U.S. patent application number 12/364996 was filed with the patent office on 2009-07-23 for anti-amyloid immunogenic compositions, methods and uses.
This patent application is currently assigned to CHIESI FARMACEUTICI S.P.A. Invention is credited to Bruno Pietro Imbimbo, Nadia Moretto, Simone Ottonello, Gino Villetti.
Application Number | 20090186033 12/364996 |
Document ID | / |
Family ID | 38437718 |
Filed Date | 2009-07-23 |
United States Patent
Application |
20090186033 |
Kind Code |
A1 |
Ottonello; Simone ; et
al. |
July 23, 2009 |
ANTI-AMYLOID IMMUNOGENIC COMPOSITIONS, METHODS AND USES
Abstract
The present invention provides a recombinant immunogenic
obtained by tandem multimerization of a B-cell epitope bearing
fragment of A.beta.42, within the active loop site of a carrier
(display site), preferably bacterial thioredoxin (Trx).
Polypeptides bearing multiple copies of A.beta.42 fragments,
preferably with an interposed amino acid linker, were constructed
and injected into mice in combination with an adjuvant. Monoclonal
antibodies were made which recognize the immunogenic construct
comprising a carrier bearing at least one fragment of A.beta.42
within an active loop site of the carrier. The elicited antibodies
were found to selectively bind to fibrillar and/or oligomers
A.beta. within neuritic AD plaques.
Inventors: |
Ottonello; Simone; (Parma,
IT) ; Moretto; Nadia; (Parma, IT) ; Imbimbo;
Bruno Pietro; (Parma, IT) ; Villetti; Gino;
(Parma, IT) |
Correspondence
Address: |
YOUNG & THOMPSON
209 Madison Street, Suite 500
ALEXANDRIA
VA
22314
US
|
Assignee: |
CHIESI FARMACEUTICI S.P.A
PARMA
IT
|
Family ID: |
38437718 |
Appl. No.: |
12/364996 |
Filed: |
February 3, 2009 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
11709280 |
Feb 22, 2007 |
7507710 |
|
|
12364996 |
|
|
|
|
60776210 |
Feb 24, 2006 |
|
|
|
Current U.S.
Class: |
424/139.1 ;
435/69.6; 530/387.9 |
Current CPC
Class: |
A61K 39/385 20130101;
C07K 16/18 20130101; A61K 2039/627 20130101; A61P 25/28 20180101;
A61K 39/0007 20130101; A61K 2039/505 20130101; A61P 37/02 20180101;
A61K 2039/6068 20130101 |
Class at
Publication: |
424/139.1 ;
530/387.9; 435/69.6 |
International
Class: |
A61K 39/395 20060101
A61K039/395; C07K 16/00 20060101 C07K016/00; C12P 21/04 20060101
C12P021/04 |
Claims
1. A monoclonal antibody which recognizes an immunogenic construct
comprising a carrier bearing at least one fragment of A.beta.42
within an active loop site of the carrier.
2. The monoclonal antibody of claim 1, wherein the carrier is
thioredoxin.
3. The monoclonal antibody of claim 2, wherein the at least one
A.beta.42 fragment is selected from the group consisting of
A.beta.1-3, A.beta.1-4 (SEQ ID NO: 3), A.beta.1-5 (SEQ ID NO: 4),
A.beta.1-6 (SEQ ID NO: 5), A.beta.1-7 (SEQ ID NO: 6), A.beta.1-8
(SEQ ID NO: 7), A.beta.1-9 (SEQ ID NO: 8), A.beta.1-10 (SEQ ID NO:
9), A.beta.1-11 (SEQ ID NO: 10), A.beta.1-12 (SEQ ID NO: 11),
A.beta.1-13 (SEQ ID NO: 12), A.beta.1-14 (SEQ ID NO: 13), and
A.beta.1-15 (SEQ ID NO: 14).
4. The monoclonal antibody of claim 3, wherein said at least one
A.beta.42 fragment is A.beta.1-15 (SEQ ID NO: 14).
5. The monoclonal antibody of claim 4, wherein the A.beta.1-15 (SEQ
ID NO: 14) fragment is bound to the thioredoxin by means of an
amino acid linker.
6. The monoclonal antibody of claim 5, wherein the amino acid
linker is Gly-Gly-Pro.
7. The monoclonal antibody of claim 4, wherein the thioredoxin
bears more than one said A.beta.1-15 (SEQ ID NO: 14) fragment.
8. The monoclonal antibody of claim 7, wherein the thioredoxin
bears 4 to 16 said A.beta.1-15 (SEQ ID NO: 14) fragments.
9. The monoclonal antibody of claim 8, wherein the thioredoxin
bears 4 said A.beta.1-15 (SEQ ID NO: 14) fragments.
10. The monoclonal antibody of claim 7, wherein each said
A.beta.1-15 (SEQ ID NO: 14) fragment is bound to the thioredoxin by
means of the amino acid linker.
11. The monoclonal antibody of claim 10, wherein the amino acid
linker is Gly-Gly-Pro.
12. A therapeutic agent for preventing or treating an amyloidogenic
disease, said agent comprising the monoclonal antibody of claim 1
as an active ingredient.
13. The therapeutic agent of claim 12, wherein the amyloidogenic
disease is Alzheimer's disease.
14. A therapeutic agent for preventing or treating an amyloidogenic
disease, said agent comprising the monoclonal antibody of claim 9
as an active ingredient.
15. The therapeutic agent of claim 14, wherein the amyloidogenic
disease is Alzheimer's disease.
16. A method for preparing an immunogenic construct comprising a
carrier, said carrier bearing at least one fragment of A.beta.42
within its active loop site, said method comprising: i) amplifying
the carrier in a suitable bacterium, ii) inserting the carrier in a
suitable vector, said vector comprising a T7 promoter for the
protein expression throughout the pET system; iii) preparing an
A.beta. fragment DNA insert; and iv) restricting and ligating the
carrier-vector and the A.beta. fragment DNA insert.
17. The method of claim 16, wherein the carrier is thioredoxin.
18. A method of claim 16, wherein the bacterium is E. Coli.
19. A method of claim 16, wherein the vector is pT7Kan-Trx.
Description
[0001] This application claims is divisional of application Ser.
No. 11/709,280, filed Feb. 22, 2007, now allowed, which claims
priority to provisional application No. 60/776,210, filed Feb. 24,
2006. The entire contents of the above-referenced application are
hereby incorporated by reference in its entirety.
FIELD OF THE INVENTION
[0002] The present invention relates to immunogenic constructs
comprising a fragment of A.beta.42 and a carrier characterized in
that said fragment is positioned within the active loop site
(display site) of the carrier, method of production and uses of the
same.
BACKGROUND OF THE INVENTION
[0003] Amyloidogenic diseases such as Alzheimer's disease (AD) have
been recognized as the major cause of dementia in elderly people.
The decline of cognitive abilities in AD is associated with
histopathological changes in the brain, the most relevant being the
formation of amyloid plaques and neurofibrilary tangles.
[0004] While amyloid plaques contain many proteins, they have as
their main constituent the amyloid-.beta. (A.beta.) peptide. The
formation of the A.beta. peptide, and thereby A.beta. amyloid
plaques, arises from aberrant processing of the amyloid precursor
protein (APP).
[0005] Currently, several pharmacological approaches have being
developed to slow or reverse the progression of AD. While several
approaches are directed to inhibit the metabolic generation of the
A.beta. peptide, others are directed to prevent the aggregation of
the A.beta. amyloid in the brain of AD affected patients.
[0006] However, the most promising approaches are directed to
increase the brain clearance of A.beta. plaques through the
administration of either antigens able to generate an immune
response against A.beta. (active immunization) or antibodies
directed against A.beta. (passive immunization).
[0007] Antigens or immunogens are usually macromolecules that
contain distinct antigenic sites or "epitopes" that are recognized
and interact with the various components of the immune system. They
usually comprise a small molecule or "hapten", such as short
peptide, coupled to a suitable carrier. Carriers typically are
proteins of higher molecular weight that are able to cause an
immunological response when administered in vivo.
[0008] In an immune response, antibodies are produced and secreted
by the B-lymphocytes in conjunction with the T-helper (TH) cells.
In the majority of hapten-carrier systems, the B cells produce
antibodies that are specific for both the hapten and the carrier.
In these cases, the T lymphocytes will have specific binding
domains on the carrier, but will not recognize the hapten alone. In
a kind of synergism, the B and T cells cooperate to induce a
hapten-specific antibody response.
[0009] Therefore, in constructing an effective antigen, the
selection of the proper carrier and the proper hapten is crucial to
guarantee a robust and selective immunogenic response. The safety
of the antigen is also of crucial importance. For example, the
administration to AD patients of the promising AN-1792 vaccine
constituted by pre-aggregated A.beta.42 and the immune adjuvant
QS-21 led to severe meningoencephalitis in about 6% of the treated
subjects. Both central activation of cytotoxic T cells and
autoimmune reactions were proposed as potential mechanisms of
toxicity. An immunological response against endogenous monomeric
A.beta. may be harmful since non-aggregated A.beta. species have a
physiological role in neuronal activity.
[0010] Thus, it is of great importance the proper selection of both
the hapten and the carrier to guarantee antibody selectivity
towards the harmful A.beta. species and to prevent autoimmune
toxicity.
[0011] WO2005058940 proposes conjugating peptide immunogen
comprising A.beta. peptide or a fragment thereof to a
protein/polypeptide carrier.
[0012] The immunogenic constructs are produced by a chemical method
comprising derivatizing functional groups of amino acid residues of
the carrier wherein any unconjugated, derivatized functional groups
of the amino acid residues are inactivated via capping to block
them from reacting with other molecules. Such a method results in
immunogens wherein the A.beta. fragment is bound to the amino acid
side chains of the carrier. While in WO2005058940 several different
carriers and haptens have been proposed their in vivo
histopathological efficacy has not been shown.
[0013] Kim, H. D. et al in Biochem. Biophys, Res. Commun. Volume
336, pages 84-92 propose an anti-A.beta. DNA vaccine, composed of
unscaffolded 11-fold repeats of A.beta.1-6.
[0014] Such construct yielded antibodies that indiscriminately
recognized monomeric, oligomeric and fibrillar A.beta.42
species.
[0015] In general, selective targeting of immunogens against the
different assembly states of A.beta.42 (monomers, oligomers or
fibrils) has not been achieved so far.
[0016] In view of the above considerations there is still a need to
develop a safe and effective immunogenic construct which may be
used in therapeutic vaccination compositions to prevent the
aggregation of A.beta. amyloid in the brain of patients affected by
AD or other amyloidogenic diseases such as Down Syndrome.
[0017] The present invention provides a recombinant immunogenic
construct characterized in that the A.beta. fragments is positioned
within the active loop site (display site) of the carrier rather
than bound to the ends of the carrier. Said peptide is obtained by
tandem multimerization of a B-cell epitope bearing fragment of
A.beta.42, within the active loop site (display site) of a carrier,
preferably thioredoxin (Trx).
[0018] The immunogens of the present invention were found to elicit
antibodies recognizing neurotoxic oligomeric species of the A.beta.
amyloid which recently have been indicated as the most proximate
causative agents of amyloidogenic diseases.
[0019] This capability has been associated with the construction of
the immunogen featuring the A.beta. amyloid within the carrier.
Such configuration to some extent permits the right folding of the
immunogenic protein and more effectively presents it to the immune
system. When the immunogen bears more than one A.beta. amyloid
fragment, and in particular specific numbers of said fragments, the
resemblance of the immunogen to the A.beta. amyloid oligomers, is
believed to further improve its efficacy as well as to increase the
selectivity.
[0020] A linker between the carrier and the fragments further helps
in preserving the peptide epitope assembly state.
SUMMARY OF THE INVENTION
[0021] The present invention provides an immunogenic construct
(also indicated hereinafter as immunogen) comprising a fragment
bearing the immunodominant B-cell epitope of A.beta.42 and a
carrier characterized in that said fragment is positioned within
the active loop site (display site) of the carrier. The carrier is
preferably thioredoxin whereas the A.beta. fragment is
advantageously a N-terminal fragment of less than 30 amino acid
residues, preferably less than 20 amino acid, more preferably is
A.beta.1-15.
[0022] Even more preferably the immunogenic construct bears more
than one fragment, preferably 2 to 16, most preferably 4
fragments.
[0023] The present invention also provides a method to construct
said immunogen, the method comprising a linker assisted tandem
multimerization of a B-cell epitope bearing a fragment of A.beta.42
within the display of the carrier, preferably a N-terminal fragment
of less than 30 amino acid residues.
[0024] In another aspect the present invention provides a
composition comprising said immunogen for active vaccination
against amyloidogenic diseases.
[0025] In a further aspect the present invention provides the use
of said immunogen to develop antibodies, preferably monoclonal
antibodies, to be used as passive vaccine against amyloidogenic
diseases.
DESCRIPTION OF THE FIGURES
[0026] FIG. 1a shows the Trx(A.beta.1-15-Gly-Gly-Pro)n construct
according to the present invention.
[0027] FIG. 1b shows the purification to homogeneity by
metal-affinity chromatography of constructs bearing one, four or
eight copies of Trx-displayed A.beta.1-15.
[0028] FIG. 1c shows anti-A.beta. antibody levels elicited by
immunogens according to embodiments of the present invention.
[0029] FIG. 1d shows Th2-polarized response immunogens according to
embodiments of the present invention.
[0030] FIG. 2a-b-c show human brain sections treated with sera from
mice immunized with immunogens according to the embodiments of the
present invention.
[0031] FIG. 3 shows AFM images showing preferential bindings of
immunogens according to embodiments of the present invention.
DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS
[0032] The present invention provides an immunogenic construct (or
immunogen) comprising a carrier bearing at least one A.beta.42
fragment. Said fragment is positioned within a surface exposed
region (active loop site or display site) of the carrier which
stabilizes it conformationally.
[0033] The exact size and chemical homogeneity of the construct is
routinely determined by both gel electroforesis and mass
spectrometry.
[0034] The structure of the construct may be determined by
analytical techniques; however nuclear magnetic resonance (NMR) is
preferably employed.
[0035] The carrier is preferably thioredoxin (Trx). Trx is
particularly suitable for its small size (109 amino acids), peptide
display capacity, and ability to act as a non-toxic immunoenhancer
capable of stimulating murine T-cell proliferation. However other
carriers may be used.
[0036] The A.beta. amyloid fragment is a N-terminal end,
advantageously a N-terminal fragment having less than 30 amino acid
residues, preferably less than 20 amino acid, and more preferably
selected from the group consisting of A.beta.1-3, 1-4, 1-5, 1-6,
1-7, 1-8, 1-9, 1-10, 1-11, 1-12, 1-13, 1-14, 1-15 reported in Table
1 below, according to the one-letter code for amino acids.
Preferably, the A.beta. amyloid fragment is A.beta.1-15.
[0037] Advantageously the immunogenic construct of the invention
bears more than one fragment, preferably from 2 to 16, more
preferably 4 fragments.
[0038] In a preferred embodiment the fragments are bound to the
carrier throughout a linker to prevent the formation of junctional
epitopes. Said linker is a short amino acid sequence, preferably a
linker constituted of 1 to 5 amino acid residues, more preferably
Glycine-Glycine-Proline (Gly-Gly-Pro). However other linkers may be
used, such as Glycine-Proline-Glycine-Proline-Glycine
(Gly-Pro-Gly-Pro-Gly) (SEQ ID NO: 1), or
Serine-Glycine-Serine-Glycine (Ser-Gly-Ser-Gly) (SEQ ID NO: 2).
[0039] The preferred immunogen construct consists of thioredoxin
linked, optionally through a suitable linker, to four A.beta.1-15
fragments, indicated hereinafter as Trx(A.beta.1-15).sub.4.
[0040] The method to construct said immunogen is a cloning method
that comprises amplifying the carrier in a suitable bacterium,
inserting the carrier in a suitable vector, said vector comprising
a T7 promoter for the protein expression throughout the pET system;
preparing an A.beta. fragment DNA insert; restricting and ligating
the carrier-vector and the A.beta. fragment DNA insert.
[0041] Preferably the A.beta. fragment DNA insert comprises an
amino acid linker.
[0042] Whenever multimers are prepared an excess of A.beta.
fragment DNA insert is employed.
TABLE-US-00001 TABLE 1 Description Sequence A.beta.1-3 DAE
A.beta.1-4 DAEF (SEQ ID NO: 3) A.beta.1-5 DAEFR (SEQ ID NO: 4)
A.beta.1-6 DAEFRH (SEQ ID NO: 5) A.beta.1-7 DAEFRHD (SEQ ID NO: 6)
A.beta.1-8 DAEFRHDS (SEQ ID NO: 7) A.beta.1-9 DAEFRHDSG (SEQ ID NO:
8) A.beta.1-10 DAEFRHDSGY (SEQ ID NO: 9) A.beta.1-11 DAEFRHDSGYE
(SEQ ID NO: 10) A.beta.1-12 DAEFRHDSGYEV (SEQ ID NO: 11)
A.beta.1-13 DAEFRHDSGYEVH (SEQ ID NO: 12) A.beta.1-14
DAEFRHDSGYEVHH (SEQ ID NO: 13) A.beta.1-15 DAEFRHDSGYEVHHQ (SEQ ID
NO: 14)
[0043] The preferred immunogenic construct of the present
invention, upon injection once-a-month for 4 months in transgenic
mice in which a brain .beta.-amyloid pathology had been induced,
appears to reduce the number and the size of A.beta. plaques in
hippocampus and cerebral cortex. Moreover the preferred immunogenic
construct of the invention was found to elicit antibodies which
recognize determined species of A.beta.42.
[0044] Said antibodies upon intra-hippocampal injection are capable
of clearing A.beta.42-positive plaques in hippocampus and cortex of
the transgenic mice, said clearing effect being particularly
evident for oligomeric A.beta. species. Said antibodies were also
found to strongly improve A.beta.-associated astrogliosis (Example
2).
[0045] Accordingly, the immunogenic constructs of the present
invention may form compositions for use as both active and passive
vaccine against amyloidogenic diseases.
[0046] For active vaccination, a pharmaceutical composition
comprising the immunogenic construct of the invention is
advantageously administered in combination with an adjuvant.
[0047] The selection of an adjuvant and/or carrier depends on the
stability of the vaccine containing the adjuvant, the route of
administration, the dosing schedule, the efficacy of the adjuvant
for the species being vaccinated, and, in humans, a
pharmaceutically acceptable adjuvant is one that has been approved
or is approvable for human administration by pertinent regulatory
bodies. For example, Complete Freund's adjuvant is not suitable for
human administration. Suitable adjuvants include 3 De-O-acylated
monophosphoryl lipid A (MPL), muramyl-di-pepdide and saponins such
as QS21 and Quil A. A preferred class of adjuvants is aluminum
salts (alum), such as aluminum hydroxide, aluminum phosphate,
aluminum sulfate. Further adjuvants include cytokines, such as
interleukins (IL-1, IL-2, and IL-12), macrophage colony stimulating
factor (M-CSF), tumor necrosis factor (TNF).
[0048] An adjuvant can be administered with the immunogen as a
single composition, or can be administered before, concurrent with
or after administration of the immunogen. Optionally, two or more
different adjuvants can be used simultaneously.
[0049] Immunogen and adjuvant can be packaged and supplied either
in the same vial or in separate vials and mixed before use.
[0050] The pharmaceutical compositions comprising the immunogenic
construct of the invention may also include a variety of other
pharmaceutically acceptable components. See Remington's
Pharmaceutical Science (15.sup.th Ed., Mack Publishing Company,
Easton, Pa., 1980).
[0051] The preferred pharmaceutical form depends on the intended
mode of administration and therapeutic application. The
compositions can also include, depending on the formulation
desired, pharmaceutically-acceptable, non-toxic carriers or
diluents, which are defined as vehicles commonly used to formulate
pharmaceutical compositions for animal or human administration.
[0052] The diluent is selected so as not to affect the biological
activity of the combination. Examples of such diluents are
distilled water, physiological phosphate-buffered saline, Ringer's
solutions, dextrose solution, and Hank's solution.
[0053] For the parenteral administration, the immunogenic construct
of the invention can be administered as injectable dosages of a
solution or suspension of the substance in a physiologically
acceptable diluent with a pharmaceutical carrier which can be a
sterile liquid such as water oils, saline, glycerol, or
ethanol.
[0054] Additionally, auxiliary substances, such as wetting or
emulsifying agents, surfactants, pH buffering substances and the
like can be present in the compositions.
[0055] The compositions of the invention may be prepared as
injectables, either as liquid solutions or suspensions; solid forms
suitable for solution in, or suspension in, liquid vehicles prior
to injection can also be prepared.
[0056] The immunogenic construct of the invention may be
administered in the form of a depot injection or implant
preparation which can be formulated in such a manner as to permit a
sustained release of the active ingredient.
[0057] Additional formulations suitable for other modes of
administration include oral, intranasal, and pulmonary
formulations, suppositories, and transdermal formulations.
[0058] For passive vaccination, the composition is injected into a
mammal, such as a Guinea pig or other animal species and the
resulting antibodies are purified and subsequently injected into
humans.
[0059] Preferably the antibodies are monoclonal and are produced by
immunizing a mammal with the Trx(A.beta.1-15).sub.4 immunogenic
construct. Said antibodies are used for the prevention and
treatment of amyloidogenic diseases, in particular Alzheimer's
disease.
Example 1
Preparation of Different TrxA.beta. Immunogenic Constructs and Ex
Vivo Evaluation of the Effects of Different Anti-TrxA.beta.
Antibodies
[0060] A cloning strategy relying on the use of an excess of the
A.beta.1-15 DNA insert with respect to a modified recipient vector
bearing the Trx coding sequence under the control of a phage T7
promoter was utilized for Trx(A.beta.1-15)n construction (FIG. 1a).
Constructs bearing one, four or eight copies of Trx-displayed
A.beta.1-15 were isolated and used to express the corresponding
polypeptides, which were then purified to homogeneity by
metal-affinity chromatography (FIG. 1b).
[0061] Instrumental to the production of properly assembled
A.beta.1-15 multimers were the directionality and in-frame fusion
capability of the unique CpoI site present within the Trx sequence
(nucleotide positions 99-105, corresponding to amino acid residues
34-35, identified as: 5' . . . CG/GT(A)CCG . . . 3') as well as the
incorporation into A.beta.1-15 DNA of a terminal sequence coding
for an intervening Gly-Gly-Pro linker, thus also preventing the
formation of junctional epitopes.
[0062] A fourth construct (TrxA.beta.42) bearing a single copy of
the full-length A.beta.42 peptide was prepared in a similar way.
While all Trx(A.beta.1-15)n polypeptides were soluble regardless of
A.beta.1-15 multiplicity, most of the TrxA.beta.42 protein ended up
in inclusion bodies in an insoluble form (not shown). Thus,
A.beta.42 appears to be poorly soluble even when fused to Trx in
the heterologous context of bacterial cells.
[0063] Five groups of 10 male BALB/c mice were treated with 10 nmol
of the above Trx(A.beta.15)n polypeptides, or with equivalent
amounts of pre-aggregated synthetic A.beta.42 or TrxA.beta.42, all
supplemented with alum, an adjuvant approved for human use (FIG.
1c).
[0064] Two additional groups injected with buffer alone (PBS) or
with alum-free A.beta.42 served as negative controls. Sera were
collected two weeks after the fourth injection, randomly pooled in
pairs, and analyzed with Enzyme-Linked Immunosorbent Assay (ELISA)
using aggregated A.beta.42 as the target antigen. As shown in FIG.
1c, mean anti-A.beta. antibody levels elicited by Trx(A.beta.1-15)4
and Trx(A.beta.1-15)8, but not by TrxA.beta.1-15, were
significantly higher (P<0.05;) than those of mock-treated
controls and similar to those of the A.beta.42-treated groups,
where TrxA.beta.42 performed as well as free A.beta.42.
[0065] P is the p-value associated with the t-test on log
transformed control and experimental data using the Bayesian or
regularized standard deviations; P indicates the probability that
the result obtained in a statistical test is due to chance rather
than a true relationship between measures.
[0066] A strongly anti-inflammatory Th2-polarized response, typical
of the alum adjuvant, was revealed by isotype profiling (FIG. 1d).
Although a prevalence of immunoglobulin of class G and subclasses 1
(IgG1) was observed with all antigens, the IgG1/IgG2
(immunoglobulin of class G and subclasses 2) a ratio was
reproducibly higher (P<0.05) for multimeric Trx(A.beta.1-15)n
and TrxA.beta.42 immunoconjugates than for unconjugated
A.beta.42.
[0067] The ability of antisera generated in response to
Trx(A.beta.1-15)n to bind amyloid plaques was investigated next.
This property, presently considered as the best prognostic
indication of in vivo anti-A.beta. antibody efficacy, is not shared
by all previously described anti-A.beta. antisera (e.g., m266 and
other antibodies targeting the C-terminal portion of
A.beta.42).
[0068] As shown in FIG. 2a-b, sera from mice immunized with the
tetrameric or the octameric form of Trx(A.beta.1-15)n, bound to
amyloid plaques up to a dilution of 1/1000.
[0069] Large neuritic plaques, as well as mature and immature
plaques, were labelled by antimultimeric Trx(A.beta.1-15)n
antibodies. A broader immunostaining, especially within senile
plaque cores, was observed with the positive control anti-Pan
.beta.-amyloid antiserum, generated in rabbits using A.beta.40 as
antigen (not shown). By comparison, no plaques were detected either
with sera from mock-treated animals (not shown), or with sera from
mice immunized with monomeric TrxA.beta.1-15 (FIG. 2c).
[0070] Finally, immunoblots were used to assess the capacity of the
various anti-Trx(A.beta.1-15)n antibodies toward different assembly
states of A.beta.42 (monomers, oligomers and fibrils) generated in
vitro under previously determined conditions and verified by atomic
force microscopy (AFM). The results of this analysis are given in
FIG. 3, which shows that anti-Trx(A.beta.1-15)8 antibodies bind all
three A.beta.42 species, while anti-Trx(A.beta.1-15)4 antibodies
preferentially bind both soluble oligomers and fibrils, but not
A.beta.42 monomers. In sharp contrast, antibodies raised against
the monomeric TrxA.beta.1-15 antigen shows no binding as well as
lack of recognition of A.beta.42 fibrils. The latter observation is
in accordance with the inability of these antibodies to recognize
higher order A.beta.42 aggregates in ELISAs as well as A.beta.
fibrils in AD plaques (see FIGS. 1c and 2c). Interestingly,
however, anti-monomeric TrxA.beta.1-15 antibodies bind A.beta.42
monomers and oligomers (FIG. 3). Trx(A.beta.1-15)4 is thus a
soluble, T cell epitope-lacking amyloid-.beta. derivative with good
immunogenic activity, even when formulated with a moderate-strength
adjuvant such as alum, Al(OH)3. Also significant is the ability of
Trx(A.beta.1-15)4 to generate antibodies that bind to synaptotoxic
A.beta.42 oligomers and fibrils, but not to the presumably
physiological monomeric A.beta. species.
[0071] The main advantages of Trx-dPI compared to other peptide
immunization strategies are its time and cost effectiveness, the
lack of cellular toxicity and the yield of chemically homogeneous
immunoconjugates, the batch-to-batch consistency of which can be
readily verified. Moreover, once a "lead antigen" has been
identified, it is easily amenable to further modification,
including the incorporation of additional peptide epitopes and
vector replacement for DNA vaccination purposes.
[0072] TrxA.beta. constructs. The sequence coding for E. coli
thioredoxin has been amplified by polymer chain reaction (PCR)
employing primers 1 and 2 (Table 2), design to confer the
restriction site NdeI e BamHI. The amplified fragment has been
double digested with NdeI e BamHI restriction enzymes and ligated
to pET28b.RTM. (Novagen) digested with the same two enzymes; the
resulting vector, designed as pT7Kan-Trx, harbors the sequence for
an N- and C terminally His6-tagged (SEQ ID NO: 15) version of
bacterial thioredoxin along with a kanamicin resistance marker.
[0073] The unique CpoI site present within the Trx coding sequence
(nucleotide positions 99-105, corresponding to amino acid residues
34-35, identified as: 5' . . . CG/GT(A)CCG . . . 3') was used as
cloning site.
[0074] Instrumental to the production of multimers are the
directionality and in-frame fusion capabilities of the unique CpoI
site.
[0075] pT7Kan-TrxA.beta.1-15. The sequence coding for the
A.beta.1-15 peptide, the N-terminal fragment of the amyloid beta
peptide A.beta.42, has been obtained by annealing of the
phosphorylated oligonucleotides:
TABLE-US-00002 (SEQ ID NO: 16) 5'-
GTCCGATGGATGCAGAATTCCGACATGACTCAGGATATGAAGTTCATCAT CAAGGCG-3'
(forward) (SEQ ID NO: 17) 3'-
GCTACCTACGTCTTAAGGCTGTACTGAGTCCTATACTTCAAGTAGTAGTT CCGCCAG-5'
(reverse)
[0076] bearing a terminal CpoI recognition sequence. The DNA insert
of 57 bp (5'-protruding CpoI) has been ligated to CpoI-digested
pT7Kan-Trx, at 1/10 vector/insert molar ratio.
[0077] N-n4-6xHis (SEQ ID NO: 15)-n10-TRX
(1-33)GPMDAEFRHDSGYEVHHQGGPTRX (Residues 54-74 of SEQ ID NO: 18)
(36-109)-n15-6xHis (SEQ ID NO: 15)-C
[0078] The entire sequence is:
TABLE-US-00003 (SEQ ID NO: 18)
mgsshhhhhhssglvprgshMGDKIIHLTDDSFDTDVLKADGAILVDFWA
EWCGPMDAEFRHDSGYEVHHQGGPCKMTAPTLDETADEYQGKLTVAKLNI
DQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLRdp
nsssvdklaaalehhhhhh
[0079] The main features of the TrxA.beta.1-15 construct concern
with the presence of a Met residue (M) at the N-terminus of
A.beta.1-15 peptide, a Gly-Gly-Pro linker at the C-terminus of
A.beta.1-15 peptide and sequences coding for an N- and a
C-terminally His.sub.6-tagged (SEQ ID NO: 15) version of bacteria
thioredoxin.
[0080] pT7Kan-Trx(A.beta.1-15).sub.4 e
pT7Kan-Trx(A.beta.1-15).sub.8. Constructs bearing more copies of
A.beta.1-15 peptide have been obtained in a similar way, but at
1/100 vector/insert molar ratio. Recombinant clones were screened
by restriction digestion/gel electrophoresis and two of them
bearing four or eight copies of the A.beta.1-15 sequence were used
to express and purify the corresponding recombinant proteins
Trx(A.beta.1-15).sub.4 and Trx(A.beta.1-15).sub.8.
[0081] The presence of two His.sub.6-tag (SEQ ID NO: 15) helps the
purification step and could increase the immunogenicity, as the
case of tandem repeats of lysine residues.
TABLE-US-00004 TABLE 2 N.degree. Primer Name Sequence T.sub.m 1
Nde_Trx-PLUS Cgcatatgggcgataaaattattcacc 60 (SEQ ID NO: 19) 2
Bam_Trx-MINUS Cgggatcccgccaggttagcgtcgag 60 (SEQ ID NO: 20)
[0082] Expression and purification of the Trx A.beta. polypeptides.
Expression was induced by adding 1 mM
isopropyl-.beta.-D-thiogalactopyranoside (IPTG) to E. coli BL21Star
(DE3) cells (Invitrogen) transformed with each of the above
constructs and allowed to proceed for 2 h at 37.degree. C. A
different E. coli strain (Origami-DE3; Novagen) and modified
expression conditions (pT7-Amp-Trx vector; 5 h at 30.degree. C.)
were used for Trx A.beta. 42, which was otherwise completely
insoluble. Following cell lysis, His6-tagged (SEQ ID NO: 15) Trx
A.beta. polypeptides were bound to a metal-affinity resin (Talon;
Clontech), purified as per manufacturer instructions and
extensively dialyzed against phosphate buffered saline (PBS).
Protein concentration was determined with the Coomassie dye method
(Bio-Rad) and by UV absorbance. The composition and purity of
individual polypeptides was assessed by both gel electrophoresis on
11% polyacrylamide-SDS gels and MALDI-TOF analysis (MassLynx 4.0,
Waters).
[0083] Immunization protocol. Recombinant Trx A.beta. polypeptides
(2 mg/ml in PBS) were filter-sterilized and an aliquot of each (10
nmol) was mixed with 1 mg of alum (Sigma-Aldrich), in a final
volume of 400 .mu.l, immediately before use. A.beta. 42
(Sigma-Aldrich) was dissolved in PBS (2 mg/ml) and aggregated
overnight at 37.degree. C. prior to immunization. Five randomly
assorted groups of one-month-old, male BALB/c mice (Charles River
Laboratories; 10 animals each) were injected subcutaneously with
the above antigens at day 1, 15, 30 and 60, as specified in FIG.
1c. The same treatment was applied to two negative control groups
that were injected with PBS and with aggregated A.beta. 42, both
without alum. Sera were collected two weeks after the last boost
and randomly pooled in pairs.
[0084] Detection of anti-A.beta. 42 antibodies. Total anti-A.beta.
42 antibodies were detected by ELISA at a fixed 1/200 dilution,
using aggregated A.beta.42 (0.5 .mu.g/well) as the target
antigen23. Following incubation, washing, and the addition of
horseradish peroxidase (HRP)-conjugated anti-mouse immunoglobulins
( 1/5000; Sigma-Aldrich) and chromogenic substrate
o-phenylendiamine (Sigma-Aldrich), plates were read
spectrophotometrically at 450 nm. Immunoglobulin isotype
determination was conducted at a fixed 1/200 dilution, using rat
anti-mouse Ig subclass-specific, HRP-conjugated secondary
antibodies (TechniPharm). ELISAs were conducted in triplicate on
the five-paired sera from each group; only a subset of sera from
the three top responders in groups 1, 3, 4, 6 and 7 (FIG. 1c) was
utilized for isotype determination. Comparisons between groups were
conducted by one-way ANOVA using the Analyze-it software.
[0085] Immunohistochemistry. Sera from mice immunized with each of
the three TrxA.beta.1-15 polypeptides were screened for their
ability to bind A.beta. plaques in human brain sections from a
68-year-old patient with neuropathological and clinical symptoms
typical of severe Alzheimer's disease. Various dilutions ( 1/100-
1/1000) of pooled sera from the three top responders in groups 5, 6
and 7 were analyzed; the best results were obtained with a 1/500
dilution. Sera were added to serial 8-.mu.m brain sections of
formalin-fixed, temporal cortical tissue, pre-treated with formic
acid (80%, 15 min). Sera from mock-treated (PBS) animals and a
commercial anti-A.beta.40 polyclonal antibody preparation (Anti-Pan
.beta.-Amyloid, Biosource) were used as negative and positive
controls, respectively. Immunolabeling was revealed with the
EnVision Plus/horseradish peroxidase system (Dako), using
3-3'-diaminobenzidine as the chromogenic substrate according to
manufacturer instructions.
[0086] Images were captured with a digital camera at magnifications
ranging from 50 to 400.times..
[0087] Dot blot assays and AFM imaging. A.beta.42 species for dot
blot analysis were prepared according to previously protocols known
in the art (see for example Stine, W. B. et al in J. Biol. Chem.
Volume 278, page 11612-11622). Briefly, A.beta.42 dissolved in 2 M
DMSO (1 mM final concentration) was utilized as the source of the
monomeric form; dilution of the DMSO stock solution into cold Ham's
F12 K medium (phenol red-free; Biosource) at a final concentration
of 100 .mu.M, followed by incubation for 24 h at 4.degree. C. was
used to prepare soluble oligomers; the same stock solution diluted
into 10 mM HCl at a final concentration of 100 mM and incubated for
24 h at 37.degree. C. was used to generate A fibrils. The identity
of the various A species, as well as the absence of fibrils from
soluble oligomer solutions, was verified by AFM. To this end, the
above-described A.beta. 42 solutions were diluted 10-fold in 20
.mu.l of deposition buffer (4 mM HEPES pH 7.4, 10 mM NaCl, 7 mM
MgCl2) to a final concentration of 10 .mu.M and immediately
deposited onto freshly cleaved ruby mica at room temperature. After
five minutes, mica disks were rinsed with milli-Q grade water and
gently dried under a stream of nitrogen. Images were collected with
a Nanoscope III microscope (Digital Instruments) operated in
tapping mode, using commercial diving board silicon cantilevers
(MikroMasch). A fixed volume of each A species, corresponding to
either 0.1 pmol or 1 pmol of A.beta.42 peptide, was spotted onto
nitrocellulose membranes (GE Healthcare Life Sciences) pre-wetted
with 20 mM Tris-HCl, pH 7.5, 0.8% NaCl (TBS) using a
vacuum-operated dot blotter apparatus (96 wells; Bio-Rad). Dot
blots were prepared in batches of eight membranes each, which were
dried and stored at 4.degree. C. for no more than two weeks before
use. Antisera for dot blot analysis were affinity-purified on
protein-A minicolumns (Diatheva) as per manufacturer instructions.
Following determination of total immunoglobulin concentration with
the Coomassie dye method, purified immunoglobulins were used for
dot blot assays at a final concentration of 0.75 .mu.g/ml. After
blocking at room temperature with 5% non-fat dry milk in TBS
supplemented with 0.05% Tween 20 (TBST), blots were incubated for
1.5 hours with each of the three primary Trx A.beta.1-15 antibodies
in dry milk-TBST, washed 3.times.10 min with TBST, followed by
mouse immunoglobulin detection with the SuperSignal West Femto kit
(Pierce) as specified by the manufacturer. Three independent
technical replicates were carried with antisera from the top
responding pool in each group.
Example 2
Evaluation of the Effects of Anti-Trx(A.beta.1-15).sub.4 Antibodies
In Vivo on Brain .beta.-Amyloid Pathology in Adult Tg2576
Transgenic Mice
[0088] Methods
[0089] Female transgenic AD (Tg2576) mice expressing the Swedish
mutation of human APP (1) were obtained from Boston University
Alzheimer's Disease Center's mouse colony. Founders for this colony
were provided by Dr. Karen Hsiao-Ashe (Department of Neurology,
University of Minnesota Medical School). APP Tg2576 mice develop
behavioural abnormalities and exhibit histological evidence of
brain A.beta. deposits as plaques, along with associated
astrogliosis, from as early as 8 months. Mice were genotyped using
a standardized PCR assay on tail DNA and were housed four in each
cage under standard conditions with ad libitum access to food and
water. Six 14-month-old APP mice (32-34 g each), placed on a 12 hr
light schedule, were used for surgeries. Mice were anesthetized
with ketamine HCl/xylazine intraperitoneal injection (100 mg/kg
ketamine and 10 mg/kg xylazine; 100 .mu.l/10 g body weight) and
were positioned in a stereotaxic apparatus (Koph) with a mouse head
adaptor. Thermoregulation was maintained at 37.degree. C. using a
warming pad with respiratory monitoring throughout the procedure.
The scalp was incised in the midline to expose the sagittal suture
and stereotaxic coordinates in both hemispheres were determined
(2). The bregma was used as reference point (2.0 mm) and holes were
drilled in the calvarium at the junction of the left and right
lateral coordinates (1.75 mm). Affinity-purified
anti-Trx(A.beta.1-15).sub.4 antibodies along with mock
immunoglobulins from PBS-treated mice (2 .mu.l each) were
stereotaxically injected into the left and right hippocampus (2.0
mm ventral), respectively, using a blunt-tipped 10 .mu.l syringe
(Hamilton). Upon syringe placement there was a 2 min dwell time,
followed by a 4 min injection time and an additional 2 min dwell
time prior to removal of the syringe. A topical antiseptic was
applied as the incision was closed, using a 9 mm autoclip. Mice
were kept on a warming pad until full recovery. All animal
experiments were performed in accordance with the National
Institutes of Health Guide for the Care and Use of Laboratory
Animals and both the Veterans Administration and Boston University
Animal Care Committees. Seven days post-injection, mice were deeply
anesthetized and transcardially perfused with 2% buffered
paraformaldehyde (100 ml). Brains were post-fixed for 2 h,
cryoprotected in a graded series of glycerol and subsequently
frozen-sectioned (50 .mu.m). Serially cut mouse tissue sections
were stained for Nissl substance, immunostained with anti-A.beta.42
(cat. no. 344; Biosource International), anti-A.beta. oligomer
(A11; Biosource International) and glial fibrillary antigen protein
(GFAP; Dako) antibodies, and silver stained using the
Campbell-Switzer method for identification of mature A.beta.
plaques. Serial-cut A.beta.42 immunostained coronal tissue-sections
within the hippocampus beginning from Interaural: 1.68 mm/Bregma:
-2.12 mm to Interaural: 2.16 mm/Bregma: -1.64 mm were
quantitatively analyzed. A.beta.42-positive plaques were quantified
from high resolution images of the same brain areas within the
anti-Trx(A.beta.1-15).sub.4-treated hemisphere and the
contralateral PBS-treated hemisphere using BioVision (3) and
Neurolucida software programs (MicroBrightField, Williston, Vt.).
BioVision differentiates and counts plaques from the background
neuropil, while Neurolucida extracts the data from the BioVision
images, exporting it to Excel (Microsoft, Redmond, Wash.) for
statistical analysis.
[0090] Results
[0091] The immunotherapeutic potential of
anti-Trx(A.beta.1-15).sub.4 was evaluated next by stereotaxically
injecting this antibody into the hippocampus of 14-month-old APP
transgenic AD (Tg2576) mice. Mock immunoglobulins from mice treated
with PBS only, injected into the contralateral hemisphere, served
as an internal control for this experiment. Seven days
post-injection, histopathological examination revealed a marked
reduction of A.beta.immunostaining in the hippocampus and
overriding neocortex of mice receiving the
anti-Trx(A.beta.1-15).sub.4 antibody, in contrast to the
mock-injected hemisphere. A{tilde over (.beta.)}positive plaques
were not only absent at the injection site, but significantly
diminished within the injection penumbra (2 mm anterior/posterior
to the injection site).
[0092] This suggests that not only fibrils and small oligomers, but
also higher-order oligomers are targeted in vivo by the
anti-Trx(A.beta.1-15).sub.4 antibody. In order to verify that these
findings were not the result of a competition between
anti-Trx(A.beta.1-15).sub.4 and the primary anti-A.beta. antibody,
we performed alternative histopathological analyses using glial
fibrillary antigen protein (GFAP) immunostaining and
Campbell-Switzer silver staining to detect astrogliosis and A.beta.
plaques. Astrogliosis and glia-associated plaques were markedly
reduced within the anti-Trx(A.beta.1-15).sub.4 antibody injection
penumbra compared to the contralateral mock-injected hemisphere. In
addition, as revealed by Campbell-Switzer silver staining, there
were far less plaques in the anti-Trx(A.beta.1-15).sub.4-injected
hemisphere compared to the mock-injected hemisphere. Both
observations are consistent with the immunostaining data obtained
with anti-A.beta. antibody detection. From a quantitative point of
view, in comparison to the PBS-treated hemisphere, there was a
significant reduction in the number of A.beta.42-positive plaques
in the anti-Trx(A.beta.1-15).sub.4-treated hemisphere (PBS-treated
hemisphere: 3.34.times.10.sup.3.+-.0.58;
anti-Trx(A.beta.1-15).sub.4-treated hemisphere:
0.97.times.10.sup.3.+-.0.27, P<0.01).
Sequence CWU 1
1
2015PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 1Gly Pro Gly Pro Gly1 524PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 2Ser
Gly Ser Gly134PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 3Asp Ala Glu Phe145PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 4Asp
Ala Glu Phe Arg1 556PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 5Asp Ala Glu Phe Arg His1
567PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 6Asp Ala Glu Phe Arg His Asp1 578PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 7Asp
Ala Glu Phe Arg His Asp Ser1 589PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 8Asp Ala Glu Phe Arg His
Asp Ser Gly1 5910PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 9Asp Ala Glu Phe Arg His Asp Ser Gly
Tyr1 5 101011PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 10Asp Ala Glu Phe Arg His Asp Ser Gly
Tyr Glu1 5 101112PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 11Asp Ala Glu Phe Arg His Asp Ser Gly
Tyr Glu Val1 5 101213PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 12Asp Ala Glu Phe Arg His Asp
Ser Gly Tyr Glu Val His1 5 101314PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 13Asp Ala Glu Phe Arg His
Asp Ser Gly Tyr Glu Val His His1 5 101415PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 14Asp
Ala Glu Phe Arg His Asp Ser Gly Tyr Glu Val His His Gln1 5 10
15156PRTArtificial SequenceDescription of Artificial Sequence
Synthetic 6xHis tag 15His His His His His His1 51657DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 16gtccgatgga tgcagaattc cgacatgact caggatatga
agttcatcat caaggcg 571757DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 17gctacctacg
tcttaaggct gtactgagtc ctatacttca agtagtagtt ccgccag
5718169PRTArtificial SequenceDescription of Artificial Sequence
Synthetic construct 18Met Gly Ser Ser His His His His His His Ser
Ser Gly Leu Val Pro1 5 10 15Arg Gly Ser His Met Gly Asp Lys Ile Ile
His Leu Thr Asp Asp Ser20 25 30Phe Asp Thr Asp Val Leu Lys Ala Asp
Gly Ala Ile Leu Val Asp Phe35 40 45Trp Ala Glu Trp Cys Gly Pro Met
Asp Ala Glu Phe Arg His Asp Ser50 55 60Gly Tyr Glu Val His His Gln
Gly Gly Pro Cys Lys Met Ile Ala Pro65 70 75 80Ile Leu Asp Glu Ile
Ala Asp Glu Tyr Gln Gly Lys Leu Thr Val Ala85 90 95Lys Leu Asn Ile
Asp Gln Asn Pro Gly Thr Ala Pro Lys Tyr Gly Ile100 105 110Arg Gly
Ile Pro Thr Leu Leu Leu Phe Lys Asn Gly Glu Val Ala Ala115 120
125Thr Lys Val Gly Ala Leu Ser Lys Gly Gln Leu Lys Glu Phe Leu
Asp130 135 140Ala Asn Leu Arg Asp Pro Asn Ser Ser Ser Val Asp Lys
Leu Ala Ala145 150 155 160Ala Leu Glu His His His His His
His1651927DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 19cgcatatggg cgataaaatt attcacc
272026DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 20cgggatcccg ccaggttagc gtcgag 26
* * * * *