compartmentalised, or by in-vitro transcription of
compartmentalised DNA. The RNA could encode a co-compartmentalised
replicase (e.g. reverse transcriptase or polymerase) that has been
expressed in vivo (and released in emulsion along with the RNA by
means disclosed below) or in vitro. Other components necessary for
amplification (polymerase and/or reverse transcriptase, dNTPs,
primers) are also compartmentalised. Under given selection
pressure(s), the cDNA product of the reverse transcription reaction
serves as a template for PCR amplification. As with other
replication reactions (in particular ndk in the Examples) the RNA
may encode a range of enzymes feeding the reaction.
[0128] Self-Sustained Sequence Replication (3SR)
[0129] Self-sustained sequence replication (3SR) is a variation of
TAS, which involves the isothermal amplification of a nucleic acid
template via sequential rounds of reverse transcriptase (RT),
polymerase and nuclease activities that are mediated by an enzyme
cocktail and appropriate oligonucleotide primers (Guatelli et al.,
1990, Proc. Natl. Acad. Sci. USA 87, 1874). Enzymatic degradation
of the RNA of the RNA/DNA heteroduplex is used instead of heat
denaturation. RNAse H and all other enzymes are added to the
reaction and all steps occur at the same temperature and without
further reagent additions. Following this process, amplifications
of 10.sup.6 to 10.sup.9 have been achieved in one hour at
42.degree. C.
[0130] The methods of our invention may therefore be extended to
select polymerases or replicases from mesophilic organisms using
3SR isothermal amplification (Guatelli et al., 1990, Proc. Natl.
Acad. Sci. USA 87, 7797; Compton, 1991, Nature 7:350, 91-92)
instead of PCR thermocycling. As described above, 3SR involves the
concerted action of two enzymes: an RNA polymerases as well as a
reverse transcriptase cooperate in a coupled reaction of
transcription and reverse transcription, leading to the
simultaneous amplification of both RNA and DNA. Clearly, in this
system self-amplification may be applied to either of the two
enzymes involved or to both simultaneously. It may also include the
evolution of the RNAse H activity either as part of the reverse
transcriptase enzyme (e.g. HIV-1 RT) or on its own.
[0131] The various enzymatic activities that define 3SR and related
methods are all targets for selection using the methods of our
invention. Variants of either T7 RNA polymerase, reverse
transcriptase (RT), or RNAse H can be provided within the aqueous
compartments of the emulsions, and selected for under otherwise
limiting conditions. These variants can be introduced via E. coli
"gene pellets" (i.e., bacteria express the polypeptide), or other
means as described else where in this document. Initial release in
emulsion may be mediated by enzymatic (for example, lambda lysogen)
or thermal lysis, or other methods as disclosed here. The latter
may necessitate the use of agents that stabilize enzymatic activity
at transiently elevated temperatures. For example, it may be
necessary to include amounts of proline, glycerol, trehalose or
other stabilising agents as known in the art to effect
stabilisation of thermosensitive enzymes such as reverse
transcriptase. Furthermore, stepwise removal of the agent may be
undertaken to select for increased stability of the thermosensitive
enzyme.
[0132] Alternatively, and as disclosed elsewhere, variants may be
produced via coupled transcription translation, with the expressed
products feeding into the 3SR cycle.
[0133] It will also be appreciated that it is possible to replace
reverse transcriptase with the thermostable Tth DNA polymerase. Tth
DNA polymerase is known to have reverse transcriptase activity and
the RNA template is effectively reverse-transcribed into template
DNA using this enzyme. It is therefore possible to select for
useful variants of this enzyme, by for example, introducing
bacterially expressed T7 RNA polymerase variants into emulsion and
preincubation at an otherwise non-permissive temperature.
[0134] Example 18 below is an example showing one way in which the
methods of our invention may be applied to selection of replicases
using self-sustained sequence replication (3SR).
[0135] Ligation Amplification (LAR/LAS)
[0136] Ligation amplification reaction or ligation amplification
system uses DNA ligase and four oligonucleotides, two per target
strand. This technique is described by Wu, D. Y. and Wallace, R.
B., 1989, Genomics 4, 560. The oligonucleotides hybridize to
adjacent sequences on the target DNA and are joined by the ligase.
The reaction is heat denatured and the cycle repeated.
[0137] By analogy to the application to polymerases, our method may
be applied to ligases in particular from thermophilic organisms.
Oligonucleotides complementary to one strand of the ligase gene
sequence are synthesized (either as perfect match or comprising
targeted or random diversity). The two end oligos overlap into the
vector or untranslated regions of the ligase gene. The ligase gene
is either cloned for expression in an appropriate host and
compartmentalized together with the oligonucleotides and an
appropriate energy source (usually ATP (or NADPH)). If necessary,
the ligase expressed as above in bacteria is released from the
cells by thermal lysis. Compartments contain appropriate buffer
together with appropriate amounts of an appropriate energy source
(ATP or NADH) and oligonucleotides encoding the whole of the ligase
gene as well as flanking sequences required for cloning. Ligation
of oligonucleotides leads to assembly of a full-length ligase gene
(templated by the ligase gene on the expression plasmid) by an
active ligase. In compartments containing an inactive ligase, no
assembly will take place. As with polymerases, the copy number of a
ligase gene X after self-ligation will preferably be proportional
to the catalytic activity under the selection conditions of the
ligase X it encodes.
[0138] After lysis of the cell, thermocycling leads to annealing of
the oligonucleotides to the ligase gene. However, ligation of the
oligos and thus assembly of the full-length ligase gene depends on
the presence of an active ligase in the same compartment. Thus only
genes encoding active ligases will assemble their own encoding
genes from the present oligonucleotides. Assembled genes can then
be amplified, diversified and recloned for another round of
selection if necessary. The methods of our invention are therefore
suitable for the selection of ligases, which are faster or more
efficient at ligation.
[0139] As noted elsewhere, the ligase can be produced either in
situ by expression from a suitable bacterial or other host, or by
in vitro translation. The ligase may be an oligonucleotide (e.g.
ribo or deoxiribozyme) ligase assembling its own sequence from
available fragments, or the ligase may be a conventional
(polypeptide) ligase. The length of the oligonucleotides will
depend on the particular reaction, but if necessary, they can be
very short (e.g. triplets). As noted elsewhere, the method of our
invention may be used to select for an agent capable of modulating
ligase activity, either directly or indirectly. For example, the
gene to be evolved may be another enzyme or enzymes that generates
a substrate for the ligase (e.g. NADH) or consumes an inhibitor. In
this case the oligonucleotides encode parts of the other enzyme or
enzymes etc.
[0140] The ligation reaction between oligonucleotides may
incorporate alternative chemistries e.g. amide linkages. As long as
the chemical linkages do not interfere with templated copying of
the opposite strand by any replicase (e.g. reverse transcriptase),
a wide variety of linkage chemistries and ligases that catalyse it
may be evolved.
[0141] Q.beta. Replicase
[0142] In this technique, RNA replicase for the bacteriophage
Q.beta., which replicates single-stranded RNA, is used to amplify
the target DNA, as described by Lizardi et al., 1988, Bio.
Technology 6, 1197. First, the target DNA is hybridized to a primer
including a T7 promoter and a Q.beta. 5' sequence region. Using
this primer, reverse transcriptase generates a cDNA connecting the
primer to its 5' end in the process. These two steps are similar to
the TAS protocol. The resulting heteroduplex is heat denatured.
Next, a second primer containing a Q.beta. 3' sequence region is
used to initiate a second round of cDNA synthesis. This results in
a double stranded DNA containing both 5' and 3' ends of the Q.beta.
bacteriophage as well as an active T7 RNA polymerase binding site.
T7 RNA polymerase then transcribes the double-stranded DNA into new
RNA, which mimics the Q.beta.. After extensive washing to remove
any unhybridized probe, the new RNA is eluted from the target and
replicated by Q.beta. replicase. The latter reaction creates
10.sup.7 fold amplification in approximately 20 minutes.
Significant background may be formed due to minute amounts of probe
RNA that is non-specifically retained during the reaction.
[0143] A reaction employing Q.beta. replicase as described above
may be used to build a continuous selection reaction in an
alternative embodiment according to our invention.
[0144] For example, the gene for Q.beta. replicase (with
appropriate 5' and 3' regions) is added to an in vitro translation
reaction and compartmentalised. In compartments, the replicase is
expressed and immediately starts to replicate its own gene. Only
genes encoding an active replicase replicate themselves.
Replication proceeds until NTPs are exhausted. However, as NTPs can
be made to diffuse through the emulsion (see the description of ndk
in the Examples), the replication reaction may be "fed" from the
outside and proceed much longer, essentially until there is no room
left within the compartments for further replication. It is
possible to propagate the reaction further by serial dilution of
the emulsion mix into a fresh oil-phase and re-emulsification after
addition of a fresh water-phase containing NIPs. Q.beta. replicase
is known to be very error-prone, so replication alone will
introduce lots of random diversity (which may be desirable). The
methods described here allow the evolution of more specific (e.g.
primer dependent) forms of Q.beta.-replicase. As with other
replication reactions (in particular ndk in the Examples) a range
of enzymes feeding the reaction may be evolved.
[0145] Other Amplification Techniques
[0146] Alternative amplification technology may be exploited in the
present invention. For example, rolling circle amplification
(Lizardi et al., 1998, Nat. Genet. 19, 225) is an amplification
technology available commercially (RCAT.TM.) which is driven by DNA
polymerase and can replicate circular oligonucleotide probes with
either linear or geometric kinetics under isothermal
conditions.
[0147] In the presence of two suitably designed primers, a
geometric amplification occurs via DNA strand displacement and
hyperbranching to generate 10.sup.12 or more copies of each circle
in 1 hour.
[0148] If a single primer is used, RCAT generates in a few minutes
a linear chain of thousands of tandemly linked DNA copies of a
target covalently linked to that target.
[0149] A further technique, strand displacement amplification (SDA;
Walker et al., 1992 PNAS (USA) 80, 392) begins with a specifically
defined sequence unique to a specific target. But unlike other
techniques which rely on thermal cycling, SDA is an isothermal
process that utilizes a series of primers, DNA polymerase and a
restriction enzyme to exponentially amplify the unique nucleic acid
sequence.
[0150] SDA comprises both a target generation phase and an
exponential amplification phase.
[0151] In target generation, double-stranded DNA is heat denatured
creating two single-stranded copies. A series of specially
manufactured primers combine with DNA polymerase (amplification
primers for copying the base sequence and bumper primers for
displacing the newly created strands) to form altered targets
capable of exponential amplification.
[0152] The exponential amplification process begins with altered
targets (single-stranded partial DNA strands with restricted enzyme
recognition sites) from the target generation phase.
[0153] An amplification primer is bound to each strand at its
complimentary DNA sequence. DNA polymerase then uses the primer to
identify a location to extend the primer from its 3' end, using the
altered target as a template for adding individual nucleotides. The
extended primer thus forms a double-stranded DNA segment containing
a complete restriction enzyme recognition site at each end.
[0154] A restriction enzyme is then bound to the double stranded
DNA segment at its recognition site. The restriction enzyme
dissociates from the recognition site after having cleaved only one
strand of the double-sided segment, forming a nick. DNA polymerase
recognizes the nick and extends the strand from the site,
displacing the previously created strand. The recognition site is
thus repeatedly nicked and restored by the restriction enzyme and
DNA polymerase with continuous displacement of DNA strands
containing the target segment.
[0155] Each displaced strand is then available to anneal with
amplification primers as above. The process continues with repeated
nicking, extension and displacement of new DNA strands, resulting
in exponential amplification of the original DNA target.
Selection of Catalytic RNA
[0156] Known methods of in-vitro evolution have been used to
generate catalytically active RNA molecules (ribozymes) with a
diverse range of activities. However, these have involved selection
by self-modification, which inherently isolates variants that rely
on proximity catalysis and which display reduced activities in
trans.
[0157] Compartmentalisation affords a means to select for truly
trans-acting ribozymes capable of multiple turnover, without the
need to tether substrate to the ribozyme by covalent linkage or
hydrogen-bonding (i.e., base-pairing) interactions.
[0158] In its simplest case, a gene encoding a ribozyme can be
introduced into emulsion and readily transcribed as demonstrated by
the transcription and the 3SR amplification of the RNA encoding Taq
polymerase in situ as follows: The Taq polymerase gene is first
transcribed in emulsion. 100 .mu.l of a reaction mix comprising 80
mM HEPES-KOH (pH 7.5), 24 mM MgCl.sub.2, 2 mM spermidine, 40 mM
DTT, rNTPs (30 mM), 50 ng T7-Taq template (see Example 18.
Selection Using Self-Sustained Sequence Replication (3SR)), 60
units T7 RNA polymerase (USB), 40 units RNAsin (Promega) is
emulsified using the standard protocol. Emulsions are incubated at
37.degree. C. for up to 6 hours and analysis of reaction products
by gel electrophoresis showed levels of RNA production to be
comparable to those of the non-emulsified control.
[0159] By creating a 5' overhang (e.g. by ligation of either DNA or
RNA adaptors) in the emulsified gene, RNA variants are selected for
with the ability of carrying out the template directed addition of
successive dNTPs in trans (i.e. polymerase activity, see FIG. 6).
Genes that have been "filled-in" may be rescued by PCR using
primers complimentary to the single-stranded region of the gene
(i.e., the region, which is single stranded prior to ribozyme
fill-in) or by capture of biotin (or otherwise) modified
nucleotides that are incorporated followed by PCR. In compartments
without catalytic RNA activity, this region remains single
stranded, and PCR will fail to amplify the template (alternatively
no nucleotides are incorporated and the template is not captured
but washed away).
[0160] A coupling approach can also be used to further extend the
range of enzymatic activities that could be selected for. For
example, co-emulsification of a DNA polymerase with the gene
described above (5' overhang) can be used to select for ribozymes
that convert an otherwise unsuitable NTP substrate into one that
can be utilised by the polymerase. As before, the "filled-in" gene
can then be rescued by PCR. The above approach can also be used to
select for protein polymerase enzyme produced in-situ from a
similar template (i.e. with 3' overhang). A diagram showing the
selection of RNA having catalytic activity is shown as FIG. 6.
Selection of Agents Capable of Modifying Replicase Activity
[0161] In another embodiment, our invention is used to select for
an agent capable of modifying the activity of a replicase. In this
embodiment, a pool of nucleic acids is generated comprising members
encoding one or more candidate agents. Members of the nucleic acid
library are compartmentalised together with a replicase (which, as
explained above, is able only to act on the nucleic acid encoding
the agent).
[0162] The candidate agents may be functionally or chemically
distinct from each other, or they may be variants of an agent known
or suspected to be capable of modulating replicase activity.
Members of the pool are then segregated into compartments together
with the polypeptides or polynucleotides encoded by them, so that
preferably each compartment comprises a single member of the pool
together with its cognate encoded polypeptide. Each compartment
also comprises one or more molecules of the replicase. Thus, the
encoded polypeptide agent is able to modulate the activity of the
replicase, to prevent or enhance replication of the
compartmentalised nucleic acid (i.e., the nucleic acid encoding the
agent). In this way, the polypeptide agent is able to act via the
replicase to increase or decrease the number of molecules of its
encoding nucleic acid. In a highly preferred embodiment of the
invention, the agent is capable of enhancing replicase activity, to
enable detection or selection of the agent by detecting the
encoding nucleic acid.
[0163] The modulating agent may act directly or indirectly on the
replicase. For example, the modulating agent may be an enzyme
comprising an activity, which acts on the replicase molecule, for
example, by a post-translational modification of replicase, to
activate or inactivate the replicase. The agent may act by taking
off or putting on a ligand from the replicase molecule. It is known
that many replicases such as polymerases and ligases are regulated
by phosphorylation, so that in preferred embodiments the agent
according to the invention is a kinase or a phosphorylase. The
modulating agent may also directly interact with the replicase and
modify its properties (e.g. Thioredoxin & T7-DNA polymerase,
members of the replisome e.g. clamp, helicase etc. with DNA
polymerase III).
[0164] Alternatively, the modulating agent may exert its effects on
the replicase in an indirect manner. For example, modulation of
replicase activity may take place via a third body, which third
body is modified by the modulating agent, for example as described
above.
[0165] Furthermore, the modulating agent may be an enzyme, which
forms part of a pathway, which produces as an end product a
substrate for the replicase. In this embodiment, the modulating
agent is involved in the synthesis of an intermediate (or the end
product) of the pathway. Accordingly, the rate of replication (and
hence the amount of nucleic acid encoding the agent) is dependent
on the activity of the modulating agent.
[0166] For example, the modulating agent may be a kinase that is
involved in the biosynthesis of bases, deoxyribonucleosides,
deoxyribonucleotides such as dAMP, dCMP, dGMP and dTMP,
deoxyribonucleoside diphosphates (such as dADP, dCDP, dCTP and
dTDP), deoxyribonucleoside triphosphates such as dATP, dCTP, dGTP
or dTTP, or nucleosides, nucleotides such as AMP, CMP, GMP and UMP,
nucleoside diphosphates (such as ADP, CDP, CTP and UDP), nucleoside
triphosphates such as ATP, CTP, GTP or UTP, etc. The modulating
agent may be involved in the synthesis of other intermediates in
the biosynthesis of nucleotides (as described and well known from
biochemical textbooks such as Stryer or Lehninger), such as IMP,
5-phospho-.alpha.-D-ribose-1-pyrophosphoric acid,
5-phospho-.beta.-D-ribossylamine, 5-phosphoribosyl-glycinamide,
5-phosphoribosyl-N-formylglycinamide, etc. Thus, the agent may
comprise an enzyme such as ribosephosphate pyrophosphokinase,
phosphoribosylglycinamide synthetase, etc. Other examples of such
agents will be apparent to those skilled in the art. The methods of
our invention allow the selection of such agents with improved
catalytic activity.
[0167] In yet another embodiment, the modulator functions to
"unblock" a constituent of the replication cocktail (primers, dNTP,
replicase etc.). An example of a blocked constituent would be a
primer or dNTP with a chemical moiety attached that inhibits the
replicase used in the CSR cycle. Alternatively, the pair of primers
used could be covalently tethered by a linking agent, with cleavage
of the agent by the modulator allowing both primers to amplify its
gene in the presence of supplemented replicase. An example of a
linking agent would be a peptide nucleic acid (PNA). Additionally,
by designing a large oligonucleotide that encodes a pair of primer
sequences interspersed by target nucleotide sequence, novel
site-specific restriction enzymes could be evolved. As before, the
rate of replication (and hence the amount of nucleic acid encoding
the agent) is dependent on the activity of the modulating agent.
Alternatively the modulator can modify the 5' end a primer such
that amplification products incorporating the primer can be
captured by a suitable agent (e.g. antibody) and thus enriched and
reamplified.
[0168] In a further embodiment, the scope of CSR may be further
broadened to select for agents that are not necessarily
thermostable. Delivery vehicles (e.g. E. coli) containing
expression constructs that encode a secretable form of a
modulator/replicase of interest are compartmentalised. Inclusion of
an inducing agent in the aqueous phase and incubation at permissive
temperature (e.g. 37.degree. C.) allows for expression and
secretion of the modulator/replicase into the compartment.
Sufficient time is then allowed for the modulator to act in any of
the aforementioned ways to facilitate subsequent amplification of
the gene encoding it (e.g. consume an inhibitor of replication).
The ensuing temperature change during the amplification process
serves to rid the compartment of host cell enzymatic activities
(that have up to this point been segregated from the aqueous phase)
and release the encoding gene for amplification.
[0169] Thus, according to an embodiment of our invention, we
provide a method of selecting a polypeptide involved in a pathway
which has as an end product a substrate which is involved in a
replication reaction ("a pathway polypeptide"), the method
comprising the steps of: (a) providing a replicase; (b) providing a
pool of nucleic acids comprising members each encoding a pathway
polypeptide or a variant of the pathway polypeptide; (c)
subdividing the pool of nucleic acids into compartments, such that
each compartment comprises a nucleic acid member of the pool, the
pathway polypeptide or variant encoded by the nucleic acid member,
the replicase, and other components of the pathway; and (d)
detecting amplification of the nucleic acid member by the
replicase.
[0170] The Examples (in particular Example 19 and following
Examples) show the use of our invention in the selection of
nucleoside diphosphate kinase (NDP Kinase), which catalyses the
transfer of a phosphate group from ATP to a deoxynucleoside
diphosphate to produce a deoxynucleoside triphosphate.
[0171] In yet another embodiment, the modulating agent is such that
it consumes an inhibitor of replicase activity. For example, it is
known that heparin is an inhibitor of replicase (polymerase)
activity. Our method allows the selection of a heparinase with
enhanced activity, by compartmentalisation of a library of nucleic
acids encoding heparinase or variants of this enzyme, in the
presence of heparin and polymerase. Heparinase variants with
enhanced activity are able to break down heparin to a greater
extent or more rapidly, thus removing the inhibition of replicase
activity within the compartment and allowing the replication of the
nucleic acid within the compartment (i.e., the nucleic acid
encoding that heparinase variant).
Selection of Interacting Polypeptides
[0172] The most important systems for the selection of
protein-protein interactions are in vivo methods, with the most
important and best developed being the yeast two-hybrid system
(Fields and Song, 1989, Nature 340, 245-246). In this system and
related approaches two hybrid proteins are generated: a bait-hybrid
comprising protein X fused to a DNA-binding domain and a
prey-hybrid comprising protein Y fused to a transcription
activation domain with cognate interaction of X and Y
reconstituting the transcriptional activator. Two other in vivo
systems have been put forward in which the polypeptide chain of an
enzyme is expressed in two parts fused to two proteins X and Y and
in which cognate X-Y interaction reconstitutes function of the
enzyme (Karimova, 1998, Proc. Natl. Acad. Sci. USA 95, 5752-6;
Pelletier, 1999, Nat. Biotechnol. 17, 683-690) conferring a
selectable phenotype on the cell.
[0173] It has recently been shown that Taq polymerase can be split
in a similar way (Vainshtein et al., 1996, Protein Science 5,
1785). According to our invention, therefore, we provide a method
of selecting a pair of polypeptides capable of stable interaction
by splitting Taq polymerase or any enzyme or factor auxiliary to
the polymerase reaction.
[0174] The method comprises several steps. The first step consists
of providing a first nucleic acid and a second nucleic acid. The
first nucleic acid encodes a first fusion protein comprising a
first subdomain of a replicase (or other see above) enzyme fused to
a first polypeptide, while the second nucleic acid encodes a second
fusion protein comprising a second subdomain of a replicase (or
other see above) enzyme fused to a second polypeptide. The two
fusion proteins are such that stable interaction of the first and
second replicase (or other see above) subdomains generates
replicase activity (either directly or indirectly). At least one of
the first and second nucleic acids (preferably both) is provided in
the form of a pool of nucleic acids encoding variants of the
respective first and/or second polypeptide(s).
[0175] The pool or pools of nucleic acids are then subdivided into
compartments, such that each compartment comprises a first nucleic
acid and a second nucleic acid together with respective fusion
proteins encoded by the first and second nucleic acids. The first
polypeptide is then allowed to bind to the second polypeptide, such
that binding of the first and second polypeptides leads to stable
interaction of the replicase subdomains to generate replicase
activity. Finally, amplification of at least one of the first and
second nucleic acids by the replicase is detected.
[0176] Our invention therefore encompasses an in vitro selection
system whereby reconstitution of replicase function through the
cognate association of two polypeptide ligands drives amplification
and linkage of the genes of the two ligands. Such an in vitro
two-hybrid system is particularly suited for the investigation of
protein-protein interactions at high temperatures, e.g. for the
investigation of the protenomes of thermophilic organisms or the
engineering of highly stable interactions.
[0177] The system can also be applied to the screening and
isolation of molecular compounds that promote cognate interactions.
For example, compounds can be chemically linked to either primers
or dNTPs and thus would only be incorporated into amplicons if
promoting association. In order to prevent cross-over, such
compounds would have to be released only after compartmentalisation
has taken place, e.g. by coupling to microbeads or by inclusion
into dissolvable microspheres.
Single Step and Multiple Step Selections
[0178] The selection of suitable encapsulation conditions is
desirable. Depending on the complexity and size of the library to
be screened, it may be beneficial to set up the encapsulation
procedure such that 1 or less than 1 nucleic acids is encapsulated
per microcapsule or compartment. This will provide the greatest
power of resolution. Where the library is larger and/or more
complex, however, this may be impracticable; it may be preferable
to encapsulate or compartmentalise several nucleic acids together
and rely on repeated application of the method of the invention to
achieve sorting of the desired activity. A combination of
encapsulation procedures may be used to obtain the desired
enrichment.
[0179] Theoretical studies indicate that the larger the number of
nucleic acids variants created the more likely it is that a
molecule will be created with the properties desired (see Perelson
and Oster, 1979, J. Theor. Biol. 81, 64570 for a description of how
this applies to repertoires of antibodies). Recently it has also
been confirmed practically that larger phage-antibody repertoires
do indeed give rise to more antibodies with better binding
affinities than smaller repertoires (Griffiths et al., 1994, Embo.
J. 13, 3245-60). To ensure that rare variants are generated and
thus are capable of being selected, a large library size is
desirable. Thus, the use of optimally small microcapsules is
beneficial.
[0180] In addition to the nucleic acids described above, the
microcapsules or compartments according to the invention may
comprise further components required for the replication reaction
to take place. Other components of the system may for example
comprise those necessary for transcription and/or translation of
the nucleic acid. These are selected for the requirements of a
specific system from the following: a suitable buffer, an in vitro
transcription/replication system and/or an in vitro translation
system containing all the necessary ingredients, enzymes and
cofactors, RNA polymerase, nucleotides, nucleic acids (natural or
synthetic), transfer RNAs, ribosomes and amino acids, and the
substrates of the reaction of interest in order to allow selection
of the modified gene product.
[0181] Buffer
[0182] A suitable buffer will be one in which all of the desired
components of the biological system are active and will therefore
depend upon the requirements of each specific reaction system.
Buffers suitable for biological and/or chemical reactions are known
in the art and recipes provided in various laboratory texts
(Sambrook et al., 1989, Molecular cloning: a laboratory manual.
Cold Spring Harbor Laboratory Press, New York).
[0183] In Vitro Translation
[0184] The replicase may be provided by expression from a suitable
host as described elsewhere, or it may be produced by in vitro
transcription/translation in a suitable system as known in the
art.
[0185] The in vitro translation system will usually comprise a cell
extract, typically from bacteria (Zubay, 1973, Annu. Rev. Genet. 7,
267-87; Zubay, 1980, Methods Enzymol. 65, 856-77; Lesley et al.,
1991, J. Biol. Chem. 266 (4), 2632-8; Lesley, 1995, Methods Mol.
Biol. 37, 265-78), rabbit reticulocytes (Pelham and Jackson, 1976,
Eur. J. Biochem. 67, 247-56), or wheat germ (Anderson et al., 1983,
Methods Enzymol. 101, 635-44). Many suitable systems are
commercially available (for example from Promega) including some
which will allow coupled transcription/translation (all the
bacterial systems and the reticulocyte and wheat germ TNT.TM.
extract systems from Promega). The mixture of amino acids used may
include synthetic amino acids if desired, to increase the possible
number or variety of proteins produced in the library. This can be
accomplished by charging tRNAs with artificial amino acids and
using these tRNAs for the in vitro translation of the proteins to
be selected (Ellman et al., 1991, Methods Enzymol. 202, 301-36;
Beimer, 1994, Trends Biotechnol. 12, 158-63; Mendel et al., 1995,
Annu. Rev. Biophys. Biomol. Struc. 24, 435-62). Particularly
desirable may be the use of in vitro translation systems
reconstituted from purified components like the PURE system
(Shimizu et al., 2001, Nat. Biotech. 19, 751).
[0186] After each round of selection the enrichment of the pool of
nucleic acids for those encoding the molecules of interest can be
assayed by non-compartmentalised in vitro transcription/replication
or coupled transcription-translation reactions. The selected pool
is cloned into a suitable plasmid vector and RNA or recombinant
protein is produced from the individual clones for further
purification and assay.
[0187] The invention moreover relates to a method for producing a
gene product, once a nucleic acid encoding the gene product has
been selected by the method of the invention. Clearly, the nucleic
acid itself may be directly expressed by conventional means to
produce the gene product. However, alternative techniques may be
employed, as will be apparent to those skilled in the art. For
example, the genetic information incorporated in the gene product
may be incorporated into a suitable expression vector, and
expressed therefrom.
Compartments
[0188] As used here, the term "compartment" is synonymous with
"microcapsule" and the terms are used interchangeably. The function
of the compartment is to enable co-localisation of the nucleic acid
and the corresponding polypeptide encoded by the nucleic acid. This
is preferably achieved by the ability of the compartment to
substantially restrict diffusion of template and product strands to
other compartments. Any replicase activity of the polypeptide is
therefore restricted to being exercised on a nucleic acid within
the confines of a compartment, and not other nucleic acids in other
compartments. Another function of compartments is to restrict
diffusion of molecules generated in a chemical or enzymatic
reaction that feed or unblock a replication reaction.
[0189] The compartments of the present invention therefore require
appropriate physical properties to allow the working of the
invention.
[0190] First, to ensure that the nucleic acids and polypeptides do
not diffuse between compartments, the contents of each compartment
must be isolated from the contents of the surrounding compartments,
so that there is no or little exchange of the nucleic acids and
polypeptides between the compartments over a significant
timescale.
[0191] Second, the method of the present invention requires that
there are only a limited number of nucleic acids per compartment,
or that all members within a single compartment are clonal (i.e.
identical). This ensures that the polypeptide encoded by and
corresponding to an individual nucleic acid will be isolated from
other different nucleic acids. Thus, coupling between nucleic acid
and its corresponding polypeptide will be highly specific. The
enrichment factor is greatest with on average one or fewer nucleic
acid clonal species per compartment, the linkage between nucleic
acid and the activity of the encoded polypeptide being as tight as
is possible, since the polypeptide encoded by an individual nucleic
acid will be isolated from the products of all other nucleic acids.
However, even if the theoretically optimal situation of, on
average, a single nucleic acid or less per compartment is not used,
a ratio of 5, 10, 50, 100 or 1000 or more nucleic acids per
compartment may prove beneficial in selecting from a large library.
Subsequent rounds of selection, including renewed
compartmentalisation with differing nucleic acid distribution, will
permit more stringent selection of the nucleic acids. Preferably,
on average there is a single nucleic acid clonal species, or fewer,
per compartment.
[0192] Moreover, each compartment contains a nucleic acid; this
means that whilst some compartments may remain empty, the
conditions are adjusted such that, statistically, each compartment
will contain at least one, and preferably only one, nucleic
acid.
[0193] Third, the formation and the composition of the compartments
must not abolish the function of the machinery for the expression
of the nucleic acids and the activity of the polypeptides.
[0194] Consequently, any compartmentalisation system used must
fulfil these three requirements. The appropriate system(s) may vary
depending on the precise nature of the requirements in each
application of the invention, as will be apparent to the skilled
person.
[0195] Various technologies are available for compartmentalisation,
for example, gas aphrons (Juaregi and Varley, 1998, Biotechnol.
Bioeng. 59, 471) and prefabricated nanowells (Huang and Schreiber,
1997, Proc. Natl. Acad. Sci. USA 94, 25). For different
applications, different compartment sizes and surface chemistries,
as discussed in further detail below, may be desirable. For
example, it may be sufficient to utilise diffusion limiting porous
materials like gels or alginate (Draget et al., 1997, Int. J.
Macromol. 21, 47) or zeolithe-type materials. Furthermore, where
in-situ PCR or in-cell PCR is carried out, cells may be treated
with a cross-linking fixative to form porous compartments allowing
diffusion of dNTPs, enzymes and primers.
[0196] A wide variety of compartmentalisation or microencapsulation
procedures are available (Benita, S., Ed. (1996).
Microencapsulation: methods and industrial applications. Drugs and
pharmaceutical sciences. Edited by Swarbrick, J. New York: Marcel
Dekker) and may be used to create the compartments used in
accordance with the present invention. Indeed, more than 200
microencapsulation or compartmentalisation methods have been
identified in the literature (Finch, C. A., 1993, Encapsulation and
controlled release. Spec. Publ-R. Soc. Chem. 138, 35).
[0197] These include membrane enveloped aqueous vesicles such as
lipid vesicles (liposomes) (New, R. R. C., Ed. (1990). Liposomes: a
practical approach. The practical approach series. Edited by
Rickwood, D. & Hames, B. D. Oxford: Oxford University Press)
and non-ionic surfactant vesicles (van Hal, D. A., Bouwstra, J. A.
& Junginger, H. E. (1996). Nonionic surfactant vesicles
containing estradiol for topical application. In
Microencapsulation: methods and industrial applications (Benita,
S., ed.), pp. 329-347. Marcel Dekker, New York). These are
closed-membranous capsules of single or multiple bilayers of
non-covalently assembled molecules, with each bilayer separated
from its neighbour by an aqueous compartment. In the case of
liposomes the membrane is composed of lipid molecules; these are
usually phospholipids but sterols such as cholesterol may also be
incorporated into the membranes (New, R. R. C., Ed. (1990).
Liposomes: a practical approach. The practical approach series.
Edited by Rickwood, D. & Hames, B. D. Oxford: Oxford University
Press). A variety of enzyme-catalysed biochemical reactions,
including RNA and DNA polymerisation, can be performed within
liposomes (Chakrabarti, 1994, J. Mol. Evol. 39, 555-9; Oberholzer,
1995, Biochem. Biophys. Res. Commun. 207, 250-7; Oberholzer, 1995,
Chem. Biol. 2, 677-82; Walde, 1998, Biotechnol. Bioeng. 57,
216-219; Wick and Luisi, 1996, Chem. Biol. 3, 277-85).
[0198] With a membrane-enveloped vesicle system much of the aqueous
phase is outside the vesicles and is therefore
non-compartmentalised. This continuous, aqueous phase should be
removed or the biological systems in it inhibited or destroyed (for
example, by digestion of nucleic acids with DNase or RNase) in
order that the reactions are limited to the compartmentalised
microcapsules (Luisi et al., 1987, Methods Enzymol. 136,
188-216).
[0199] Enzyme-catalysed biochemical reactions have also been
demonstrated in microcapsule compartments generated by a variety of
other methods. Many enzymes are active in reverse micellar
solutions (Bru and Walde, 1991, Eur. J. Biochem. 199, 95-103; Bru
and Walde, 1993, Biochem. Mol. Biol. Int. 31, 685-92; Creagh et
al., 1993, Enzyme Microb. Technol. 15, 383-92; Haber et al., 1993
UNABLE TO FIND; Kumar et al., 1989, Biophys. J. 55, 789-792; Luisi,
P. L. and B., S.-H., 1987, Activity and conformation of enzymes in
reverse micellar solutions. Methods Enzymol. 136 (188), 188-216;
Mao and Walde, 1991, Biochem. Biophys. Res. Commun. 178, 1105-1112;
Mao, Q. and Walde, P., 1991, Substrate effects on the enzymatic
activity of alpha-chymotrypsin in reverse micelles. Biochem.
Biophys. Res. Commun. 178 (3), 1105-12; Mao, 1992, Eur. J. Biochem.
208, 165-70; Perez, G. M., Sanchez, F. A. and Garcia, C. F., 1992,
Application of active-phase plot to the kinetic analysis of
lipoxygenase in reverse micelles. Biochem. J.; Walde, P., Goto, A.,
Monnard, P.-A., Wessicken, M. and Luisi, P. L., 1994, Oparin's
reactions revisited: enzymatic synthesis of poly(adenylic acid) in
micelles and self-reproducing vesicles. J. Am. Chem. Soc. 116,
7541-7547; Walde, P., Han, D. and Luisi, P. L., 1993, Spectroscopic
and kinetic studies of lipases solubilized in reverse micelles.
Biochemistry 32, 4029-34; Walde, 1988, Eur. J. Biochem. 173, 401-9)
such as the AOT-isooctane-water system (Menger, F. M. and Yamada,
K., 1979, J. Am. Chem. Soc. 101, 6731-6734).
[0200] Compartments can also be generated by interfacial
polymerisation and interfacial complexation (Whateley, T. L., 1996,
Microcapsules: preparation by interfacial polymerisation and
interfacial complexation and their applications. In
Microencapsulation: methods and industrial applications (Benita,
S., ed.), pp. 349-375. Marcel Dekker, New York). Microcapsule
compartments of this sort can have rigid, nonpermeable membranes,
or semipermeable membranes. Semipermeable microcapsules bordered by
cellulose nitrate membranes, polyamide membranes and
lipid-polyamide membranes can all support biochemical reactions,
including multienzyme systems (Chang, 1987, Methods Enzymol. 136,
67-82; Chang, 1992, Artif. Organs 16, 71-4; Lim, 1984, Appl.
Biochem. Biotechnol. 10, 81-5). Alginate/polylysine compartments
(Lim and Sun, 1980, Science 210, 908-10), which can be formed under
very mild conditions, have also proven to be very biocompatible,
providing, for example, an effective method of encapsulating living
cells and tissues (Chang, 1992, Artif Organs 16, 71-4; Sun, 1992,
ASAIO J. 38, 125-7).
[0201] Non-membranous compartmentalisation systems based on phase
partitioning of an aqueous environment in a colloidal system, such
as an emulsion, may also be used.
[0202] Preferably, the compartments of the present invention are
formed from emulsions; heterogeneous systems of two immiscible
liquid phases with one of the phases dispersed in the other as
droplets of microscopic or colloidal size (Becher, P. (1957)
Emulsions: theory and practice. Reinhold, New York; Sherman, P.
(1968) Emulsion science. Academic Press, London; Lissant, K. J.,
ed. Emulsions and emulsion technology. Surfactant Science New York:
Marcel Dekker, 1974; Lissant, K. J., ed. Emulsions and emulsion
technology. Surfactant Science New York: Marcel Dekker, 1984).
[0203] Emulsions may be produced from any suitable combination of
immiscible liquids. Preferably the emulsion of the present
invention has water (containing the biochemical components) as the
phase present in the form of finely divided droplets (the disperse,
internal or discontinuous phase) and a hydrophobic, immiscible
liquid (an "oil") as the matrix in which these droplets are
suspended (the nondisperse, continuous or external phase). Such
emulsions are termed "water-in-oil" (W/O). This has the advantage
that the entire aqueous phase containing the biochemical components
is compartmentalised in discrete droplets (the internal phase). The
external phase, being a hydrophobic oil, generally contains none of
the biochemical components and hence is inert.
[0204] The emulsion may be stabilised by addition of one or more
surface-active agents (surfactants). These surfactants are termed
emulsifying agents and act at the water/oil interface to prevent
(or at least delay) separation of the phases. Many oils and many
emulsifiers can be used for the generation of water-in-oil
emulsions; a recent compilation listed over 16,000 surfactants,
many of which are used as emulsifying agents (Ash, M. and Ash, I.
(1993) Handbook of industrial surfactants. Gower, Aldershot).
Suitable oils include light white mineral oil and non-ionic
surfactants (Schick, 1966 not found) such as sorbitan monooleate
(Span.TM. 80; ICI) and polyoxyethylenesorbitan monooleate
(Tween.TM. 80; ICI) or t-Octylphenoxypolyethoxy-ethanol (Triton
X-100).
[0205] The use of anionic surfactants may also be beneficial.
suitable surfactants include sodium cholate and sodium
taurocholate. Particularly preferred is sodium deoxycholate,
preferably at a concentration of 0.5% w/v, or below. Inclusion of
such surfactants can in some cases increase the expression of the
nucleic acids and/or the activity of the polypeptides. Addition of
some anionic surfactants to a non-emulsified reaction mixture
completely abolishes translation. During emulsification, however,
the surfactant is transferred from the aqueous phase into the
interface and activity is restored. Addition of an anionic
surfactant to the mixtures to be emulsified ensures that reactions
proceed only after compartmentalisation.
[0206] Creation of an emulsion generally requires the application
of mechanical energy to force the phases together. There are a
variety of ways of doing this which utilise a variety of mechanical
devices, including stirrers (such as magnetic stir-bars, propeller
and turbine stirrers, paddle devices and whisks), homogenisers
(including rotor-stator homogenisers, high-pressure valve
homogenisers and jet homogenisers), colloid mills, ultrasound and
"membrane emulsification" devices (Becher, P. (1957) Emulsions:
theory and practice. Reinhold, New York; Dickinson, E. (1994) In
Wedlock, D. J. (ed.), Emulsions and droplet size control.
Butterworth-Heine-mann, Oxford, Vol. pp. 191-257).
[0207] Aqueous compartments formed in water-in-oil emulsions are
generally stable with little if any exchange of polypeptides or
nucleic acids between compartments. Additionally, it is known that
several biochemical reactions proceed in emulsion compartments.
Moreover, complicated biochemical processes, notably gene
transcription and translation are also active in emulsion
microcapsules. The technology exists to create emulsions with
volumes all the way up to industrial scales of thousands of litres
(Becher, P. (1957) Emulsions: theory and practice. Reinhold, New
York; Sherman, P. (1968) Emulsion science. Academic Press, London;
Lissant, K. J., ed. Emulsions and emulsion technology. Surfactant
Science New York: Marcel Dekker, 1974; Lissant, K. J., ed.
Emulsions and emulsion technology. Surfactant Science New York;
Marcel Dekker, 1984).
[0208] The preferred compartment size will vary depending upon the
precise requirements of any individual selection process that is to
be performed according to the present invention. In all cases,
there will be an optimal balance between gene library size, the
required enrichment and the required concentration of components in
the individual compartments to achieve efficient expression and
reactivity of the polypeptides.
[0209] The processes of expression may occur either in situ within
each individual microcapsule or exogenously within cells (e.g.
bacteria) or other suitable forms of subcompartmentalization. Both
in vitro transcription and coupled transcription-translation become
less efficient at sub-nanomolar DNA concentrations. Because of the
requirement for only a limited number of DNA molecules to be
present in each compartment, this therefore sets a practical upper
limit on the possible compartment size where in vitro transcription
is used. Preferably, for expression in situ using in vitro
transcription and/or translation the mean volume of the
compartments is less that 5.2.times.10.sup.-16 m.sup.3,
(corresponding to a spherical compartment of diameter less than 1
.mu.m.
[0210] An alternative is the separation of expression and
compartmentalisation, e.g. using a cellular host. For inclusion of
cells (in particular eucaryotic cells) mean compartment diameters
of larger than 10 .mu.M may be preferred.
[0211] As shown in the Examples, to colocalize the polymerase gene
and encoded protein within the same emulsion compartment, we used
bacteria (E. coli) overexpressing Taq polymerase as "delivery
vehicles". E. coli cells (diameter 1-5 .mu.M) fit readily into our
emulsion compartments while leaving room for sufficient amounts of
PCR reagents like nucleotide triphosphates and primers (as shown in
FIG. 2). The denaturation step of the first PCR cycle ruptures the
bacterial cell and releases the expressed polymerase and its
encoding gene into the compartment allowing self-replication to
proceed while simultaneously destroying background bacterial
enzymatic activities. Furthermore, by analogy to hot-start
strategies, this cellular "subcompartmentalization" prevents
release of polymerase activity at ambient temperatures and the
resulting non-specific amplification products.
[0212] The effective DNA or RNA concentration in the compartments
may be artificially increased by various methods that will be
well-known to those versed in the art. These include, for example,
the addition of volume excluding chemicals such as polyethylene
glycols (PEG) and a variety of gene amplification techniques,
including transcription using RNA polymerases including those from
bacteria such as E. coli (Roberts, 1969, Nature 224, 1168-74;
Blattner and Dahlberg, 1972, Nat. New. Biol. 237, 227-32; Roberts
et al., 1975, J. Biol. Chem. 250, 5530-41; Rosenberg et al., 1975,
J. Biol. Chem. 250, 4755-4764), eukaryotes e.g. (Weil et al., 1979,
J. Biol. Chem. 254, 6163-6173; Manley et al., 1983, Methods
Enzymol. 101, 568-82) and bacteriophage such as T7, T3 and SP6
(Melton et al., 1984, Nucleic Acids Res. 12, 7035-56); the
polymerase chain reaction (PCR) (Saiki et al., 1988, Science 239,
487-91); Q.beta. replicase amplification (Miele et al., 1983, J.
Mol. Biol. 171, 281-95; Cahill et al., 1991, Clin. Chem. 37,
1482-5; Chetverin and Spirin, 1995, Frog Nucleic Acid Res. Mol.
Biol. 51, 225-70; Katanaev et al., 1995, FEBS Lett. 359, 89-92);
the ligase chain reaction (LCR) (Landegren et al., 1988, Science
241, 1077-80; Barany, 1991, PCR Methods Appl. 1, 5-16); and
self-sustained sequence replication system (Fahy et al., 1991, PCR
Methods Appl. 1, 25-33) and strand displacement amplification
(Walker et al., 1992, Nucleic Acids Res. 20, 1691-6). Gene
amplification techniques requiring thermal cycling such as PCR and
LCR may also be used if the emulsions and the in vitro
transcription or coupled transcription-translation systems are
thermostable (for example, the coupled transcription-translation
systems could be made from a thermostable organism such as Thermus
aquaticus).
[0213] Increasing the effective local nucleic acid concentration
enables larger compartments to be used effectively.
[0214] The compartment size must be sufficiently large to
accommodate all of the required components of the biochemical
reactions that are needed to occur within the compartment. For
example, in vitro, both transcription reactions and coupled
transcription-translation reactions require a total nucleoside
triphosphate concentration of about 2 mM.
[0215] For example, in order to transcribe a gene to a single short
RNA molecule of 500 bases in length, this would require a minimum
of 500 molecules of nucleoside triphosphate per compartment
(8.33.times.10.sup.-22 moles). In order to constitute a 2 mM
solution, this number of molecules must be contained within a
compartment of volume 4.17.times.10.sup.-19 litres
(4.17.times.10.sup.22 m.sup.3) which if spherical would have a
diameter of 93 nm. Hence, the preferred lower limit for
microcapsules is a diameter of approximately 0.1 .mu.m (100
nm).
[0216] When using expression hosts as delivery vehicles, there are
much less strict requirements on the compartment size. Basically,
the compartment has to be of sufficient size to contain the
expression host as well as sufficient amounts of reagents to carry
out the required reactions. Thus, in such cases larger compartment
sizes >10 .mu.M are preferred. By an appropriate choice of
vector used for expression in the host, the template concentration
within compartments can be controlled via the vector origin and
resulting copy number (e.g. E. coli: colE (pUC)>100, p15: 30-50,
pSC101:1-4). Likewise the concentration of the gene product can be
controlled by the amount by choice of expression promoter and
expression protocol (e.g. full induction of expression versus
promoter leakage). Preferably, gene product concentration is as
high as possible.
[0217] Furthermore, the use of feeder compartments allows feeding
of substrates from the outside (see Ghadessy et al., 2001, PNAS 98,
4552; 01). Feeding emulsion reactions from the outside may allow
compartment dimensions <0.1 .mu.M for ribozyme selections, as
reagents do not need to be contained in their entirety within the
compartment.
[0218] The size of emulsion microcapsules or compartments may be
varied simply by tailoring the emulsion conditions used to form the
emulsion according to requirements of the selection system. The
larger the compartment size, the larger is the volume that will be
required to encapsulate a given nucleic acid library, since the
ultimately limiting factor will be the size of the compartment and
thus the number of microcapsule compartments possible per unit
volume.
[0219] The size of the compartments is selected not only having
regard to the requirements of the replication system, but also
those of the selection system employed for the nucleic acid.
[0220] Thus, the components of the selection system, such as a
chemical modification system, may require reaction volumes and/or
reagent concentrations, which are not optimal for replication. As
set forth herein, such requirements may be accommodated by a
secondary re-encapsulation step; moreover, they may be accommodated
by selecting the compartment size in order to maximise replication
and selection as a whole. Empirical determination of optimal
compartment volume and reagent concentration, for example, as set
forth herein, is preferred.
[0221] In a highly preferred embodiment of the present invention,
the emulsion is a water-in-oil emulsion. The water-in-oil emulsion
is made by adding an aqueous phase dropwise to an oil phase in the
presence of a surfactant comprising 4.5% (v/v) Span 80, about 0.4%
(v/v) Tween 80 and about 0.05-0.1% (v/v) Triton X100 in mineral oil
preferably at a ratio of oil:water phase of 2:1 or 3:1. It appears
that the ratio of the three surfactants is important for the
advantageous properties of the emulsion, and accordingly, our
invention also encompasses a water-in-oil emulsion having increased
amounts of surfactant but with substantially the same ratio of Span
80, Tween 80 and Triton X100. In a preferred embodiment, the
surfactant comprises 4.5% (v/v) Span 80, 0.4% (v/v) Tween 80 and
0.05% (v/v) Triton X100.
[0222] The water-in-oil emulsion is preferably formed under
constant stirring in 2 ml round bottom biofreeze vials with
continued stirring at 1000 rpm for a further 4 or 5 minutes after
complete addition of the aqueous phase. The rate of addition may be
up to 12 drops/mm (ca. 10 .mu.l each). The aqueous phase may
include just water, or it may comprise a buffered solution having
additional components such as nucleic acids, nucleotide
triphosphates, etc. In a preferred embodiment, the aqueous phase
comprises a PCR reaction mix as disclosed elsewhere in this
document, as well as nucleic acid, and polymerase. The water-in-oil
emulsion may be formed from 200 .mu.l of aqueous phase (for example
PCR reaction mix) and 400 .mu.l oil phase as described above.
[0223] The water-in-oil emulsion according to the invention has
advantageous properties of increased thermal stability. Thus, no
changes in compartment size or evidence of coalescence is observed
after 20 cycles of PCR as judged by laser diffraction and light
microscopy. This is shown in FIG. 2. In addition, polymerase chain
reaction proceeded efficiently within the compartments of this
water-in-oil composition, to approach the rates observed in
solution PCR. Average aqueous compartment dimensions in the
water-in-oil emulsion according to our invention are on average 15
.mu.m in size. Once formed, the compartments of the emulsion
according to our invention do not permit the exchange of
macromolecules like DNA and proteins to any significant degree (as
shown in FIG. 3A). This is presumably because the large molecular
weight and charged nature of the macromolecules precludes diffusion
across the hydrophobic surfactant shell, even at elevated
temperatures.
Nucleic Acids
[0224] A nucleic acid in accordance with the present invention is
as described above. Preferably, the nucleic acid is a molecule or
construct selected from the group consisting of a DNA molecule, an
RNA molecule, a partially or wholly artificial nucleic acid
molecule consisting of exclusively synthetic or a mixture of
naturally-occurring and synthetic bases, any one of the foregoing
linked to a polypeptide, and any one of the foregoing linked to any
other molecular group or construct. Advantageously, the other
molecular group or construct may be selected from the group
consisting of nucleic acids, polymeric substances, particularly
beads, for example polystyrene beads, magnetic substances such as
magnetic beads, labels, such as fluorophores or isotopic labels,
chemical reagents, binding agents such as macrocycles and the
like.
[0225] The nucleic acid may comprise suitable regulatory sequences,
such as those required for efficient expression of the gene
product, for example promoters, enhancers, translational initiation
sequences, polyadenylation sequences, splice sites and the
like.
[0226] The terms "isolating", "sorting" and "selecting", as well as
variations thereof, are used herein. Isolation, according to the
present invention, refers to the process of separating an entity
from a heterogeneous population, for example a mixture, such that
it is free of at least one substance with which it is associated
before the isolation process. In a preferred embodiment, isolation
refers to purification of an entity essentially to homogeneity.
Sorting of an entity refers to the process of preferentially
isolating desired entities over undesired entities. In as far as
this relates to isolation of the desired entities, the terms
"isolating" and "sorting" are equivalent. The method of the present
invention permits the sorting of desired nucleic acids from pools
(libraries or repertoires) of nucleic acids which contain the
desired nucleic acid. Selecting is used to refer to the process
(including the sorting process) of isolating an entity according to
a particular property thereof.
[0227] "Oligonucleotide" refers to a molecule comprised of two or
more deoxyribonucleotides or ribonucleotides, preferably more than
three. The exact size of the oligonucleotide will depend on the
ultimate function or use of the oligonucleotide. The
oligonucleotide may be derived synthetically or by cloning.
[0228] The nucleic acids selected according to our invention may be
further manipulated. For example, nucleic acid encoding selected
replicase or interacting polypeptides are incorporated into a
vector, and introduced into suitable host cells to produce
transformed cell lines that express the gene product. The resulting
cell lines can then be propagated for reproducible qualitative
and/or quantitative analysis of the effect(s) of potential drugs
affecting gene product function. Thus gene product expressing cells
may be employed for the identification of compounds, particularly
small molecular weight compounds, which modulate the function of
gene product. Thus host cells expressing gene product are useful
for drug screening and it is a further object of the present
invention to provide a method for identifying compounds which
modulate the activity of the gene product, said method comprising
exposing cells containing heterologous DNA encoding gene product,
wherein said cells produce functional gene product, to at least one
compound or mixture of compounds or signal whose ability to
modulate the activity of said gene product is sought to be
determined, and thereafter monitoring said cells for changes caused
by said modulation. Such an assay enables the identification of
modulators, such as agonists, antagonists and allosteric
modulators, of the gene product. As used herein, a compound or
signal that modulates the activity of gene product refers to a
compound that alters the activity of gene product in such a way
that the activity of gene product is different in the presence of
the compound or signal (as compared to the absence of said compound
or signal).
[0229] Cell-based screening assays can be designed by constructing
cell lines in which the expression of a reporter protein, i.e. an
easily assayable protein, such as .beta. galactosidase,
chloramphenicol acetyltransferase (CAT) or luciferase, is dependent
on gene product. Such an assay enables the detection of compounds
that directly modulate gene product function, such as compounds
that antagonise gene product, or compounds that inhibit or
potentiate other cellular functions required for the activity of
gene product.
[0230] The present invention also provides a method to exogenously
affect gene product dependent processes occurring in cells.
Recombinant gene product producing host cells, e.g. mammalian
cells, can be contacted with a test compound, and the modulating
effect(s) thereof can then be evaluated by comparing the gene
product-mediated response in the presence and absence of test
compound, or relating the gene product-mediated response of test
cells, or control cells (i.e., cells that do not express gene
product), to the presence of the compound.
Nucleic Acid Libraries
[0231] The method of the present invention is useful for sorting
libraries of nucleic acids. Herein, the terms "library",
"repertoire" and "pool" are used according to their ordinary
signification in the art, such that a library of nucleic acids
encodes a repertoire of gene products. In general, libraries are
constructed from pools of nucleic acids and have properties, which
facilitate sorting. Initial selection of a nucleic acid from a
library of nucleic acids using the present invention will in most
cases require the screening of a large number of variant nucleic
acids. Libraries of nucleic acids can be created in a variety of
different ways, including the following.
[0232] Pools of naturally occurring nucleic acids can be cloned
from genomic DNA or cDNA (Sambrook et al., 1989, Molecular cloning:
a laboratory manual. Cold Spring Harbor Laboratory Press, New
York); for example, phage antibody libraries, made by PCR
amplification repertoires of antibody genes from immunised or
uninimunised donors have proved very effective sources of
functional antibody fragments (Winter et al., 1994, Annu. Rev.
Immunol. 12, 433-55; Hoogenboom, H. R., 1997, Trends Biotechnol.
15, 62-70). Designing and optimizing library selection strategies
for generating high-affinity antibodies. Trends Biotechnol. 15,
62-70; Hoogenboom, H. R., 1997, Trends Biotechnol. 15, 62-70).
Libraries of genes can also be made by encoding all (see for
example Smith, G. P., 1985, Science 228, 1315-7; Parmley, S. F. and
Smith, G. P., 1988, Gene 73, 305-18) or part of genes (see for
example Lowman et al., 1991, Biochemistry 30, 10832-8) or pools of
genes (see for example Nissim, A., Hoogenboom et al., 1994, Embo J.
13, 692-8) by a randomised or doped synthetic oligonucleotide.
Libraries can also be made by introducing mutations into a nucleic
acids or pools of nucleic acids "randomly" by a variety of
techniques in vivo, including: using "mutator strains" of bacteria
such as E. coli mutD5 (Liao et al., 1986, Proc. Natl. Acad. Sci.
USA 83, 576-80; Yamagishi et al., 1990, Protein Eng. 3, 713-9; Low
et al., 1996, J. Mol. Biol. 260, 359-68); using the antibody
hypermutation system of B-lymphocytes (Yelamos et al., 1995, Nature
376, 225-9). Random mutations can also be introduced both in vivo
and in vitro by chemical mutagens, and ionising or UV irradiation
(see Friedberg et al., 1995, DNA repair and mutagenesis. ASM Press,
Washington D.C.), or incorporation of mutagenic base analogues
(Freese, 1959, J. Mol. Biol. 1, 87; Zaccolo et al., 1996, J. Mol.
Biol. 255, 589-603). "Random" mutations can also be introduced into
genes in vitro during polymerisation for example by using
error-prone polymerases (Leung et al., 1989, Technique 1,
11-15).
[0233] Further diversification can be introduced by using
homologous recombination either in vivo (Kowalczykowski et al.,
1994, Microbiol. Rev. 58, 401-65 or in vitro (Stemmer, 1994, Nature
370, 389-9; Stemmer, 1994, Proc. Natl. Acad. Sci. USA 91,
10747-51).
Agent
[0234] As used herein, the term "agent" includes but is not limited
to an atom or molecule, wherein a molecule may be inorganic or
organic, a biological effector molecule and/or a nucleic acid
encoding an agent such as a biological effector molecule, a
protein, a polypeptide, a peptide, a nucleic acid, a peptide
nucleic acid (PNA), a virus, a virus-like particle, a nucleotide, a
ribonucleotide, a synthetic analogue of a nucleotide, a synthetic
analogue of a ribonucleotide, a modified nucleotide, a modified
ribonucleotide, an amino acid, an amino acid analogue, a modified
amino acid, a modified amino acid analogue, a steroid, a
proteoglycan, a lipid, a fatty acid and a carbohydrate. An agent
may be in solution or in suspension (e.g., in crystalline,
colloidal or other particulate form). The agent may be in the form
of a monomer, dimer, oligomer, etc., or otherwise in a complex.
Polypeptide
[0235] As used herein, the terms "peptide", "polypeptide" and
"protein" refer to a polymer in which the monomers are amino acids
and are joined together through peptide or disulfide bonds.
"Polypeptide" refers to either a full-length naturally-occurring
amino acid chain or a "fragment thereof" or "peptide", such as a
selected region of the polypeptide that binds to another protein,
peptide or polypeptide in a manner modulatable by a ligand, or to
an amino acid polymer, or a fragment or peptide thereof, which is
partially or wholly non-natural. "Fragment thereof" thus refers to
an amino acid sequence that is a portion of a full-length
polypeptide, between about 8 and about 500 amino acids in length,
preferably about 8 to about 300, more preferably about 8 to about
200 amino acids, and even more preferably about 10 to about 50 or
100 amino acids in length. "Peptide" refers to a short amino acid
sequence that is 10-40 amino acids long, preferably 10-35 amino
acids. Additionally, unnatural amino acids, for example,
.beta.-alanine, phenyl glycine and homoarginine may be included.
Commonly encountered amino acids, which are not gene-encoded, may
also be used in the present invention. All of the amino acids used
in the present invention may be either the D- or L-optical isomer.
The L-isomers are preferred. In addition, other peptidomimetics are
also useful, e.g. in linker sequences of polypeptides of the
present invention (see Spatola, 1983, in Chemistry and Biochemistry
of Amino Acids, Peptides and Proteins, Weinstein, ed., Marcel
Dekker, New York, p. 267). A "polypeptide binding molecule" is a
molecule, preferably a polypeptide, protein or peptide, which has
the ability to bind to another polypeptide, protein or peptide.
Preferably, this binding ability is modulatable by a ligand.
[0236] The term "synthetic", as used herein, means that the process
or substance described does not ordinarily occur in nature.
Preferably, a synthetic substance is defined as a substance which
is produced by in vitro synthesis or manipulation.
[0237] The term "molecule" is used herein to refer to any atom,
ion, molecule, macromolecule (for example polypeptide), or
combination of such entities. The term "ligand" may be used
interchangeably with the term "molecule". Molecules according to
the invention may be free in solution, or may be partially or fully
immobilised. They may be present as discrete entities, or may be
complexed with other molecules. Preferably, molecules according to
the invention include polypeptides displayed on the surface of
bacteriophage particles. More preferably, molecules according to
the invention include libraries of polypeptides presented as
integral parts of the envelope proteins on the outer surface of
bacteriophage particles. Methods for the production of libraries
encoding randomised polypeptides are known in the art and may be
applied in the present invention. Randomisation may be total, or
partial; in the case of partial randomisation, the selected codons
preferably encode options for amino acids, and not for stop
codons.
EXAMPLES
Example 1
Construction of Taq Polymerase Expression Plasmids
[0238] The Taq polymerase open reading frame is amplified by PCR
from Thermus aquaticus genomic DNA using primers 1 & 2, cut
with XbaI & SalI and ligated into pASK75 (Skerra A., 1994, Gene
151, 131) cut with XbaI & SalI. pASK75 is an expression vector
which directs the synthesis of foreign proteins in E. coli under
transcriptional control of the tetA promoter/operator.
[0239] Clones are screened for inserts using primers 3, 4 and
assayed for expression of active Taq polymerase (Taq pol) (see
below). The inactive Taq pol mutant D785H/E786V is constructed
using Quickchange mutagenesis (Stratagene). The mutated residues
are critical for activity (Doublie S. et al., 1998, Nature 391,
251; Kiefer J. R. et al., 1998, Nature 391, 304). Resulting clones
are screened for mutation using PCR screening with primers 3, 5 and
diagnostic digestion of the products with PmlI. Mutant clones are
assayed for expression of active Taq pol (see below).
Example 2
Protein Expression and Activity Assay
[0240] Transformed TG1 cells are grown in 2.times.TY 0.1 mg/ml
ampicillin. For expression, overnight cultures are diluted 1/100
into fresh 2.times.TY medium and grown to OD600=0.5 at 37.degree.
C. Protein expression is induced by addition of anhydro
tetracycline to a final concentration of 0.2 .mu.g/ml. After 4
hours further incubation at 37.degree. C., cells are spun down,
washed once, and re-suspended in an equal volume of 1.times.
SuperTaq polymerase buffer (50 mM KCl, 10 mM Tris-HCl (pH9.0), 0.1%
Triton X-100, 1.5 mM MgCl.sub.2) (HT Biotechnology Ltd, Cambridge
UK).
[0241] Washed cells are added directly to a PCR reaction mix (2
.mu.l per 30 .mu.l reaction volume) comprising template plasmid (20
ng), primers 4 and 5 (1 .mu.M each), dNTPs (0.25 mM), 1.times.
SuperTaq polymerase buffer, and overlaid with mineral oil.
Reactions are incubated for 10 min at 94.degree. C. to release Taq
pol from the cells and then thermocycled with 30 cycles of the
profile 94.degree. C. (1 min), 55.degree. C. (1 min), 72.degree. C.
(2 min).
Example 3
Emulsification of Amplification Reactions
[0242] Emulsification of reactions is carried out as follows. 200
.mu.l of PCR reaction mix (Taq expression plasmid (200 ng), primers
3 and 4 (1 .mu.M each), dNTPs (0.25 mM), Taq polymerase (10 units)
is added dropwise (12 drops/min) to the oil phase (mineral oil
(Sigma)) in the presence of 4.5% (v/v) Span 80 (Fluka), 0.4% (v/v)
Tween 80 (Sigma) and 0.05% (v/v) Triton X100 (Sigma) under constant
stirring (1000 rpm) in 2 ml round bottom biofreeze vials (Costar,
Cambridge Mass.). After complete addition of the aqueous phase,
stirring is continued for a further 4 minutes. Emulsified mixtures
are then transferred to 0.5 ml thin-walled PCR tubes (100
.mu.l/tube) and PCR carried out using 25 cycles of the profile
94.degree. C. (1 min), 60.degree. C. (1 min), 72.degree. C. (3 min)
after an initial 5 min incubation at 94.degree. C. Reaction
mixtures are recovered by the addition of a double volume of ether,
vortexing and centrifugation for 2 minutes prior to removal of the
ether phase. Amplified product is visualised on by gel
electrophoresis on agarose gels using standard methods (see for
example J. Sambrook, E. F. Fritsch, and T. Maniatis, 1989,
Molecular Cloning: A Laboratory Manual, Second Edition, Books 1-3,
Cold Spring Harbor Laboratory Press).
[0243] For emulsification of whole cells expressing Taq polymerase,
the protocol is modified in the following way: Taq expression
plasmid and Taq polymerase in the reaction cocktail are omitted and
instead 5.times.10.sup.8 induced E. coli TG1 cells (harbouring the
expressed Taq polymerase as well as the expression plasmid) are
added together with the additive tetramethyl ammonium chloride (50
.mu.M), and RNAse (0.05% w/v, Roche, UK). The number of PCR cycles
is also reduced to 20.
Example 4
Self-Replication of the Full-Length wt Taq Gene
[0244] In order to test genotype-phenotype linkage during
self-replication, we mixed cells expressing either wild-type Taq
polymerase (wt Taq) or the poorly active (under the buffer
conditions) Stoffel fragment (sf Taq) (F. C. Lawyer, et al., 1993,
PCR Methods Appl. 2, 275-87) at a 1:1 ratio and subjected them to
CSR either in solution or in emulsion. In solution the smaller sf
Taq is amplified preferentially. However, in emulsion there is
almost exclusive self-replication of the full-length wt Taq gene
(FIG. 3B). The number of bacterial cells is adjusted such that the
majority of emulsion compartments contain only a single cell.
However, because cells are distributed randomly among compartments,
it is unavoidable that a minor fraction will contain two or more
cells. As compartments do not appear to exchange template DNA (FIG.
3A), the small amount of sf Taq amplification in emulsion is likely
to originate from these compartments. Clearly, their abundance is
low and, as such, unlikely to affect selections. Indeed, in a test
selection, a single round of CSR is sufficient to isolate wt Taq
clones from a 106-fold excess of an inactive Taq mutant.
[0245] Using error-prone PCR, we prepared two repertoires of random
Taq mutants (L1 (J. P. Vartanian, M. Henry, S. Wain-Hobson, 1996,
Nucleic Acid Res. 24, 2627-2631 (1996)) and L2 (M. Zaccolo, E.
Gherardi, 1999, J. Mol. Biol. 285, 775-83)). Only 1-5% of L1 or L2
clones are active, as judged by PCR, but a single round of CSR
selection for polymerase activity under standard PCR conditions
increased the proportion of active clones to 81% (L1*) and 77%
(L2*).
Example 5
Mutagenic PCR
[0246] Taq polymerase gene variants are constructed using two
different methods of error-prone PCR.
[0247] The first utilises the nucleoside analogues dPTP and dLTP
(Zaccolo et al., 1996, J. Mol. Biol. 255, 589-603). Briefly, a
3-cycle PCR reaction comprising 50 mM KCl, 10 mM TrisHCl (pH9.0),
0.1% Triton X-100, 2 mM MgCl2, dNTPS (500 .mu.M), dPTP (500 .mu.M),
dLTP (500 .mu.M), 1 pM template DNA, primers 8 and 9 (1 .mu.M
each), Taq polymerase (2.5 units) in a total volume of 50 .mu.l is
carried out with the thermal profile 94.degree. C. (1 min),
55.degree. C. (1 min), 72.degree. C. (5 min). A 2 .mu.l aliquot is
then transferred to a 100 .mu.l standard PCR reaction comprising 50
mM KCl, 10 mM Tris-HCl (pH9.0), 0.1% Triton X-100, 1.5 mM MgCl2,
dNTPS (250 .mu.M), primers 6 and 7 (1 .mu.M each), Taq polymerase
(2.5 units). This reaction is cycled 30.times. with the profile
94.degree. C. (30 seconds), 55.degree. C. (30 seconds), 72.degree.
C. (4 minutes). Amplified product is gel-purified, and cloned into
pASK75 as above to create library L2.
[0248] The second method utilises a combination of biased dNTPs and
MnCl.sub.2 to introduce errors during PCR. The reaction mix
comprises 50 mM KCl, 10 mM Tris-HCl (pH9.0), 0.1% Triton X-100, 2.5
mM MgCl.sub.2, 0.3 mM MnCl.sub.2, 1 pM template DNA, dTTP, dCTP,
dGTP (all 1 mM), dATP (100 .mu.M) primers 8 and 9 (1 .mu.M each)
and Taq polymerase (2.5 units). This reaction is cycled 30.times.
with the profile 94.degree. C. (30 seconds), 55.degree. C. (30
seconds), 72.degree. C. (4 minutes), and amplified products cloned
as above to create library L1.
Example 6
Selection Protocol
[0249] For selection of active polymerases, PCR reactions within
emulsions are carried out as described above but using primers 8,
9. For selection of variants with increased thermostability,
emulsions are preincubated at 99.degree. C. for up to 7 minutes
prior to cycling as above. For selection of variants with increased
activity in the presence of the inhibitor heparin, the latter is
added to concentrations of 0.08 and 0.16 units/.mu.l and cycling
carried out as above. Detailed protocols are set out in further
Examples below.
[0250] Amplification products resulting from compartments
containing an active polymerase are extracted from emulsion with
ether as before and then purified by standard phenolchlofororm
extraction. 0.5 volumes of PEG/MgCl.sub.2 solution (30% v/v PEG
800, 30 mM MgCl.sub.2) is next added, and after mixing
centrifugation carried out at 13,000 RPM for 10 minutes at room
temperature. The supernatant (containing unincorporated primers and
dNTPs) is discarded and the pellet re-suspended in TE. Amplified
products are then further purified on spin-columns (Qiagen) to
ensure complete removal of primers. These products are then
re-amplified using primers 6, 7 (which are externally nested to
primers 8 and 9) in a standard PCR reaction, with the exception
that only 20 cycles are used. Re-amplified products are
gel-purified and re-cloned into pASK75 as above. Transformants are
plated and colonies screened as below. The remainder are scraped
into 2.times.TY/0.1 mg/ml ampicillin, diluted down to
OD.sub.600=0.1 and grown/induced as above for repetition of the
selection protocol.
Example 7
Colony Screening Protocol
[0251] Colonies are picked into a 96 well culture dish (Costar),
grown and induced for expression as above. For screening, 2 .mu.l
of cells are used in a 30 .mu.l PCR reaction to test for activity
as above in a 96 well PCR plate (Costar) using primers 4 and 5. A
temperature gradient block is used for the screening of selectants
with increased thermostability. Reactions are preincubated for 5
minutes at temperatures ranging from 94.5 to 99.degree. C. prior to
standard cycling as above with primers 4 and 5 or 3 and 4. For
screening of heparin-compatible polymerases, heparin is added to
0.1 units/30 .mu.l during the 96-well format colony PCR screen.
Active polymerases are then assayed in a range of heparin
concentrations ranging from 0.007 to 3.75 units/30 .mu.l and
compared to wild-type.
Example 8
Assay for Catalytic Activity of Polymerases
[0252] K.sub.cat and K.sub.m (dTTP) are determined using a
homopolymeric substrate (Polesky et al., 1990, J. Biol. Chem.
265:14579-91). The final reaction mix (25 .mu.l) comprises 1.times.
SuperTaq buffer (HT Biotech), poly(dA).oligo(dT)(500 nM,
Pharmacia), and variable concentrations of [.alpha.-.sup.32P]dTTP
(approx. 0.01 Ci/mmole). The reaction is initiated by addition of 5
.mu.l enzyme in 1.times. SuperTaq buffer to give a final enzyme
concentrations between 1-5 nM. Reactions are incubated for 4
minutes at 72.degree. C., quenched with EDTA as in example 14, and
applied to 24 mm DE-81 filters. Filters are washed and activity
measured as in example 14. Kinetic parameters are determined using
the standard Lineweaver-Burke plot. Experiments using 50% reduced
homopolymer substrate show no gross difference in incorporation of
dTTP by polymerase, indicating it is present in sufficient excess
to validate the kinetic analysis protocol used.
Example 9
Standard PCR in Aqueous Compartments within an Emulsion
[0253] To establish whether conditions in the aqueous compartments
present in an emulsion are permissive for catalysis, a standard
reaction mix is emulsified and PCR carried out. This leads to
amplification of the correct sized Taq polymerase gene present in
the plasmid template, with yields sufficient yields to allow
visualisation using standard agarose gel electrophoresis.
Example 10
Emulsification of E. coli Expressing Taq Polymerase and Subsequent
PCR to Amplify Polymerase Gene
[0254] E. coli cells expressing Taq polymerase are emulsified and
PCR carried out using primers flanking the polymerase cassette in
the expression vector. Emulsification of up to 5.times.10.sup.8
cells (per 600 .mu.l total volume) leads to discernible product
formation as judged by agarose gel electrophoresis. The cells
therefore segregate into the aqueous compartments where conditions
are suitable for self-amplification of the polymerase gene by the
expressed Taq polymerase. Similar emulsions are estimated to
contain about 1.times.10.sup.10 compartments per ml (Tawfik D. and
Griffiths A. D., 1998, Nature Biotech. 16, 652). The large number
of cells that can be emulsified allows for selection from diverse
repertoires of randomised protein.
Example 11
Maintenance of Genotype-Phenotype Linkage in Emulsion
[0255] To be viable for a selection method, the majority of aqueous
compartments in the emulsion should harbour a single cell, and the
integrity of compartments should be maintained during thermal
cycling. This is tested by including in the emulsion cells
harbouring a competitor template distinguishable by its smaller
size.
[0256] E. coli expressing Taq polymerase are co-emulsified with E.
coli expressing the Stoffel fragment at a ratio of one to one. The,
Stoffel fragment is poorly active under the conditions used in
emulsion, and thus amplification of its expression cassette by the
same primer pair used for Taq self-amplification is the result of
co-compartmentalisation with a cell expressing active Taq
polymerase or leakage of Taq polymerase between compartments. After
PCR, the vast majority of products are found to correspond to the
active Taq polymerase gene thus validating the premise of one cell
per durable compartment (see FIG. 2, Ghadessy et al., 2001, PNAS
98, 4552).
Example 12
Test Selection of Active over Inactive Taq Polymerase
[0257] To demonstrate that the method can select for potentially
rare variants, a 10.sup.6 fold excess of cells expressing inactive
polymerase over those expressing the active form are co-emulsified.
After PCR and cloning of amplified product, a single expression
screen using a 96 well format indicated a 10.sup.4 fold enrichment
for the active polymerase.
Example 13
Directed Evolution of Taq Polymerase Variants with Increased
Thermal Stability
[0258] Polymerases with increased thermostability are of potential
practical importance, reducing activity loss during thermocycling
and allowing higher denaturation temperatures for the amplification
of GC rich templates. Thus, we first used the selection method of
our invention for the directed evolution of Taq variants with
increased thermostability, starting from preselected libraries
(L1*, L2*) and progressively increasing the temperature and
duration of the initial thermal denaturation. After 3 rounds of
selection, we isolated T8 (Table 1), a Taq clone with an 11-fold
longer half-life at 97.5.degree. C. than the already thermostable
wt Taq enzyme (Table 2), making T8 the most thermostable member of
the Pol I family on record. Clones are screened and marked by a PCR
assay. Briefly, 2 .mu.l of induced cells are added to 30 .mu.l PCR
mix and amplification of a 0.4 kb fragment is assayed under
selection conditions (e.g. increasing amounts of heparin).
Thermostability and heparin resistance of purified His tagged wt
and mutant Taq clones is determined as in Lawyer et al., 1993, PCR
Methods Appl. 2, 275-287; Lawer et al., 1989, J. Biol. Chem. 264,
6427-37, using activated salmon sperm DNA and normalized enzyme
concentrations. Mutations conferring thermostability to T8 (and to
a majority of less thermostable mutants) cluster in the 5'-3'
exonuclease domain (Table 1). Indeed, truncation variants of Taq
polymerase (F. C. Lawyer et al., 1993, PCR Methods Appl. 2, 275-87;
W. M. Barnes, 1992, Gene 112, 29-35) lacking the exonuclease domain
show improved thermostability, suggesting it may be less
thermostable than the main polymerase domain. The lower
thermostability of the exonuclease domain may have functional
significance (for example reflecting a need for greater
flexibility), as the stabilizing mutations in T8 appear to reduce
exonuclease activity (approx. 5-fold) (5'-3' exonuclease activity
is determined essentially as in (Y. Xu et al., 1997, J. Mol. Biol.
268, 284-302) but in 1.times. Taq buffer with 0.25 mM dNTP's and
the 22-mer oligonucleotide of (Y. Xu et al., 1997, J. Mol. Biol.
268, 284-302) 5' labelled with (Amersham). Steady-state kinetics
are measured as in A. H. Polesky, T. A. Steitz, N. D. Grindley, C.
M. Joyce, 1990, J. Biol. Chem. 265, 14579-91, using the
homopolymeric substrate poly(dA).sub.200 (Pharmacia) and
oligo(dT).sub.40 primer at 50.degree. C. (at least at low
temperature).
TABLE-US-00001 TABLE 1 Properties of Selected Clones Thermo-
Heparin Round Taq variant stability* Resistance* Taq.sub.wt 1 1 1
T646 (G46V, A109P, F285L) 2x n.d. T788 (F73S, R205K, K219E, M236T,
A608V) 4x n.d. 2 T9 (F278L, P298S) 4x n.d. T13 (R205K, K219E,
M236T, A608V) 7x n.d. 3 T8 (F73S, R205K, K219E, M236T, E434D,
A608V) 11x <0.5x 1 H32 (E9K, P93S, K340E, Q534R, T539A, V703A,
n.d. 8x R778K) 2 H94 (K225E, L294P, A454S, L461R, D578G, N583S)
n.d. 32x 3 H15 (K225E, E388V, K540R, D578G, N583S, M747R) 0.3x 130x
*as judged by PCR (relative to Taq.sub.wt), at 97.5.degree. C. **as
judged by PCR (relative to Taq.sub.wt) Clones in bold are related
through underlined mutations. Clones are ranked in relation to wt
Taq.
[0259] Two libraries of Taq polymerase variants generated using
error-prone PCR are expressed in E. coli (library L1,
8.times.10.sup.7 clones, library L2, 2.times.10.sup.7 clones; see
example 5) and emulsified as before. The first round of PCR is
carried out to enrich for active variants using the standard Taq
polymerase thermocycling profile outlined above. Enriched
amplification products are purified, and recloned to generate
libraries comprising of active variants (L1*, L2*; approx. 10.sup.6
clones for each library). A screen of the L1* and L2* libraries
respectively showed 81% and 77% of randomly picked clones to be
active.
[0260] Selective pressure is applied to the L1* and L2* libraries
during the next round of PCR by pre-incubating emulsions at
99.degree. C. for 6 or 7 minutes prior to the normal PCR cycle.
Under these conditions, the wild-type Taq polymerase loses all
activity. Amplified products are enriched and cloned as above and a
96-well expression screen used to select for active variants under
normal PCR conditions. This yielded 7 clones form the L2* library
and 10 clones from the L1* library. These are then screened for
increased thermostability using a temperature gradient PCR block,
with a 5 minute pre-incubation at temperatures of 94.5 to
99.degree. C. prior to standard cycling. As judged by gel
electrophoresis, 5 clones from each library are present with
increased thermostability compared to wild-type. These mutants are
able to efficiently amplify the 320 b.p. target after
pre-incubation at 99.degree. C. for 5 minutes. The wild-type enzyme
has no discernible activity after pre-incubation at temperatures
above 97.degree. C. for 5 minutes or longer.
Example 14
Assay for Thermal Stability of Polymerase
[0261] Thermal inactivation assays of WT and purified His-tagged
polymerases are carried out in a standard 50 .mu.l PCR mixture
comprising 1.times. SuperTaq buffer (HT Biotech), 0.5 ng plasmid
DNA template, 200 .mu.M each of dATP, dTTP, and dGTP, primers 3 and
4 (10 .mu.M), and polymerase (approximately 5 nM). Reaction
mixtures are overlaid with oil and incubated at 97.5.degree. C.,
with 5 .mu.l aliquots being removed and stored on ice after defined
intervals. These aliquots are assayed in a 50 .mu.l activity
reaction buffer comprising 25 mM
N-tris[hydroxymethyl-3-amino-propanesulfonic acid (TAPS) (pH9.5), 1
mM .beta.-mercaptoethanol, 2 mM MgCl2, 200 .mu.M each dATP, dTTP,
and dGTP, 100 .mu.M[.alpha.-.sup.32P]dCTP (0.05 Ci/mmole), and 250
.mu.g/ml activated salmon sperm DNA template. Reactions are
incubated for 10 minutes at 72.degree. C., stopped by addition of
EDTA (25 mM final). Reaction volumes are made up to 500 .mu.l with
solution S (2 mM EDTA, 50 ug/ml sheared salmon sperm DNA) and 500
.mu.l 20% TCA (v/v) 12% sodium pyrophosphate (v/v) added. After 20
minutes incubation on ice, reactions are applied to 24 mm GF/C
filters (Whatman). Unincorporated nucleotides are removed by 3
washes with 5% TCA (v/v), 2% sodium pyrophosphate (v/v) followed by
two washes with 96% ethanol (v/v). Dried filters are counted in
scintillation vials containing Ecoscint A (National Diagnostics).
The assay is calibrated using a known amount of the labeled dCTP
solution (omitting the washes).
Example 15
Directed Evolution of Taq Polymerase Variants with Increased
Activity in the Presence of the Inhibitor Heparin
[0262] As indicated above, the methods of our invention can also be
used to evolve resistance to an inhibitor of enzymatic activity.
Heparin is a widely used anticoagulant, but also a potent inhibitor
of polymerase activity, creating difficulties for PCR
amplifications from clinical blood samples (J. Satsangi, D. P.
Jewell, K. Welsh, M. Bunce, J. I. Bell, 1994, Lancet 343, 1509-10).
While heparin can be removed from blood samples by various
procedures, these can be both costly and time-consuming. The
availability of a heparin-compatible polymerase would therefore
greatly improve characterisation of therapeutically significant
amplicons, and obviate the need for possibly cost-prohibitive
heparinase treatment of samples (Taylor A. C., 1997, Mol. Ecol. 6,
383).
[0263] The L1* and L2* libraries are combined, and selected in
emulsion for polymerases active in up to 0.16 units heparin per
.mu.l. After a single round, 5 active clones are isolated in the 96
well PCR screen incorporating 0.1 units/30 .mu.l reaction, with the
wild-type showing no activity. Titration shows that 4 of these
clones to be active in up to four times the amount of heparin
inhibiting wild-type (0.06 units/30 .mu.l versus 0.015 units/30
.mu.l). The other clone is active in up to eight times the amount
of heparin inhibiting wild-type (0.12 units/30 .mu.l versus 0.015
units/30 .mu.l).
[0264] Using selection in the presence of increasing amounts of
heparin, we isolated H15, a Taq variant functional in PCR at up to
130-times the inhibitory concentration of heparin (Table 2).
Intriguingly, heparin resistance conferring mutations also cluster,
in this case in the base of the finger and thumb polymerase
subdomains, regions involved in binding duplex DNA. Indeed, judging
from a recent high-resolution structure of a Taq-DNA complex (Y.
L1, S. Korolev, G. Waksman, 1998, EMBO J. 17, 7514-25) four out of
six residues mutated in H15 (K540, D578, N583, M747) directly
contact either template or product strand (as shown in FIG. 7). H15
mutations appear to be neutral (or mutually compensating) as far as
affinity for duplex DNA is concerned (while presumably reducing
affinity for heparin) (Table 2) (K.sub.D for DNA is determined
using BIAcore. Briefly, the 68-mer used in (M. Astalke, N. D.
Grindley, C. M. Joyce, 1995, J. Biol. Chem. 270, 1945-54) is
biotinylated at the 5' end and bound to a SA sensorchip and binding
of polymerases is measured in 1.times. Taq buffer (see above) at
20.degree. C. Relative K.sub.D values are estimated by the PCR
ranking assay using decreasing amounts of template). The precise
molecular basis of heparin inhibition is not known, but our results
strongly suggest overlapping (and presumably mutually exclusive)
binding sites for DNA and heparin in the polymerase active site,
lending support to the notion that heparin exerts its inhibitory
effect by mimicking and competing with duplex DNA for binding to
the active site. Our observation that heparin inhibition is
markedly reduced under conditions of excess template DNA, (see,
Clones are screened and ranked by a PCR assay. Briefly, 2 .mu.l of
induced cells are added to 30 .mu.l PCR mix and amplification of a
0.4 kb fragment is assayed under selection conditions (e.g.
increasing amounts of heparin). Thermostability and heparin
resistance of purified His tagged wt and mutant Taq clones is
determined as in (F. C. Lawyer et al., 1993, PCR Methods Appl. 2,
275-87; F. C. Lawyer et al., 1989, J. Biol. Chem. 264, 6427-37)
using activated salmon sperm DNA and normalized enzyme
concentrations, Table 2) appears consistent with this
hypothesis.
TABLE-US-00002 TABLE 2 Properties of Selected Taq Clones Heparin
5'-3' Taq T.sub.1/2 (97.5.degree. C.) resistance K.sub.D k.sub.cat
K.sub.M-dTTP exo Mutation clone (min) (units/ml) (nM.sup.-1)
(s.sup.-1) (.mu.M) activity Rate.sup..sctn. Taq* n.d. n.d. 0.6***
0.8.sup..dagger. 4.0.sup..dagger-dbl. 43.2 n.d. 1.1 Taq.sub.wt
1.5** 90** 0.6*** 0.8 9.0 45.0 1 1 T8 16.5** n.d. 0.3*** 1.2 8.8
48.6 0.2 1.2 H15 0.3*** 1750* 84*** 0.79 6.8 47.2 1.5 0.9
*commercial Taq preparation (HT Biotechnology), **with N-terminal
His.sub.6 tag, measured by CTP.sup.32 incorporation into salmon
sperm DNA, ***no tag, measured by PCR assay, .sup..dagger.Taq,
published value: 1 nM.sup.-1 (1), Klenow (Cambio), 4 nM.sup.-1,
.sup..dagger-dbl.E. coli DNA Pol I, published value: 3.8 s.sup.-1
(A. H. Polesky, T. A. Steitz, N. D. Grindley, C. M. Joyce, 1990, J.
Biol. Chem. 265, 14579-91), .sup..sctn.in relation to Taq.sub.wt
measured by mutS ELISA (Genecheck) (P. Debbie et al., 1997, Nucleic
Acids Res. 25, 4825-4829), Pfu (Stratagene): 0.2.
Example 16
Template Evolution in Emulsion Selection
[0265] A classic outcome of in vitro replication experiments is an
adaptation of the template sequence towards more rapid replication
(S. Spiegelman, 1971, Q. Rev. Biophys. 4, 213-253). Indeed, we also
observe template evolution through silent mutations. Unlike the
coding mutations (AT to GC vs. GC to AT/29 vs. 16), non-coding
mutations display a striking bias (AT to GC vs. GC to AT/0 vs. 42)
towards decreased GC content, generally thought to promote more
efficient replication by facilitating strand separation and
destabilizing secondary structures. Apart from selecting for
adaptation, our method may also select for adaptability; i.e.
polymerases might evolve towards an optimal, presumably higher,
rate of self-mutation (M. Eigen, 1971, Naturwissenschaften 58,
465-523). Indeed, mutators can arise spontaneously in asexual
bacterial populations under adaptive stress (F. Taddei et al.,
1997, Nature 387, 700-2; P. D. Sniegowski, P. J. Gerrish, R. E.
Lenski, 1997, Nature 387, 703-5). By analogy, it could be argued
that our method might favour polymerase variants that are more
error-prone and hence capable of faster adaptive evolution.
However, none of the selected polymerases displayed increased error
rates (Table 2). Eliminating recombination and decreasing the
mutational load during our method cycle may increase selective
pressures towards more error-prone enzymes.
Example 17
Assay for Heparin Tolerance of Polymerases
[0266] Heparin tolerance of polymerases is assayed using a similar
assay to that for thermal stability. Heparin is serially diluted
into the activity buffer (0-320 units/45 .mu.l) and 5 .mu.l of
enzyme in the standard PCR mixture above are added. Reactions are
incubated and incorporation assayed as above.
Example 18
Selection for Taq Variants with Increased Ability to Extend from a
3' Mismatched Base
[0267] The primers used are Primer 9 (LMB388ba5WA) and Primer 10
(8fo2WC). This primer combination presents polymerase variants with
a 3' purine-purine mismatch (A-G), and a 3' pyrimidine-pyrimidine
mismatch (C-C). These are the mismatches least tolerated by Taq
polymerase (Huang et al., 1992, Nucleic Acids Res. 20 (17),
4567-73) and are poorly extended.
[0268] The selection protocol is essentially the same as before,
except that these two primers are used in emulsion. Extension time
is also increased to 8 minutes. After two rounds of selection, 7
clones are isolated which display up to a 16-fold increase in
extension off the mismatch as judged by a PCR ranking assay (see
example 2: using primers 5 and 11) and standardised for activity
using the normal primer pair. These clones are subsequently
shuffled back into the original L1* and L2* libraries along with
wild-type Taq and the selection process repeated, albeit with a
lower number of cycles (10) during the CSR reaction. This round of
selection yielded numerous clones, the best of which displayed up
to 32-fold increase in mismatch extension as judged by PCR (see
example 2) using primers 5 and 11.
[0269] Incorporation of an incorrect base pair by Taq polymerase
can stall the polymerisation process as certain mismatches (see
above) are poorly extended by Taq. As such, Taq polymerase alone
cannot be used in the amplification of large (>6 Kb) templates
(Barnes). This problem can be overcome by supplementing Taq with a
polymerase that has a 3'-5' exonuclease activity (eg Pfu
polymerase) that removes incorrectly incorporated bases and allows
resumption of polymerisation by Taq. The clones above are therefore
investigated for their ability to carry out amplification of large
DNA fragments (long-distance PCR) from a lambda DNA template, as
incorporation of an incorrect base would not be expected to stall
polymerisation. Using primers 12 (LBA23) and 13 (LF046) (1 uM each)
in a 50 ul PCR reaction containing 3 ng lambda DNA (New England
Biolabs) dNTPs (0.2 mM), 1.times.PCR buffer (HT Biotech) clone M1
is able to amplify a 23 Kb fragment using 20 repetitions of a
2-step amplification cycle (94.degree. C., 15 seconds; 68.degree.
C., 25 minutes). Wild-type polymerase is unable to extend products
above 13 kb using the same reaction buffer. Commercial Taq (Perkin
Elmer) could not extend beyond 6 kb using buffer supplied by the
manufacturer.
Example 19
Selection Using Self-Sustained Sequence Replication (3SR)
[0270] To demonstrate the feasibility of 3SR within emulsion, the
Taq polymerase gene is first PCR-amplified from the parent plasmid
(see example 1) using a forward primer that is designed to
incorporate a T7 RNA polymerase promoter into the PCR product. A
250 .mu.l 3SR reaction mix comprising the modified Taq gene (50
ng), 180 units T7 RNA polymerase (USB, 63 units reverse
transcriptase (HT Biotech), rNTPs (12.5 mM), dNTPs (1 mM),
MgCl.sub.2 (10 mM), primer Taqba2T7 (primer 12; 125 pmoles), primer
88fo2 (primer 4; 125 pmoles), 25 mM Tris-HCl (pH 8.3), 50 mM KCl,
and 2.0 mM DTT is made. 200 .mu.l of this is emulsified using the
standard protocol. After prolonged incubation at room temperature,
amplification of the Taq gene (representing a model gene size)
within emulsion is seen to take place as judged by standard
gel-electrophoresis.
[0271] To further expand the scope of the method, the 3SR reaction
is carried out in an in-vitro transcription/translation extract
(EcoPro, Novagen). The inactive Taq gene (see example 1) is
amplified from parental plasmid using primers 2 (TaqfoSal) and 12
(Taqba2T7). 100 ng (approx. 1.times.10.sup.10 copies) is added to
make up 100 ul of the aqueous phase comprising EcoPro extract (70
ul), methionine (4 ul), reverse transcriptase (84 units, HT
Biotech), primer 12 (Taqba2T7, 2 uM), primer 13 (TaqfoLMB2, 2 uM),
dNTPs (250 uM). The aqueous phase is emulsified into 400 ul
oil-phase using the standard protocol. After incubation at
37.degree. C. overnight, the emulsion is extracted using the
standard protocol and the aqueous phase further purified using a
PCR-purification column (Qiagen). Complete removal of primers is
ensured by treating 5 ul of column eluate with 2 .mu.l ExoZap
reagent (Stratagene). DNA produced in emulsion by 3SR is rescued by
using 2 .mu.l of treated column eluate in an otherwise standard 50
ul PCR reaction using 20 cycles of amplification and primers 6
(LMB, ref 2) and 12 (Taqba2T7). Compared to background (the control
reaction where reverse transcriptase is omitted from the 3SR
reaction in emulsion), a more intense correctly sized band could be
seen when products are visualised using agarose gel
electrophoresis. The 3SR reaction can therefore proceed in the
transcription/translation extracts, allowing for the directed
evolution of agents expressed in aqueous compartments.
[0272] WT Taq polymerase has limited reverse transcriptase activity
(Perler et al., 1996, Adv. Protein Chem. 48, 377-435). It is also
known that reverse transcriptases (eg HIV reverse transcriptase
that has both reverse transcriptase and polymerase activities) are
considerably more error prone than other polymerases. This raises
the possibility that a more error-prone polymerase (where increased
tolerance for non-cognate substrate is evident) might display
increased reverse transcriptase activity. The genes for Taq
variants M1, M4 as well as the inactive mutant are amplified from
parental plasmids using primers 12 (Taqba2T7) and 2 (TaqfoSal) and
the 3SR reaction is carried out as above in the
transcription/translation extract (Novagen) with the exception that
reverse transcriptase is not exogenously added. In control
reactions, methionine is omitted from the reaction mix. After 3
hours incubation at 37.degree. C., the reaction is treated as above
and PCR carried out using primer pair 6 and 12 to rescue products
synthesised during the 3SR reaction. Of the clones tested, clone M4
gave a more intense correctly sized band compared to control
reaction when products are visualised using agarose gel
electrophoresis. Clone M4 would therefore appear to possess some
degree of reverse transcriptase activity. This result shows that it
is possible to express functionally active replicases in vitro.
When coupled to selection by compartmentalisation, novel replicases
could be evolved.
Selection of Agents Modifying Replicase Activity
[0273] Example 19 and the following Examples describes how the
methods of our invention may be employed to select an enzyme which
is involved in a metabolic pathway whose final product is a
substrate for the replicase. These Examples show a method for
selection of nucleoside diphosphate kinase (NDP Kinase), which
catalyses the transfer of a phosphate group from ATP to a
deoxynucleoside diphosphate to produce a deoxynucleoside
triphosphate (dNTP). Here, the selectable enzyme (NDK) provides
substrates for Taq polymerase to amplify the gene encoding it. This
selection method differs from the compartmentalized
self-replication of a replicase (CSR, Ghadessy and Holliger) in
that replication is a coupled process, allowing for selection of
enzymes (nucleic acids and protein) that are not replicases
themselves. Bacteria expressing NDK (and containing its gene on an
expression vector) are co-emulsified with its substrate (in this
case, dNDPs and ATP) along with the other reagents needed to
facilitate its amplification (Taq polymerase, primers specific for
the ndk gene, and buffer). Compartmentalization in a water-in-oil
emulsion ensures the segregation of individual library variants.
Active clones provide the dNTPs necessary for Taq polymerase to
amplify the ndk gene. Variants with increased activity provide more
substrate for its own amplification and hence post-selection copy
number correlates to enzymatic activity within the constraints of
polymerase activity. Additional selective pressure arises from the
minimum amount of dNTPs required for polymerase activity, hence
clones with increased catalytic activity are amplified
preferentially at the expense of poorly active variants (selection
is for k.sub.cat as well as K.sub.m).
[0274] By showing that we can evolve an enzyme whose product feeds
into the polymerase reaction, we hope to eventually co-evolve
multiple enzymes linked through a pathway where one enzyme's
product is substrate for the next. Diversity could be introduced
into two or more genes, and both genes could be co-transformed into
the same expression host on plasmids or phage. We hope to develop
cooperative enzyme systems that enable selection for the synthesis
of unnatural substrates and their subsequent incorporation into
DNA.
Example 20
Induced Expression of NDP Kinase in Bacterial Cells
[0275] A pUC19 expression plasmid containing the EcoRI/HindIII
restriction fragment with the open reading frame of Nucleoside
Diphosphate Kinase from Myxococcus Xanthus is cloned. Plasmid is
prepared from an overnight culture and transformed into the ndk-,
pykA-, pykF-strain of E. coli QL1387. An overnight culture of
QL1387/pUC19ndk is grown in the presence of chloramphenicol (10
.mu.g/ml final concentration), ampicillin (100 .mu.g/ml final
concentration) and glucose (2%) for 14-18 hours. The overnight
culture is diluted 1:100 in (2.times.TY, 10 .mu.g/ml
chloramphenicol, 100 .mu.g/ml anipicillin and 0.1% glucose). Cells
are grown to an O.D. (600 nm) of 0.4 and induced with IPTG (1 mM
final concentration) for 4 hours at 37.degree. C. After protein
induction, cells are washed once in SuperTaq buffer (10 mM tris-HCL
pH 9, 50 mM KCl, 0.1% Triton X-100, 1.5 mM MgCl2, HT Biotechnology)
and resuspended in 1/10 volume of the same buffer. The number of
cells is quantified by spectrophotometric analysis with the
approximation of O.D.600 0.1=1.times.10.sup.8 cells/ml.
Example 21
Phosphoryl Transfer Reaction in Aqueous Compartments within an
Emulsion
[0276] To establish whether deoxynucleoside diphosphates can be
phosphorylated by NDP kinase in Taq buffer, a standard PCR reaction
is carried out in which dNTPs are replaced by dNDPs and ATP, a
donor phosphate molecule. Nucleoside diphosphate kinase is
expressed from E. coli QL1387 (a ndk and pyruvate kinase deficient
strain of E. coli) as described in the previous example. Cells are
mixed with the PCR reaction mix.
[0277] Washed cells are added to a PCR reaction mixture (approx.
8e5 cells/.mu.l final concentration) containing SuperTaq buffer,
0.5 .mu.M primers, 100 .mu.M each dNDP, 400 .mu.M ATP, SuperTaq
polymerase (0.1 unit/.mu.l final concentration, HT
Biotechnology).
[0278] After breaking open the cells at 65.degree. C. for 10 min,
incubating the reaction mixture for 10 minutes at 37.degree. C.,
and thermocycling (15 cycles of 94.degree. C. 15 sec, 55.degree. C.
30 sec, 72.degree. C. 1 min 30 sec), amplified products are
visualized on a standard 1.5% agarose/TBE gel stained with ethidium
bromide (Sambrook). The results of this experiment show that
expressed NDP kinase can phosphorylate dNDPs to provide Taq
polymerase with substrates for the PCR amplification of the ndk
gene.
[0279] The experiment is repeated, with the additional step of
emulsifying the reaction mixture with mineral oil and detergent as
described above. It is found that NDP kinase is active within
aqueous compartments of an emulsion.
Example 22
Compartmentalization of NDK Variants by Emulsification
[0280] The original emulsion mix allowed for the diffusion of small
molecules between compartments during thermocycling. However, by
adjusting the water to oil ratio and minimizing the thermocycling
profile, the exchange of product and substrate between compartments
is minimized, resulting in a tighter linkage of genotype to
phenotype. Given the diffusion rates can be controlled by modifying
the emulsion mix, it may be possible to adjust buffer conditions
after emulsification, possibly allowing for greater control of
selection conditions (i.e. adjusting pH with the addition of acid
or base, or starting/stopping reactions with the addition of
substrates or inhibitors).
[0281] 150 .mu.l of PCR reaction mix (SuperTaq buffer, 0.5 .mu.M
each primer, 100 .mu.M each dNDP, 400 .mu.M ATP, 0.1 unit/.mu.l Taq
polymerase, 8.times.10.sup.5 cells/.mu.l of QL1387/ndk) are added
dropwise (1 drop/5 sec) to 450 .mu.l oil phase (mineral oil) in the
presence of 4.5% v/v Span 80, 0.4% v/v Tween 80 and 0.05% v/v
Triton X-100 under constant stirring in a 2 ml round bottom
biofreeze vial (Corning). After addition of the aqueous phase,
stirring is continued for an additional 5 minutes. Emulsion
reactions are aliquoted (100 .mu.l) into thin-walled PCR tubes and
thermocycled as indicated above.
[0282] Recovery of amplified products after emulsification is
carried out as follows. After thermocycling, products are recovered
by extraction with 2 volumes of diethyl ether, vortexed, and
centrifuged for 10 minutes in a tabletop microfuge. Amplification
products are analyzed as before.
Example 23
Minimizing Background Kinase Activity
[0283] Background kinase activity levels are determined by
emulsifying E. coli TG1 cells in Taq buffer with substrates, as
described above. It is found that native nucleoside diphosphate
kinase from E. coli retained enough activity after the initial
denaturation to provide significant kinase activity in our assay.
The pUC19 expression plasmid containing the ndk gene is transformed
into a ndk deficient strain of E. coli QL1387. Compared to a
catalytic knockout mutant of mx ndk (H117A), the background kinase
activity is determined to be negligible in our assay (amplified
products could not be visualized by agarose gel electrophoresis)
when ndk is expressed from the knockout strain.
Example 24
Maintenance of the Genotype-Phenotype Linkage in Emulsion
[0284] A catalytic knockout mutation (NDK H117A) of NDP kinase is
co-emulsified with wild-type NDP kinase in equal amounts. The
inactive mutant of ndk is distinguished by a smaller amplification
product, since the 5' and 3' regions flanking the ORF downstream
from the priming sites are removed during construction of the
knockout mutant. Our emulsification procedure gives complete bias
towards amplification of the active kinase, as determined by
agarose gel electrophoresis.
Example 25
Method for the Parallel Genotyping of Heterogenous Populations of
Cells
[0285] The approach involves compartmentation of the cells in
question in the emulsion (see WO9303151) together with PCR reagents
etc. and polymerase. However, instead of linking genes derived from
one cell by PCR assembly, one (or several) biotinylated primers are
used as well as a streptavidin coated polystyrene beads (or any
other suitable means of linking primers onto beads). Thus, PCR
fragments from one single cell are transferred to a single bead.
Beads are pooled, interrogated for presence of a certain mutation
or allele using fluorescently labelled probes (as described for
"Digital PCR") and counted by FACS. Multiplex PCR allows the
simultaneous interrogation of 10 or maybe more markers. Single
beads can also be sorted for sequencing.
[0286] Applications include, for example, diagnosis of asymptomatic
tumors, which hinge on the detection of a very small number of
mutant cells in a large excess of normal cells. The advantage of
this method over cytostaining is through-put. Potentially
10.sup.8-10.sup.9 cells can be interrogated simultaneously.
Example 25
Short-Patch CSR
[0287] The present example relates to the selection of polymerases
with low catalytic activity or processivity. Compartmentalized
Self-Replication (CSR), as described, is a method of selecting
polymerase variants with increased adaptation to distinct selection
conditions. Mutants with increased catalytic activity have a
selective advantage over ones that are less active under the
selection conditions. However, for many selection objectives (e.g.
altered substrate specificity) it is likely that intermediates
along the evolutionary pathway to the new phenotype will have
lowered catalytic activity. For example, from kinetic studies of E.
coli DNA polymerase I, mutations such as E710A increased affinity
and incorporation of ribonucleotides at the expense of lower
catalytic rates and less affinity for wild-type substrates
(deoxyribonucleotides) (F. B. Perler, S. Kumar, H. Kong, 1996, Adv.
in Prot. Chem. 48, 377-430). The corresponding mutant of Taq DNA
polymerase I, E615A, could incorporate ribonucleotides into PCR
products more efficiently than wild-type polymerase. However, using
wild-type substrates, it is only able to synthesize short fragments
and not the full-length Taq gene, as analyzed by agarose gel
electrophoresis. Therefore it would be difficult to select for this
mutation by CSR. In another selection experiment in which
Beta-glucuronidase is evolved into a .beta.-galactosidase, the
desired phenotype is obtained after several rounds of selection but
at the expense of catalytic activity. It is also found that
selected variants in the initial rounds of selection are able to
catalyze the conversion of several different substrates not
utilized by either parental enzyme, and at much lower catalytic
rates (T. A. Steitz, 1999, J. Biol. Chem. 274, 17395-8).
[0288] In order to address the problem of being able to select
polymerase variants with low catalytic activity or processivity
such as may occur along an evolutionary trajectory to a desired
phenotype, a variant of CSR, in which only a small region (a
"patch") of the gene under investigation is randomized and
replicated, is employed. The technique is referred to as
"short-patch CSR" (spCSR). spCSR allows for less active or
processive polymerases to still become enriched during a round of
selection by decreasing the selective advantage given to highly
active or processive mutants. This method expands on the previously
described method of compartmentalized self-replication, but,
because the entire gene is not replicated, the short patch method
is also useful for example for investigating specific domains
independent of the rest of the protein.
[0289] There are many ways to introduce localised diversity into a
gene, among these are error-prone PCR (using manganese or synthetic
bases, as described above for the Taq polymerase library), DNA
shuffling (C. A. Brautigani, T. A. Steitz, 1998, Curr. Opin.
Struct. Biol. 8, 54-63; Y. L1, S. Korolev, G. Waksman, 1998, EMBO
J. 17, 7514-25), cassette mutagenesis (E. Bedford, S. Tabor, C. C.
Richardson, 1997, Proc. Natl. Acad. Sci. USA 94, 479-84), and
degenerate oligonucleotide directed mutagenesis (Y. L1, V. Mitaxov,
G. Waksman, 1999, Proc. Natl. Acad. Sci. USA 96, 9491-6; M. Suzuki,
D. Baskin, L. Hood, L. A. Loeb, 1996, Proc. Natl. Acad. Sci. USA
93, 9670-5) and its variants, e.g. sticky feet mutagenesis (J. L.
Jestin, P. Kristensen, G. Winter, 1999, Angew. Chem. Int. Ed. 38,
1124-1127), and random mutagenesis by whole plasmid amplification
(T. Oberholzer, M. Aibrizio, P. L. Luisi, 1995, Chem. Biol. 2,
677-82). Combinatorial alanine scanning (A. T. Haase, E. F. Retzel,
K. A. Staskus, 1990, Proc. Natl. Acad. Sci. USA 87, 4971-5) may be
used to generate library variants to determine which amino acid
residues are functionally important.
[0290] Structural (M. J. Embleton, G. Gorochov, P. T. Jones, G.
Winter, 1992, Nucleic Acids Res. 20, 3831-7), sequence alignment
(D. S. Tawfik, A. D. Griffiths, 1998, Nat. Biotechnol. 16,
652-656), and biochemical data from DNA polymerase I studies reveal
regions of the gene involved in nucleotide binding and catalysis.
Several possible regions to target include regions 1 through 6, as
discussed in D. S. Tawfik, A. D. Griffiths, 1998, Nat. Biotechnol.
16, 652-656 (regions 3, 4, and 5 are also referred to as Motif A,
B, and C, respectively, in Taq DNA polymerase I). Other possible
targeted regions would be those regions conserved across several
diverse species, those implicated by structural data to contact the
nucleotide substrate or to be involved in catalysis or in proximity
to the active site, or any other region important to polymerase
function or substrate binding.
[0291] During a round of selection, each library variant is
required to replicate only the region of diversity. This can be
easily achieved by providing primers in a PCR reaction which flank
the region diversified. CSR selections would be done essentially as
described. After CSR selection the short region which is
diversified and replicated now is reintroduced into the starting
gene (or another genetic framework e.g. a library of mutants of the
parent gene, a related gene etc.) using either appropriately
situated restriction sites or PCR recombination methods like PCR
shuffling or Quickchange mutagenesis etc. The spCSR cycle may be
repeated many times and multiple regions could be targeted
simultaneously or iteratively with flanking primers either
amplifying individual regions separately or inclusively.
[0292] To increase stringency in selections at a later stage spCSR
is tunable simply by increasing the length of replicated sequence
as defined by the flanking primers up to full length CSR. Indeed,
for selection for processivity i.a. it may be beneficial to extend
the replicated segment beyond the encoding gene to the whole vector
using strategies analogous to iPCR (inverted PCR).
[0293] spCSR can have advantages over full length CSR not only when
looking for polymerase variants with low activities or
processivities but also when mapping discrete regions of a protein
for mutability, e.g. in conjunction with combinatorial alanine
scanning (A. T. Haase, E. F. Retzel, K. A. Staskus, 1990, Proc.
Natl. Acad. Sci. USA 87, 4971-5) to determine which amino acid
residues are functionally important. Such information may be useful
at a later stage to guide semi-rational approaches, i.e. to target
diversity to residues/regions not involved in core polymerase
activity. Furthermore spCSR may be used to transplant polypeptide
segments between polymerases (as with immunoglobulin CDR grafting).
A simple swap of segments may lead initially to poorly active
polymerases because of steric clashes and may require "reshaping"
to integrate segments functionally. Reshaping may be done using
either full length CSR (e.g. from existing random mutant libraries)
or spCSR targeted to secondary regions ("Vernier zone" in
antibodies).
[0294] Short patches may also be located at either N- or C-terminus
as extensions to existing polymerase gene sequences or as internal
insertions. Precedents for such phenotype modifying extensions and
insertions exist in nature. For example both a C-terminal extension
of T5 DNA pol and the thioredoxin-binding insertion in T7 DNA pol
are critical for processivity in these enzymes and enable them to
efficiently replicate the large (>30 kb) T-phage genomes. N- or
C-terminal extensions have also been shown to enhance activity in
other enzymes.
Example 26
Low Temperature CSR Using Klenow Fragment
[0295] Klenow fragment was cloned from E. coli genomic DNA into
expression vector pASK75 (as with Taq) and expressed in E. coli
strain DH5.alpha.Z1 (Lutz R. and Bujard H., 1997, Nucleic Acids
Res. 25, 1203). Cells were washed and resuspended in 10 mM Tris
pH7.5. 2.times.10.sup.8 resuspended cells (20 .mu.l) were added to
200 .mu.l low temperature PCR buffer (LTP) (Iakobashvili, R. and
Lapidot, A., 1999, Nucleic Acids Res. 27, 1566) and emulsified as
described (Ghadessy et al., 2001, PNAS 98, 4552). LTP was 10 mM
Tris (pH7.5), 5.5M L-proline, 15% w/v glycerol, 15 mM
MgCl2+suitable primers (because proline lowers melting temperature,
primers need to be 40-mers or longer) and dNTP's and emulsified as
described. Low temperature PCR cycling was 70.degree. C. 10 min,
50.times. (70.degree. C. 30 sec, 37.degree. C. 12 min). Aqueous
phase was extracted as described and puried selection products
reamplified as described (Ghadessy et al., 2001, PNAS 98,
4552).
[0296] All publications mentioned in the above specification are
herein incorporated by reference. Various modifications and
variations of the described methods and system of the invention
will be apparent to those skilled in the art without departing from
the scope and spirit of the invention. Although the invention has
been described in connection with specific preferred embodiments,
it should be understood that the invention as claimed should not be
unduly limited to such specific embodiments. Indeed, various
modifications of the described modes for carrying out the invention
which are apparent to those skilled in molecular biology or related
fields are intended to be within the scope of the following
claims.
TABLE-US-00003 TABLE 3 Primer Sequences Used in Examples Primer
Designation Sequence (5' to 3') Primer 1 TaqbaXba
GGCGACTCTAGATAACGAGGGCAAAAAATG (SEQ ID
CGTGGTATGCTTCCTCTTTTTGAGCCCAAGGG NO: 1) Primer 2 TaqfoSal
GCGGTGCGGAGTCGACTCACTCCTTGGCGGA (SEQ ID GAGCCAGTCCTC NO: 2) Primer
3 88ba4 AAAAATCTAGATAACGAGGGCAA (SEQ ID NO: 3) Primer 4 88fo2
ACCACCGAACTGCGGGTGACGCCAAGCG (SEQ ID NO: 4) Primer 5 Taqba(scr)
GGGTACGTGGAGACCCTCTTCGGCC (SEQ ID NO: 5) Primer 6 LMB2
GTAAAACGACGGCCAGT (SEQ ID NO: 6) Primer 7 LMB3 CAGGAAACAGCTATGAC
(SEQ ID NO: 7) Primer 8 88ba4LMB3 CAGGAAACAGCTATGACAAAAATCTAGATAA
(SEQ ID CGAGGGCAA NO: 8) Primer 9 88fo2LMB2
GTAAAACGACGGCCAGTACCACCGAACTGCG (SEQ ID GGTGACGCCAAGCG NO: 9)
Primer 10 LMB388ba5 CAG GAA ACA GCT ATG ACA AAA ATC TAG (SEQ ID WA
ATA ACG AGG GA(A-G mismatch) NO: 10) Primer 11 8fo2WC GTA AAA CGA
CGG CCA GTA CCA CCG AAC (SEQ ID TGC GGG TGA CGC CAA GCC(C-C
mismatch) NO: 11) Primer 12 LBA23 GAGTAGATGCTTGCTT TTCTGAGCC (SEQ
ID NO: 12) Primer 13 LF046 GCTCTGGT TATCTGCATC ATCGTCTGCC (SEQ ID
NO: 13)
SEQUENCES
TABLE-US-00004 [0297] Thermostable Clone T7-88: Nucleotide Sequence
AACCTTGGTATGCTTCCTCTTTTTGAGCCCAAGGGTCGCGTCCTCCTGGTGGACGGCC (SEQ ID
NO: 14) ACCACCTGGCCTACCGCACCTTCCACGCCCTGAAGGGCCTCACCACCAGCCGGGGG
GAGCCGGTGCAGGCGGTCTACGGCTTCGCCAAGAGCCTCCTCAAGGCCCTCAAGGA
GGACGGGGACGCGGTGATCGTGGTCTTTGACGCCAAGGCCCCCTCCTCCCGCCACG
AGGCCTACGGGGGGTACAAGGCGGGCCGGGCCCCCACGCCGGAGGACTTTCCCCGG
CAACTCGCCCTCATCAAGGAGCTGGTGGACCTCCTGGGGCTGGCGCGCCTCGAGGTC
CCGGGCTACGAGGCGGACGACGTCCTGGCCAGCCTGGCCAAGAAGGCGGAAAAGG
AGGGCTACGAGGTCCGCATCCTCACCGCCGACAAAGACCTTTACCAGCTCCTTTCCG
ACCGCATCCACGTCCTCCACCCCGAGGGGTACCTCATCACCCCGGCCTGGCTTTGGG
AAAAGTACGGCCTGAGGCCCGACCAGTGGGCCGACTACCGGGCCCTGACCGGGGAC
GAGTCCGACAACCTTCCCGGGGTCAAGGGCATCGGGGAGAAGACGGCGAAGAAGC
TTCTGGAGGAGTGGGGGAGCCTGGAAGCCCTCCTCGAGAACCTGGACCGGCTGAAG
CCCGCCATCCGGGAGAAGATCCTGGCCCACACGGACGATCTGAAGCTCTCCTGGGA
CCTGGCCAAGGTGCGCACCGACCTGCCCCTGGAGGTGGACTTCGCCAAAAGGCGGG
AGCCCGACCGGGAGAGGCTTAGGGCCTTTCTGGAGAGGCTTGAGTTTGGCAGCCTCC
TCCACGAGTTCGGCCTTCTGGAAAGCCCCAAGGCCCTGGAGGAGGCCCCCTGGCCC
CCGCCGGAAGGGGCCTTCGTGGGCTTTGTGCTTTCCCGCAAGGAGCCCATGTGGGCC
GATCTTCTGGCCCTGGCCGCCGCCAGGGGGGGCCGGGTCCACCGGGCCCCCGAGCC
TTATAAAGCCCTCAGGGACTTGAAGGAGGCGCGGGGGCTTCTCGCCAAAGACCTGA
GCGTTCTGGCCCTAAGGGAAGGCCTTGGCCTCCCGCCCGGCGACGACCCCATGCTCC
TCGCCTACCTCCTGGACCCTTCCAACACCACCCCCGAGGGGGTGGCCCGGCGCTACG
GCGGGGAGTGGACGGAGGAGGCGGGGGAGCGGGCCGCCCTTTCCGAGAGGCTCTTC
GCCAACCTGTGGGGGAGGCTTGAGGGGGAGGAGAGGCTCCTTTGGCTTTACCGGGA
GGTGGAGAGGCCCCTTTCCGCTGTCCTGGCCCACATGGAGGCCACGGGGGTGCGCC
TGGACGTGGCCTATCTCAGGGCCTTGTCCCTGGAGGTGGCCGAGGAGATCGCCCGCC
TCGAGGCCGAGGTCTTCCGCCTGGCCGGCCACCCCTTCAACCTCAACTCCCGGGACC
AGCTGGAAAGGGTCCTCTTTGACGAGCTAGGGCTTCCCGCCATCGGCAAGACGGAG
AAGACCGGCAAGCGCTCCACCAGCGCCGCCGTCCTGGAGGCCCTCCGCGAGGCCCA
CCCCATCGTGGAGAAGATCCTGCAGTACCGGGAGCTCACCAAGCTGAAGAGCACCT
ACATTGACCCCTTGCCGGACCTCATCCACCCCAGGACGGGCCGCCTCCACACCCGCT
TCAACCAGACGGCCACGGCCACGGGCAGGCTAAGTAGCTCCGATCCCAACCTCCAG
AACATCCCCGTCCGCACCCCGCTTGGGCAGAGGATCCGCCGGGCCTTCATCGCCGAG
GAGGGGTGGCTATTGGTGGTCCTGGACTATAGCCAGATAGAGCTCAGGGTGCTGGC
CCACCTCTCCGGCGACGAGAACCTGATCCGGGTCTTCCAGGAGGGGCGGGACATCC
ACACGGAAACCGCCAGCTGGATGTTCGGCGTCCCCCGGGAGGCCGTGGACCCCCTG
ATGCGCCGGGCGGCCAAGACCATCAACTTCGGGGTTCTCTACGGCATGTCGGCCCAC
CGCCTCTCCCAGGAGCTAGCCATCCCTTACGAGGAGGCCCAGGCCTTCATTGAGCGC
TACTTTCAGAGCTTCCCCAAGGTGCGGGCCTGGATTGAGAAGACCCTGGAGGAGGG
CAGGAGGCGGGGGTACGTGGAGACCCTCTTCGGCCGTCGCCGCTACGTGCCAGACC
TAGAGGCCCGGGTGAAGAGCGTGCGGGAGGCGGCCGAGCGCATGGCCTTCAACATG
CCCGTCCAGGGCACCGCCGCCGACCTCATGAAGCTGGCTATGGTGAAGCTCTTCCCC
AGGCTGGAGGAAATGGGGGCCAGGATGCTCCTTCAGGTCCACGACGAGCTGGTCCT
CGAGGCCCCAAAAGAGAGGGCGGAGGCCGTGGCCCGGCTGGCCAAGGAGGTCATG
GAGGGGGTGTATCCCCTGGCCGTGCCCCTGGAGGTGGAGGTGGGGATAGGGGAGGA
CTGGCTCTCTGCCAAGGAGTGAG Thermostable Clone T7-88: Amino Acid
Sequence MLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGDA
(SEQ ID NO: 15)
VIVVFDAKAPSSRHEAYGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADD
VLASLAKKAEKEGYEVRILTADKDLYQLLSDRIHVLHPEGYLITPAWLWEKYGLRPDQ
WADYRALTGDESDNLPGVKGIGEKTAKKLLEEWGSLEALLENLDRLKPAIREKILAHTD
DLKLSWDLAKVRTDLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEA
PWPPPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGLLAK
DLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLF
ANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVALEIARLE
AEVFRLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKTGKRSTSAAVLEALREAHPIVEK
ILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQ
RIRRAFIAEEGWLLVVLDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPRE
AVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLE
EGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKL
FPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGED WLSAKE*
Thermostable Clone T9: Nucleic Acid Sequence
GATGCTCCCTCTTTTTGAGCCCAAGGGTCGCGTCCTCCTGGTGGACGGCCACCACCT (SEQ ID
NO: 16) GGCCTACCGCACCTTCCACGCCCTGAAGGGCCTCACCACCAGCCGGGGGGAGCCGG
TGCAGGCGGTCTACGGCTTCGCCAAGAGCCTCCTCAAGGCCCTCAAGGAGGACGGG
GACGCGGTGATCGTGGTCTTTGACGCCAAGGCCCCCTCCTTCCGCCACGAGGCCTAC
GGGGGGTACAAGGCGGGCCGGGCCCCCACGCCGGAGGACTTTCCCCGGCAACTCGC
CCTCATCAAGGAGCTGGTGGACCTCCTGGGGCTGGCGCGCCTCGAGGTCCCGGGCT
ACGAGGCGGACGACGTCCTGGCCAGCCTGGCCAAGAAGGCGGAAAAGGAGGGCTA
CGAGGTCCGCATCCTCACCGCCGACAAAGACCTTTACCAGCTCCTTTCCGACCGCAT
CCACGTCCTCCACCCCGAGGGGTACCTCATCACCCCGGCCTGGCTTTGGGAAAAGTA
CGGCCTGAGGCCCGACCAGTGGGCCGACTACCGGGCCCTGACCGGGGACGAGTCCG
ACAACCTTCCCGGGGTCAAGGGCATCGGGGAGAAGACGGCGAGGAAGCTTCTGGAG
GAGTGGGGGAGCCTGGAAGCCCTCCTCAAGAACCTGGACCGGCTGAAGCCCGCCAT
CCGGGAGAAGATCCTGGCCCACATGGACGATCTGAAGCTCTCCTGGGACCTGGCCA
AGGTGCGCACCGACCTGCCCCTGGAGGTGGACTTCGCCAAAAGGCGGGAGCCCGAC
CGGGAGAGGCTTGGGCCTTTCTGGAGAGGCTTGAGCTTGGCAGCCTCCTCCACGAGT
TCGGCCTTCTGGAAAGCCCCAAGGCCCTGGAGGAGGCCTCCTGGCCCCCGCCGGAA
GGGGCCTTCGTGGGCTTTGTGCTTTCCCGCAAGGAGCCCATGTGGGCCGATCTTCTG
GCCCTGGCCGCCGCCAGGGGGGGCCGGGTCCACCGGGCCCCCGAGCCTTATAAAGC
CCTCAGAGACCTGAAGGAGGCGCGGGGGCTTCTCGCCAAAGACCTGAGCGTTCTGG
CCCTGAGGGAAGGCCTTGGCCTCCCGCCCGGCGACGACCCCATGCTCCTCGCCTACC
TCCTGGACCCTTCCAACACCACCCCCGAGGGGGTGGCCCGGCGCTACGGCGGGGAG
TGGACGGAGGAGGCGGGGGAGCGGGCCGCCCTTTCCGAGAGGCTCTTCGCCAACCT
GTGGGGGAGGCTTGAGGGGGAGGAGAGGCTCCTTTGGCTTTACCGGGAGGTGGAGA
GGCCCCTTTCCGCTGTCCTGGCCCACATGGAGGCCACGGGGGTGCGCCTGGACGTGG
CCTATCTCAGGGCCTTGTCCCTGGAGGTGGCCGAGGAGATCGCCCGCCTCGAGGCCG
AGGTCTTCCGCCTGGCCGGCCACCCCTTCAACCTCAACTCCCGAGACCAGCTGGAAA
GGGTCCTCTTTGACGAGCTAGGGCTTCCCGCCATCGGCAAGACGGAGAAGACCGGC
AAGCGCTCCACCAGCGCCGCCGTCCTGGAGGCCCTCCGCGAGGCCCACCCCATCGT
GGAGAAGATCCTGCAGTACCGGGAGCTCACCAAGCTGAAGAGCACCTACATTGACC
CCTTGCCGGACCTCATCCACCCCAGGACGGGCCGCCTCCACACCCGCTTCAACCAGA
CGGCCACGGCCACGGGCAGGCTAAGTAGCTCCGATCCCAACCTCCAGAACATCCCC
GTCCGCACCCCGCTTGGGCAGAGGATCCGCCGGGCCTTCATCGCCGAGGAGGGGTG
GCTATTGGTGGCCCTGGACTATAGCCAGATAGAGCTCAGGGTGCTGGCCCACCTCTC
CGGCGACGAGAACCTGATCCGGGTCTTCCAGGAGGGGCGGGACATCCACACGGAGA
CCGCCAGCTGGATGTTCGGCGTCCCCCGGGAGGCCGTGGACCCCCTGATGCGCCGG
GCGGCCAAGACCATCAACTTCGGGGTCCTCTACGGCATGTCGGCCACCGCCTCTCCC
AGGAGCTAGCCATCCCTTACGAGGAGGCCCAGGCCTTCATTGAGCGCTACTTTCAGA
GCTTCCCCAAGGTGCGGGCCTGGATTGAGAAGACCCTGGAGGAGGGCAGGAGGCGG
GGGTACGTGGAGACCCTCTTCGGCCGCCGCCGCTACGTGCCAGACCTAGAGGCCCG
GGTGAAGAGCGTGCGGGAGGCGGCCGAGCGCATGGCCTTCAACATGCCCGTCCAGG
GCACCGCCGCCGACCTCATGAAGCTGGCTATGGTGAAGCTCTTCCCCAGGCTGGAG
GAAATGGGGGCCAGGATGCTCCTTCAGGTCCACGACGAGCTGGTCCTCGAGGCCCC
AAAAGAGAGGGCGGAGGCCGTGGCCCGGCTGGCCAAGGAGGTCATGGAGGGGGTG
TATCCCCTGGCCGTGCCCCTGGAGGTGGAGGTGGGGATAGGGGAGGACTGGCTCTC
CGCCAAGGAGGGAGTCGACCTGCAGGCAGCGCTTGGCGTCACCCGCAGTTCGGTGG
TACTGGCCGTCGTTTTACANN Thermostable Clone T9: Amino Acid Sequence
MLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGDA (SEQ ID
NO: 17) VIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADD
VLASLAKKAEKEGYEVRILTADKDLYQLLSDRIHVLHPEGYLITPAWLWEKYGLRPDQ
WADYRALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHM
DDLKLSWDLAKVRTDLPLEVDFAKRREPDRERLRAFLERLELGSLLHEFGLLESPKALEE
ASWPPPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGLLA
KDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTEEAGERAALSER
LFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIAR
LEAEVFRLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKTGKRSTSAAVLEALREAHPIV
EKILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLG
QRIRRAFIAEEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPR
EAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTL
EEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVK
LFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGE DWLSAKE
Thermostable Clone T13: Amino Acid Sequence
MLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGDA (SEQ ID
NO: 18) VIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADD
VLASLAKKAEKEGYEVRILTADKDLYQLLSDRIHVLHPEGYLITPAWLWEKYGLRPDQ
WADYRALTGDESDNLPGVKGIGEKTAKKLLEEWGSLEALLENLDRLKPAIREKILAHTD
DLKLSWDLAKVRTDLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEA
PWPPPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGLLAK
DLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLF
ANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLE
AEVFRLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKTGKRSTSAAVLEALREAHPIVEK
ILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQ
RIRRAFIAEEGWLLVVLDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPRE
AVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLE
EGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKL
FPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGED WLSAKE
Thermostable Clone 8 (T8): Nucleic Acid Sequence
TCGTGGTACGCATCCTCTTTTTGAGCCCAAGGGCCGCGTCCTCCTGGTGGACGGCCA (SEQ ID
NO: 19) CCACCTGGCCTACCGCACCTTCCACGCCCTGAAGGGCCTCACCACCAGCCGGGGGG
AGCCGGTGCAGGCGGTCTACGGCTTCGCCAAGAGCCTCCTCAAGGCCCTCAAGGAG
GACGGGGACGCGGTGATCGTGGTCTTTGACGCCAAGGCCCCCTCCTCCCGCCACGA
GGCCTACGGGGGGTACAAGGCGGGCCGGGCCCCCACGCCGGAGGACTTTCCCCGGC
AACTCGCCCTCATCAAGGAGCTGGTGGACCTCCTGGGGCTGGCGCGCCTCGAGGTCC
CGGGCTACGAGGCGGACGACGTCCTGGCCAGCCTGGCCAAGAAGGCGGAAAAGGA
GGGCTATGAGGTCCGCATCCTCACCGCCGACAAAGACCTTTACCAGCTCCTTTCCGA
CCGCATCCACGTCCTCCACCCCGAGGGGTACCTCATCACCCCGGCCTGGCTTTGGGA
AAAGTACGGCCTGAGGCCCGACCAGTGGGCCGACTACCGGGCCCTGACCGGGGACG
AGTCCGACAACCTTCCCGGGGTCAAGGGCATCGGGGAGAAGACGGCGAAGAAGCTT
CTGGAGGAGTGGGGGAGCCTGGAAGCCCTCCTCGAGAACCTGGACCGGCTGAAGCC
CGCCATCCGGGAGAAGATCCTGGCCCACACGGACGATCTGAAGCTCTCCTGGGACC
TGGCCAAGGTGCGCACCGACCTGCCCCTGGAGGTGGACTTCGCCAAAAGGCGGGAG
CCCGACCGGGAGAGGCTTAGGGCCTTTCTGGAGAGGCTTGAGTTTGGCAGCCTCCTC
CACGAGTTCGGCCTTCTGGAAAGCCCCAAGGCCCTGGAGGAGGCCCCCTGGCCCCC
GCCGGAAGGGGCCTTCGTGGGCTTTGTGCTTTCCCGCAAGGAGCCCATGTGGGCCGA
TCTTCTGGCCCTGGCCGCCGCCAGGGGTGGCCGGGTCCACCGGGCCCCCGAGCCTTA
TAAAGCCCTCAGGGACTTGAAGGAGGCGCGGGGGCTTCTCGCCAAAGACCTGAGCG
TTCTGGCCCTAAGGGAAGGCCTTGGCCTCCCGCCCGGCGACGACCCCATGCTCCTCG
CCTACCTCCTGGACCCTTCCAACACCACCCCCGAGGGGGTGGCCCGGCGCTACGGCG
GGGAGTGGACGGAGGAGGCGGGGGAGCGGGCCGCCCTTTCCGAGAGGCTCTTCGCC
AACCTGTGGGGGAGGCTTGAGGGGGAGGAGAGGCTCCTTTGGCTTTACCGGGAGGT
GGATAGGCCCCTTTCCGCTGTCCTGGCCCACATGGAGGCCACAGGGGTGCGCCTGG
ACGTGGCCTATCTCAGGGCCTTGTCCCTGGAGGTGGCCGAGGAGATCGCCCGCCTCG
AGGCCGAGGTCTTCCGCCTGGCCGGCCACCCCTTCAACCTCAACTCCCGGGACCAGC
TGGAAAGGGTCCTCTTTGACGAGCTAGGGCTTCCCGCCATCGGCAAGACGGAGAAG
ACCGGCAAGCGCTCCACCAGCGCCGCCGTCCTGGAGGCCCTCCGCGAGGCCCACCC
CATCGTGGAGAAGATCCTGCAGTACCGGGAGCTCACCAAGCTGAAGAGCACCTACA
TTGACCCCTTGCCGGACCTCATCCACCCCAGGACGGGCCGCCTCCACACCCGCTTCA
ACCAGACGGCCACGGCCACGGGCAGGCTAAGTAGCTCCGATCCCAACCTCCAGAAC
ATCCCCGTCCGCACCCCGCTTGGGCAGAGGATCCGCCGGGCCTTCATCGCCGAGGA
GGGGTGGCTATTGGTGGTCCTGGACTATAGCCAGATAGAGCTCAGGGTGCTGGCCC
ACCTCTCCGGCGACGAGAACCTGATCCGGGTCTTCCAGGAGGGGCGGGACATCCAC
ACGGAAACCGCCAGCTGGATGTTCGGCGTCCCCCGGGAGGCCGTGGACCCCCTGAT
GCGCCGGGCGGCCAAGACCATCAACTTCGGGGTTCTCTACGGCATGTCGGCCCACC
GCCTCTCCCAGGAGCTAGCCATCCCTTACGAGGAGGCCCAGGCCTTCATTGAGCGCT
ACTTTCAGAGCTTCCCCAAGGTGCGGGCCTGGATTGAGAAGACCCTGGAGGAGGGC
AGGAGGCGGGGGTACGTGGAGACCCTCTTCGGCCGCCGCCGCTACGTGCCAGACCT
AGAGGCCCGGGTGAAGAGCGTGCGGGAGGCGGCCGAGCGCATGGCCTTCAACATGC
CCGTCCAGGGCACCGCCGCCGACCTCATGAAGCTGGCTATGGTGAAGCTCTTCCCCA
GGCTGGAGGAAATGGGGGCCAGGATGCTCCTTCAGGTCCACGACGAGCTGGTCCTC
GAGGCCCCAAAAGAGAGGGCGGAGGCCGTGGCCCGGCTGGCCAAGGAGGTCATGG
AGGGGGTGTATCCCCTGGCCGTGCCCCTGGAGGTGGAGGTGGGGATAGGGGAGGAC
TGGCTCTCCGCCAAGGAGTGAGT Thermostable Clone 8 (T8): Amino Acid
Sequence PLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGDAVI
(SEQ ID NO: 20)
VVFDAKAPSSRHEAYGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVL
ASLAKKAEKEGYEVRILTADKDLYQLLSDRIHVLHPEGYLITPAWLWEKYGLRPDQWA
DYRALTGDESDNLPGVKGIGEKTAKKLLEEWGSLEALLENLDRLKPATREKILAHTDDL
KLSWDLAKVRTDLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAP
WPPPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGLLAKD
LSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFA
NLWGRLEGEERLLWLYREVDRPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEA
EVFRLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKTGKRSTSAAVLEALREAHPIVEKIL
QYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRI
RRAFIAEEGWLLVVLDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREA
VDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLEE
GRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKLFP
RLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDW LSAKE*
Note: First two amino acids at N terminus not sequenced. Heparin
Resistant Clone 94: Nucleic Acid Sequence
ATTTTTGAGCCCAAGGGCCGCGTCCTCCTGGTGGACGGCCACCACCTGGCCTACCGC (SEQ ID
NO: 21) ACCTTCCACGCCCTGAAGGGCCTCACCACCAGCCGGGGGGAGCCGGTGCAGGCGGT
CTACGGCTTCGCCAAGAGCCTCCTCAAGGCCCTCAAGGAGGACGGGGACGCGGTGA
TCGTGGTCTTTGACGCCAAGGCCCCCTCCTTCCGCCACGAGGCCTACGGGGGGTACA
AGGCGGGCCGGGCCCCCACGCCGGAGGACTTTCCCCGGCAACTCGCCCTCATCAAG
GAGCTGGTGGACCTCCTGGGGCTGGCGCGCCTCGAGGTCCCGGGCTACGAGGCGGA
CGACGTCCTGGCCAGCCTGGCCAAGAAGGCGGAAAAGGAGGGCTACGAGGTCCGC
ATCCTCACCGCCGACAAAGACCTTTACCAGCTCCTTTCCGACCGCATCCACGTCCTC
CACCCCGAGGGGTACCTCATCACCCCGGCCTGGCTTTGGGAAAAGTACGGCCTGAG
GCCCGACCAGTGGGCCGACTACCGGGCCCTGACCGGGGACGAGTCCGACAACCTTC
CCGGTGTCAAGGGCATCGGGGAGAAGACGGCGAGGAAGCTTCTGGAGGAGTGGGG
GAGCCTGGAAGCCCTCCTCAAGAACCTGGACCGGCTGGAGCCCGCCATCCGGGAGA
AGATCCTGGCCCACATGGACGATCTGAAGCTCTCCTGGGACCTGGCCAAGGTGCGC
ACCGACCTGCCCCTGGAGGTGGACTTCGCCAAAAGGCGGGAGCCCGACCGGGAGAG
GCTTAGGGCCTTTCTGGAGAGGCTTGAGTTTGGCAGCCTCCTCCACGAGTTCGGCCT
TCTGGAAAGCCCCAAGGCCCCGGAGGAGGCCCCCTGGCCCCCGCCGGAAGGGGCCT
TCGTGGGCTTTGTGCTTTCCCGCAAGGAGCCCATGTGGGCCGATCTTCTGGCCCTGG
CCGCCGCCAGGGGGGGCCGGGTCCACCGGGCCCCCGAGCCTTATAAAGCCCTCAGG
GACCTGAAGGAGGCGCGGGGGCTTCTCGCCAAAGACCTGAGCGTTCTGGCCCTGAG
GGAAGGCCTTGGCCTCCCGCCCGGCGACGACCCCATGCTCCTCGCCTACCTCCTGGA
CCCTTCCAACACCACCCCCGAGGGGGTGGCCCGGCGCTACGGCGGGGAGTGGACGG
AGGAGGCGGGGGAGCGGGCCGCCCTTTCCGAGAGGCTCTTCGCCAACCTGTGGGGG
AGGCTTGAGGGGGAGGAGAGGCTCCTTTGGCTTTACCGGGAGGTGGAGAGGCCCCT
TTCCGCTGTCCTGGCCCACATGGAGGCCACGGGGGTGCGCCTGGACGTGTCCTATCT
CAGGGCCTTGTCCCGGGAGGTGGCCGAGGAGATCGCCCGCCTCGAGGCCGAGGTCT
TCCGCCTGGCCGGCCACCCCTTCAACCTCAACTCCCGGGACCAGCTGGAAAGGGTCC
TCTTTGACGAGCTAGGGCTTCCCGCCATCGGCAAGACGGAGAAGACCGGCAAGCGC
TCCACCAGCGCCGCCGTCCTGGAGGCCCTCCGCGAGGCCCACCCCATCGTGGAGAA
GATCCTGCAGTACCGGGAGCTCACCAAGCTGAAGAGCACCTACATTGACCCCTTGCC
GGACCTCATCCACCCCAGGACGGGCCGCCTCCACACCCGCTTCAACCAGACGGCCA
CGGCCACGGGCAGGCTAAGTAGCTCCGGTCCCAACCTCCAGAGCATCCCCGTCCGC
ACCCCGCTTGGGCAGAGGATCCGCCGGGCCTTCATCGCCGAGGAGGGGTGGCTATT
GGTGGCCCTGGACTATAGCCAGATAGAGCTCAGGGTGCTGGCCCACCTCTCCGGCG
ACGAGAACCTGATCCGGGTCTTCCAGGAGGGGCGGGACATCCACACGGAGACCGCC
AGCTGGATGTTCGGCGTCCCCCGGGAGGCCGTGGACCCCCTGATGCGCCGGGCGGC
CAAGACCATCAACTTCGGGGTCCTCTACGGCATGTCGGCCCACCGCCTCTCCCAGGA
GCTAGCCATCCCTTACGAGGAGGCCCAGGCCTTCATTGAGCGCTACTTTCAGAGCTT
CCCCAAGGTGCGGGCCTGGATTGAGAAGACCCTGGAGGAGGGCAGGAGGCGGGGG
TACGTGGAGACCCTCTTCGGCCGCCGCCGCTACGTGCCAGACCTAGAGGCCCGGGT
GAAGAGCGTGCGGGAGGCGGCCGAGCGCATGGCCTTCAACATGCCCGTCCAGGGCA
CCGCCGCCGACCTCATGAAGCTGGCTATGGTGAAGCTCTTCCCCAGGCTGGAGGAA
ATGGGGGCCAGGATGCTCCTTCAGGTCCACGACGAGCTGGTCCTCGAGGCCCCAAA
AGAGAGGGCGGAGGCCGTGGCCCGGCTGGCCAAGGAGGTCATGGAGGGGGTGTAT
CCCCTGGCCGTGCCCCTGGAGGTGGAGGTGGGGATAGGGGAGGACTGGCTCTCCGC
CAAGGAGTGATT Heparin Resistant Clone H94: Amino Acid Sequence
FEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGDAVIVV (SEQ ID
NO: 22)
FDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVLAS
LAKKAEKEGYEVRILTADKDLYQLLSDRIHVLHPEGYLITPAWLWEKYGLRPDQWADY
RALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLKNLDRLEPAIREKILAHMDDLKL
SWDLAKVRTDLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKAPEEAPWPP
PEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGLLAKDLSV
LALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANL
WGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLDVSYLRALSREVAEEIARLEAEV
FRLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQ
YRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSGPNLQSIPVRTPLGQRIRR
AFIAEEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVD
PLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLEEGR
RRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRL
EEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDWLS AKE*
Note. N-TERMINAL 5 amino acids not determined. Heparin Resistant
Clone 15: Nucleic Acid Sequence
TTTGAGCCCAAGGGCCGCGTCCTCCTGGTGGACGGCCACCACCTGGCCTACCGCACC (SEQ ID
NO: 23) TTCCACGCCCTGAAGGGCCTCACCACCAGCCGGGGGGAGCCGGTGCAGGCGGTCTA
CGGCTTCGCCAAGAGCCTCCTCAAGGCCCTCAAGGAGGACGGGGACGCGGTGATCG
TGGTCTTTGACGCCAAGGCCCCCTCCTTCCGCCACGAGGCCTACGGGGGGTACAAGG
CGGGCCGGGCCCCCACGCCGGAGGACTTTCCCCGGCAACTCGCCCTCATCAAGGAG
CTGGTGGACCTCCTGGGGCTGGCGCGCCTCGAGGTCCCGGGCTACGAGGCGGACGA
CGTCCTGGCCAGCCTGGCCAAGAAGGCGGAAAAGGAGGGCTACGAGGTCCGCATCC
TCACCGCCGACAAAGACCTTTACCAGCTCCTTTCCGACCGCATCCACGTCCTCCACC
CCGAGGGGTACCTCATCACCCCGGCCTGGCTTTGGGAAAAGTACGGCCTGAGGCCC
GACCAGTGGGCCGACTACCGGGCCCTGACCGGGGACGAGTCCGACAACCTTCCCGG
TGTCAAGGGCATCGGGGAGAAGACGGCGAGGAAGCCTTCTGGAGGAGTGGGGGAG
CCTGGAAGCCCTCCTCAAGAACCTGGACCGGCTGGAGCCCGCCATCCGGGAGAAGA
TCCTGGCCCACATGGACGATCTGAAGCTCTCCTGGGACCTGGCCAAGGTGCGCACCG
ACCTGCCCCTGGAGGTGGACTTCGCCAAAAGGCGGGAGCCCGACCGGGAGAGGCTT
AGGGCCTTTCTGGAGAGGCTTGAGTTTGGCAGCCTCCTCCACGAGTTCGGCCTTCTG
GAAAGCCCCAAGGCCCTGGAGGAGGCCCCCTGGCCCCCGCCGGAAGGGGCCTTCGT
GGGCTTTGTGCTTTCCCGCAAGGAGCCCATGTGGGCCGATCTTCTGGCCCTGGCCGC
CGCCAGGGGGGGTCGGGTCCACCGGGCCCCCGAGCCTTATAAAGCCCTCAGGGACC
TGAAGGAGGCGCGGGGGCTTCTCGCCAAAGACCTGAGCGTTCTGGCCCTGAGGGAA
GGCCTTGGCCTCCCGCCCGGCGACGACCCCATGCTCCTCGCCTACCTCCTGGACCCT
TCCAACACCACCCCCGTGGGGGTGGCCCGGCGCTACGGCGGGGAGTGGACGGAGGA
GGCGGGGGAGCGGGCCGCCCTTTCCGAGAGGCTCTTCGCCAACCTGTGGGGGAGGC
TTGAGGGGGAGGAGAGGCTCCTTTGGCTTTACCGGGAGGTGGAGAGGCCCCTTTCC
GCTGTCCTGGCCCACATGGAGGCTACGGGGGTGCGCCTGGACGTGGCCTATCTCAG
GGCCTTGTCCCTGGAGGTGGCCGAGGAGATCGCCCGCCTCGAGGCCGAGGTCTTCC
GCCTGGCCGGCCACCCCTTCAACCTCAACTCCCGGGACCAGCTGGAAAGGGTCCTCT
TTGACGAGCTAGGGCTTCCCGCCATCGGCAAGACGGAGAAGACCGGCAAGCGCTCC
ACCAGCGCCGCCGTCCTGGAGGCCCTCCGCGAGGCCCACCCCATCGTGGAGAAGAT
CCTGCAGTACCGGGAGCTCACCAGGCTGAAGAGCACCTACATTGACCCCTTGCCGG
ACCTCATCCACCCCAGGACGGGCCGCCTCCACACCCGCTTCAACCAGACGGCCACG
GCCACGGGCAGGCTAAGTAGCTCCGGTCCCAACCTCCAGAGCATCCCCGTCCGCAC
CCCGCTTGGGCAGAGGATCCGCCGGGCCTTCATCGCCGAGGAGGGGTGGCTATTGG
TGGCCCTGGACTATAGCCAGATAGAGCTCAGGGTGCTGGCCCACCTCTCCGGCGAC
GAGAACCTGATCCGGGTCTTCCAGGAGGGGCGGGACATCCACACGGAGACCGCCAG
CTGGATGTTCGGCGTCCCCCGGGAGGCCGTGGACCCCCTGATGCGCCGGGCGGCCA
AGACCATCAACTTCGGGGTCCTCTACGGCATGTCGGCCCACCGCCTCTCCCAGGAGC
TAGCCATCCCTTACGAGGAGGCCCAGGCCTTCATTGAGCGCTACTTTCAGAGCTTCC
CCAAGGTGCGGGCCTGGATTGAGAAGACCCTGGAGGAGGGCAGGAGGCGGGGGTA
CGTGGAGACCCTCTTCGGCCGCCGCCGCTACGTGCCAGACCTAGAGGCCCGGGTGA
AGAGCGTGCGGGAGGCGGCCGAGCGCAGGGCCTTCAACATGCCCGTCCAGGGCACC
GCCGCCGACCTCATGAAGCTGGCTATGGTGAAGCTCTTCCCCAGGCTGGAGGAAAT
GGGGGCCAGGATGCTCCTTCAGGTCCACGACGAGCTGGTCCTCGAGGCCCCAAAAG
AGAGGGCGGAGGCCGTGGCCCGGCTGGCCAAGGAGGTCATGGAGGGGGTGTATCCC
CTGGCCGTGCCCCTGGAGGTGGAGGTGGGGATAGGGGAGGACTGGCTCTCCGCCAA GGAGTGAGT
Heparin Resistant Clone 15: Amino Acid Sequence
PLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGDAVI (SEQ ID
NO: 24) VVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVL
ASLAKKAEKEGYEVRILTADKDLYQLLSDRIHVLHPEGYLITPAWLWEKYGLRPDQWA
DYRALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLKNLDRLEPAIREKILAHMDDL
KLSWDLAKVRTDLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAP
WPPPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGLLAKD
LSVLALREGLGLPPGDDPMLLAYLLDPSNTTPVGVARRYGGEWTEEAGERAALSERLFA
NLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEA
EVFRLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKTGKRSTSAAVLEALREAHPIVEKIL
QYRELTRLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSGPNLQSIPVRTPLGQRIR
RAFIAEEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAV
DPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFTERYFQSFPKVRAWIEKTLEE
GRRRGYVETLFGRRRYVPDLEARVKSVREAAERRAFNMPVQGTAADLMKLAMVKLFP
RLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDW LSAKE*
Note: N-terminal 5 amino acids not determined. Mismatch Extension
Clone M1: Nucleic Acid Sequence
TTGGAATGCTCCCTCTTTTTGAGCCCAAAGGCCGCGTCCTCCTGGTGGACGGCCACC (SEQ ID
NO: 25) ACCTGGCCTACCGCACCTTCCACGCCCTGAAGGGCCTCACCACCAGCCGGGGGGAG
CCGGTGCAGGCGGTCTACGGCTTCGCCAAGAGCCTCCTCAAGGCCCTCAAGGAGGA
CGGGGACGCGGTGATCGTGGTCTTTGACGCCAAGGCCCCCTCCTTCCGCCACGAGGC
CTACGGGGGGTACAAGGCGGCCCGGGCCCCCACGCCGGAGGACTTTCCCCGGCAAC
TCGCCCTCATCAAGGAGCTGGTGGATCTCCTGGGGCTGGCGCGCCTCGAGGTCCCGG
GCTACGAGGCGGACGACGTCCTGGCCAGCCTGGCCAAGAAGGCGGAAAAGGAGGG
CTACGAGGTCCGCATCCTCACCGCCGACAAAGGCCTTTACCAGCTCCTTTCCGACCG
CATCCACGTCCTCCACCCCGAGGGGTACCTCATCACCCCGGCCTGGCTTTGGGAAAA
GTACGGCCTGAGGCCCGACCAGTGGGCCGACTACCGGGCCCTGACCGGGGACGAGT
CCGACAACCTTCCCGGGGTCAAGGGCATCGGGGAGAAGACGGCGAGGAAGCTTCTG
GAGGAGTGGGGGAGCCTGGAAGCCCTCCTCAAGAACCTGGACCGGCTGAAGCCCGC
CATCCGGGAGAAGATCCTGGCCCACATGGACGATCTGAAGCTCTCCTGGGATCTGG
CCAAGGTGCGCACCGACCGCCCCTGOAGGTGGACTTCGCCAAAAGGCGGGAGCCCG
ACCGGGAGAGGCTTAGGGCCTTTCTGGAGAGGCTTGAGTTTGGCAGCCTCCTCCACG
AGTTCGGCCTTCTGGAAAGCCCCAAGGCCCTGGAGGAGGCCCCCTGGCCCCCGCCG
GAAGGGGCCTTCGTGGGCTTTGTCCTTTCCCGCAGGGAGCCCATGTGGGCCGATCTT
CTGGCCCTGGCCGCCGCCAGGGGGGGCCGGGTCCACCGGGCCCCCGAGCCTTATAA
AGCCCTCAGGGACCTGAAGGAGGCGCGGGGGCTTCTCGCCAAAGACCTGAGCGTTC
TGGCCCTGAGGGAAGGCCTTGGCCTCCCGCCCGGCGACGACCCCATGCTCCTCGCCT
ACCTCCTGGACCCTTCCAACACCACCCCCGAGGGGGTGGCCCGGCGCTACGGCGGG
GAGTGGACGGAGGAGGCGGGGGAGCGGGCCGCCCTTTCCGAGAGGCTCTTCGCCAA
CCTGTGGGGGAGGCTTGAGGGGGAGGAGAGGCTCCTTTGGCTTTACCGGGAGGTGG
AGAGGCCCCTTTCCGCTGTCCTGGCCCACATGGAGGCCACGGGGGTGCGCCTGGAC
GTGGCCTATCTCAGGGCCTTGTCCCTGGAGGTGGCCGAGGAGATCGCCCGCCTCGAG
GCCGAGGTCTTCCGCCTGGCCGGCCACCCCTTCAACCTCAACTCCCGGGACCAGCTG
GAAAGGGTCCTCTTTGACGAGCTAGGGCTTCCCGCCATCGGCAAGACGGAGAAGAC
CGGCAAGCGCTCCACCAGCGCCGCCGTCCTGGGGGCCCTCCGCGAGGCCCACCCCA
TCGTGGAGAAGATCCTGCAGTACCGGGAGCTCACCAAGCTGAAGAGCACCTACATT
GACCCCTTACCGGACCTCATCCACCCCAGGACGGGCCGCCTCCACACCCGCTTCAAC
CAGACGGCCACGGCCACGGGCAGGCTAAGTAGCTCCGATCCCAACCTCCAGAACAT
CCCCGTCCGCACCCCGCTTGGGCAGAGGATCCGCCGGGCCTTCATCGCCGAGGAGG
GGTGGCTATTGGTGGTCCTGGACTATAGCCAGATAGAGCTCAGGGTGCTGGCCCACC
TCTCCGGCGACGAGAACCTGATCCGGGTCTTCCAGGAGGGGCGGGACATCCACACG
GAGACCGCCAGCTGGATGTTCGGCGTCCCCCGGGAGGCCGTGGACCCCCTGATGCG
CCGGGCGGCCAAGACCATCAACTTCGGGGTCCTCTACGGCATGTCGGCCCACCGCCT
CTCCCAGGAGCTAGCCATCCCTTACGAGGAGGCCCAGGCCTTCATTGAGCGCTACTT
TCAGAGCTTCCCCAAGGTGCGGGCCTGGATTGAGAAGACCCTGGAGGAGGGCAGGA
GGCGGGGGTACGTGGAGACCCTCTTCGGCCGCCGCCGCTACGTGCCAGACCTAGAG
GCCCGGGTGAAGAGCGTGCGGGGGGCGGCCGAGCGCATGGCCTTCAACATGCCCGT
CCAGGGCACCGCCGCCGACCTCATGAAGCTGGCTATGGTGAAGCTCTTCCCCAGGCT
GGAGGAAATGGGGGCCAGGATGCTCCTTCAGGTCCACGACGAGCTGGTCCTCGAGG
CCCCAAAAGAGAGGGCGGAGGCCGTGGCCCGGCTGGCCAAGGAGGTCATGGAGGG
GGTGTATCCCCTGGCCGTGCCCCTGGAGGTGGAGGTGGGGATAGGGGAGGACTGGC
TCTCCGCCAAGGAGTGAGTCGACCTGCAGGCAGCGCTTGGCGTCACCCGCAGTTCG
GTGGTTAATAAGCTTGACCTGTGAAGTGAAAAATGGCGCACATTGTGCGACATTTTT
TTTGTCTGCCGTTTACCGCTACTGCGTCACGGATCTCCACGCGCCCTGTAGCGGCGC
ATTAAGCGCGGCGGGTGTGGTGGTTACGCGCAGCGTGACCGCTACACTTGCCAGCG
CCCTAGCGCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGTTCGCCGGCTTT
CCCCGTCAAGCTCTAAATCGGGGGCTCCCTTTAGGGGTTCCCGATTTAGTGCTTTTAC
GGGACCTCGAACCCAAAAAATTGATTAGG Mismatch Extension Clone M1: Amino
Acid Sequence
GMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGD (SEQ ID
NO: 26) AVIVVFDAKAPSFRHEAYGGYKAARAPTPEDFPRQLALIKELVDLLGLARLEVPGYEAD
DVLASLAKKAEKEGYEVRILTADKGLYQLLSDRIHVLHPEGYLITPAWLWEKYGLRPDQ
WADYRALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHM
DDLKLSWDLAKVRTDLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEE
APWPPPEGAFVGFVLSRREPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGLLA
KDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTEEAGERAALSER
LFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVALEIAR
LEAEVFRLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKTGKRSTSAAVLGALREAHPIV
EKILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLG
QRIRRAFIAEEGWLLVVLDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPR
EAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTL
EEGRRRGYVETLFGRRRYVPDLEARVKSVRGAAERMAFNMPVQGTAADLMKLAMVK
LFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGE DWLSAKE
Note:N-terminal 2 amino acids not determined. Mismatch Extension
Clone M4: Nucleic Acid Sequence
TCTTTATGAGCCCAAGGGCCGCGTCCTCCTGGTGGACGGCCACCACCTGGCCTACCG (SEQ ID
NO: 27) CACCTTCCACGCCCTGAAGGGCCTCACCACCAGCCGGGGGGAGCCGGTGCAGGCGG
TCTACGGCTTCGCCAAGAGCCTCCTCAAGGCCCTCAAGGAGGGCGGGGACGCGGTG
ATCGTGGTCTTTGACGCCAAGGCCCCCTCCTTCCCCCATGAGGCCTACGGGGGGTAC
AAGGCGGGCCGGGCCCCCACGCCGGAGGACTTTCCCCGACAACTCGCCCTCATCAA
GGAGCTGGTGGACCTCCTGGGGCTGACGCGCCTCGAGGTCCCGGGCTACGAGGCGG
ACGACGTCCTGGCCAGCCTGGCCAAGAAGGCGGAAAAGGAGGGCTACGAGGTCCG
CATCCTCACCGCCGACAAAGACCTTTACCAGCTCCTTTCCGACCGCATCCACGTCCT
CCACCCCGAGGGGTACCTCATCACCCCGGCCTGGCTTTGGGAAAAGTACGGCCTGA
GGCCCGACCAGTGGGCCGACTACCGGGCCCTGACCGGGGACGAGTCCGACAACCTT
CCCGGGGTCAAGGGCATCGGGGAGAAGACGGCGAGGAAGCTTCTGGAGGAGTGGG
GGAGCCTGGAAGCCCTCCTCAAGAACCTGGACCGGCTGAAGCCCGCCATCCGGGAG
AAGATCCTGGCCCACATGGACGATCTGAAGCTCTCCTGGGACCGGGCCAAGGTGCG
CACCGACCTGCCCCTGGAGGTGGACTTCGCCAAAAGGCGGGAGCCCGACCGGGAGA
GGCTTAGGGCCTTTCTGGAGAGGCTTGAGTTTGGCAGCCTCCTCCACGAGTTCGGCC
TTCTGGAAAGCCCCAAGGCCCTGGAGGAGGCCCCCTGGCCCCCGCCGGAAGGGGCC
TTCGTGGGCTTTGTGCTTTCCCGCAAGGAGCCCATGTGGGCCGATCTTCTAGCCCTG
GCCGCCGCCAGGGGGGGCCGGGTCCACCGGGCCCCCGAGCCTTATAAAGCCCTCGG
GGACCTGAAGGAGGCGCGGGGGCTTCTCGCCAAAGACCTGAGCGTTCTGGCCCTGA
GGGAAGGCCTTGGCCTCCCGCCCGACGACGACCCCATGCTCCTCGCCTACCTCCTGG
ACCCTTCCAACACCACCCCCGAGGGGGTGGCCCGGCGCTACGGCGGGGAGTGGACG
GAGGAGCGAGGGGAGCGGGCCGCCCTTTCCGAGAGGCTCTTCGCCAACCTGTGGGG
GAGGCTTGAGGGGGAGGAAAGGCTCCTTTGGCTTTACCGGGAGGTGGAGAGGCCCC
TTTCCGCTGTCCTGGCCCACATGGAGGCCACGGGGGTGCGCCTGGACGTGGCCTATC
TCAGGGCCTTGTCCCTGGAGGTGGCCGAGGAGATCGCCCGCCTCGAGGCCGAGGTC
TTCCGCCTGGCCGGCCACCCCTTCAACCTCAACTCCCGGGACCAGCTGGAAAGGGTC
CTCTTTGACGAGCTAGGGCTTCCCGCCATCGGCAAGACGGAGAAGACCGGCAAGCG
CTCCACCAGCGCCGCCGTCCTGGGGGCCCTCCGCGAGGCCCACCCCATCGTGGAGA
AGATCCTGCAGTACCGGGAGCTCACCAAGCTGAAGAGCACCTACATTGACCCCTTG
CCGGACCTCATCCACCCCAGGACGGGCCGCCTCCACACCCGCTTCAACCAGACGGC
CACGGCCACGGGCAGGCTAAGTAGCTCCGATCCCAACCTCCAGAGCATCCCCGTCC
GCACCCCGCTTGGGCAGAGGATCCGCCGGGCCTTCATCGCCGAGGAGGGGTGGCTA
TTGGTGGCCCTGGACTATAGCCAGATAGAGCTCAGGGTGCTGGCCCACCTCTCCGGC
GACGAGAACCTGATCCGGGTCTTCCAGGAGGGGCGGGACATCCACACGGAGACCGC
CAGCTGGATGTTCGGCGTCCCCCGGGAGGCCGTGGACCCCCTGATGCGCCGGGCGG
CCAAGACCATCAACTTCGGGGTCCTCTACGGCATGTCGGCCCACCGCCTCTCCCAGG
AGCTAGCCATCCCTTACGAGGAGGCCCAGGCCTTCATTAAGCGCTACTTTCAGAGCT
TCCCCAAGGTGCGGGCCTGGATTGAGAAGACCCTGGAGGAGGGCAGGAGGCGGGG
GTACGTGGAGACCCTCTTCGGCCGCCGCCGCTACGTGCCAGACCTAGAGGCCCGGG
TGAAGAGCGTGCGGGAGCCGGCCGAGCGCATGGCCTTCAACATGCCCGTCCAGGGT
ACCGCCGCCGACCTCATGAAGCTGGCTATGGTGAAGCTCTTCCCCAGGCTGGAGGA
AATGGGGGCCAGGATGCTCCTTCAGGTCCACGACGAGCTGGTCCTCGAGGCCCCAA
AAGAGAGGGCGGAGGCCGTGGCCCGGCTGGCCAAGGAGGTCATGGAGGGGGTGTA
TCCCCTGGCCGTGCCCCTGGAGGTGGAGGTGGGGATAGGGGAGGACTGGCTCTCCG
CCAAGGAGTGAGT Mismatch Extension Clone M4: Amino Acid Sequence
LYEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEGGDAVIV (SEQ ID
NO: 28) VFDAKAPSFPHEAYGGYKAGRAPTPEDFPRQLALIKELVDLLGLTRLEVPGYEADDVLA
SLAKKAEKEGYEVRILTADKDLYQLLSDRIHVLHPEGYLITPAWLWEKYGLRPDQWAD
YRALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHMDDLK
LSWDRAKFRTDLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWP
PPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALGDLKEARGLLAKDLS
VLALREGLGLPPDDDPMLLAYLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFAN
LWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVALEIARLEAE
VFRLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKTGKRSTSAAVLGALREAHPIVEKIL
QYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQSIPVRTPLGQRIR
RAFIAEEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAV
DPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIKRYFQSFPKVRAWIEKTLEEG
RRRGYVETLFGRRRYVPDLEARVKSVREPAERMAFNMPVQGTAADLMKLAMVKLFPR
LEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDWL SAKE
Note: N-terminal 6 amino acids not determined.
Sequence CWU 1
1
28162DNAArtificialmisc_feature(1)..(62)Synthetic PCR primer for the
amplification of Taq polymerase-encoding DNA and for the
introduction of restriction sites for cloning. 1ggcgactcta
gataacgagg gcaaaaaatg cgtggtatgc ttcctctttt tgagcccaag 60gg
62243DNAArtificialmisc_feature(1)..(43)Synthetic PCR primer for the
amplification of Taq polymerase-encoding DNA and for the
introduction of restriction sites for cloning. 2gcggtgcgga
gtcgactcac tccttggcgg agagccagtc ctc
43323DNAArtificialmisc_feature(1)..(23)Synthetic PCR primer used in
screening for inserts and mutationswhen cloning Taq polymerase DNA.
3aaaaatctag ataacgaggg caa
23428DNAArtificialmisc_feature(1)..(28)Synthetic PCR primer used in
screening for inserts and mutationswhen cloning Taq polymerase DNA.
4accaccgaac tgcgggtgac gccaagcg
28525DNAArtificialmisc_feature(1)..(25)Synthetic PCR primer used to
screen amplified Taq polymerase sequences for mutation. 5gggtacgtgg
agaccctctt cggcc 25617DNAArtificialmisc_feature(1)..(17)Synthetic
PCR primer used in error-prone PCR mutagenesis of Taq polymerase
DNA. 6gtaaaacgac ggccagt
17717DNAArtificialmisc_feature(1)..(17)Synthetic PCR primer used in
error-prone PCR mutagenesis of Taq polymerase DNA. 7caggaaacag
ctatgac 17840DNAArtificialmisc_feature(1)..(40)Synthetic PCR primer
used in error-prone PCR mutagenesis of Taq polymerase DNA.
8caggaaacag ctatgacaaa aatctagata acgagggcaa
40945DNAArtificialmisc_feature(1)..(45)Synthetic PCR primer used in
error-prone PCR mutagenesis of Taq polymerase DNA. 9gtaaaacgac
ggccagtacc accgaactgc gggtgacgcc aagcg
451038DNAArtificialmisc_feature(1)..(38)Synthetic PCR primer that
introduces a 3' purine-purine mismatch (A-G mismatch) 10caggaaacag
ctatgacaaa aatctagata acgaggga
381145DNAArtificialmisc_feature(1)..(45)Synthetic PCR primer that
introduces a 3' pyrimidine-pyrimidine mismatch (C-C mismatch)
11gtaaaacgac ggccagtacc accgaactgc gggtgacgcc aagcc
451226DNAArtificialmisc_feature(1)..(26)Synthetic oligonucleotide
primer used in 3SR. 12ggagtagatg cttgcttttc tgagcc
261328DNAArtificialmisc_feature(1)..(28)Synthetic oligonucleotide
used for PCR/3SR amplification of Taq polymerase mutants.
13gctctggtta tctgcatcat cgtctgcc
28142500DNAArtificialmisc_feature(1)..(2500)Mutant of Taq
polymerase. 14aaccttggta tgcttcctct ttttgagccc aagggtcgcg
tcctcctggt ggacggccac 60cacctggcct accgcacctt ccacgccctg aagggcctca
ccaccagccg gggggagccg 120gtgcaggcgg tctacggctt cgccaagagc
ctcctcaagg ccctcaagga ggacggggac 180gcggtgatcg tggtctttga
cgccaaggcc ccctcctccc gccacgaggc ctacgggggg 240tacaaggcgg
gccgggcccc cacgccggag gactttcccc ggcaactcgc cctcatcaag
300gagctggtgg acctcctggg gctggcgcgc ctcgaggtcc cgggctacga
ggcggacgac 360gtcctggcca gcctggccaa gaaggcggaa aaggagggct
acgaggtccg catcctcacc 420gccgacaaag acctttacca gctcctttcc
gaccgcatcc acgtcctcca ccccgagggg 480tacctcatca ccccggcctg
gctttgggaa aagtacggcc tgaggcccga ccagtgggcc 540gactaccggg
ccctgaccgg ggacgagtcc gacaaccttc ccggggtcaa gggcatcggg
600gagaagacgg cgaagaagct tctggaggag tgggggagcc tggaagccct
cctcgagaac 660ctggaccggc tgaagcccgc catccgggag aagatcctgg
cccacacgga cgatctgaag 720ctctcctggg acctggccaa ggtgcgcacc
gacctgcccc tggaggtgga cttcgccaaa 780aggcgggagc ccgaccggga
gaggcttagg gcctttctgg agaggcttga gtttggcagc 840ctcctccacg
agttcggcct tctggaaagc cccaaggccc tggaggaggc cccctggccc
900ccgccggaag gggccttcgt gggctttgtg ctttcccgca aggagcccat
gtgggccgat 960cttctggccc tggccgccgc cagggggggc cgggtccacc
gggcccccga gccttataaa 1020gccctcaggg acttgaagga ggcgcggggg
cttctcgcca aagacctgag cgttctggcc 1080ctaagggaag gccttggcct
cccgcccggc gacgacccca tgctcctcgc ctacctcctg 1140gacccttcca
acaccacccc cgagggggtg gcccggcgct acggcgggga gtggacggag
1200gaggcggggg agcgggccgc cctttccgag aggctcttcg ccaacctgtg
ggggaggctt 1260gagggggagg agaggctcct ttggctttac cgggaggtgg
agaggcccct ttccgctgtc 1320ctggcccaca tggaggccac gggggtgcgc
ctggacgtgg cctatctcag ggccttgtcc 1380ctggaggtgg ccgaggagat
cgcccgcctc gaggccgagg tcttccgcct ggccggccac 1440cccttcaacc
tcaactcccg ggaccagctg gaaagggtcc tctttgacga gctagggctt
1500cccgccatcg gcaagacgga gaagaccggc aagcgctcca ccagcgccgc
cgtcctggag 1560gccctccgcg aggcccaccc catcgtggag aagatcctgc
agtaccggga gctcaccaag 1620ctgaagagca cctacattga ccccttgccg
gacctcatcc accccaggac gggccgcctc 1680cacacccgct tcaaccagac
ggccacggcc acgggcaggc taagtagctc cgatcccaac 1740ctccagaaca
tccccgtccg caccccgctt gggcagagga tccgccgggc cttcatcgcc
1800gaggaggggt ggctattggt ggtcctggac tatagccaga tagagctcag
ggtgctggcc 1860cacctctccg gcgacgagaa cctgatccgg gtcttccagg
aggggcggga catccacacg 1920gaaaccgcca gctggatgtt cggcgtcccc
cgggaggccg tggaccccct gatgcgccgg 1980gcggccaaga ccatcaactt
cggggttctc tacggcatgt cggcccaccg cctctcccag 2040gagctagcca
tcccttacga ggaggcccag gccttcattg agcgctactt tcagagcttc
2100cccaaggtgc gggcctggat tgagaagacc ctggaggagg gcaggaggcg
ggggtacgtg 2160gagaccctct tcggccgtcg ccgctacgtg ccagacctag
aggcccgggt gaagagcgtg 2220cgggaggcgg ccgagcgcat ggccttcaac
atgcccgtcc agggcaccgc cgccgacctc 2280atgaagctgg ctatggtgaa
gctcttcccc aggctggagg aaatgggggc caggatgctc 2340cttcaggtcc
acgacgagct ggtcctcgag gccccaaaag agagggcgga ggccgtggcc
2400cggctggcca aggaggtcat ggagggggtg tatcccctgg ccgtgcccct
ggaggtggag 2460gtggggatag gggaggactg gctctctgcc aaggagtgag
250015829PRTArtificialMISC_FEATURE(1)..(829)Mutant of Taq
polymerase. 15Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val Leu Leu
Val Asp Gly1 5 10 15His His Leu Ala Tyr Arg Thr Phe His Ala Leu Lys
Gly Leu Thr Thr 20 25 30Ser Arg Gly Glu Pro Val Gln Ala Val Tyr Gly
Phe Ala Lys Ser Leu 35 40 45Leu Lys Ala Leu Lys Glu Asp Gly Asp Ala
Val Ile Val Val Phe Asp 50 55 60Ala Lys Ala Pro Ser Ser Arg His Glu
Ala Tyr Gly Gly Tyr Lys Ala65 70 75 80Gly Arg Ala Pro Thr Pro Glu
Asp Phe Pro Arg Gln Leu Ala Leu Ile 85 90 95Lys Glu Leu Val Asp Leu
Leu Gly Leu Ala Arg Leu Glu Val Pro Gly 100 105 110Tyr Glu Ala Asp
Asp Val Leu Ala Ser Leu Ala Lys Lys Ala Glu Lys 115 120 125Glu Gly
Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp Leu Tyr Gln 130 135
140Leu Leu Ser Asp Arg Ile His Val Leu His Pro Glu Gly Tyr Leu
Ile145 150 155 160Thr Pro Ala Trp Leu Trp Glu Lys Tyr Gly Leu Arg
Pro Asp Gln Trp 165 170 175Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu
Ser Asp Asn Leu Pro Gly 180 185 190Val Lys Gly Ile Gly Glu Lys Thr
Ala Lys Lys Leu Leu Glu Glu Trp 195 200 205Gly Ser Leu Glu Ala Leu
Leu Glu Asn Leu Asp Arg Leu Lys Pro Ala 210 215 220Ile Arg Glu Lys
Ile Leu Ala His Thr Asp Asp Leu Lys Leu Ser Trp225 230 235 240Asp
Leu Ala Lys Val Arg Thr Asp Leu Pro Leu Glu Val Asp Phe Ala 245 250
255Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe Leu Glu Arg
260 265 270Leu Glu Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu Glu
Ser Pro 275 280 285Lys Ala Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu
Gly Ala Phe Val 290 295 300Gly Phe Val Leu Ser Arg Lys Glu Pro Met
Trp Ala Asp Leu Leu Ala305 310 315 320Leu Ala Ala Ala Arg Gly Gly
Arg Val His Arg Ala Pro Glu Pro Tyr 325 330 335Lys Ala Leu Arg Asp
Leu Lys Glu Ala Arg Gly Leu Leu Ala Lys Asp 340 345 350Leu Ser Val
Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro Pro Gly Asp 355 360 365Asp
Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn Thr Thr Pro 370 375
380Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu Glu Ala
Gly385 390 395 400Glu Arg Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn
Leu Trp Gly Arg 405 410 415Leu Glu Gly Glu Glu Arg Leu Leu Trp Leu
Tyr Arg Glu Val Glu Arg 420 425 430Pro Leu Ser Ala Val Leu Ala His
Met Glu Ala Thr Gly Val Arg Leu 435 440 445Asp Val Ala Tyr Leu Arg
Ala Leu Ser Leu Glu Val Ala Glu Glu Ile 450 455 460Ala Arg Leu Glu
Ala Glu Val Phe Arg Leu Ala Gly His Pro Phe Asn465 470 475 480Leu
Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp Glu Leu Gly 485 490
495Leu Pro Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg Ser Thr Ser
500 505 510Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile Val
Glu Lys 515 520 525Ile Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser
Thr Tyr Ile Asp 530 535 540Pro Leu Pro Asp Leu Ile His Pro Arg Thr
Gly Arg Leu His Thr Arg545 550 555 560Phe Asn Gln Thr Ala Thr Ala
Thr Gly Arg Leu Ser Ser Ser Asp Pro 565 570 575Asn Leu Gln Asn Ile
Pro Val Arg Thr Pro Leu Gly Gln Arg Ile Arg 580 585 590Arg Ala Phe
Ile Ala Glu Glu Gly Trp Leu Leu Val Val Leu Asp Tyr 595 600 605Ser
Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly Asp Glu Asn 610 615
620Leu Ile Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr Glu Thr
Ala625 630 635 640Ser Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp
Pro Leu Met Arg 645 650 655Arg Ala Ala Lys Thr Ile Asn Phe Gly Val
Leu Tyr Gly Met Ser Ala 660 665 670His Arg Leu Ser Gln Glu Leu Ala
Ile Pro Tyr Glu Glu Ala Gln Ala 675 680 685Phe Ile Glu Arg Tyr Phe
Gln Ser Phe Pro Lys Val Arg Ala Trp Ile 690 695 700Glu Lys Thr Leu
Glu Glu Gly Arg Arg Arg Gly Tyr Val Glu Thr Leu705 710 715 720Phe
Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg Val Lys Ser 725 730
735Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro Val Gln Gly
740 745 750Thr Ala Ala Asp Leu Met Lys Leu Ala Met Val Lys Leu Phe
Pro Arg 755 760 765Leu Glu Glu Met Gly Ala Arg Met Leu Leu Gln Val
His Asp Glu Leu 770 775 780Val Leu Glu Ala Pro Lys Glu Arg Ala Glu
Ala Val Ala Arg Leu Ala785 790 795 800Lys Glu Val Met Glu Gly Val
Tyr Pro Leu Ala Val Pro Leu Glu Val 805 810 815Glu Val Gly Ile Gly
Glu Asp Trp Leu Ser Ala Lys Glu 820
825162553DNAArtificialmisc_feature(2552)..(2553)"n" can be any of
g, a, t and c. 16gatgctccct ctttttgagc ccaagggtcg cgtcctcctg
gtggacggcc accacctggc 60ctaccgcacc ttccacgccc tgaagggcct caccaccagc
cggggggagc cggtgcaggc 120ggtctacggc ttcgccaaga gcctcctcaa
ggccctcaag gaggacgggg acgcggtgat 180cgtggtcttt gacgccaagg
ccccctcctt ccgccacgag gcctacgggg ggtacaaggc 240gggccgggcc
cccacgccgg aggactttcc ccggcaactc gccctcatca aggagctggt
300ggacctcctg gggctggcgc gcctcgaggt cccgggctac gaggcggacg
acgtcctggc 360cagcctggcc aagaaggcgg aaaaggaggg ctacgaggtc
cgcatcctca ccgccgacaa 420agacctttac cagctccttt ccgaccgcat
ccacgtcctc caccccgagg ggtacctcat 480caccccggcc tggctttggg
aaaagtacgg cctgaggccc gaccagtggg ccgactaccg 540ggccctgacc
ggggacgagt ccgacaacct tcccggggtc aagggcatcg gggagaagac
600ggcgaggaag cttctggagg agtgggggag cctggaagcc ctcctcaaga
acctggaccg 660gctgaagccc gccatccggg agaagatcct ggcccacatg
gacgatctga agctctcctg 720ggacctggcc aaggtgcgca ccgacctgcc
cctggaggtg gacttcgcca aaaggcggga 780gcccgaccgg gagaggcttg
ggcctttctg gagaggcttg agcttggcag cctcctccac 840gagttcggcc
ttctggaaag ccccaaggcc ctggaggagg cctcctggcc cccgccggaa
900ggggccttcg tgggctttgt gctttcccgc aaggagccca tgtgggccga
tcttctggcc 960ctggccgccg ccaggggggg ccgggtccac cgggcccccg
agccttataa agccctcaga 1020gacctgaagg aggcgcgggg gcttctcgcc
aaagacctga gcgttctggc cctgagggaa 1080ggccttggcc tcccgcccgg
cgacgacccc atgctcctcg cctacctcct ggacccttcc 1140aacaccaccc
ccgagggggt ggcccggcgc tacggcgggg agtggacgga ggaggcgggg
1200gagcgggccg ccctttccga gaggctcttc gccaacctgt gggggaggct
tgagggggag 1260gagaggctcc tttggcttta ccgggaggtg gagaggcccc
tttccgctgt cctggcccac 1320atggaggcca cgggggtgcg cctggacgtg
gcctatctca gggccttgtc cctggaggtg 1380gccgaggaga tcgcccgcct
cgaggccgag gtcttccgcc tggccggcca ccccttcaac 1440ctcaactccc
gagaccagct ggaaagggtc ctctttgacg agctagggct tcccgccatc
1500ggcaagacgg agaagaccgg caagcgctcc accagcgccg ccgtcctgga
ggccctccgc 1560gaggcccacc ccatcgtgga gaagatcctg cagtaccggg
agctcaccaa gctgaagagc 1620acctacattg accccttgcc ggacctcatc
caccccagga cgggccgcct ccacacccgc 1680ttcaaccaga cggccacggc
cacgggcagg ctaagtagct ccgatcccaa cctccagaac 1740atccccgtcc
gcaccccgct tgggcagagg atccgccggg ccttcatcgc cgaggagggg
1800tggctattgg tggccctgga ctatagccag atagagctca gggtgctggc
ccacctctcc 1860ggcgacgaga acctgatccg ggtcttccag gaggggcggg
acatccacac ggagaccgcc 1920agctggatgt tcggcgtccc ccgggaggcc
gtggaccccc tgatgcgccg ggcggccaag 1980accatcaact tcggggtcct
ctacggcatg tcggccaccg cctctcccag gagctagcca 2040tcccttacga
ggaggcccag gccttcattg agcgctactt tcagagcttc cccaaggtgc
2100gggcctggat tgagaagacc ctggaggagg gcaggaggcg ggggtacgtg
gagaccctct 2160tcggccgccg ccgctacgtg ccagacctag aggcccgggt
gaagagcgtg cgggaggcgg 2220ccgagcgcat ggccttcaac atgcccgtcc
agggcaccgc cgccgacctc atgaagctgg 2280ctatggtgaa gctcttcccc
aggctggagg aaatgggggc caggatgctc cttcaggtcc 2340acgacgagct
ggtcctcgag gccccaaaag agagggcgga ggccgtggcc cggctggcca
2400aggaggtcat ggagggggtg tatcccctgg ccgtgcccct ggaggtggag
gtggggatag 2460gggaggactg gctctccgcc aaggagggag tcgacctgca
ggcagcgctt ggcgtcaccc 2520gcagttcggt ggtactggcc gtcgttttac ann
255317829PRTArtificialMISC_FEATURE(1)..(829)Mutant of Taq
polymerase. 17Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val Leu Leu
Val Asp Gly1 5 10 15His His Leu Ala Tyr Arg Thr Phe His Ala Leu Lys
Gly Leu Thr Thr 20 25 30Ser Arg Gly Glu Pro Val Gln Ala Val Tyr Gly
Phe Ala Lys Ser Leu 35 40 45Leu Lys Ala Leu Lys Glu Asp Gly Asp Ala
Val Ile Val Val Phe Asp 50 55 60Ala Lys Ala Pro Ser Phe Arg His Glu
Ala Tyr Gly Gly Tyr Lys Ala65 70 75 80Gly Arg Ala Pro Thr Pro Glu
Asp Phe Pro Arg Gln Leu Ala Leu Ile 85 90 95Lys Glu Leu Val Asp Leu
Leu Gly Leu Ala Arg Leu Glu Val Pro Gly 100 105 110Tyr Glu Ala Asp
Asp Val Leu Ala Ser Leu Ala Lys Lys Ala Glu Lys 115 120 125Glu Gly
Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp Leu Tyr Gln 130 135
140Leu Leu Ser Asp Arg Ile His Val Leu His Pro Glu Gly Tyr Leu
Ile145 150 155 160Thr Pro Ala Trp Leu Trp Glu Lys Tyr Gly Leu Arg
Pro Asp Gln Trp 165 170 175Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu
Ser Asp Asn Leu Pro Gly 180 185 190Val Lys Gly Ile Gly Glu Lys Thr
Ala Arg Lys Leu Leu Glu Glu Trp 195 200 205Gly Ser Leu Glu Ala Leu
Leu Lys Asn Leu Asp Arg Leu Lys Pro Ala 210 215 220Ile Arg Glu Lys
Ile Leu Ala His Met Asp Asp Leu Lys Leu Ser Trp225 230 235 240Asp
Leu Ala Lys Val Arg Thr Asp Leu Pro Leu Glu Val Asp Phe Ala 245 250
255Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe Leu Glu Arg
260 265 270Leu Glu Leu Gly Ser Leu Leu His Glu Phe Gly Leu Leu Glu
Ser Pro 275 280 285Lys Ala Leu Glu Glu Ala Ser Trp Pro Pro Pro Glu
Gly Ala Phe Val 290 295 300Gly Phe Val Leu Ser Arg Lys Glu Pro Met
Trp Ala Asp Leu Leu Ala305 310 315 320Leu Ala Ala Ala Arg Gly Gly
Arg Val His Arg Ala Pro Glu Pro Tyr 325 330 335Lys Ala Leu Arg Asp
Leu Lys Glu Ala Arg Gly Leu Leu Ala Lys Asp 340 345 350Leu Ser Val
Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro Pro Gly Asp 355
360 365Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn Thr Thr
Pro 370 375 380Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu
Glu Ala Gly385 390 395 400Glu Arg Ala Ala Leu Ser Glu Arg Leu Phe
Ala Asn Leu Trp Gly Arg 405 410 415Leu Glu Gly Glu Glu Arg Leu Leu
Trp Leu Tyr Arg Glu Val Glu Arg 420 425 430Pro Leu Ser Ala Val Leu
Ala His Met Glu Ala Thr Gly Val Arg Leu 435 440 445Asp Val Ala Tyr
Leu Arg Ala Leu Ser Leu Glu Val Ala Glu Glu Ile 450 455 460Ala Arg
Leu Glu Ala Glu Val Phe Arg Leu Ala Gly His Pro Phe Asn465 470 475
480Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp Glu Leu Gly
485 490 495Leu Pro Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg Ser
Thr Ser 500 505 510Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His Pro
Ile Val Glu Lys 515 520 525Ile Leu Gln Tyr Arg Glu Leu Thr Lys Leu
Lys Ser Thr Tyr Ile Asp 530 535 540Pro Leu Pro Asp Leu Ile His Pro
Arg Thr Gly Arg Leu His Thr Arg545 550 555 560Phe Asn Gln Thr Ala
Thr Ala Thr Gly Arg Leu Ser Ser Ser Asp Pro 565 570 575Asn Leu Gln
Asn Ile Pro Val Arg Thr Pro Leu Gly Gln Arg Ile Arg 580 585 590Arg
Ala Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala Leu Asp Tyr 595 600
605Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly Asp Glu Asn
610 615 620Leu Ile Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr Glu
Thr Ala625 630 635 640Ser Trp Met Phe Gly Val Pro Arg Glu Ala Val
Asp Pro Leu Met Arg 645 650 655Arg Ala Ala Lys Thr Ile Asn Phe Gly
Val Leu Tyr Gly Met Ser Ala 660 665 670His Arg Leu Ser Gln Glu Leu
Ala Ile Pro Tyr Glu Glu Ala Gln Ala 675 680 685Phe Ile Glu Arg Tyr
Phe Gln Ser Phe Pro Lys Val Arg Ala Trp Ile 690 695 700Glu Lys Thr
Leu Glu Glu Gly Arg Arg Arg Gly Tyr Val Glu Thr Leu705 710 715
720Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg Val Lys Ser
725 730 735Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro Val
Gln Gly 740 745 750Thr Ala Ala Asp Leu Met Lys Leu Ala Met Val Lys
Leu Phe Pro Arg 755 760 765Leu Glu Glu Met Gly Ala Arg Met Leu Leu
Gln Val His Asp Glu Leu 770 775 780Val Leu Glu Ala Pro Lys Glu Arg
Ala Glu Ala Val Ala Arg Leu Ala785 790 795 800Lys Glu Val Met Glu
Gly Val Tyr Pro Leu Ala Val Pro Leu Glu Val 805 810 815Glu Val Gly
Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu 820
82518829PRTArtificialMISC_FEATURE(1)..(829)Mutant of Taq
polymerase. 18Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val Leu Leu
Val Asp Gly1 5 10 15His His Leu Ala Tyr Arg Thr Phe His Ala Leu Lys
Gly Leu Thr Thr 20 25 30Ser Arg Gly Glu Pro Val Gln Ala Val Tyr Gly
Phe Ala Lys Ser Leu 35 40 45Leu Lys Ala Leu Lys Glu Asp Gly Asp Ala
Val Ile Val Val Phe Asp 50 55 60Ala Lys Ala Pro Ser Phe Arg His Glu
Ala Tyr Gly Gly Tyr Lys Ala65 70 75 80Gly Arg Ala Pro Thr Pro Glu
Asp Phe Pro Arg Gln Leu Ala Leu Ile 85 90 95Lys Glu Leu Val Asp Leu
Leu Gly Leu Ala Arg Leu Glu Val Pro Gly 100 105 110Tyr Glu Ala Asp
Asp Val Leu Ala Ser Leu Ala Lys Lys Ala Glu Lys 115 120 125Glu Gly
Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp Leu Tyr Gln 130 135
140Leu Leu Ser Asp Arg Ile His Val Leu His Pro Glu Gly Tyr Leu
Ile145 150 155 160Thr Pro Ala Trp Leu Trp Glu Lys Tyr Gly Leu Arg
Pro Asp Gln Trp 165 170 175Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu
Ser Asp Asn Leu Pro Gly 180 185 190Val Lys Gly Ile Gly Glu Lys Thr
Ala Lys Lys Leu Leu Glu Glu Trp 195 200 205Gly Ser Leu Glu Ala Leu
Leu Glu Asn Leu Asp Arg Leu Lys Pro Ala 210 215 220Ile Arg Glu Lys
Ile Leu Ala His Thr Asp Asp Leu Lys Leu Ser Trp225 230 235 240Asp
Leu Ala Lys Val Arg Thr Asp Leu Pro Leu Glu Val Asp Phe Ala 245 250
255Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe Leu Glu Arg
260 265 270Leu Glu Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu Glu
Ser Pro 275 280 285Lys Ala Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu
Gly Ala Phe Val 290 295 300Gly Phe Val Leu Ser Arg Lys Glu Pro Met
Trp Ala Asp Leu Leu Ala305 310 315 320Leu Ala Ala Ala Arg Gly Gly
Arg Val His Arg Ala Pro Glu Pro Tyr 325 330 335Lys Ala Leu Arg Asp
Leu Lys Glu Ala Arg Gly Leu Leu Ala Lys Asp 340 345 350Leu Ser Val
Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro Pro Gly Asp 355 360 365Asp
Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn Thr Thr Pro 370 375
380Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu Glu Ala
Gly385 390 395 400Glu Arg Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn
Leu Trp Gly Arg 405 410 415Leu Glu Gly Glu Glu Arg Leu Leu Trp Leu
Tyr Arg Glu Val Glu Arg 420 425 430Pro Leu Ser Ala Val Leu Ala His
Met Glu Ala Thr Gly Val Arg Leu 435 440 445Asp Val Ala Tyr Leu Arg
Ala Leu Ser Leu Glu Val Ala Glu Glu Ile 450 455 460Ala Arg Leu Glu
Ala Glu Val Phe Arg Leu Ala Gly His Pro Phe Asn465 470 475 480Leu
Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp Glu Leu Gly 485 490
495Leu Pro Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg Ser Thr Ser
500 505 510Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile Val
Glu Lys 515 520 525Ile Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser
Thr Tyr Ile Asp 530 535 540Pro Leu Pro Asp Leu Ile His Pro Arg Thr
Gly Arg Leu His Thr Arg545 550 555 560Phe Asn Gln Thr Ala Thr Ala
Thr Gly Arg Leu Ser Ser Ser Asp Pro 565 570 575Asn Leu Gln Asn Ile
Pro Val Arg Thr Pro Leu Gly Gln Arg Ile Arg 580 585 590Arg Ala Phe
Ile Ala Glu Glu Gly Trp Leu Leu Val Val Leu Asp Tyr 595 600 605Ser
Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly Asp Glu Asn 610 615
620Leu Ile Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr Glu Thr
Ala625 630 635 640Ser Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp
Pro Leu Met Arg 645 650 655Arg Ala Ala Lys Thr Ile Asn Phe Gly Val
Leu Tyr Gly Met Ser Ala 660 665 670His Arg Leu Ser Gln Glu Leu Ala
Ile Pro Tyr Glu Glu Ala Gln Ala 675 680 685Phe Ile Glu Arg Tyr Phe
Gln Ser Phe Pro Lys Val Arg Ala Trp Ile 690 695 700Glu Lys Thr Leu
Glu Glu Gly Arg Arg Arg Gly Tyr Val Glu Thr Leu705 710 715 720Phe
Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg Val Lys Ser 725 730
735Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro Val Gln Gly
740 745 750Thr Ala Ala Asp Leu Met Lys Leu Ala Met Val Lys Leu Phe
Pro Arg 755 760 765Leu Glu Glu Met Gly Ala Arg Met Leu Leu Gln Val
His Asp Glu Leu 770 775 780Val Leu Glu Ala Pro Lys Glu Arg Ala Glu
Ala Val Ala Arg Leu Ala785 790 795 800Lys Glu Val Met Glu Gly Val
Tyr Pro Leu Ala Val Pro Leu Glu Val 805 810 815Glu Val Gly Ile Gly
Glu Asp Trp Leu Ser Ala Lys Glu 820
825192499DNAArtificialmisc_feature(1)..(2499)Thermostable mutant of
Bacteriophage T7 polymerase. 19tcgtggtacg catcctcttt ttgagcccaa
gggccgcgtc ctcctggtgg acggccacca 60cctggcctac cgcaccttcc acgccctgaa
gggcctcacc accagccggg gggagccggt 120gcaggcggtc tacggcttcg
ccaagagcct cctcaaggcc ctcaaggagg acggggacgc 180ggtgatcgtg
gtctttgacg ccaaggcccc ctcctcccgc cacgaggcct acggggggta
240caaggcgggc cgggccccca cgccggagga ctttccccgg caactcgccc
tcatcaagga 300gctggtggac ctcctggggc tggcgcgcct cgaggtcccg
ggctacgagg cggacgacgt 360cctggccagc ctggccaaga aggcggaaaa
ggagggctat gaggtccgca tcctcaccgc 420cgacaaagac ctttaccagc
tcctttccga ccgcatccac gtcctccacc ccgaggggta 480cctcatcacc
ccggcctggc tttgggaaaa gtacggcctg aggcccgacc agtgggccga
540ctaccgggcc ctgaccgggg acgagtccga caaccttccc ggggtcaagg
gcatcgggga 600gaagacggcg aagaagcttc tggaggagtg ggggagcctg
gaagccctcc tcgagaacct 660ggaccggctg aagcccgcca tccgggagaa
gatcctggcc cacacggacg atctgaagct 720ctcctgggac ctggccaagg
tgcgcaccga cctgcccctg gaggtggact tcgccaaaag 780gcgggagccc
gaccgggaga ggcttagggc ctttctggag aggcttgagt ttggcagcct
840cctccacgag ttcggccttc tggaaagccc caaggccctg gaggaggccc
cctggccccc 900gccggaaggg gccttcgtgg gctttgtgct ttcccgcaag
gagcccatgt gggccgatct 960tctggccctg gccgccgcca ggggtggccg
ggtccaccgg gcccccgagc cttataaagc 1020cctcagggac ttgaaggagg
cgcgggggct tctcgccaaa gacctgagcg ttctggccct 1080aagggaaggc
cttggcctcc cgcccggcga cgaccccatg ctcctcgcct acctcctgga
1140cccttccaac accacccccg agggggtggc ccggcgctac ggcggggagt
ggacggagga 1200ggcgggggag cgggccgccc tttccgagag gctcttcgcc
aacctgtggg ggaggcttga 1260gggggaggag aggctccttt ggctttaccg
ggaggtggat aggccccttt ccgctgtcct 1320ggcccacatg gaggccacag
gggtgcgcct ggacgtggcc tatctcaggg ccttgtccct 1380ggaggtggcc
gaggagatcg cccgcctcga ggccgaggtc ttccgcctgg ccggccaccc
1440cttcaacctc aactcccggg accagctgga aagggtcctc tttgacgagc
tagggcttcc 1500cgccatcggc aagacggaga agaccggcaa gcgctccacc
agcgccgccg tcctggaggc 1560cctccgcgag gcccacccca tcgtggagaa
gatcctgcag taccgggagc tcaccaagct 1620gaagagcacc tacattgacc
ccttgccgga cctcatccac cccaggacgg gccgcctcca 1680cacccgcttc
aaccagacgg ccacggccac gggcaggcta agtagctccg atcccaacct
1740ccagaacatc cccgtccgca ccccgcttgg gcagaggatc cgccgggcct
tcatcgccga 1800ggaggggtgg ctattggtgg tcctggacta tagccagata
gagctcaggg tgctggccca 1860cctctccggc gacgagaacc tgatccgggt
cttccaggag gggcgggaca tccacacgga 1920aaccgccagc tggatgttcg
gcgtcccccg ggaggccgtg gaccccctga tgcgccgggc 1980ggccaagacc
atcaacttcg gggttctcta cggcatgtcg gcccaccgcc tctcccagga
2040gctagccatc ccttacgagg aggcccaggc cttcattgag cgctactttc
agagcttccc 2100caaggtgcgg gcctggattg agaagaccct ggaggagggc
aggaggcggg ggtacgtgga 2160gaccctcttc ggccgccgcc gctacgtgcc
agacctagag gcccgggtga agagcgtgcg 2220ggaggcggcc gagcgcatgg
ccttcaacat gcccgtccag ggcaccgccg ccgacctcat 2280gaagctggct
atggtgaagc tcttccccag gctggaggaa atgggggcca ggatgctcct
2340tcaggtccac gacgagctgg tcctcgaggc cccaaaagag agggcggagg
ccgtggcccg 2400gctggccaag gaggtcatgg agggggtgta tcccctggcc
gtgcccctgg aggtggaggt 2460ggggataggg gaggactggc tctccgccaa
ggagtgagt 249920827PRTArtificialMISC_FEATURE(1)..(827)Mutant of Taq
polymerase. 20Pro Leu Phe Glu Pro Lys Gly Arg Val Leu Leu Val Asp
Gly His His1 5 10 15Leu Ala Tyr Arg Thr Phe His Ala Leu Lys Gly Leu
Thr Thr Ser Arg 20 25 30Gly Glu Pro Val Gln Ala Val Tyr Gly Phe Ala
Lys Ser Leu Leu Lys 35 40 45Ala Leu Lys Glu Asp Gly Asp Ala Val Ile
Val Val Phe Asp Ala Lys 50 55 60Ala Pro Ser Ser Arg His Glu Ala Tyr
Gly Gly Tyr Lys Ala Gly Arg65 70 75 80Ala Pro Thr Pro Glu Asp Phe
Pro Arg Gln Leu Ala Leu Ile Lys Glu 85 90 95Leu Val Asp Leu Leu Gly
Leu Ala Arg Leu Glu Val Pro Gly Tyr Glu 100 105 110Ala Asp Asp Val
Leu Ala Ser Leu Ala Lys Lys Ala Glu Lys Glu Gly 115 120 125Tyr Glu
Val Arg Ile Leu Thr Ala Asp Lys Asp Leu Tyr Gln Leu Leu 130 135
140Ser Asp Arg Ile His Val Leu His Pro Glu Gly Tyr Leu Ile Thr
Pro145 150 155 160Ala Trp Leu Trp Glu Lys Tyr Gly Leu Arg Pro Asp
Gln Trp Ala Asp 165 170 175Tyr Arg Ala Leu Thr Gly Asp Glu Ser Asp
Asn Leu Pro Gly Val Lys 180 185 190Gly Ile Gly Glu Lys Thr Ala Lys
Lys Leu Leu Glu Glu Trp Gly Ser 195 200 205Leu Glu Ala Leu Leu Glu
Asn Leu Asp Arg Leu Lys Pro Ala Ile Arg 210 215 220Glu Lys Ile Leu
Ala His Thr Asp Asp Leu Lys Leu Ser Trp Asp Leu225 230 235 240Ala
Lys Val Arg Thr Asp Leu Pro Leu Glu Val Asp Phe Ala Lys Arg 245 250
255Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe Leu Glu Arg Leu Glu
260 265 270Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu Glu Ser Pro
Lys Ala 275 280 285Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly Ala
Phe Val Gly Phe 290 295 300Val Leu Ser Arg Lys Glu Pro Met Trp Ala
Asp Leu Leu Ala Leu Ala305 310 315 320Ala Ala Arg Gly Gly Arg Val
His Arg Ala Pro Glu Pro Tyr Lys Ala 325 330 335Leu Arg Asp Leu Lys
Glu Ala Arg Gly Leu Leu Ala Lys Asp Leu Ser 340 345 350Val Leu Ala
Leu Arg Glu Gly Leu Gly Leu Pro Pro Gly Asp Asp Pro 355 360 365Met
Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn Thr Thr Pro Glu Gly 370 375
380Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu Glu Ala Gly Glu
Arg385 390 395 400Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu Trp
Gly Arg Leu Glu 405 410 415Gly Glu Glu Arg Leu Leu Trp Leu Tyr Arg
Glu Val Asp Arg Pro Leu 420 425 430Ser Ala Val Leu Ala His Met Glu
Ala Thr Gly Val Arg Leu Asp Val 435 440 445Ala Tyr Leu Arg Ala Leu
Ser Leu Glu Val Ala Glu Glu Ile Ala Arg 450 455 460Leu Glu Ala Glu
Val Phe Arg Leu Ala Gly His Pro Phe Asn Leu Asn465 470 475 480Ser
Arg Asp Gln Leu Glu Arg Val Leu Phe Asp Glu Leu Gly Leu Pro 485 490
495Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg Ser Thr Ser Ala Ala
500 505 510Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile Val Glu Lys
Ile Leu 515 520 525Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser Thr Tyr
Ile Asp Pro Leu 530 535 540Pro Asp Leu Ile His Pro Arg Thr Gly Arg
Leu His Thr Arg Phe Asn545 550 555 560Gln Thr Ala Thr Ala Thr Gly
Arg Leu Ser Ser Ser Asp Pro Asn Leu 565 570 575Gln Asn Ile Pro Val
Arg Thr Pro Leu Gly Gln Arg Ile Arg Arg Ala 580 585 590Phe Ile Ala
Glu Glu Gly Trp Leu Leu Val Val Leu Asp Tyr Ser Gln 595 600 605Ile
Glu Leu Arg Val Leu Ala His Leu Ser Gly Asp Glu Asn Leu Ile 610 615
620Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr Glu Thr Ala Ser
Trp625 630 635 640Met Phe Gly Val Pro Arg Glu Ala Val Asp Pro Leu
Met Arg Arg Ala 645 650 655Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr
Gly Met Ser Ala His Arg 660 665 670Leu Ser Gln Glu Leu Ala Ile Pro
Tyr Glu Glu Ala Gln Ala Phe Ile 675 680 685Glu Arg Tyr Phe Gln Ser
Phe Pro Lys Val Arg Ala Trp Ile Glu Lys 690 695 700Thr Leu Glu Glu
Gly Arg Arg Arg Gly Tyr Val Glu Thr Leu Phe Gly705 710 715 720Arg
Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg Val Lys Ser Val Arg
725 730 735Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro Val Gln Gly
Thr Ala 740 745 750Ala Asp Leu Met Lys Leu Ala Met Val Lys Leu Phe
Pro Arg Leu Glu 755 760 765Glu Met Gly Ala Arg Met Leu Leu Gln Val
His Asp Glu Leu Val Leu 770 775 780Glu Ala Pro Lys Glu Arg Ala Glu
Ala Val Ala Arg Leu Ala Lys Glu785 790 795 800Val Met Glu Gly Val
Tyr Pro Leu Ala Val Pro Leu Glu Val Glu Val 805 810 815Gly Ile Gly
Glu Asp Trp Leu Ser Ala Lys Glu 820
825212483DNAArtificialmisc_feature(1)..(2483)Heparin-resistant
mutant of Taq polymerase. 21atttttgagc ccaagggccg cgtcctcctg
gtggacggcc accacctggc ctaccgcacc 60ttccacgccc tgaagggcct caccaccagc
cggggggagc cggtgcaggc ggtctacggc 120ttcgccaaga gcctcctcaa
ggccctcaag gaggacgggg acgcggtgat cgtggtcttt 180gacgccaagg
ccccctcctt ccgccacgag gcctacgggg ggtacaaggc gggccgggcc
240cccacgccgg aggactttcc ccggcaactc gccctcatca aggagctggt
ggacctcctg 300gggctggcgc gcctcgaggt cccgggctac gaggcggacg
acgtcctggc cagcctggcc 360aagaaggcgg aaaaggaggg ctacgaggtc
cgcatcctca ccgccgacaa agacctttac 420cagctccttt ccgaccgcat
ccacgtcctc caccccgagg ggtacctcat caccccggcc 480tggctttggg
aaaagtacgg cctgaggccc gaccagtggg ccgactaccg ggccctgacc
540ggggacgagt ccgacaacct tcccggtgtc aagggcatcg gggagaagac
ggcgaggaag 600cttctggagg agtgggggag cctggaagcc ctcctcaaga
acctggaccg gctggagccc 660gccatccggg agaagatcct ggcccacatg
gacgatctga agctctcctg ggacctggcc 720aaggtgcgca ccgacctgcc
cctggaggtg gacttcgcca aaaggcggga gcccgaccgg 780gagaggctta
gggcctttct ggagaggctt gagtttggca gcctcctcca cgagttcggc
840cttctggaaa gccccaaggc cccggaggag gccccctggc ccccgccgga
aggggccttc 900gtgggctttg tgctttcccg caaggagccc atgtgggccg
atcttctggc cctggccgcc 960gccagggggg gccgggtcca ccgggccccc
gagccttata aagccctcag ggacctgaag 1020gaggcgcggg ggcttctcgc
caaagacctg agcgttctgg ccctgaggga aggccttggc 1080ctcccgcccg
gcgacgaccc catgctcctc gcctacctcc tggacccttc caacaccacc
1140cccgaggggg tggcccggcg ctacggcggg gagtggacgg aggaggcggg
ggagcgggcc 1200gccctttccg agaggctctt cgccaacctg tgggggaggc
ttgaggggga ggagaggctc 1260ctttggcttt accgggaggt ggagaggccc
ctttccgctg tcctggccca catggaggcc 1320acgggggtgc gcctggacgt
gtcctatctc agggccttgt cccgggaggt ggccgaggag 1380atcgcccgcc
tcgaggccga ggtcttccgc ctggccggcc accccttcaa cctcaactcc
1440cgggaccagc tggaaagggt cctctttgac gagctagggc ttcccgccat
cggcaagacg 1500gagaagaccg gcaagcgctc caccagcgcc gccgtcctgg
aggccctccg cgaggcccac 1560cccatcgtgg agaagatcct gcagtaccgg
gagctcacca agctgaagag cacctacatt 1620gaccccttgc cggacctcat
ccaccccagg acgggccgcc tccacacccg cttcaaccag 1680acggccacgg
ccacgggcag gctaagtagc tccggtccca acctccagag catccccgtc
1740cgcaccccgc ttgggcagag gatccgccgg gccttcatcg ccgaggaggg
gtggctattg 1800gtggccctgg actatagcca gatagagctc agggtgctgg
cccacctctc cggcgacgag 1860aacctgatcc gggtcttcca ggaggggcgg
gacatccaca cggagaccgc cagctggatg 1920ttcggcgtcc cccgggaggc
cgtggacccc ctgatgcgcc gggcggccaa gaccatcaac 1980ttcggggtcc
tctacggcat gtcggcccac cgcctctccc aggagctagc catcccttac
2040gaggaggccc aggccttcat tgagcgctac tttcagagct tccccaaggt
gcgggcctgg 2100attgagaaga ccctggagga gggcaggagg cgggggtacg
tggagaccct cttcggccgc 2160cgccgctacg tgccagacct agaggcccgg
gtgaagagcg tgcgggaggc ggccgagcgc 2220atggccttca acatgcccgt
ccagggcacc gccgccgacc tcatgaagct ggctatggtg 2280aagctcttcc
ccaggctgga ggaaatgggg gccaggatgc tccttcaggt ccacgacgag
2340ctggtcctcg aggccccaaa agagagggcg gaggccgtgg cccggctggc
caaggaggtc 2400atggaggggg tgtatcccct ggccgtgccc ctggaggtgg
aggtggggat aggggaggac 2460tggctctccg ccaaggagtg att
248322825PRTArtificialMISC_FEATURE(1)..(825)Heparin-resistant
mutant of Taq polymerase. 22Phe Glu Pro Lys Gly Arg Val Leu Leu Val
Asp Gly His His Leu Ala1 5 10 15Tyr Arg Thr Phe His Ala Leu Lys Gly
Leu Thr Thr Ser Arg Gly Glu 20 25 30Pro Val Gln Ala Val Tyr Gly Phe
Ala Lys Ser Leu Leu Lys Ala Leu 35 40 45Lys Glu Asp Gly Asp Ala Val
Ile Val Val Phe Asp Ala Lys Ala Pro 50 55 60Ser Phe Arg His Glu Ala
Tyr Gly Gly Tyr Lys Ala Gly Arg Ala Pro65 70 75 80Thr Pro Glu Asp
Phe Pro Arg Gln Leu Ala Leu Ile Lys Glu Leu Val 85 90 95Asp Leu Leu
Gly Leu Ala Arg Leu Glu Val Pro Gly Tyr Glu Ala Asp 100 105 110Asp
Val Leu Ala Ser Leu Ala Lys Lys Ala Glu Lys Glu Gly Tyr Glu 115 120
125Val Arg Ile Leu Thr Ala Asp Lys Asp Leu Tyr Gln Leu Leu Ser Asp
130 135 140Arg Ile His Val Leu His Pro Glu Gly Tyr Leu Ile Thr Pro
Ala Trp145 150 155 160Leu Trp Glu Lys Tyr Gly Leu Arg Pro Asp Gln
Trp Ala Asp Tyr Arg 165 170 175Ala Leu Thr Gly Asp Glu Ser Asp Asn
Leu Pro Gly Val Lys Gly Ile 180 185 190Gly Glu Lys Thr Ala Arg Lys
Leu Leu Glu Glu Trp Gly Ser Leu Glu 195 200 205Ala Leu Leu Lys Asn
Leu Asp Arg Leu Glu Pro Ala Ile Arg Glu Lys 210 215 220Ile Leu Ala
His Met Asp Asp Leu Lys Leu Ser Trp Asp Leu Ala Lys225 230 235
240Val Arg Thr Asp Leu Pro Leu Glu Val Asp Phe Ala Lys Arg Arg Glu
245 250 255Pro Asp Arg Glu Arg Leu Arg Ala Phe Leu Glu Arg Leu Glu
Phe Gly 260 265 270Ser Leu Leu His Glu Phe Gly Leu Leu Glu Ser Pro
Lys Ala Pro Glu 275 280 285Glu Ala Pro Trp Pro Pro Pro Glu Gly Ala
Phe Val Gly Phe Val Leu 290 295 300Ser Arg Lys Glu Pro Met Trp Ala
Asp Leu Leu Ala Leu Ala Ala Ala305 310 315 320Arg Gly Gly Arg Val
His Arg Ala Pro Glu Pro Tyr Lys Ala Leu Arg 325 330 335Asp Leu Lys
Glu Ala Arg Gly Leu Leu Ala Lys Asp Leu Ser Val Leu 340 345 350Ala
Leu Arg Glu Gly Leu Gly Leu Pro Pro Gly Asp Asp Pro Met Leu 355 360
365Leu Ala Tyr Leu Leu Asp Pro Ser Asn Thr Thr Pro Glu Gly Val Ala
370 375 380Arg Arg Tyr Gly Gly Glu Trp Thr Glu Glu Ala Gly Glu Arg
Ala Ala385 390 395 400Leu Ser Glu Arg Leu Phe Ala Asn Leu Trp Gly
Arg Leu Glu Gly Glu 405 410 415Glu Arg Leu Leu Trp Leu Tyr Arg Glu
Val Glu Arg Pro Leu Ser Ala 420 425 430Val Leu Ala His Met Glu Ala
Thr Gly Val Arg Leu Asp Val Ser Tyr 435 440 445Leu Arg Ala Leu Ser
Arg Glu Val Ala Glu Glu Ile Ala Arg Leu Glu 450 455 460Ala Glu Val
Phe Arg Leu Ala Gly His Pro Phe Asn Leu Asn Ser Arg465 470 475
480Asp Gln Leu Glu Arg Val Leu Phe Asp Glu Leu Gly Leu Pro Ala Ile
485 490 495Gly Lys Thr Glu Lys Thr Gly Lys Arg Ser Thr Ser Ala Ala
Val Leu 500 505 510Glu Ala Leu Arg Glu Ala His Pro Ile Val Glu Lys
Ile Leu Gln Tyr 515 520 525Arg Glu Leu Thr Lys Leu Lys Ser Thr Tyr
Ile Asp Pro Leu Pro Asp 530 535 540Leu Ile His Pro Arg Thr Gly Arg
Leu His Thr Arg Phe Asn Gln Thr545 550 555 560Ala Thr Ala Thr Gly
Arg Leu Ser Ser Ser Gly Pro Asn Leu Gln Ser 565 570 575Ile Pro Val
Arg Thr Pro Leu Gly Gln Arg Ile Arg Arg Ala Phe Ile 580 585 590Ala
Glu Glu Gly Trp Leu Leu Val Ala Leu Asp Tyr Ser Gln Ile Glu 595 600
605Leu Arg Val Leu Ala His Leu Ser Gly Asp Glu Asn Leu Ile Arg Val
610 615 620Phe Gln Glu Gly Arg Asp Ile His Thr Glu Thr Ala Ser Trp
Met Phe625 630 635 640Gly Val Pro Arg Glu Ala Val Asp Pro Leu Met
Arg Arg Ala Ala Lys 645 650 655Thr Ile Asn Phe Gly Val Leu Tyr Gly
Met Ser Ala His Arg Leu Ser 660 665 670Gln Glu Leu Ala Ile Pro Tyr
Glu Glu Ala Gln Ala Phe Ile Glu Arg 675 680 685Tyr Phe Gln Ser Phe
Pro Lys Val Arg Ala Trp Ile Glu Lys Thr Leu 690 695 700Glu Glu Gly
Arg Arg Arg Gly Tyr Val Glu Thr Leu Phe Gly Arg Arg705 710 715
720Arg Tyr Val Pro Asp Leu Glu Ala Arg Val Lys Ser Val Arg Glu Ala
725 730 735Ala Glu Arg Met Ala Phe Asn Met Pro Val Gln Gly Thr Ala
Ala Asp 740 745 750Leu Met Lys Leu Ala Met Val Lys Leu Phe Pro Arg
Leu Glu Glu Met 755 760 765Gly Ala Arg Met Leu Leu Gln Val His Asp
Glu Leu Val Leu Glu Ala 770 775 780Pro Lys Glu Arg Ala Glu Ala Val
Ala Arg Leu Ala Lys Glu Val Met785 790 795 800Glu Gly Val Tyr Pro
Leu Ala Val Pro Leu Glu Val Glu Val Gly Ile 805 810 815Gly Glu Asp
Trp Leu Ser Ala Lys Glu 820
825232481DNAArtificialmisc_feature(1)..(2481)Heparin-resistant
mutant of Taq polymerase. 23tttgagccca agggccgcgt cctcctggtg
gacggccacc acctggccta ccgcaccttc 60cacgccctga agggcctcac caccagccgg
ggggagccgg tgcaggcggt ctacggcttc 120gccaagagcc tcctcaaggc
cctcaaggag gacggggacg cggtgatcgt ggtctttgac 180gccaaggccc
cctccttccg ccacgaggcc tacggggggt acaaggcggg ccgggccccc
240acgccggagg actttccccg gcaactcgcc ctcatcaagg agctggtgga
cctcctgggg 300ctggcgcgcc tcgaggtccc gggctacgag gcggacgacg
tcctggccag cctggccaag 360aaggcggaaa aggagggcta cgaggtccgc
atcctcaccg ccgacaaaga cctttaccag 420ctcctttccg accgcatcca
cgtcctccac cccgaggggt acctcatcac cccggcctgg 480ctttgggaaa
agtacggcct gaggcccgac cagtgggccg actaccgggc cctgaccggg
540gacgagtccg acaaccttcc cggtgtcaag ggcatcgggg agaagacggc
gaggaagcct 600tctggaggag tgggggagcc tggaagccct cctcaagaac
ctggaccggc tggagcccgc 660catccgggag aagatcctgg cccacatgga
cgatctgaag ctctcctggg acctggccaa 720ggtgcgcacc gacctgcccc
tggaggtgga cttcgccaaa aggcgggagc ccgaccggga 780gaggcttagg
gcctttctgg agaggcttga gtttggcagc ctcctccacg agttcggcct
840tctggaaagc cccaaggccc tggaggaggc cccctggccc ccgccggaag
gggccttcgt 900gggctttgtg ctttcccgca aggagcccat gtgggccgat
cttctggccc tggccgccgc 960cagggggggt cgggtccacc gggcccccga
gccttataaa gccctcaggg acctgaagga 1020ggcgcggggg cttctcgcca
aagacctgag cgttctggcc ctgagggaag gccttggcct 1080cccgcccggc
gacgacccca tgctcctcgc ctacctcctg gacccttcca acaccacccc
1140cgtgggggtg gcccggcgct acggcgggga gtggacggag gaggcggggg
agcgggccgc 1200cctttccgag aggctcttcg ccaacctgtg ggggaggctt
gagggggagg agaggctcct 1260ttggctttac cgggaggtgg agaggcccct
ttccgctgtc ctggcccaca tggaggctac 1320gggggtgcgc ctggacgtgg
cctatctcag ggccttgtcc ctggaggtgg ccgaggagat 1380cgcccgcctc
gaggccgagg tcttccgcct ggccggccac cccttcaacc tcaactcccg
1440ggaccagctg gaaagggtcc tctttgacga gctagggctt cccgccatcg
gcaagacgga 1500gaagaccggc aagcgctcca ccagcgccgc cgtcctggag
gccctccgcg aggcccaccc 1560catcgtggag aagatcctgc agtaccggga
gctcaccagg ctgaagagca cctacattga 1620ccccttgccg gacctcatcc
accccaggac gggccgcctc cacacccgct tcaaccagac 1680ggccacggcc
acgggcaggc taagtagctc cggtcccaac ctccagagca tccccgtccg
1740caccccgctt gggcagagga tccgccgggc cttcatcgcc gaggaggggt
ggctattggt 1800ggccctggac tatagccaga tagagctcag ggtgctggcc
cacctctccg gcgacgagaa 1860cctgatccgg gtcttccagg aggggcggga
catccacacg gagaccgcca gctggatgtt 1920cggcgtcccc cgggaggccg
tggaccccct gatgcgccgg gcggccaaga ccatcaactt 1980cggggtcctc
tacggcatgt cggcccaccg cctctcccag gagctagcca tcccttacga
2040ggaggcccag gccttcattg agcgctactt tcagagcttc cccaaggtgc
gggcctggat 2100tgagaagacc ctggaggagg gcaggaggcg ggggtacgtg
gagaccctct tcggccgccg 2160ccgctacgtg ccagacctag aggcccgggt
gaagagcgtg cgggaggcgg ccgagcgcag 2220ggccttcaac atgcccgtcc
agggcaccgc cgccgacctc atgaagctgg ctatggtgaa 2280gctcttcccc
aggctggagg aaatgggggc caggatgctc cttcaggtcc acgacgagct
2340ggtcctcgag gccccaaaag agagggcgga ggccgtggcc cggctggcca
aggaggtcat 2400ggagggggtg tatcccctgg ccgtgcccct ggaggtggag
gtggggatag gggaggactg 2460gctctccgcc aaggagtgag t
248124827PRTArtificialMISC_FEATURE(1)..(827)Heparin-resistant
mutant of Taq polymerase. 24Pro Leu Phe Glu Pro Lys Gly Arg Val Leu
Leu Val Asp Gly His His1 5 10 15Leu Ala Tyr Arg Thr Phe His Ala Leu
Lys Gly Leu Thr Thr Ser Arg 20 25 30Gly Glu Pro Val Gln Ala Val Tyr
Gly Phe Ala Lys Ser Leu Leu Lys 35 40 45Ala Leu Lys Glu Asp Gly Asp
Ala Val Ile Val Val Phe Asp Ala Lys 50 55 60Ala Pro Ser Phe Arg His
Glu Ala Tyr Gly Gly Tyr Lys Ala Gly Arg65 70 75 80Ala Pro Thr Pro
Glu Asp Phe Pro Arg Gln Leu Ala Leu Ile Lys Glu 85 90 95Leu Val Asp
Leu Leu Gly Leu Ala Arg Leu Glu Val Pro Gly Tyr Glu 100 105 110Ala
Asp Asp Val Leu Ala Ser Leu Ala Lys Lys Ala Glu Lys Glu Gly 115 120
125Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp Leu Tyr Gln Leu Leu
130 135 140Ser Asp Arg Ile His Val Leu His Pro Glu Gly Tyr Leu Ile
Thr Pro145 150 155 160Ala Trp Leu Trp Glu Lys Tyr Gly Leu Arg Pro
Asp Gln Trp Ala Asp 165 170 175Tyr Arg Ala Leu Thr Gly Asp Glu Ser
Asp Asn Leu Pro Gly Val Lys 180 185 190Gly Ile Gly Glu Lys Thr Ala
Arg Lys Leu Leu Glu Glu Trp Gly Ser 195 200 205Leu Glu Ala Leu Leu
Lys Asn Leu Asp Arg Leu Glu Pro Ala Ile Arg 210 215 220Glu Lys Ile
Leu Ala His Met Asp Asp Leu Lys Leu Ser Trp Asp Leu225 230 235
240Ala Lys Val Arg Thr Asp Leu Pro Leu Glu Val Asp Phe Ala Lys Arg
245 250 255Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe Leu Glu Arg
Leu Glu 260 265 270Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu Glu
Ser Pro Lys Ala 275 280 285Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu
Gly Ala Phe Val Gly Phe 290 295 300Val Leu Ser Arg Lys Glu Pro Met
Trp Ala Asp Leu Leu Ala Leu Ala305 310 315 320Ala Ala Arg Gly Gly
Arg Val His Arg Ala Pro Glu Pro Tyr Lys Ala 325 330 335Leu Arg Asp
Leu Lys Glu Ala Arg Gly Leu Leu Ala Lys Asp Leu Ser 340 345 350Val
Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro Pro Gly Asp Asp Pro 355 360
365Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn Thr Thr Pro Val Gly
370 375 380Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu Glu Ala Gly
Glu Arg385 390 395 400Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu
Trp Gly Arg Leu Glu 405 410 415Gly Glu Glu Arg Leu Leu Trp Leu Tyr
Arg Glu Val Glu Arg Pro Leu 420 425 430Ser Ala Val Leu Ala His Met
Glu Ala Thr Gly Val Arg Leu Asp Val 435 440 445Ala Tyr Leu Arg Ala
Leu Ser Leu Glu Val Ala Glu Glu Ile Ala Arg 450 455 460Leu Glu Ala
Glu Val Phe Arg Leu Ala Gly His Pro Phe Asn Leu Asn465 470 475
480Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp Glu Leu Gly Leu Pro
485 490 495Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg Ser Thr Ser
Ala Ala 500 505 510Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile Val
Glu Lys Ile Leu 515 520 525Gln Tyr Arg Glu Leu Thr Arg Leu Lys Ser
Thr Tyr Ile Asp Pro Leu 530 535 540Pro Asp Leu Ile His Pro Arg Thr
Gly Arg Leu His Thr Arg Phe Asn545 550 555 560Gln Thr Ala Thr Ala
Thr Gly Arg Leu Ser Ser Ser Gly Pro Asn Leu 565 570 575Gln Ser Ile
Pro Val Arg Thr Pro Leu Gly Gln Arg Ile Arg Arg Ala 580 585 590Phe
Ile Ala Glu Glu Gly Trp Leu Leu Val Ala Leu Asp Tyr Ser Gln 595 600
605Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly Asp Glu Asn Leu Ile
610 615 620Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr Glu Thr Ala
Ser Trp625 630 635 640Met Phe Gly Val Pro Arg Glu Ala Val Asp Pro
Leu Met Arg Arg Ala 645 650 655Ala Lys Thr Ile Asn Phe Gly Val Leu
Tyr Gly Met Ser Ala His Arg 660 665 670Leu Ser Gln Glu Leu Ala Ile
Pro Tyr Glu
Glu Ala Gln Ala Phe Thr 675 680 685Glu Arg Tyr Phe Gln Ser Phe Pro
Lys Val Arg Ala Trp Ile Glu Lys 690 695 700Thr Leu Glu Glu Gly Arg
Arg Arg Gly Tyr Val Glu Thr Leu Phe Gly705 710 715 720Arg Arg Arg
Tyr Val Pro Asp Leu Glu Ala Arg Val Lys Ser Val Arg 725 730 735Glu
Ala Ala Glu Arg Arg Ala Phe Asn Met Pro Val Gln Gly Thr Ala 740 745
750Ala Asp Leu Met Lys Leu Ala Met Val Lys Leu Phe Pro Arg Leu Glu
755 760 765Glu Met Gly Ala Arg Met Leu Leu Gln Val His Asp Glu Leu
Val Leu 770 775 780Glu Ala Pro Lys Glu Arg Ala Glu Ala Val Ala Arg
Leu Ala Lys Glu785 790 795 800Val Met Glu Gly Val Tyr Pro Leu Ala
Val Pro Leu Glu Val Glu Val 805 810 815Gly Ile Gly Glu Asp Trp Leu
Ser Ala Lys Glu 820
825252849DNAArtificialmisc_feature(1)..(2849)Mismatch extension
mutant of Taq polymerase. 25ttggaatgct ccctcttttt gagcccaaag
gccgcgtcct cctggtggac ggccaccacc 60tggcctaccg caccttccac gccctgaagg
gcctcaccac cagccggggg gagccggtgc 120aggcggtcta cggcttcgcc
aagagcctcc tcaaggccct caaggaggac ggggacgcgg 180tgatcgtggt
ctttgacgcc aaggccccct ccttccgcca cgaggcctac ggggggtaca
240aggcggcccg ggcccccacg ccggaggact ttccccggca actcgccctc
atcaaggagc 300tggtggatct cctggggctg gcgcgcctcg aggtcccggg
ctacgaggcg gacgacgtcc 360tggccagcct ggccaagaag gcggaaaagg
agggctacga ggtccgcatc ctcaccgccg 420acaaaggcct ttaccagctc
ctttccgacc gcatccacgt cctccacccc gaggggtacc 480tcatcacccc
ggcctggctt tgggaaaagt acggcctgag gcccgaccag tgggccgact
540accgggccct gaccggggac gagtccgaca accttcccgg ggtcaagggc
atcggggaga 600agacggcgag gaagcttctg gaggagtggg ggagcctgga
agccctcctc aagaacctgg 660accggctgaa gcccgccatc cgggagaaga
tcctggccca catggacgat ctgaagctct 720cctgggatct ggccaaggtg
cgcaccgacc gcccctggag gtggacttcg ccaaaaggcg 780ggagcccgac
cgggagaggc ttagggcctt tctggagagg cttgagtttg gcagcctcct
840ccacgagttc ggccttctgg aaagccccaa ggccctggag gaggccccct
ggcccccgcc 900ggaaggggcc ttcgtgggct ttgtcctttc ccgcagggag
cccatgtggg ccgatcttct 960ggccctggcc gccgccaggg ggggccgggt
ccaccgggcc cccgagcctt ataaagccct 1020cagggacctg aaggaggcgc
gggggcttct cgccaaagac ctgagcgttc tggccctgag 1080ggaaggcctt
ggcctcccgc ccggcgacga ccccatgctc ctcgcctacc tcctggaccc
1140ttccaacacc acccccgagg gggtggcccg gcgctacggc ggggagtgga
cggaggaggc 1200gggggagcgg gccgcccttt ccgagaggct cttcgccaac
ctgtggggga ggcttgaggg 1260ggaggagagg ctcctttggc tttaccggga
ggtggagagg cccctttccg ctgtcctggc 1320ccacatggag gccacggggg
tgcgcctgga cgtggcctat ctcagggcct tgtccctgga 1380ggtggccgag
gagatcgccc gcctcgaggc cgaggtcttc cgcctggccg gccacccctt
1440caacctcaac tcccgggacc agctggaaag ggtcctcttt gacgagctag
ggcttcccgc 1500catcggcaag acggagaaga ccggcaagcg ctccaccagc
gccgccgtcc tgggggccct 1560ccgcgaggcc caccccatcg tggagaagat
cctgcagtac cgggagctca ccaagctgaa 1620gagcacctac attgacccct
taccggacct catccacccc aggacgggcc gcctccacac 1680ccgcttcaac
cagacggcca cggccacggg caggctaagt agctccgatc ccaacctcca
1740gaacatcccc gtccgcaccc cgcttgggca gaggatccgc cgggccttca
tcgccgagga 1800ggggtggcta ttggtggtcc tggactatag ccagatagag
ctcagggtgc tggcccacct 1860ctccggcgac gagaacctga tccgggtctt
ccaggagggg cgggacatcc acacggagac 1920cgccagctgg atgttcggcg
tcccccggga ggccgtggac cccctgatgc gccgggcggc 1980caagaccatc
aacttcgggg tcctctacgg catgtcggcc caccgcctct cccaggagct
2040agccatccct tacgaggagg cccaggcctt cattgagcgc tactttcaga
gcttccccaa 2100ggtgcgggcc tggattgaga agaccctgga ggagggcagg
aggcgggggt acgtggagac 2160cctcttcggc cgccgccgct acgtgccaga
cctagaggcc cgggtgaaga gcgtgcgggg 2220ggcggccgag cgcatggcct
tcaacatgcc cgtccagggc accgccgccg acctcatgaa 2280gctggctatg
gtgaagctct tccccaggct ggaggaaatg ggggccagga tgctccttca
2340ggtccacgac gagctggtcc tcgaggcccc aaaagagagg gcggaggccg
tggcccggct 2400ggccaaggag gtcatggagg gggtgtatcc cctggccgtg
cccctggagg tggaggtggg 2460gataggggag gactggctct ccgccaagga
gtgagtcgac ctgcaggcag cgcttggcgt 2520cacccgcagt tcggtggtta
ataagcttga cctgtgaagt gaaaaatggc gcacattgtg 2580cgacattttt
tttgtctgcc gtttaccgct actgcgtcac ggatctccac gcgccctgta
2640gcggcgcatt aagcgcggcg ggtgtggtgg ttacgcgcag cgtgaccgct
acacttgcca 2700gcgccctagc gcccgctcct ttcgctttct tcccttcctt
tctcgccacg ttcgccggct 2760ttccccgtca agctctaaat cgggggctcc
ctttaggggt tcccgattta gtgcttttac 2820gggacctcga acccaaaaaa
ttgattagg 284926830PRTArtificialMISC_FEATURE(1)..(830)Mismatch
extension mutant of Taq polymerase. 26Gly Met Leu Pro Leu Phe Glu
Pro Lys Gly Arg Val Leu Leu Val Asp1 5 10 15Gly His His Leu Ala Tyr
Arg Thr Phe His Ala Leu Lys Gly Leu Thr 20 25 30Thr Ser Arg Gly Glu
Pro Val Gln Ala Val Tyr Gly Phe Ala Lys Ser 35 40 45Leu Leu Lys Ala
Leu Lys Glu Asp Gly Asp Ala Val Ile Val Val Phe 50 55 60Asp Ala Lys
Ala Pro Ser Phe Arg His Glu Ala Tyr Gly Gly Tyr Lys65 70 75 80Ala
Ala Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg Gln Leu Ala Leu 85 90
95Ile Lys Glu Leu Val Asp Leu Leu Gly Leu Ala Arg Leu Glu Val Pro
100 105 110Gly Tyr Glu Ala Asp Asp Val Leu Ala Ser Leu Ala Lys Lys
Ala Glu 115 120 125Lys Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp
Lys Gly Leu Tyr 130 135 140Gln Leu Leu Ser Asp Arg Ile His Val Leu
His Pro Glu Gly Tyr Leu145 150 155 160Ile Thr Pro Ala Trp Leu Trp
Glu Lys Tyr Gly Leu Arg Pro Asp Gln 165 170 175Trp Ala Asp Tyr Arg
Ala Leu Thr Gly Asp Glu Ser Asp Asn Leu Pro 180 185 190Gly Val Lys
Gly Ile Gly Glu Lys Thr Ala Arg Lys Leu Leu Glu Glu 195 200 205Trp
Gly Ser Leu Glu Ala Leu Leu Lys Asn Leu Asp Arg Leu Lys Pro 210 215
220Ala Ile Arg Glu Lys Ile Leu Ala His Met Asp Asp Leu Lys Leu
Ser225 230 235 240Trp Asp Leu Ala Lys Val Arg Thr Asp Leu Pro Leu
Glu Val Asp Phe 245 250 255Ala Lys Arg Arg Glu Pro Asp Arg Glu Arg
Leu Arg Ala Phe Leu Glu 260 265 270Arg Leu Glu Phe Gly Ser Leu Leu
His Glu Phe Gly Leu Leu Glu Ser 275 280 285Pro Lys Ala Leu Glu Glu
Ala Pro Trp Pro Pro Pro Glu Gly Ala Phe 290 295 300Val Gly Phe Val
Leu Ser Arg Arg Glu Pro Met Trp Ala Asp Leu Leu305 310 315 320Ala
Leu Ala Ala Ala Arg Gly Gly Arg Val His Arg Ala Pro Glu Pro 325 330
335Tyr Lys Ala Leu Arg Asp Leu Lys Glu Ala Arg Gly Leu Leu Ala Lys
340 345 350Asp Leu Ser Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro
Pro Gly 355 360 365Asp Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro
Ser Asn Thr Thr 370 375 380Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly
Glu Trp Thr Glu Glu Ala385 390 395 400Gly Glu Arg Ala Ala Leu Ser
Glu Arg Leu Phe Ala Asn Leu Trp Gly 405 410 415Arg Leu Glu Gly Glu
Glu Arg Leu Leu Trp Leu Tyr Arg Glu Val Glu 420 425 430Arg Pro Leu
Ser Ala Val Leu Ala His Met Glu Ala Thr Gly Val Arg 435 440 445Leu
Asp Val Ala Tyr Leu Arg Ala Leu Ser Leu Glu Val Ala Glu Glu 450 455
460Ile Ala Arg Leu Glu Ala Glu Val Phe Arg Leu Ala Gly His Pro
Phe465 470 475 480Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu
Phe Asp Glu Leu 485 490 495Gly Leu Pro Ala Ile Gly Lys Thr Glu Lys
Thr Gly Lys Arg Ser Thr 500 505 510Ser Ala Ala Val Leu Gly Ala Leu
Arg Glu Ala His Pro Ile Val Glu 515 520 525Lys Ile Leu Gln Tyr Arg
Glu Leu Thr Lys Leu Lys Ser Thr Tyr Ile 530 535 540Asp Pro Leu Pro
Asp Leu Ile His Pro Arg Thr Gly Arg Leu His Thr545 550 555 560Arg
Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser Ser Asp 565 570
575Pro Asn Leu Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln Arg Ile
580 585 590Arg Arg Ala Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Val
Leu Asp 595 600 605Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu
Ser Gly Asp Glu 610 615 620Asn Leu Ile Arg Val Phe Gln Glu Gly Arg
Asp Ile His Thr Glu Thr625 630 635 640Ala Ser Trp Met Phe Gly Val
Pro Arg Glu Ala Val Asp Pro Leu Met 645 650 655Arg Arg Ala Ala Lys
Thr Ile Asn Phe Gly Val Leu Tyr Gly Met Ser 660 665 670Ala His Arg
Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu Ala Gln 675 680 685Ala
Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg Ala Trp 690 695
700Ile Glu Lys Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr Val Glu
Thr705 710 715 720Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu
Ala Arg Val Lys 725 730 735Ser Val Arg Gly Ala Ala Glu Arg Met Ala
Phe Asn Met Pro Val Gln 740 745 750Gly Thr Ala Ala Asp Leu Met Lys
Leu Ala Met Val Lys Leu Phe Pro 755 760 765Arg Leu Glu Glu Met Gly
Ala Arg Met Leu Leu Gln Val His Asp Glu 770 775 780Leu Val Leu Glu
Ala Pro Lys Glu Arg Ala Glu Ala Val Ala Arg Leu785 790 795 800Ala
Lys Glu Val Met Glu Gly Val Tyr Pro Leu Ala Val Pro Leu Glu 805 810
815Val Glu Val Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu 820 825
830272484DNAArtificialmisc_feature(1)..(2484)Mismatch extension
mutant of Taq polymerase. 27tctttatgag cccaagggcc gcgtcctcct
ggtggacggc caccacctgg cctaccgcac 60cttccacgcc ctgaagggcc tcaccaccag
ccggggggag ccggtgcagg cggtctacgg 120cttcgccaag agcctcctca
aggccctcaa ggagggcggg gacgcggtga tcgtggtctt 180tgacgccaag
gccccctcct tcccccatga ggcctacggg gggtacaagg cgggccgggc
240ccccacgccg gaggactttc cccgacaact cgccctcatc aaggagctgg
tggacctcct 300ggggctgacg cgcctcgagg tcccgggcta cgaggcggac
gacgtcctgg ccagcctggc 360caagaaggcg gaaaaggagg gctacgaggt
ccgcatcctc accgccgaca aagaccttta 420ccagctcctt tccgaccgca
tccacgtcct ccaccccgag gggtacctca tcaccccggc 480ctggctttgg
gaaaagtacg gcctgaggcc cgaccagtgg gccgactacc gggccctgac
540cggggacgag tccgacaacc ttcccggggt caagggcatc ggggagaaga
cggcgaggaa 600gcttctggag gagtggggga gcctggaagc cctcctcaag
aacctggacc ggctgaagcc 660cgccatccgg gagaagatcc tggcccacat
ggacgatctg aagctctcct gggaccgggc 720caaggtgcgc accgacctgc
ccctggaggt ggacttcgcc aaaaggcggg agcccgaccg 780ggagaggctt
agggcctttc tggagaggct tgagtttggc agcctcctcc acgagttcgg
840ccttctggaa agccccaagg ccctggagga ggccccctgg cccccgccgg
aaggggcctt 900cgtgggcttt gtgctttccc gcaaggagcc catgtgggcc
gatcttctag ccctggccgc 960cgccaggggg ggccgggtcc accgggcccc
cgagccttat aaagccctcg gggacctgaa 1020ggaggcgcgg gggcttctcg
ccaaagacct gagcgttctg gccctgaggg aaggccttgg 1080cctcccgccc
gacgacgacc ccatgctcct cgcctacctc ctggaccctt ccaacaccac
1140ccccgagggg gtggcccggc gctacggcgg ggagtggacg gaggagcgag
gggagcgggc 1200cgccctttcc gagaggctct tcgccaacct gtgggggagg
cttgaggggg aggaaaggct 1260cctttggctt taccgggagg tggagaggcc
cctttccgct gtcctggccc acatggaggc 1320cacgggggtg cgcctggacg
tggcctatct cagggccttg tccctggagg tggccgagga 1380gatcgcccgc
ctcgaggccg aggtcttccg cctggccggc caccccttca acctcaactc
1440ccgggaccag ctggaaaggg tcctctttga cgagctaggg cttcccgcca
tcggcaagac 1500ggagaagacc ggcaagcgct ccaccagcgc cgccgtcctg
ggggccctcc gcgaggccca 1560ccccatcgtg gagaagatcc tgcagtaccg
ggagctcacc aagctgaaga gcacctacat 1620tgaccccttg ccggacctca
tccaccccag gacgggccgc ctccacaccc gcttcaacca 1680gacggccacg
gccacgggca ggctaagtag ctccgatccc aacctccaga gcatccccgt
1740ccgcaccccg cttgggcaga ggatccgccg ggccttcatc gccgaggagg
ggtggctatt 1800ggtggccctg gactatagcc agatagagct cagggtgctg
gcccacctct ccggcgacga 1860gaacctgatc cgggtcttcc aggaggggcg
ggacatccac acggagaccg ccagctggat 1920gttcggcgtc ccccgggagg
ccgtggaccc cctgatgcgc cgggcggcca agaccatcaa 1980cttcggggtc
ctctacggca tgtcggccca ccgcctctcc caggagctag ccatccctta
2040cgaggaggcc caggccttca ttaagcgcta ctttcagagc ttccccaagg
tgcgggcctg 2100gattgagaag accctggagg agggcaggag gcgggggtac
gtggagaccc tcttcggccg 2160ccgccgctac gtgccagacc tagaggcccg
ggtgaagagc gtgcgggagc cggccgagcg 2220catggccttc aacatgcccg
tccagggtac cgccgccgac ctcatgaagc tggctatggt 2280gaagctcttc
cccaggctgg aggaaatggg ggccaggatg ctccttcagg tccacgacga
2340gctggtcctc gaggccccaa aagagagggc ggaggccgtg gcccggctgg
ccaaggaggt 2400catggagggg gtgtatcccc tggccgtgcc cctggaggtg
gaggtgggga taggggagga 2460ctggctctcc gccaaggagt gagt
248428826PRTArtificialMISC_FEATURE(1)..(826)Mismatch extension
mutant of Taq polymerase. 28Leu Tyr Glu Pro Lys Gly Arg Val Leu Leu
Val Asp Gly His His Leu1 5 10 15Ala Tyr Arg Thr Phe His Ala Leu Lys
Gly Leu Thr Thr Ser Arg Gly 20 25 30Glu Pro Val Gln Ala Val Tyr Gly
Phe Ala Lys Ser Leu Leu Lys Ala 35 40 45Leu Lys Glu Gly Gly Asp Ala
Val Ile Val Val Phe Asp Ala Lys Ala 50 55 60Pro Ser Phe Pro His Glu
Ala Tyr Gly Gly Tyr Lys Ala Gly Arg Ala65 70 75 80Pro Thr Pro Glu
Asp Phe Pro Arg Gln Leu Ala Leu Ile Lys Glu Leu 85 90 95Val Asp Leu
Leu Gly Leu Thr Arg Leu Glu Val Pro Gly Tyr Glu Ala 100 105 110Asp
Asp Val Leu Ala Ser Leu Ala Lys Lys Ala Glu Lys Glu Gly Tyr 115 120
125Glu Val Arg Ile Leu Thr Ala Asp Lys Asp Leu Tyr Gln Leu Leu Ser
130 135 140Asp Arg Ile His Val Leu His Pro Glu Gly Tyr Leu Ile Thr
Pro Ala145 150 155 160Trp Leu Trp Glu Lys Tyr Gly Leu Arg Pro Asp
Gln Trp Ala Asp Tyr 165 170 175Arg Ala Leu Thr Gly Asp Glu Ser Asp
Asn Leu Pro Gly Val Lys Gly 180 185 190Ile Gly Glu Lys Thr Ala Arg
Lys Leu Leu Glu Glu Trp Gly Ser Leu 195 200 205Glu Ala Leu Leu Lys
Asn Leu Asp Arg Leu Lys Pro Ala Ile Arg Glu 210 215 220Lys Ile Leu
Ala His Met Asp Asp Leu Lys Leu Ser Trp Asp Arg Ala225 230 235
240Lys Phe Arg Thr Asp Leu Pro Leu Glu Val Asp Phe Ala Lys Arg Arg
245 250 255Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe Leu Glu Arg Leu
Glu Phe 260 265 270Gly Ser Leu Leu His Glu Phe Gly Leu Leu Glu Ser
Pro Lys Ala Leu 275 280 285Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly
Ala Phe Val Gly Phe Val 290 295 300Leu Ser Arg Lys Glu Pro Met Trp
Ala Asp Leu Leu Ala Leu Ala Ala305 310 315 320Ala Arg Gly Gly Arg
Val His Arg Ala Pro Glu Pro Tyr Lys Ala Leu 325 330 335Gly Asp Leu
Lys Glu Ala Arg Gly Leu Leu Ala Lys Asp Leu Ser Val 340 345 350Leu
Ala Leu Arg Glu Gly Leu Gly Leu Pro Pro Asp Asp Asp Pro Met 355 360
365Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn Thr Thr Pro Glu Gly Val
370 375 380Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu Glu Ala Gly Glu
Arg Ala385 390 395 400Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu Trp
Gly Arg Leu Glu Gly 405 410 415Glu Glu Arg Leu Leu Trp Leu Tyr Arg
Glu Val Glu Arg Pro Leu Ser 420 425 430Ala Val Leu Ala His Met Glu
Ala Thr Gly Val Arg Leu Asp Val Ala 435 440 445Tyr Leu Arg Ala Leu
Ser Leu Glu Val Ala Glu Glu Ile Ala Arg Leu 450 455 460Glu Ala Glu
Val Phe Arg Leu Ala Gly His Pro Phe Asn Leu Asn Ser465 470 475
480Arg Asp Gln Leu Glu Arg Val Leu Phe Asp Glu Leu Gly Leu Pro Ala
485 490 495Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg Ser Thr Ser Ala
Ala Val 500 505 510Leu Gly Ala Leu Arg Glu Ala His Pro Ile Val Glu
Lys Ile Leu Gln 515 520 525Tyr Arg Glu Leu Thr Lys Leu Lys Ser Thr
Tyr Ile Asp Pro Leu Pro 530 535 540Asp Leu Ile His Pro Arg Thr Gly
Arg Leu His
Thr Arg Phe Asn Gln545 550 555 560Thr Ala Thr Ala Thr Gly Arg Leu
Ser Ser Ser Asp Pro Asn Leu Gln 565 570 575Ser Ile Pro Val Arg Thr
Pro Leu Gly Gln Arg Ile Arg Arg Ala Phe 580 585 590Ile Ala Glu Glu
Gly Trp Leu Leu Val Ala Leu Asp Tyr Ser Gln Ile 595 600 605Glu Leu
Arg Val Leu Ala His Leu Ser Gly Asp Glu Asn Leu Ile Arg 610 615
620Val Phe Gln Glu Gly Arg Asp Ile His Thr Glu Thr Ala Ser Trp
Met625 630 635 640Phe Gly Val Pro Arg Glu Ala Val Asp Pro Leu Met
Arg Arg Ala Ala 645 650 655Lys Thr Ile Asn Phe Gly Val Leu Tyr Gly
Met Ser Ala His Arg Leu 660 665 670Ser Gln Glu Leu Ala Ile Pro Tyr
Glu Glu Ala Gln Ala Phe Ile Lys 675 680 685Arg Tyr Phe Gln Ser Phe
Pro Lys Val Arg Ala Trp Ile Glu Lys Thr 690 695 700Leu Glu Glu Gly
Arg Arg Arg Gly Tyr Val Glu Thr Leu Phe Gly Arg705 710 715 720Arg
Arg Tyr Val Pro Asp Leu Glu Ala Arg Val Lys Ser Val Arg Glu 725 730
735Pro Ala Glu Arg Met Ala Phe Asn Met Pro Val Gln Gly Thr Ala Ala
740 745 750Asp Leu Met Lys Leu Ala Met Val Lys Leu Phe Pro Arg Leu
Glu Glu 755 760 765Met Gly Ala Arg Met Leu Leu Gln Val His Asp Glu
Leu Val Leu Glu 770 775 780Ala Pro Lys Glu Arg Ala Glu Ala Val Ala
Arg Leu Ala Lys Glu Val785 790 795 800Met Glu Gly Val Tyr Pro Leu
Ala Val Pro Leu Glu Val Glu Val Gly 805 810 815Ile Gly Glu Asp Trp
Leu Ser Ala Lys Glu 820 825
* * * * *