U.S. patent application number 10/434479 was filed with the patent office on 2009-07-09 for androgen-regulated pmepa1 gene and polypeptides.
Invention is credited to Judd W. Moul, Shiv Srivastava, Linda L. Xu.
Application Number | 20090176722 10/434479 |
Document ID | / |
Family ID | 32234349 |
Filed Date | 2009-07-09 |
United States Patent
Application |
20090176722 |
Kind Code |
A9 |
Srivastava; Shiv ; et
al. |
July 9, 2009 |
Androgen-regulated PMEPA1 gene and polypeptides
Abstract
This invention relates to the androgen-regulated gene, PMEPA1,
and proteins encoded by this gene, including variants and analogs
thereof. Also provided are other androgen-regulated nucleic acids,
a polynucleotide array containing these androgen-regulated nucleic
acids, and methods of using the polynucleotide array in the
diagnosis and prognosis of prostate cancer.
Inventors: |
Srivastava; Shiv; (Potomac,
MD) ; Moul; Judd W.; (Bethesda, MD) ; Xu;
Linda L.; (Rockville, MD) |
Correspondence
Address: |
LATIMER, MAYBERRY & MATTHEWS IP LAW, LLP
13873 PARK CENTER ROAD
SUITE 106
HERNDON
VA
20171
US
|
Prior
Publication: |
|
Document Identifier |
Publication Date |
|
US 20040092469 A1 |
May 13, 2004 |
|
|
Family ID: |
32234349 |
Appl. No.: |
10/434479 |
Filed: |
May 9, 2003 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
10390045 |
Mar 18, 2003 |
|
|
|
10434479 |
May 9, 2003 |
|
|
|
09769482 |
Jan 26, 2001 |
6566130 |
|
|
10390045 |
Mar 18, 2003 |
|
|
|
60179045 |
Jan 31, 2000 |
|
|
|
60178772 |
Jan 28, 2000 |
|
|
|
60378949 |
May 10, 2002 |
|
|
|
Current U.S.
Class: |
514/44R ;
435/184; 435/320.1; 435/325; 435/69.2; 514/1.1; 530/388.26;
536/23.2 |
Current CPC
Class: |
C07K 14/47 20130101;
C07K 14/4748 20130101 |
Class at
Publication: |
514/044 ;
435/069.2; 435/184; 435/320.1; 435/325; 530/388.26; 514/012;
536/023.2 |
International
Class: |
A61K 48/00 20060101
A61K048/00; A61K 38/17 20060101 A61K038/17; C07H 21/04 20060101
C07H021/04; C12N 9/99 20060101 C12N009/99 |
Goverment Interests
GOVERNMENT INTEREST
[0002] The invention described herein may be manufactured,
licensed, and used for governmental purposes without payment of
royalties to us thereon.
Claims
1. A polypeptide, wherein the polypeptide comprises an amino acid
sequence that is at least 95% identical to SEQ ID NO:3 and wherein
the polypepide inhibits the growth of LNCaP cells in a
colony-forming assay.
2. A polypeptide variant of SEQ ID NO:3, wherein the variant
comprises at least one mutation and/or deletion in at least one of
the PY motifs of SEQ ID NO:3.
3. An isolated nucleic acid, wherein the nucleic acid hybridizes to
a DNA having the nucleotide sequence of SEQ ID NO:2 under
conditions of high stringency, wherein the nucleic acid encodes a
polypeptide that inhibits the growth of LNCaP cells in a
colony-forming assay.
4. An isolated antibody that binds to the polypeptide of claim
1.
5. An isolated antibody that binds to the polypeptide of claim
2.
6. An isolated antibody that binds to the polypeptide of claim
3.
7. A method of reducing the expression of an androgen receptor in a
prostate cancer cell comprising administering a polypeptide
according to claim 1 to the prostate cancer cell in an amount
effective to reduce expression of the androgen receptor in the
cell.
8. A method of inhibiting the growth of a prostate cancer cell,
comprising administering a polypeptide according to claim 1 to the
prostate cancer cell in an amount effective to inhibit the growth
of the cancer cell.
9. A method of modulating the expression of a gene in a prostate
cancer cell, wherein transcription of the gene is regulated by an
androgen receptor, comprising administering a polypeptide according
to claim 1 to the prostate cancer cell in an amount effective to
modulate the expression of the gene in the cell.
Description
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] The present application is a continuation-in-part of
copending U.S. application Ser. No. 10/390,045, filed Mar. 18,
2003, which is a divisional of U.S. Applicaton Ser. No. 09/769,482,
filed Jan. 26, 2001, allowed, which is based upon U.S. provisional
applications S. No. 60/178,772, and 60/179,045, filed Jan. 28,
2000, and Jan. 31, 2000, respectively, priority to which is claimed
under 35 U.S.C. .sctn. 119(e). The entire disclosures of these
applications are expressly incorporated herein by reference.
FIELD OF THE INVENTION
[0003] The present invention relates to tumor suppressor genes, and
in particular, PMEPA1 genes, and the proteins encoded by these
genes, including variants and/or analogs thereof. More
particularly, the present invention is based in part on the
discovery that PMEPA1 polypeptides inhibit cancer cell growth. The
present invention also relates to novel, androgen-regulated nucleic
acids, polynucleotide arrays containing androgen-regulated nucleic
acids, such as PMEPA1, and methods of using the array in the
evaluation of hormone-related cancers, such as prostate cancer.
BACKGROUND
[0004] Prostate cancer (CaP) is the most common malignancy in
American men and second leading cause of cancer mortality (1).
Serum-prostate specific antigen (PSA) tests have revolutionized the
early detection of CaP (2). Although PSA has revolutionized early
detection of prostate cancer, there is still a very high false
positive rate. The increasing incidence of CaP has translated into
wider use of radical prostatectomy as well as other therapies for
localized disease (3-5). The wide spectrum of biologic behavior (6)
exhibited by prostatic neoplasms poses a difficult problem in
predicting the clinical course for the individual patient (3-5).
Traditional prognostic markers such as grade, clinical stage, and
pretreatment PSA have limited prognostic value for individual men
(3-5). A more reliable technique for the evaluation and prognosis
of CaP is desirable.
[0005] Molecular studies have shown a significant heterogeneity
between multiple cancer foci present in a cancerous prostate gland
(7, 8). These studies have also documented that the metastatic
lesion can arise from cancer foci other than those present in
dominant tumors (7). Approximately 50-60% of patients treated with
radical prostatectomy for localized prostate carcinomas are found
to have microscopic disease that is not organ-confined, and a
significant portion of these patients relapse (9). Therefore,
identification and characterization of genetic alterations defining
CaP onset and progression is crucial in understanding the biology
and clinical course of the disease.
[0006] Despite recent intensive research investigations, much
remains to be learned about specific molecular defects associated
with CaP onset and progression (6, 10-15). Alterations of the tumor
suppressor gene p53, bcl-2 and the androgen receptor (AR), are
frequently reported in advanced CaP (6, 10-15). However, the exact
role of these genetic defects in the genesis and progression of CaP
is poorly understood (6, 10-15). Recent studies have shown that the
"focal p53 immunostaining" or bcl-2 immunostaining in radical
prostatectomy specimens were independent prognostic markers for
cancer recurrence after surgery (16-19). Furthermore, the
combination of p53 and bcl-2 alterations was a stronger predictor
of cancer recurrence after radical prostatectomy (18).
[0007] The roles of several new chromosome loci harboring putative
proto-oncogenes or tumor suppressor genes are being currently
evaluated in CaP (7-13). High frequency of allelic losses on
8p21-22, 7q31.1, 10q23-25 and 16q24 loci have been shown in CaP (6,
10-15). PTEN1/MMAC1, a recently discovered tumor suppressor gene on
chromosome 10q25, is frequently altered in advanced CaP (20, 21).
Gains of chromosome 8q24 harboring c-myc and prostate stem-cell
antigen (PSCA) genes have also been shown in prostate cancer (22,
23). Studies utilizing comparative genomic hybridization (CGH) have
shown frequent losses of novel chromosomal loci including 2q, 5q
and 6q and gains of 11p, 12q, 3q, 4q and 2p in CaP (24, 25). The
inventors have recently mapped a 1.5 megabase interval at 6q16-21
which may contain the putative tumor suppressor gene involved in a
subset of prostate tumors. The risk for 6q LOH to non-organ
confined disease was five fold higher than for organ confined
disease (26). Chromosome regions, 1q24-25 and Xq27-28 have been
linked to familial CaP (27, 28).
[0008] It is evident that multiple molecular approaches need to be
explored to identify CaP-associated genetic alterations. Emerging
strategies for defining cancer specific genetic alterations and
characterizing androgen regulated genes in rat prostate and LNCaP
human prostate cancer cell models include, among others, the study
of global gene expression profiles in cancer cells and
corresponding normal cells by differential display (DD) (29) and
more recent techniques, such as serial amplification of gene
expression (SAGE) (30) and DNA micro-arrays (31; U.S. Pat. Nos.
5,744,305 and 5,837,832 which are herein incorporated by reference)
followed by targeted analyses of promising candidates. Our
laboratory has also employed DD, SAGE and DNA microarrays to study
CaP associated gene expression alterations (32-33). Each of these
techniques, however, is limited. The number of transcripts that can
be analyzed is the major limitation encountered in subtractive
hybridization and differential display approaches. Furthermore,
while cDNA microarray approaches can determine expression of a
large number of genes in a high throughput manner, the current
limitations of cDNA arrays include the presence of specific arrays
used for analyses and the inability to discover novel genes.
[0009] While alterations of critical tumor-suppressor genes and
oncogenes are important in prostate tumorogenesis, it is also
recognized that hormonal mechanisms play equally important roles in
prostate tumorogenesis. The cornerstone of therapy in patients with
metastatic disease is androgen ablation, commonly referred to as
"hormonal therapy (34)," which is dependent on the inhibition of
androgen signaling in prostate cancer cells. Androgen ablation can
be achieved, for example, by orchiectomy, by the administration of
estrogen, or more recently by one of the luteinizing
hormone-releasing hormone agonists. Recent clinical trials have
demonstrated the efficacy of combining an antiandrogen to
orchiectomy or a luteinizing hormone-releasing hormone to block the
remaining androgens produced by the adrenal glands. Although
approximately 80% of patients initially respond to hormonal
ablation, the vast majority of patients eventually relapse (35),
presumably due to neoplastic clones of cells which become
refractory to this therapy.
[0010] Alterations of the androgen receptor gene by mutations in
the hormone binding domain of the AR or by amplification of the AR
gene have been reported in advanced stages of CaP. Much remains to
be learned, however, about the molecular mechanisms of the
AR-mediated cell signaling in prostate growth and tumorogenesis
(36-43). Our earlier studies have also described mutations of the
AR in a subset of CaP (40). Mutations of the AR are reported to
modify the ligand (androgen) binding of the AR by making the
receptor promiscuous, so that it may bind to estrogen,
progesterone, and related molecules, in addition to the androgens
(36, 38, 42). Altered ligand binding specificity of the mutant AR
may provide one of the mechanisms for increased function in cancer
cells. Amplifications of the AR gene in hormone-refractory CaP
represent yet another scenario where increase in AR function is
associated with tumor progression (44, 45).
[0011] Several growth factors commonly involved in cell
proliferation and tumorogenesis, e.g., IGF1, EGF, and others, have
been shown to activate the transcription transactivation functions
of the AR (46). The co-activator of the AR transcription factor
functions may also play a role in prostate cancer (47). Recent
studies analyzing expression of the androgen-regulated genes (ARGs)
in hormone sensitive and refractory CWR22 nude mice xenograft
models (48) have also shown expression of several androgen
regulated genes in AR positive recurrent tumors following
castration, suggesting activation of AR in these tumors (49).
[0012] In addition to the alterations of the androgen signaling
pathway(s) in prostate tumor progression, androgen mechanisms are
suspected to play a role in the predisposition to CaP. Prolonged
administration of high levels of testosterone has been shown to
induce CaP in rats (50-52). Although recent evidence suggests an
association of androgen levels and risk of CaP, this specific
observation remains to be established. (53). An independent line of
investigations addressing the length of inherited polyglutamine
(CAG) repeat sequence in the AR gene and CaP risk have shown that
men with shorter repeats were at high risk of distant metastasis
and fatal CaP (54, 55). Moreover, the size distribution of AR CAG
repeats in various ethnic groups has also suggested a possible
relationship of shorter CAG repeats and increased prostate cancer
risks in African-American men (56, 57). Biochemical experiments
evaluating AR-CAG repeat length and in vitro transcription
transactivation functions of the AR revealed that AR with shorter
CAG repeats possessed a more potent transcription transactivation
activity (58). Thus, molecular epidemiologic studies and
biochemical experimentation suggest that gain of AR function,
consequently resulting in transcriptional transactivation of
downstream targets of the AR gene, may play an important role in
CaP initiation. However, downstream targets of AR must be defined
in order to understand the biologic basis of these
observations.
[0013] The biologic effects of androgen on target cells, e.g.,
prostatic epithelial cell proliferation and differentiation as well
as the androgen ablation-induced cell death, are likely mediated by
transcriptional regulation of ARGs by the androgen receptor
(reviewed in 59). Abrogation of androgen signaling resulting from
structural changes in the androgen gene or functional alterations
of AR due to modulation of AR functions by other proteins would
have profound effects on transcriptional regulation of genes
regulated by AR and, thus, on the growth and development of the
prostate gland, including abnormal growth characterized by benign
prostatic hyperplasia and prostatic cancer. The nature of ARGs in
the context of CaP initiation and progression, however, remains
largely unknown. Since forced proliferation of the AR prostate
cancer cells lacking AR induces cell-death related phenotypes (60),
the studies utilizing AR expression via heterologous promoters in
cell cultures have failed to address the observations relating to
gain of AR functions and prostate cancer progression. Moreover,
suitable animal models to assess gain of AR functions do not exist.
Therefore, the expression profile of androgen responsive genes
(ARGs) has potential to serve as read-out of the AR signaling
status. Such a read-out may also define potential biomarkers for
onset and progression of those prostate cancers which may involve
abrogation of the androgen signaling pathway. Furthermore,
functional analysis of androgen regulated genes will help
understand the biochemical components of the androgen signaling
pathways.
SUMMARY OF THE INVENTION
[0014] The present invention relates to the identification and
characterization of a novel androgen-regulated gene that exhibits
abundant expression in prostate tissue. The novel gene has been
designated PMEPA1. Our work with PMEPA1 is further described in
U.S. Provisional Application S. No. 60/378,949, filed May 10, 2002,
and PCT Application No. PCT/US03/XXXXX, filed May 9, 2003, the
entire disclosures of which are hereby incorporated by
reference.
[0015] The invention provides the isolated nucleotide sequence of
PMEPA1 or fragments thereof and nucleic acid sequences that
hybridize to PMEPA1. These sequences have utility, for example, as
markers of prostate cancer and other prostate-related diseases, and
as targets for therapeutic intervention in prostate cancer and
other prostate-related diseases. The invention further provides a
vector that directs the expression of PMEPA1, and a host cell
transfected or transduced with this vector.
[0016] In another embodiment, the invention provides a method of
detecting prostate cancer cells in a biological sample, for
example, by using nucleic acid amplification techniques with
primers and probes selected to bind specifically to the PMEPA1
sequence.
[0017] In another aspect, the invention relates to an isolated
polypeptide encoded by the PMEPA1 gene or a fragment thereof, and
antibodies generated against the PMEPA1 polypeptide, peptides, or
portions thereof, which can be used to detect, treat, and prevent
prostate cancer.
[0018] In another aspect, the invention provides variants of the
PMEPA1 polypeptide that retain at least one of the following
abilities: inhibiting cancer cell growth, reducing the expression
of an androgen receptor, or modulating the expression of a gene
whose transcription is regulated by the androgen receptor. In one
embodiment, these variants are at least 95% identical to SEQ ID
NO:3 and inhibit the growth of prostate cancer cells (e.g., LNCaP
cells), as measured, for example, in a colony-forming assay.
[0019] In another aspect, the invention provides a method of
inhibiting the growth of a cancer cell, comprising administering
these variants to the cancer cell in an amount effective to inhibit
the growth of the cancer cell. In one embodiment the cancer cell is
a prostate cancer cell. The polypeptide may be administered
directly to the cell or indirectly using a vector containing a
polynucleotide sequence that encodes the variant. These methods
include therapeutic methods of treating cancer, and in particular,
prostate cancer.
[0020] A further embodiment of the invention provides a method of
reducing the expression of an androgen receptor or modulating the
expression of genes that are transcriptionally regulated by
androgen receptor, including, but not limited to the
prostate-specific antigen (PSA) gene, the PSMA gene, and the PCGEM1
gene. Thus, in one aspect, the invention provides a method of
reducing the expression in a cancer cell of an androgen receptor or
modulating (i.e., increasing or decreasing) the expression of a
gene whose transcription is regulated by the androgen receptor,
comprising administering the variants described above to the cancer
cell, in an amount effective to reduce the androgen receptor or
modulate the expression of the gene in the cancer cell. In one
embodiment the cancer cell is a prostate cancer cell. The
polypeptide may be administered directly to the cell or indirectly
using a vector containing a polynucleotide sequence that encodes
the variant.
[0021] In yet another aspect, the invention provides variants of
the PMEPA1 polypeptide having at least one mutation and/or deletion
in the at least one of the PY motifs of PMEPA1, as discussed in
further detail below. Such mutations reduce the cell growth
inhibitory effects of PMEPA1. These PMEPA1 variants can be used,
for example, to define cellular proteins through which PMEPA1
interacts, directly or indirectly, to mediate cell growth
inhibitory functions.
[0022] In a still further embodiment, the invention provides the
polynucleotides that encode the PMEPA1 variants, as well as methods
(as described above for a polypeptide comprising SEQ ID NO:3) of
using these variants, for example, to inhibit cancer cell growth,
including prostate cancer, and/or to reduce the expression of an
androgen receptor and/or to modulate the expression of a gene whose
transcription is regulated by the androgen receptor.
[0023] The present invention also relates to a polynucleotide array
comprising (a) a planar, non-porous solid support having at least a
first surface; and (b) a first set of polynucleotide probes
attached to the first surface of the solid support, where the first
set of polynucleotide probes comprises polynucleotide sequences
derived from genes that are up-regulated, such as PMEPA1, or
down-regulated in response to androgen, including genes downstream
of the androgen receptor gene and genes upstream of the androgen
receptor gene that modulate androgen receptor function. In another
embodiment of the invention the polynucleotides immobilized on the
solid support include genes that are known to be involved in
testosterone biosynthesis and metabolism. In another embodiment of
the invention the oligonucleotides immobilized on the solid support
include genes whose expression is altered in prostate cancer or is
specific to prostate tissue.
[0024] In another embodiment, the invention provides a method for
the diagnosis or prognosis of prostate cancer, comprising (a)
hybridizing nucleic acids of a target cell of a patient with a
polynucleotide array, as described above, to obtain a first
hybridization pattern, where the first hybridization pattern
represents an expression profile of androgen-regulated genes in the
target cell; (b) comparing the first hybridization pattern of the
target cell to a second hybridization pattern, where the second
hybridization pattern represents an expression profile of
androgen-regulated genes in prostate cancer, and (c) diagnosing or
prognosing prostate cancer in the patient.
[0025] Thus, a first aspect of the present invention is directed
towards a method for analysis of radical prostatectomy specimens
for the expression profile of those genes involved in androgen
receptor-mediated signaling. In a preferred embodiment, computer
models may be developed for the analysis of expression profiles.
Another aspect of the invention is directed towards a method of
correlating expression profiles with clinico-pathologic features.
In a preferred embodiment, computer models to identify gene
expression features associated with tumor phenotypes may be
developed. Another aspect of the invention is directed towards a
method of distinguishing indolent prostate cancers from those with
a more aggressive phenotype. In a preferred embodiment, computer
models to such cancers may be developed. Another aspect of the
invention is directed towards a method of analyzing tumor specimens
of patients treated by radical prostate surgery to help define
prognosis. Another aspect of the invention is directed towards a
method of screening candidate genes for the development of a blood
test for improved prostate cancer detection. Another aspect of the
invention is directed towards a method of identifying androgen
regulated genes that may serve as biomarkers for response to
treatment to screen drugs for the treatment of advanced prostate
cancer.
[0026] This invention is further directed to a method of
identifying an expression profile of androgen-regulated genes in a
target cell, comprising hybridizing the nucleic acids of the target
cell with a polynucleotide array, as described above, to obtain a
hybridization pattern, where the hybridization pattern represents
the expression profile of androgen-regulated genes in the target
cell.
[0027] Additional features and advantages of the invention will be
set forth in the description which follows, and in part will be
apparent from the description, or may be learned by practice of the
invention.
BRIEF DESCRIPTION OF THE DRAWINGS
[0028] FIG. 1 is a Northern blot showing that PMEPA1 is expressed
at high levels in prostate tissue. Multiple tissue northern blots
were hybridized with PMEPA1 and GAPDH probes. The arrows indicate
the two variants of the PMEPA1 transcript.
[0029] FIG. 2 shows the androgen-dependent expression of PMEPA1.
FIG. 2A is a Northern blot using PMEPA1 probe with mRNA derived
from LNCaP cells with or without R1881 treatment for various
durations. FIG. 2B is a Northern blot of PMEPA1 expression in
primary epithelial cell cultures of normal prostate and prostate
and breast cancer cell lines.
[0030] FIGS. 3A-H show the effect of PMEPA1 on colony formation.
Prostate tumor cell lines: C4 (FIG. 3A), C4-2 (FIG. 3B), C4-2B
(FIG. 3C), LNCaP (FIG. 3D), DU145 (FIG. 3E), and PC3 (FIG. 3F) were
transfected with 3 .mu.g of each of PMEPA1-V5-pcDNA3.1 (PMEPA1) and
pcDNA3.1 vector (Vector) in triplicate sets. In a separate
experiments LNCaP (FIG. 3G) and PC3 (FIG. 3H) cells were
transfected with control vector or expression vectors encoding
wt-PMEPA1 or PMEPA1-PY mutants (1. PMEPA1-V5-pcDNA3.1, 2.
PMEPA1-PY1m-pcDNA3.1, 3. PMEPA1-PY2m-pcDNA3.1, 4. PMEPA1-PY1m/PY2
m-pcDNA3.1, and 5. pcDNA3.1). Transfected cells were selected for
plasmid-containing cells with G418 for 3 weeks and surviving cells
were fixed and stained with crystal violet. In each experiment, the
number of colonies per dish were counted and displayed as
histograms, representing the mean number of colonies.+-.SD of the
triplicate sets. For each cell line, a photograph of one dish of
cells treated with 3 .mu.g of each plasmid is also shown.
[0031] FIG. 4A shows PMEPA1-mediated down regulation of androgen
receptor and its functional consequences on androgen receptor
regulated genes. LNCaP cells stably transfected with PMEPA1-GFP and
pEGFP (control) plasmids were cultured in medium with cFBS for 5
days and then were stimulated with R1881 at 0.1 nM. Cells were
harvested for Western blotting at 0 h, 12 h and 24 h after androgen
stimulation. Antibodies against androgen receptor, PSA, PSMA and
tubulin were used to detect corresponding proteins on Western
Blots.
[0032] FIG. 4B shows that PMEPA1 does not reduce androgen receptor
expression through a non-specific, PMEPA1-induced effect on the
ubiquitin-proteasome pathway. Stable PMEPA1-GFP-Tet-LNCaP
transfectants (Tet-off system) were cultured in proper medium with
or without tetracycline for 10 days and were applied for
immunoblotting. Antibodies against androgen receptor, GFP, p27 and
tubulin were used to detect the corresponding proteins.
[0033] FIG. 5 shows the effect of PMEPA1 on cell proliferation.
Stable PMEPA1-GFP-Tet-LNCaP transfectants were seeded in 96-well
plates with or without 1 .mu.g/ml of tetracycline in the medium.
The cell proliferation was measured using the CellTiter 96 Aqueous
One Solution kit at the indicated time. Tet+ and Tet- denote the
cell culture medium with or without tetracycline, respectively. The
OD values reflecting the cell numbers are significantly different
(p<0.01) between the two groups except on day one.
[0034] FIG. 6 defines binding of PMEPA1 to NEDD4 proteins. The in
vitro transcription/translation products
([.sup.35S]Methionine-labeled lysates) derived from expression
plasmids: PMEPA1-V5-pcDNA3.1 (Lanes 1, 5), PMEPA1-PY1m-pcDNA3.1
(Lanes 2, 6), PMEPA1-PY2m-pcDNA3.1 (Lanes 3, 7), and
PMEPA1-PY1m/PY2m-pcDNA3.1 (Lanes 4, 8) were incubated with
GST-NEDD4-WW-Sepharose beads (Lanes 1-4) or control GST beads
(Lanes 5-8) and [.sup.35S] Methionine labeled proteins bound to
GST-NEDD4-WW-Sepharose beads were solublized in sample buffer and
were resolved by SDS-PAGE gel. Equal amounts of
[.sup.35S]Methionine lysates corresponding to samples in lanes 1-4
were run on SDS-PAGE gel without GST pull-down (Lane 9-12).
[0035] FIG. 7 represents an immunoprecipitation assay. 293 cells
were co-transfected with expression vectors encoding NEDD4-GFP and
one of following fusion proteins: PMEPA1-V5 (Lane 1),
PMEPA1-PY1m-V5 (Lane 2), PMEPA1-PY2m-V5 (Lane 3) or
PMEPA1-PY1m/PY2m-V5 (Lane 4). The cell lysates from each group were
immunoprecipitated with anti-GFP antibody then subjected to
immunoblotting (blot a). Cell lysates from each group without
immunoprecipitation were also processed for immunoblotting (blots b
and c) to serve as a control. Blots a and b were detected by
anti-V5 antibody and blot c was detected by anti-GFP antibody.
[0036] FIG. 8 shows PMEPA1 expression in CWR22 xenograft tumors.
Lane 1, sample from CWR22 tumor (androgen dependent). Lanes 2-5,
samples from 4 individual CWR22R tumors (AR positive but androgen
independent).
DETAILED DESCRIPTION OF THE INVENTION
[0037] The present invention provides a method useful in the
diagnosis and prognosis of prostate cancer. An aspect of the
invention provides a method to identify ARGs, such as PMEPA1, that
exhibit stable transcriptional induction/repression in response to
androgen and have potential as surrogate markers of the status of
the androgen signaling in normal and cancerous epithelial cells of
prostate.
[0038] A second aspect of the invention provides for use of the
expression profiles resulting from these methods in diagnostic
methods, including, but not limited to, characterizing the
treatment response to "hormonal therapy," correlating expression
profiles with clinico-pathologic features, distinguishing indolent
prostate cancers from those with a more aggressive phenotype,
analyzing tumor specimens of patients treated by radical prostate
surgery to help define prognosis, screening candidate genes for the
development of a polynucleotide array for use as a blood test for
improved prostate cancer detection, and identifying androgen
regulated genes that may serve as biomarkers for response to
treatment to screen drugs for the treatment of advanced prostate
cancer.
[0039] As will be readily appreciated by persons having skill in
the art, these gene sequences and ESTs described herein can easily
be synthesized directly on a support, or presynthesized
polynucleotide probes may be affixed to a support as described, for
example, in U.S. Pat. Nos. 5,744,305, 5,837,832, and 5,861,242,
each of which is incorporated herein by reference. Furthermore,
such arrays may be made in a wide number of variations, combining,
probes derived from sequences identified by the inventors as
up-regulated or down-regulated in response to androgen and listed
in Table 3 (genes and ESTs derived from the inventors' SAGE library
that are up-regulated and down-regulated by androgens) with any of
the sequences described in Table 4 (candidate genes and ESTs whose
expression are potentially prostate specific or restricted), Table
5 (previously described genes and ESTs, including those associated
with androgen signaling, prostate specificity, prostate cancer, and
nuclear receptors/regulators with potential interaction with
androgen receptors), Table 6 (genes and ESTs identified from the
NIH CGAP database that are differentially expressed in prostate
cancer), Table 7 (androgen regulated genes and ESTs derived from
the CPDR Genome Systems ARG Database) and Table 8 (other genes
associated with cancers). Tables 3-8 are located at the end of the
specification at the end of the "Detailed Description" section and
before the "References." In Table 3, genes in bold type are known
androgen-regulated genes based on Medline Search. In Table 4, genes
in bold type are known prostate-specific genes.
[0040] Such arrays may be used to detect specific nucleic acid
sequences contained in a target cell or sample, as described in
U.S. Pat. Nos. 5,744,305, 5,837,832, and 5,861,242, each of which
is incorporated herein by reference. More specifically, in the
present invention, these arrays may be used in methods for the
diagnosis or prognosis of prostate cancer, such as by assessing the
expression profiles of genes, derived from biological samples such
as blood or tissues, that are up-regulated and down-regulated in
response to androgen or otherwise involved in androgen
receptor-mediated signaling. In a preferred embodiment, computer
models may be developed for the analysis of expression profiles.
Moreover, such polynucleotide arrays are useful in methods to
screen drugs for the treatment of advanced prostate cancer. In
these screening methods, the polynucleotide arrays are used to
analyze how drugs affect the expression of androgen-regulated genes
that are involved in prostate cancer.
[0041] SAGE analysis. The SAGE technology is based on three main
principles: 1) A short sequence tag (10-11 bp) is generated that
contains sufficient information to identify a transcript, thus,
each tag represents a signature sequence of a unique transcript; 2)
many transcript tags can be concatenated into a single molecule and
then sequenced, revealing the identity of multiple tags
simultaneously; 3) quantitation of the number of times a particular
tag is observed provides the expression level of the corresponding
transcript (30). The schematic diagram and the details of SAGE
procedure can be obtained from the web site:
www.genzyme.com/SAGE.
[0042] About fifty percent of SAGE tags identified by the inventors
represent ESTs which need to be further analyzed for their protein
coding capacity. The known genes up-regulated or down-regulated by
four-fold (p<0.05) were broadly classified on the basis of the
biochemical functions. SAGE tag defined ARGs were grouped under
following categories: transcriptional regulators; RNA processing
and translation regulators; protein involved in genomic maintenance
and cell cycle; protein trafficking/chaperone proteins; energy
metabolism, apoptosis and redox regulators; and signal transducers.
As determined by PubMed database searches, a majority of genes
listed in Table 3 have not been described as androgen regulated
before. This is the first comprehensive list of the functionally
defined genes regulated by androgen in the context of prostatic
epithelial cells.
[0043] Although promising candidate ARGs have been identified using
these approaches, much remains to be learned about the complete
repertoire of these genes. SAGE provides both quantitative and high
throughput information with respect to global gene expression
profiles of known as well as novel transcripts. We have performed
SAGE analysis of the ARGs in the widely studied hormone responsive
LNCaP prostate cancer cells treated with and without synthetic
androgen, R1881. Of course, this SAGE technique could be repeated
with hormones other than R1881, including other synthetic or
natural androgens, such as dihydroxytestosterone, to potentially
obtain a slightly different ARG expression panel. A goal of the
inventors was to identify highly induced and repressed ARGs in
LNCaP model which may define a panel of surrogate markers for the
status androgen signaling in normal as well as cancerous prostate.
Here, we report identification and analyses of a comprehensive
database of SAGE tags corresponding to well-characterized genes,
expressed sequence tags (ESTs) without any protein coding
information and SAGE tags corresponding to novel transcripts. This
is the first report describing a quantitative evaluation of the
global gene expression profiles of the ARGs in the context of
prostatic cancer cells by SAGE. We have further defined the ARGs on
the basis of their known biologic/biochemical functions. Our study
provides quantitative information on about 23,000 transcripts
expressed in LNCaP cells, the most common cell line used in
prostate cancer research. Finally, comparison of the LNCaP SAGE tag
library and 35 SAGE tag libraries representing diverse cell
type/tissues have unraveled a panel of genes whose expression are
prostate specific or prostate abundant. Utilizing the LNCaP
prostate cancer cells, the only well-characterized androgen
responsive prostatic epithelial cells (normal or cancerous), we
have identified a repertoire of androgen regulated genes by
SAGE.
[0044] Utilizing cell-culture systems and cell-signaling agents or
exogenous expression of p53 and APC genes, SAGE technology has
identified novel physiologically relevant transcriptional target
genes which have unraveled new functions of p53 and APC genes
(61-64). Our analysis of ARGs has provided identification and
quantitative assessment of induction or repression of a global
expression profile of ARGs in LNCaP cells. ARGs resulting from the
mutational defects of the AR and those ARGs unaffected by AR
mutations may be identified in this model system. Subsequent
androgen regulation analysis of the selected ARGs in AR-positive,
primary cultures of normal prostatic epithelial cells, and ARGs
expression analysis in normal and tumor tissues will clarify normal
or abnormal regulation of these ARGs. A panel of highly
inducible/repressible ARGs identified by the inventors may provide
bio-indicators of the AR transcription factor activity in
physiologic context. These AR Function Bio-indicators (ARFBs) are
useful in assessing the risk of CaP onset and/or progression.
Moreover, identification or ARGs may also help in defining the
therapeutic targets which could lead to effective treatment for
hormone refractory cancer, currently a frustrating stage of the
disease with limited therapeutic options.
[0045] Characterization of a SAGE-defined EST that exhibited the
highest level of induction in LNCaP cells responding to R1881 led
to the discovery of a novel, androgen-induced gene, PMEPA1, which
encodes a polypeptide with a type lb transmembrane domain. A
Protein sequence similarity search showed homology to C18orf1, a
novel gene located on chromosome 18 that is mainly expressed in
brain with multiple transcriptional variants (Yoshikawa et al.,
1998). In addition to the sequence similarity, PMEPA.TM. also
shares other features with C18orf1, e.g., similar size of the
predicted protein and similar transmembrane domain as the P1
isoform of C18orf1. Therefore, it is likely that other isoforms of
PMEPA1 may exist.
[0046] Database searches showed that the PMEPA1 sequence matched to
genomic clones RP5-1059L7 and 718J7 which were mapped to chromosome
20q13.2-13.33. Gain of 20q has been observed in many cancer types,
including prostate, bladder, melanoma, colon, pancreas and breast
(Brothman et al., 1990; Richter et al., 1998; Bastian et al., 1998;
Kom et al., 1999; Mahlamaki et al., 1997; Tanner et al., 1996).
Chromosome 20q gain was also observed during immortalization and
may harbor genes involved in bypassing senescence (Jarrard et al.,
1999; Cuthill et al., 1999). A differentially expressed gene in
hormone refractory CaP, UEV-1, mapped to 20q13.2 (Stubbs et al.,
1999). These observations indicate that one or several genes on
chromosome 20q may be involved in prostate or other cancer
progression. Although we did not observe increased expression of
PMEPA.TM. in primary prostate tumors, increased PMEPA1 expression
was noted in recurrent cancers of CWR22 xenograft.
[0047] PMEPA1 expression is upregulated by androgens in a time- and
concentration-specific manner in LNCaP cells. This observation
underscores the potential of measuring PMEPA1 expression as one of
the surrogate markers of androgen receptor activity in vivo in the
epithelial cells of prostate tissue. Prostate cancer is androgen
dependent and its growth in prostate is mediated by a network of
ARGs that remains to be fully characterized. Most prostate cancers
respond to androgen withdrawal but relapse after the initial
response (Koivisto et al., 1998). The growth of the relapsed tumors
is androgen independent even though tumors are positive for the
expression of the AR (Bentel et al., 1996).
[0048] One of the hypotheses of how cancer cells survive and grow
in the low androgen environment is the sensitization or the
activation of the AR pathway (Jenster et al., 1999). Studies have
shown increased expression of the ARGs or amplification of AR in
androgen independent prostate cancer tissues (Gregory et al., 1998;
Lin et al., 1999). We have observed that PMEPA1 was expressed in
all CWR22R tumors and increased expression in three of four
compared with CWR22 tumor. Our data support the concept that
normally AR-dependent pathways remain activated, despite the
absence of androgen in androgen-independent prostate cancer. There
are only limited studies that have addressed whether ARGs play a
role in the transition from androgen dependent tumor to androgen
independent tumors. The high level of expression only in the
prostate gland indicates that PMEPA1 might have important roles
related to prostate cell biology or physiology. On the basis of
homology of PMEPA1 to C18orf1 it is tempting to suggest that the
PMEPA1 may belong to family of proteins involved in the binding of
calcium and LDL.
[0049] ARGs, including PMEPA1, can be used as biomarkers of AR
function readout in the subset of prostate cancers that may involve
abrogation of androgen signaling. Furthermore, the newly defined
ARGs have potential to identify novel targets in therapy of hormone
refractory prostate cancer.
[0050] The nucleic acid molecules encompassed in the invention
include the following PMEPA1 nucleotide sequence: [0051] ATGGCGGAGC
TGGAGTTTGT TCAGATCATC ATCATCGTGG TGGTGATGAT 50 [0052] GGTGATGGTG
GTGGTGATCA CGTGCCTGCT GAGCCACTAC AAGCTGTCTG 100 [0053] CACGGTCCTT
CATCAGCCGG CACAGCCAGG GGCGGAGGAG AGAAGATGCC 150 [0054] CTGTCCTCAG
AAGGATGCCT GTGGCCCTCG GAGAGCACAG TGTCAGGCAA 200 [0055] CGGAATCCCA
GAGCCGCAGG TCTACGCCCC GCCTCGGCCC ACCGACCGCC 250 [0056] TGGCCGTGCC
GCCCTTCGCC CAGCGGGAGC GCTTCCACCG CTTCCAGCCC 300 [0057] ACCTATCCGT
ACCTGCAGCA CGAGATCGAC CTGCCACCCA CCATCTCGCT 350 [0058] GTCAGACGGG
GAGGAGCCCC CACCCTACCA GGGCCCCTGC ACCCTCCAGC 400 [0059] TTCGGGACCC
CGAGCAGCAG CTGGAACTGA ACCGGGAGTC GGTGCGCGCA 450 [0060] CCCCCAAACA
GAACCATCTT CGACAGTGAC CTGATGGATA GTGCCAGGCT 500 [0061] GGGCGGCCCC
TGCCCCCCCA GCAGTAACTC GGGCATCAGC GCCACGTGCT 550 [0062] ACGGCAGCGG
CGGGCGCATG GAGGGGCCGC CGCCCACCTA CAGCGAGGTC 600 [0063] ATCGGCCACT
ACCCGGGGTC CTCCTTCCAG CACCAGCAGA GCAGTGGGCC 650 [0064] GCCCTCCTTG
CTGGAGGGGA CCCGGCTCCA CCACACACAC ATCGCGCCCC 700 [0065] TAGAGAGCGC
AGCCATCTGG AGCAAAGAGA AGGATAAACA GAAAGGACAC 750 [0066] CCTCTCTAG
(SEQ ID NO. 2) 759
[0067] The amino acid sequences of the polypeptides encoded by the
PMEPA1 nucleotide sequences of the invention include: [0068]
MAELEFVQII IIVVVMMVMV VVITCLLSHY KLSARSFISR HSQGRRREDA 50 [0069]
LSSEGCLWPS ESTVSGNGIP EPQVYAPPRP TDRLAVPPFA QRERFHRFQP 100 [0070]
TYPYLQHEID LPPTISLSDG EEPPPYQGPC TLQLRDPEQQ LELNRESVRA 150 [0071]
PPNRTIFDSD LMDSARLGGP CPPSSNSGIS ATCYGSGGRM EGPPPTYSEV 200 [0072]
IGHYPGSSFQ HQQSSGPPSL LEGTRLHHTH IAPLESAAIW SKEKDKQKGH 250 [0073]
PL* (SEQ ID NO. 3) 252
[0074] The discovery of the nucleic acids of the invention enables
the construction of expression vectors comprising nucleic acid
sequences encoding polypeptides; host cells transfected or
transformed with the expression vectors; isolated and purified
biologically active polypeptides and fragments thereof; the use of
the nucleic acids or oligonucleotides thereof as probes to identify
nucleic acid encoding proteins having PMEPA I-like activity; the
use of single-stranded sense or antisense oligonucleotides from the
nucleic acids to inhibit expression of polynucleotides encoded by
the PMEPA1 gene; the use of such polypeptides and fragments thereof
to generate antibodies; the use of the antibodies to purify PMEPA1
polypeptides; and the use of the nucleic acids, polypeptides, and
antibodies of the invention to detect, prevent, and treat prostate
cancer (e.g., prostatic intraepithelial neoplasia (PIN),
adenocarcinomas, nodular hyperplasia, and large duct carcinomas)
and prostate-related diseases (e.g., benign prostatic
hyperplasia).
[0075] As summarized below and explained in further detail in the
Examples that follow, our evaluation of PMEPA1 indicates it is a
prostate-abundant androgen regulated gene with roles in cell growth
control and tumorigenesis. Loss or reduced PMEPA1 expression in
prostate cancer correlates with a higher risk or probability of
prostate tumorigenesis or progression (e.g., advanced stages of
prostate cancer, such as non-organ defined cancer, where tumors
extend beyond the prostate gland), particularly after surgery as
primary therapy. Thus, alterations in the level, expression, and
activity of PMEPA1 and/or its encoded polypeptide provides useful
information about the clinical behavior of prostate cancer. Part of
our evaluation involved a PMEPA1 protein sequence homology search
that showed 83% identity to a recently reported gene, N4WBP4
(Example 8). N4WBP4 encodes a NEDD4 WW domain binding protein with
two PY motifs that is expressed in mouse embryo [Jolliffe et al.,
Biochem. J., 351: 557-565, 2000]. The PY motif is a proline-rich
peptide sequence with a consensus PPXY sequence (where X can be any
amino acid) that can bind to proteins with WW domains [Jolliffe et
al., Biochem. J., 351: 557-565, 2000; Harvey K et al., Trends Cell
Biol., 9: 166-169, 1999; Hicke L, Cell, 106: 527-530, 2001; Kumar
et al., Biochem. Biophys. Res. Commun., 185: 1155-1161, 1992; Kumar
et al., Genomics, 40: 435-443, 1997; Sudol M, Trends Biochem. Sci.,
21: 161-163, 1996; Harvey et al., J. Biol. Chem., 277: 9307-9317,
2002; and Brunschwig et al., Cancer Res., 63: 1568-1575, 2003].
NEDD4 was originally identified as a developmentally regulated gene
in mice and is a ubiquitin-protein ligase (E3) that is involved in
the ubiquitin-dependent proteasome-mediated protein degradation
pathway. Further studies revealed that NEDD4 is implicated in
diverse cellular functions, such as regulation of membrane channels
and permeases, endocytosis, virus budding, cell cycle,
transcription and protein trafficking [Harvey et al., Trends Cell
Biol., 9: 166-169, 1999; Hicke L, Cell, 106: 527-530, 2001]. The WW
domain present in the NEDD4 protein is a module with two highly
conserved tryptophans that bind to several target proteins
containing a PY motif.
[0076] As explained in Example 9, we discovered that PMEPA1 is a
NEDD4 binding protein and that the binding of PMEPA1 to NEDD4 is
mediated by the PY motifs of PMEPA1. Mutating the PY motifs
significantly reduces the binding of PMEPA1 to NEDD4. In addition,
the homology of PMEPA1 to the NEDD4-binding protein indicates that
PMEPA1 may also regulate protein turnover via ubiquitinylation and
proteasome pathways in the cell. This is further supported by our
observation that PMEPA1 localizes to the Golgi apparatus (Example
11).
[0077] Further, we recently found that PMEPA1 expression in LNCaP
cells down regulates androgen receptor protein and modulates the
expression of genes that are transcriptionally regulated by
androgen receptor (Example 10). This shows that PMEPA1 functions in
androgen receptor regulation.
[0078] Our data also show that PMEPA1 inhibits the growth of
prostate cancer cells (Example 12). More specifically, the coding
region of PMEPA1 was inserted into an expression vector and
transfected into 293 cell (kidney) and LNCaP cells (prostate
cancer). Cell proliferation and cell cycle analysis showed that
there was no difference between PMEPA1 overexpressed 293 cell and
control vector transfected 293 cells. However LNCaP cells
overexpressing PMEPA1 exhibited significant cell growth inhibition.
Similar growth inhibition was observed in other prostate cancer
cell lines.
[0079] In addition, in a quantitative evaluation of PMEPA1
expression in primary prostate cancers, we found that 40 of 62
(64.5%) matched prostate specimens exhibited decreased expression
of PMEPA1 in tumor tissues, indicating a correlation between
reduced PMEPA1 expression and prostate tumorigenesis (Example 13).
When these expression patterns were stratified by organ confined
and non-organ confined tumors, a higher percentage of patients
exhibited reduced expression of PMEPA1 in non-organ confined tumor
(68%) vs. organ-confined tumor (44%), indicating that reduced
PMEPA1 expression correlates with an increased probability of
advanced prostate cancer.
Nucleic Acid Molecules
[0080] In a particular embodiment, the invention relates to certain
isolated nucleotide sequences that are free from contaminating
endogenous material. A "nucleotide sequence" refers to a
polynucleotide molecule in the form of a separate fragment or as a
component of a larger nucleic acid construct. The nucleic acid
molecule has been derived from DNA or RNA isolated at least once in
substantially pure form and in a quantity or concentration enabling
identification, manipulation, and recovery of its component
nucleotide sequences by standard biochemical methods (such as those
outlined in (Sambrook et al., Molecular Cloning: A Laboratory
Manual, 3rd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor,
N.Y. (www.molecularcloning.com). Such sequences are preferably
provided and/or constructed in the form of an open reading frame
uninterrupted by internal non-translated sequences, or introns,
that are typically present in eukaryotic genes. Sequences of
non-translated DNA can be present 5' or 3' from an open reading
frame, where the same do not interfere with manipulation or
expression of the coding region.
[0081] Nucleic acid molecules of the invention include DNA in both
single-stranded and double-stranded form, as well as the RNA
complement thereof. DNA includes, for example, cDNA, genomic DNA,
chemically synthesized DNA, DNA amplified by PCR, and combinations
thereof. Genomic DNA may be isolated by conventional techniques,
e.g., using the SEQ ID NO: 1 or SEQ ID NO:2, or a suitable fragment
thereof, as a probe.
[0082] The DNA molecules of the invention include full length genes
as well as polynucleotides and fragments thereof. The full length
gene may also include the N-terminal signal peptide. Other
embodiments include DNA encoding a soluble form, e.g., encoding the
extracellular domain of the protein, either with or without the
signal peptide.
[0083] The nucleic acids of the invention are preferentially
derived from human sources, but the invention includes those
derived from non-human species, as well.
Preferred Sequences
[0084] The particularly preferred nucleotide sequence of the
invention is SEQ ID NO:2, as set forth above. The sequence of amino
acids encoded by the DNA of SEQ ID NO:2 is shown in SEQ ID
NO:3.
Additional Sequences
[0085] Due to the known degeneracy of the genetic code, where more
than one codon can encode the same amino acid, a DNA sequence can
vary from that shown in SEQ ID NO:2, and still encode a polypeptide
having the amino acid sequence of SEQ ID NO:3. Such variant DNA
sequences can result from silent mutations (e.g., occurring during
PCR amplification), or can be the product of deliberate mutagenesis
of a native sequence.
[0086] The invention thus provides isolated DNA sequences encoding
polypeptides of the invention, selected from: (a) DNA comprising
the nucleotide sequence of SEQ ID NO:2; (b) DNA encoding the
polypeptide of SEQ ID NO:3; (c) DNA capable of hybridization to a
DNA of (a) or (b) under conditions of moderate stringency and which
encode polypeptides of the invention, wherein the polypeptides
inhibit the growth of LNCaP cells in a colony-forming assay; (d)
DNA capable of hybridization to a DNA of (a) or (b) under
conditions of high stringency and which encodes polypeptides of the
invention, wherein the polypeptides inhibit the growth of LNCaP
cells in a colony-forming assay, and (e) DNA which is degenerate as
a result of the genetic code to a DNA defined in (a), (b), (c), or
(d) and which encode polypeptides of the invention. Of course,
polypeptides encoded by such DNA sequences are encompassed by the
invention.
[0087] As used herein, conditions of moderate stringency can be
readily determined by those having ordinary skill in the art based
on, for example, the length of the DNA. The basic conditions are
set forth by (Sambrook et al. Molecular Cloning: A Laboratory
Manual, 3.sup.rd ed., Cold Spring Harbor Laboratory Press,
(www.molecularcloning.com)), and include use of a prewashing
solution for the nitrocellulose filters 5.times.SSC, 0.5% SDS, 1.0
mM EDTA (pH 8.0), hybridization conditions of about 50% formamide,
6.times.SSC at about 42.degree. C. (or other similar hybridization
solution, such as Stark's solution, in about 50% formamide at about
42.degree. C.), and washing conditions of about 60.degree. C.,
0.5.times.SSC, 0.1% SDS. Conditions of high stringency can also be
readily determined by the skilled artisan based on, for example,
the length of the DNA. Generally, such conditions are defined as
hybridization conditions as above, and with washing at
approximately 68.degree. C., 0.2.times.SSC, 0.1% SDS. The skilled
artisan will recognize that the temperature and wash solution salt
concentration can be adjusted as necessary according to factors
such as the length of the probe.
[0088] Also included as an embodiment of the invention is DNA
encoding polypeptide fragments and polypeptides comprising
inactivated N-glycosylation site(s), inactivated protease
processing site(s), or conservative amino acid substitution(s), as
described below.
[0089] In another embodiment, the nucleic acid molecules of the
invention also comprise nucleotide sequences that are at least 80%
identical to a native sequence (e.g., SEQ ID NO:2). Also
contemplated are embodiments in which a nucleic acid molecule
comprises a sequence that is at least 90% identical, at least 95%
identical, at least 98% identical, at least 99% identical, or at
least 99.9% identical to a native sequence (e.g., SEQ ID NO:2).
[0090] The percent identity may be determined by visual inspection
and mathematical calculation. Alternatively, the percent identity
of two nucleic acid sequences can be determined by comparing
sequence information using the GAP computer program, version 6.0
described by (Devereux et al., Nucl. Acids Res., 12:387 (1984)) and
available from the University of Wisconsin Genetics Computer Group
(UWGCG). The preferred default parameters for the GAP program
include: (1) a unary comparison matrix (containing a value of 1 for
identities and 0 for non-identities) for nucleotides, and the
weighted comparison matrix of (Gribskov and Burgess, Nucl. Acids
Res., 14:6745 (1986)), as described by (Schwartz and Dayhoff, eds.,
Atlas of Protein Sequence and Structure, National Biomedical
Research Foundation, pp. 353-358 (1979)); (2) a penalty of 3.0 for
each gap and an additional 0.10 penalty for each symbol in each
gap; and (3) no penalty for end gaps. Other programs used by one
skilled in the art of sequence comparison may also be used.
[0091] The invention also provides isolated nucleic acids useful in
the production of polypeptides. Such polypeptides may be prepared
by any of a number of conventional techniques. A DNA sequence
encoding a PMEPA1 polypeptide, or desired fragment thereof may be
subcloned into an expression vector for production of the
polypeptide or fragment. The DNA sequence advantageously is fused
to a sequence encoding a suitable leader or signal peptide.
Alternatively, the desired fragment may be chemically synthesized
using known techniques. DNA fragments also may be produced by
restriction endonuclease digestion of a full length cloned DNA
sequence, and isolated by electrophoresis on agarose gels. If
necessary, oligonucleotides that reconstruct the 5' or 3' terminus
to a desired point may be ligated to a DNA fragment generated by
restriction enzyme digestion. Such oligonucleotides may
additionally contain a restriction endonuclease cleavage site
upstream of the desired coding sequence, and position an initiation
codon (ATG) at the N-terminus of the coding sequence.
[0092] The well-known polymerase chain reaction (PCR) procedure
also may be used to isolate and amplify a DNA sequence encoding a
desired protein fragment. Oligonucleotides that define the desired
termini of the DNA fragment are employed as 5' and 3' primers. The
oligonucleotides may additionally contain recognition sites for
restriction endonucleases, to facilitate insertion of the amplified
DNA fragment into an expression vector. PCR techniques are
described in (Saiki et al., Science, 239:487 (1988)); (Wu et al.,
Recombinant DNA Methodology, eds., Academic Press, Inc., San Diego,
pp. 189-196 (1989)); and (Innis et al., PCR Protocols: A Guide to
Methods and Applications, eds., Academic Press, Inc. (1990)).
Polypeptides and Fragments Thereof
[0093] The invention encompasses polypeptides and fragments thereof
in various forms, including those that are naturally occurring or
produced through various techniques such as procedures involving
recombinant DNA technology. Such forms include, but are not limited
to, derivatives, variants, and oligomers, as well as fusion
proteins or fragments thereof.
Polypeptides and Fragments Thereof
[0094] The polypeptides of the invention include full length
proteins encoded by the nucleic acid sequences set forth above.
Particularly preferred polypeptides comprise the amino acid
sequence of SEQ ID NO:3.
[0095] As discussed in Example 8, SEQ ID NO:3 shares 83% identity
to a NEDD4 WW binding protein and contains two PY motifs, i.e.,
PPPY (SEQ ID NO:80) ("PY1") and PPTY (SEQ ID NO:81) ("PY2"). The
PPXY motif, where X can be any amino acid, has been shown to
facilitate binding with WW domain-containing proteins. We
demonstrate in the Examples that PMEPA1 binds to the NEDD4 protein,
which contains WW domains. NEDD4 is a ubiquitin-protein ligase (E3)
that is involved in the ubiquitin-dependent proteasome-mediated
protein degradation pathway.
[0096] Assays for determining whether a polypeptide, such as
PMEPA1, binds to other proteins having a WW domain are well-known
in the art and include strategies such as combinatorial peptide
libraries, affinity chromatography, expression library screening,
and yeast two-hybrid screening (Kay et al. (2000) FEBS Lett.,
480:55-62; Frederick et al. (1999) Mol. Cell. Biol., 19: 2330-2337;
Dai and Pendergast (1995) Genes Dev., 9:2569-2582; Kitamura et al.
(1996) Biochem. Biophys. Res. Commun., 219:509-514; Richard et al.
(1995) Mol. Cell. Biol. 15:186-197; and Sudol (1994) Oncogene
9:2145-2152).
[0097] The experimental data presented in the Examples show that
PMEPA1 negatively regulates cancer cell growth. Loss of such
function favors tumorigenesis or progression of existing disease.
Thus, PMEPA1 may suppress tumorigenesis or cancer progression by
interacting with WW domain-containing molecules. The homology of
PMEPA1 to the NEDD4-binding protein and the ability of PMEPA1 to
bind NEDD4 indicates that PMEPA1 may regulate protein turnover via
ubiquitinylation and proteasome pathways in the cell. This
mechanism is, of course, merely proposed. Moreover, it is not the
only mechanism by which PMEPA1 may exert its function. The present
invention is not limited to any particular mechanism of PMEPA1
activity.
[0098] In one embodiment, a polypeptide of the invention comprises
an amino acid sequence as set out in SEQ ID NO:3. In another
embodiment, the polypeptide comprises an amino acid sequence
substantially as set out in SEQ ID NO:3. In yet another embodiment,
the polypeptide comprises an amino acid sequence that is at least
80%, 90%, 95%, 96%, 97%, 98%, 99%, OR 99.9% identical to SEQ ID
NO:3, and preferably the polypeptide inhibits prostate cancer cell
growth, as demonstrated, for example, in a colony-forming assay,
such as the one described in Example 12. Inhibiting cell growth
refers to a decrease in cell growth in the presence of a PMEPA1
polypeptide, relative to the cell growth in the absence of the
PMEPA1 polypeptide. Alternatively, if a cell has a basal level of
PMEPA1 polypeptide expression, it refers to a decrease in cell
growth in the presence of increased levels of PMEPA1 polypeptide,
relative to cell growth in the presence of the basal level of
PMEPA1 polypeptide. Cell growth can be measured using conventional
assays, such as the colony-forming assay described in the examples.
As discussed in further detail below, these polypeptides may be
produced by recombinant DNA techniques. Percent identity may be
determined by visual inspection and mathematical calculation.
Alternatively, the percent identity of two protein sequences can be
determined by comparing sequence information using the GAP computer
program, based on the algorithm of (Needleman and Wunsch, J. Mol.
Bio., 48:443 (1970)) and available from the University of Wisconsin
Genetics Computer Group (UWGCG). The preferred default parameters
for the GAP program include: (1) a scoring matrix, blosum62, as
described by (Henikoff and Henikoff Proc. Natl. Acad. Sci. USA,
89:10915 (1992)); (2) a gap weight of 12; (3) a gap length weight
of 4; and (4) no penalty for end gaps. Other programs used by one
skilled in the art of sequence comparison may also be used.
[0099] The polypeptides of the invention may be membrane bound or
they may be secreted and thus soluble. Soluble polypeptides are
capable of being secreted from the cells in which they are
expressed. In general, soluble polypeptides may be identified (and
distinguished from non-soluble membrane-bound counterparts) by
separating intact cells which express the desired polypeptide from
the culture medium, e.g., by centrifugation, and assaying the
medium (supernatant) for the presence of the desired polypeptide.
The presence of polypeptide in the medium indicates that the
polypeptide was secreted from the cells and thus is a soluble form
of the protein.
[0100] In one embodiment, the soluble polypeptides and fragments
thereof comprise all or part of the extracellular domain, but lack
the transmembrane region that would cause retention of the
polypeptide on a cell membrane. A soluble polypeptide may include
the cytoplasmic domain, or a portion thereof, as long as the
polypeptide is secreted from the cell in which it is produced.
[0101] In general, the use of soluble forms is advantageous for
certain applications. Purification of the polypeptides from
recombinant host cells is facilitated, since the soluble
polypeptides are secreted from the cells. Further, soluble
polypeptides are generally more suitable for intravenous
administration.
[0102] The invention also provides polypeptides and fragments of
the extracellular domain that retain a desired biological activity.
Such a fragment may be a soluble polypeptide, as described
above.
[0103] Also provided herein are polypeptide fragments comprising at
least 20, or at least 30, contiguous amino acids of the sequence of
SEQ ID NO:3. Fragments derived from the cytoplasmic domain find use
in studies of signal transduction, and in regulating cellular
processes associated with transduction of biological signals.
Polypeptide fragments also may be employed as immunogens, in
generating antibodies.
Variants
[0104] Naturally occurring variants as well as derived variants of
the polypeptides and fragments are provided herein.
[0105] The variants of the invention include, for example, those
that result from alternate mRNA splicing events or from proteolytic
cleavage. Alternate splicing of mRNA may, for example, yield a
truncated but biologically active protein, such as a naturally
occurring soluble form of the protein. Variations attributable to
proteolysis include, for example, differences in the N- or
C-termini upon expression in different types of host cells, due to
proteolytic removal of one or more terminal amino acids from the
protein (generally from 1-5 terminal amino acids). Proteins in
which differences in amino acid sequence are attributable to
genetic polymorphism (allelic variation among individuals producing
the protein) are also contemplated herein.
[0106] Additional variants within the scope of the invention
include polypeptides that may be modified to create derivatives
thereof by forming covalent or aggregative conjugates with other
chemical moieties, such as glycosyl groups, lipids, phosphate,
acetyl groups and the like. Covalent derivatives may be prepared by
linking the chemical moieties to functional groups on amino acid
side chains or at the N-terminus or C-terminus of a polypeptide.
Conjugates comprising diagnostic (detectable) or therapeutic agents
attached thereto are contemplated herein, as discussed in more
detail below.
[0107] Other derivatives include covalent or aggregative conjugates
of the polypeptides with other proteins or polypeptides, such as by
synthesis in recombinant culture as N-terminal or C-terminal
fusions. Examples of fusion proteins are discussed below in
connection with oligomers. Further, fusion proteins can comprise
peptides added to facilitate purification and identification. Such
peptides include, for example, poly-His or the antigenic
identification peptides described in U.S. Pat. No. 5,011,912 and in
(Hopp et al., Bio/Technology, 6:1204 (1988)). One such peptide is
the FLAG.RTM. peptide, Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys, (SEQ ID
NO:4) which is highly antigenic and provides an epitope reversibly
bound by a specific monoclonal antibody, enabling rapid assay and
facile purification of expressed recombinant protein. A murine
hybridoma designated 4E11 produces a monoclonal antibody that binds
the FLAG.RTM. peptide in the presence of certain divalent metal
cations, as described in U.S. Pat. No. 5,011,912, hereby
incorporated by reference. The 4E11 hybridoma cell line has been
deposited with the American Type Culture Collection under accession
no. HB 9259. Monoclonal antibodies that bind the FLAG.RTM. peptide
are available from Eastman Kodak Co., Scientific Imaging Systems
Division, New Haven, Conn.
[0108] Among the variant polypeptides provided herein are variants
of native polypeptides that retain one or more activities
associated with a full-length, wild-type, PMEPA1 protein. As one
example, such variants or analogs that have the desired
immunogenicity or antigenicity can be used, for example, in
immunoassays, for immunization, for inhibition of PMEPA1 activity,
etc. Variants or analogs that retain, or alternatively lack or
inhibit, a desired PMEPA1 property of interest can be used as
inducers, or inhibitors, respectively, of such property and its
physiological correlates. These PMEPA1 properties include, but are
not limited to, binding to a WW domain-containing protein or other
PMEPA1 binding partner, inhibiting cancer cell proliferation,
inhibiting the expression of an androgen receptor, and modulating
the expression of a gene whose transcription is regulated by the
androgen receptor. Binding affinity can be measured by conventional
procedures, e.g., as described in U.S. Pat. No. 5,512,457 and as
set forth below. Variants or analogs of PMEPA1 can be tested for
the desired activity by procedures known in the art, including but
not limited to, the assays described in the Examples.
[0109] In one embodiment, the PMEPA1 variants contain at least one
mutation and/or deletion in the at least one of the PY motifs of
PMEPA1. These variants can be used, for example, in the treatment
of hypoproliferative disorders. In addition, these variants can be
used as immunogens to generate antibodies.
[0110] Variants include polypeptides that are substantially
homologous to the native form, but which have an amino acid
sequence different from that of the native form because of one or
more deletions, insertions or substitutions. Particular embodiments
include, but are not limited to, polypeptides that comprise from
one to ten deletions, insertions or substitutions of amino acid
residues, when compared to a native sequence.
[0111] A given amino acid may be replaced, for example, by a
residue having similar physiochemical characteristics. Examples of
such conservative substitutions include substitution of one
aliphatic residue for another, such as Ile, Val, Leu, or Ala for
one another; substitutions of one polar residue for another, such
as between Lys and Arg, Glu and Asp, or Gln and Asn; or
substitutions of one aromatic residue for another, such as Phe,
Trp, or Tyr for one another. Other conservative substitutions,
e.g., involving substitutions of entire regions having similar
hydrophobicity characteristics, are well known.
[0112] Similarly, the DNAs of the invention include variants that
differ from a native DNA sequence because of one or more deletions,
insertions or substitutions, but that encode a biologically active
polypeptide.
[0113] The invention further includes polypeptides of the invention
with or without associated native-pattern glycosylation.
Polypeptides expressed in yeast or mammalian expression systems
(e.g., COS-1 or COS-7 cells) can be similar to or significantly
different from a native polypeptide in molecular weight and
glycosylation pattern, depending upon the choice of expression
system. Expression of polypeptides of the invention in bacterial
expression systems, such as E. coli, provides non-glycosylated
molecules. Further, a given preparation may include multiple
differentially glycosylated species of the protein. Glycosyl groups
can be removed through conventional methods, in particular those
utilizing glycopeptidase. In general, glycosylated polypeptides of
the invention can be incubated with a molar excess of
glycopeptidase (Boehringer Mannheim).
[0114] Correspondingly, similar DNA constructs that encode various
additions or substitutions of amino acid residues or sequences, or
deletions of terminal or internal residues or sequences are
encompassed by the invention. For example, N-glycosylation sites in
the polypeptide extracellular domain can be modified to preclude
glycosylation, allowing expression of a reduced carbohydrate analog
in mammalian and yeast expression systems. N-glycosylation sites in
eukaryotic polypeptides are characterized by an amino acid triplet
Asn-X-Y, wherein X is any amino acid and Y is Ser or Tbr.
Appropriate substitutions, additions, or deletions to the
nucleotide sequence encoding these triplets will result in
prevention of attachment of carbohydrate residues at the Asn side
chain. Alteration of a single nucleotide, chosen so that Asn is
replaced by a different amino acid, for example, is sufficient to
inactivate an N-glycosylation site. Alternatively, the Ser or Thr
can by replaced with another amino acid, such as Ala. Known
procedures for inactivating N-glycosylation sites in proteins
include those described in U.S. Pat. No. 5,071,972 and EP 276,846,
hereby incorporated by reference.
[0115] In another example of variants, sequences encoding Cys
residues that are not essential for biological activity can be
altered to cause the Cys residues to be deleted or replaced with
other amino acids, preventing formation of incorrect intramolecular
disulfide bridges upon folding or renaturation.
[0116] Other variants are prepared by modification of adjacent
dibasic amino acid residues, to enhance expression in yeast systems
in which KEX2 protease activity is present. EP 212,914 discloses
the use of site-specific mutagenesis to inactivate KEX2 protease
processing sites in a protein. KEX2 protease processing sites are
inactivated by deleting, adding or substituting residues to alter
Arg-Arg, Arg-Lys, and Lys-Arg pairs to eliminate the occurrence of
these adjacent basic residues. Lys-Lys pairings are considerably
less susceptible to KEX2 cleavage, and conversion of Arg-Lys or
Lys-Arg to Lys-Lys represents a conservative and preferred approach
to inactivating KEX2 sites.
Production of Polypeptides and Fragments Thereof
[0117] Expression, isolation and purification of the polypeptides
and fragments of the invention may be accomplished by any suitable
technique, including but not limited to the following:
Expression Systems
[0118] The present invention also provides recombinant cloning and
expression vectors containing DNA, as well as host cell containing
the recombinant vectors. Expression vectors comprising DNA may be
used to prepare the polypeptides or fragments of the invention
encoded by the DNA. A method for producing polypeptides comprises
culturing host cells transformed with a recombinant expression
vector encoding the polypeptide, under conditions that promote
expression of the polypeptide, then recovering the expressed
polypeptides from the culture. The skilled artisan will recognize
that the procedure for purifying the expressed polypeptides will
vary according to such factors as the type of host cells employed,
and whether the polypeptide is membrane-bound or a soluble form
that is secreted from the host cell.
[0119] Any suitable expression system may be employed. The vectors
include a DNA encoding a polypeptide or fragment of the invention,
operably linked to suitable transcriptional or translational
regulatory nucleotide sequences, such as those derived from a
mammalian, microbial, viral, or insect gene. Examples of regulatory
sequences include transcriptional promoters, operators, or
enhancers, an mRNA ribosomal binding site, and appropriate
sequences which control transcription and translation initiation
and termination. Nucleotide sequences are operably linked when the
regulatory sequence functionally relates to the DNA sequence. Thus,
a promoter nucleotide sequence is operably linked to a DNA sequence
if the promoter nucleotide sequence controls the transcription of
the DNA sequence. An origin of replication that confers the ability
to replicate in the desired host cells, and a selection gene by
which transformants are identified, are generally incorporated into
the expression vector.
[0120] In addition, a sequence encoding an appropriate signal
peptide (native or heterologous) can be incorporated into
expression vectors. A DNA sequence for a signal peptide (secretory
leader) may be fused in frame to the nucleic acid sequence of the
invention so that the DNA is initially transcribed, and the mRNA
translated, into a fusion protein comprising the signal peptide. A
signal peptide that is functional in the intended host cells
promotes extracellular secretion of the polypeptide. The signal
peptide is cleaved from the polypeptide upon secretion of
polypeptide from the cell.
[0121] Suitable host cells for expression of polypeptides include
prokaryotes, yeast or higher eukaryotic cells. Mammalian or insect
cells are generally preferred for use as host cells. Appropriate
cloning and expression vectors for use with bacterial, fungal,
yeast, and mammalian cellular hosts are described, for example, in
(Pouwels et al. Cloning Vectors: A Laboratory Manual, Elsevier, New
York, (1985)). Cell-free translation systems could also be employed
to produce polypeptides using RNAs derived from DNA constructs
disclosed herein.
Prokaryotic Systems
[0122] Prokaryotes include gram-negative or gram-positive
organisms. Suitable prokaryotic host cells for transformation
include, for example, E. coli, Bacillus subtilis, Salmonella
typhimurium, and various other species within the genera
Pseudomonas, Streptomyces, and Staphylococcus. In a prokaryotic
host cell, such as E. coli, a polypeptide may include an N-terminal
methionine residue to facilitate expression of the recombinant
polypeptide in the prokaryotic host cell. The N-terminal Met may be
cleaved from the expressed recombinant polypeptide.
[0123] Expression vectors for use in prokaryotic host cells
generally comprise one or more phenotypic selectable marker genes.
A phenotypic selectable marker gene is, for example, a gene
encoding a protein that confers antibiotic resistance or that
supplies an autotrophic requirement. Examples of useful expression
vectors for prokaryotic host cells include those derived from
commercially available plasmids such as the cloning vector pBR322
(ATCC 37017). pBR322 contains genes for ampicillin and tetracycline
resistance and thus provides simple means for identifying
transformed cells. An appropriate promoter and a DNA sequence are
inserted into the pBR322 vector. Other commercially available
vectors include, for example, pKK223-3 (Pharmacia Fine Chemicals,
Uppsala, Sweden) and pGEM1 (Promega Biotec, Madison, Wis.,
USA).
[0124] Promoter sequences commonly used for recombinant prokaryotic
host cell expression vectors include .beta.-lactamase
(penicillinase), lactose promoter system (Chang et al., Nature
275:615 (1978); and (Goeddel et al., Nature 281:544 (1979)),
tryptophan (trp) promoter system (Goeddel et al., Nucl. Acids Res.
8:4057 (1980); and EP-A-36776) and tac promoter (Maniatis,
Molecular Cloning: A Laboratory Manual, Cold Spring Harbor
Laboratory, p. 412 (1982)). A particularly useful prokaryotic host
cell expression system employs a phage .lamda.P.sub.L promoter and
a c1857ts thermolabile repressor sequence. Plasmid vectors
available from the American Type Culture Collection which
incorporate derivatives of the .lamda.P.sub.L promoter include
plasmid pHUB2 (resident in E. coli strain JMB9, ATCC 37092) and
pPLc28 (resident in E. coli RR1, ATCC 53082).
Yeast Systems
[0125] Alternatively, the polypeptides may be expressed in yeast
host cells, preferably from the Saccharomyces genus (e.g., S.
cerevisiae). Other genera of yeast, such as Pichia or
Kluyveromyces, may also be employed. Yeast vectors will often
contain an origin of replication sequence from a 2.mu. yeast
plasmid, an autonomously replicating sequence (ARS), a promoter
region, sequences for polyadenylation, sequences for transcription
termination, and a selectable marker gene. Suitable promoter
sequences for yeast vectors include, among others, promoters for
metallothionein, 3-phosphoglycerate kinase (Hitzeman et al., J.
Biol. Chem. 255:2073 (1980)) or other glycolytic enzymes (Hess et
al., J Adv. Enzyme Reg. 7:149 (1968)); and (Holland et al.,
Biochem. 17:4900 (1978)), such as enolase,
glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate
decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase,
3-phosphoglycerate mutase, pyruvate kinase, triosephosphate
isomerase, phospho-glucose isomerase, and glucokinase. Other
suitable vectors and promoters for use in yeast expression are
further described in (Hitzeman, EPA-73,657). Another alternative is
the glucose-repressible ADH2 promoter described by (Russell et al.,
J. Biol. Chem. 258:2674 (1982)) and (Beier et al., Nature 300:724
(1982)). Shuttle vectors replicable in both yeast and E. coli may
be constructed by inserting DNA sequences from pBR322 for selection
and replication in E. coli (Ampr gene and origin of replication)
into the above-described yeast vectors.
[0126] The yeast .alpha.-factor leader sequence may be employed to
direct secretion of the polypeptide. The .alpha.-factor leader
sequence is often inserted between the promoter sequence and the
structural gene sequence. See, e.g., (Kurjan et al., Cell 30:933
(1982)) and (Bitter et al., Proc. Natl. Acad. Sci. USA 81:5330
(1984)). Other leader sequences suitable for facilitating secretion
of recombinant polypeptides from yeast hosts are known to those of
skill in the art. A leader sequence may be modified near its 3' end
to contain one or more restriction sites. This will facilitate
fusion of the leader sequence to the structural gene.
[0127] Yeast transformation protocols are known to those of skill
in the art. One such protocol is described by (Hinnen et al., Proc.
Natl. Acad. Sci. USA 75:1929 (1978)). The Hinnen et al. protocol
selects for Trp.sup.+ transformants in a selective medium, wherein
the selective medium consists of 0.67% yeast nitrogen base, 0.5%
casamino acids, 2% glucose, 10 mg/ml adenine and 20 mg/ml
uracil.
[0128] Yeast host cells transformed by vectors containing an ADH2
promoter sequence may be grown for inducing expression in a "rich"
medium. An example of a rich medium is one consisting of 1% yeast
extract, 2% peptone, and 1% glucose supplemented with 80 mg/ml
adenine and 80 mg/ml uracil. Derepression of the ADH2 promoter
occurs when glucose is exhausted from the medium.
Mammalian or Insect Systems
[0129] Mammalian or insect host cell culture systems also may be
employed to express recombinant polypeptides. Bacculovirus systems
for production of heterologous proteins in insect cells are
reviewed by (Luckow and Summers, Bio/Technology, 6:47 (1988)).
Established cell lines of mammalian origin also may be employed.
Examples of suitable mammalian host cell lines include the COS-7
line of monkey kidney cells (ATCC CRL 1651) (Gluzman et al., Cell
23:175 (1981)), L cells, C127 cells, 3T3 cells (ATCC CCL 163),
Chinese hamster ovary (CHO) cells, HeLa cells, and BHK (ATCC CRL
10) cell lines, and the CV1/EBNA cell line derived from the African
green monkey kidney cell line CV1 (ATCC CCL 70) as described by
(McMahan et al., EMBO J, 10: 2821 (1991)).
[0130] Established methods for introducing DNA into mammalian cells
have been described (Kaufman, R. J., Large Scale Mammalian Cell
Culture, pp. 15-69 (1990)). Additional protocols using commercially
available reagents, such as Lipofectamine lipid reagent (Gibco/BRL)
or Lipofectamine-Plus lipid reagent, can be used to transfect cells
(Felgner et al., Proc. Natl. Acad. Sci. USA 84:7413-7417 (1987)).
In addition, electroporation can be used to transfect mammalian
cells using conventional procedures, such as those in (Sambrook et
al., Molecular Cloning: A Lahoratory Manual, 2 ed. Vol. 1-3, Cold
Spring Harbor Laboratory Press (1989)). Selection of stable
transformants can be performed using methods known in the art, such
as, for example, resistance to cytotoxic drugs. (Kaufman et al.,
Meth. in Enzymology 185:487-511 (1990)), describes several
selection schemes, such as dihydrofolate reductase (DHFR)
resistance. A suitable host strain for DHFR selection can be CHO
strain DX-B 11, which is deficient in DHFR (Urlaub and Chasin,
Proc. Natl. Acad. Sci. USA 77:4216-4220 (1980)). A plasmid
expressing the DHFR cDNA can be introduced into strain DX-B 11, and
only cells that contain the plasmid can grow in the appropriate
selective media. Other examples of selectable markers that can be
incorporated into an expression vector include cDNAs conferring
resistance to antibiotics, such as G418 and hygromycin B. Cells
harboring the vector can be selected on the basis of resistance to
these compounds.
[0131] Transcriptional and translational control sequences for
mammalian host cell expression vectors can be excised from viral
genomes. Commonly used promoter sequences and enhancer sequences
are derived from polyoma virus, adenovirus 2, simian virus 40
(SV40), and human cytomegalovirus. DNA sequences derived from the
SV40 viral genome, for example, SV40 origin, early and late
promoter, enhancer, splice, and polyadenylation sites can be used
to provide other genetic elements for expression of a structural
gene sequence in a mammalian host cell. Viral early and late
promoters are particularly useful because both are easily obtained
from a viral genome as a fragment, which can also contain a viral
origin of replication (Fiers et al., Nature 273:113 (1978));
(Kaufman, Meth. in Enzymology (1990)). Smaller or larger SV40
fragments can also be used, provided the approximately 250 bp
sequence extending from the Hind III site toward the Bgl I site
located in the SV40 viral origin of replication site is
included.
[0132] Additional control sequences shown to improve expression of
heterologous genes from mammalian expression vectors include such
elements as the expression augmenting sequence element (EASE)
derived from CHO cells (Morris et al., Animal Cell Technology, pp.
529-534 and PCT Application WO 97/25420 (1997)) and the tripartite
leader (TPL) and VA gene RNAs from Adenovirus 2 (Gingeras et al.,
J. Biol. Chem. 257:13475-13491 (1982)). The internal ribosome entry
site (IRES) sequences of viral origin allows dicistronic mRNAs to
be translated efficiently (Oh and Sarnow, Current Opinion in
Genetics and Development 3:295-300 (1993)); (Ramesh et al., Nucleic
Acids Research 24:2697-2700 (1996)). Expression of a heterologous
cDNA as part of a dicistronic mRNA followed by the gene for a
selectable marker (e.g. DHFR) has been shown to improve
transfectability of the host and expression of the heterologous
cDNA (Kaufman, Meth. in Enzymology (1990)). Exemplary expression
vectors that employ dicistronic mRNAs are pTR-DC/GFP described by
(Mosser et al., Biotechniques 22:150-161 (1997)), and p2A5I
described by (Morris et al., Animal Cell Technology, pp. 529-534
(1997)).
[0133] A useful high expression vector, pCAVNOT, has been described
by (Mosley et al., Cell 59:335-348 (1989)). Other expression
vectors for use in mammalian host cells can be constructed as
disclosed by (Okayama and Berg, Mol. Cell. Biol. 3:280 (1983)). A
useful system for stable high level expression of mammalian cDNAs
in C127 murine mammary epithelial cells can be constructed
substantially as described by (Cosman et al., Mol. Immunol. 23:935
(1986)). A useful high expression vector, PMLSV N1/N4, described by
(Cosman et al., Nature 312:768 (1984)), has been deposited as ATCC
39890. Additional useful mammalian expression vectors are described
in EP-A-0367566, and in WO 91/18982, incorporated by reference
herein. In yet another alternative, the vectors can be derived from
retroviruses.
[0134] Another useful expression vector, pFLAG.RTM., can be used.
FLAG.RTM. technology is centered on the fusion of a low molecular
weight (1 kD), hydrophilic, FLAG.RTM. marker peptide to the
N-terminus of a recombinant protein expressed by pFLAG.RTM.
expression vectors. pDC311 is another specialized vector used for
expressing proteins in CHO cells. pDC311 is characterized by a
bicistronic sequence containing the gene of interest and a
dihydrofolate reductase (DHFR) gene with an internal ribosome
binding site for DHFR translation, an expression augmenting
sequence element (EASE), the human CMV promoter, a tripartite
leader sequence, and a polyadenylation site.
Purification
[0135] The invention also includes methods of isolating and
purifying the polypeptides and fragments thereof.
Isolation and Purification
[0136] The "isolated" polypeptides or fragments thereof encompassed
by this invention are polypeptides or fragments that are not in an
environment identical to an environment in which it or they can be
found in nature. The "purified" polypeptides or fragments thereof
encompassed by this invention are essentially free of association
with other proteins or polypeptides, for example, as a purification
product of recombinant expression systems such as those described
above or as a purified product from a non-recombinant source such
as naturally occurring cells and/or tissues.
[0137] In one preferred embodiment, the purification of recombinant
polypeptides or fragments can be accomplished using fusions of
polypeptides or fragments of the invention to another polypeptide
to aid in the purification of polypeptides or fragments of the
invention.
[0138] With respect to any type of host cell, as is known to the
skilled artisan, procedures for purifying a recombinant polypeptide
or fragment will vary according to such factors as the type of host
cells employed and whether or not the recombinant polypeptide or
fragment is secreted into the culture medium.
[0139] In general, the recombinant polypeptide or fragment can be
isolated from the host cells if not secreted, or from the medium or
supernatant if soluble and secreted, followed by one or more
concentration, salting-out, ion exchange, hydrophobic interaction,
affinity purification or size exclusion chromatography steps. As to
specific ways to accomplish these steps, the culture medium first
can be concentrated using a commercially available protein
concentration filter, for example, an Amicon or Millipore Pellicon
ultrafiltration unit. Following the concentration step, the
concentrate can be applied to a purification matrix such as a gel
filtration medium. Alternatively, an anion exchange resin can be
employed, for example, a matrix or substrate having pendant
diethylaminoethyl (DEAE) groups. The matrices can be acrylamide,
agarose, dextran, cellulose or other types commonly employed in
protein purification. Alternatively, a cation exchange step can be
employed. Suitable cation exchangers include various insoluble
matrices comprising sulfopropyl or carboxymethyl groups. In
addition, a chromatofocusing step can be employed. Alternatively, a
hydrophobic interaction chromatography step can be employed.
Suitable matrices can be phenyl or octyl moieties bound to resins.
In addition, affinity chromatography with a matrix which
selectively binds the recombinant protein can be employed. Examples
of such resins employed are lectin columns, dye columns, and
metal-chelating columns. Finally, one or more reversed-phase high
performance liquid chromatography (RP-HPLC) steps employing
hydrophobic RP-HPLC media, (e.g., silica gel or polymer resin
having pendant methyl, octyl, octyldecyl or other aliphatic groups)
can be employed to further purify the polypeptides. Some or all of
the foregoing purification steps, in various combinations, are well
known and can be employed to provide an isolated and purified
recombinant protein.
[0140] It is also possible to utilize an affinity column comprising
a polypeptide-binding protein of the invention, such as a
monoclonal antibody generated against polypeptides of the
invention, to affinity-purify expressed polypeptides. These
polypeptides can be removed from an affinity column using
conventional techniques, e.g., in a high salt elution buffer and
then dialyzed into a lower salt buffer for use or by changing pH or
other components depending on the affinity matrix utilized, or be
competitively removed using the naturally occurring substrate of
the affinity moiety, such as a polypeptide derived from the
invention.
[0141] In this aspect of the invention, polypeptide-binding
proteins, such as the anti-polypeptide antibodies of the invention
or other proteins that may interact with the polypeptide of the
invention, can be bound to a solid phase support such as a column
chromatography matrix or a similar substrate suitable for
identifying, separating, or purifying cells that express
polypeptides of the invention on their surface. Adherence of
polypeptide-binding proteins of the invention to a solid phase
contacting surface can be accomplished by any means, for example,
magnetic microspheres can be coated with these polypeptide-binding
proteins and held in the incubation vessel through a magnetic
field. Suspensions of cell mixtures are contacted with the solid
phase that has such polypeptide-binding proteins thereon. Cells
having polypeptides of the invention on their surface bind to the
fixed polypeptide-binding protein and unbound cells then are washed
away. This affinity-binding method is useful for purifying,
screening, or separating such polypeptide-expressing cells from
solution. Methods of releasing positively selected cells from the
solid phase are known in the art and encompass, for example, the
use of enzymes. Such enzymes are preferably non-toxic and
non-injurious to the cells and are preferably directed to cleaving
the cell-surface binding partner.
[0142] Alternatively, mixtures of cells suspected of containing
polypeptide-expressing cells of the invention first can be
incubated with a biotinylated polypeptide-binding protein of the
invention. Incubation periods are typically at least one hour in
duration to ensure sufficient binding to polypeptides of the
invention. The resulting mixture then is passed through a column
packed with avidin-coated beads, whereby the high affinity of
biotin for avidin provides the binding of the polypeptide-binding
cells to the beads. Use of avidin-coated beads is known in the art.
See (Berenson, et al. J. Cell. Biochem., 10D:239 (1986)). Wash of
unbound material and the release of the bound cells is performed
using conventional methods.
[0143] The desired degree of purity depends on the intended use of
the protein. A relatively high degree of purity is desired when the
polypeptide is to be administered in vivo, for example. In such a
case, the polypeptides are purified such that no protein bands
corresponding to other proteins are detectable upon analysis by
SDS-polyacrylamide gel electrophoresis (SDS-PAGE). It will be
recognized by one skilled in the pertinent field that multiple
bands corresponding to the polypeptide may be visualized by
SDS-PAGE, due to differential glycosylation, differential
post-translational processing, and the like. Most preferably, the
polypeptide of the invention is purified to substantial
homogeneity, as indicated by a single protein band upon analysis by
SDS-PAGE. The protein band may be visualized by silver staining,
Coomassie blue staining, or (if the protein is radiolabeled) by
autoradiography.
Production of Antibodies
[0144] Antibodies that are immunoreactive with the polypeptides of
the invention are provided herein. Such antibodies specifically
bind to the polypeptides via the antigen-binding sites of the
antibody (as opposed to non-specific binding). Thus, the
polypeptides, fragments, variants, fusion proteins, etc., as set
forth above may be employed as "immunogens" in producing antibodies
immunoreactive therewith. More specifically, the polypeptides,
fragment, variants, fusion proteins, etc. contain antigenic
determinants or epitopes that elicit the formation of
antibodies.
[0145] These antigenic determinants or epitopes can be either
linear or conformational (discontinuous). Linear epitopes are
composed of a single section of amino acids of the polypeptide,
while conformational or discontinuous epitopes are composed of
amino acids sections from different regions of the polypeptide
chain that are brought into close proximity upon protein folding
(C. A. Janeway, Jr. and P. Travers, Immuno Biology 3:9, Garland
Publishing Inc., 2nd ed. (1996)). Because folded proteins have
complex surfaces, the number of epitopes available is quite
numerous; however, due to the conformation of the protein and
steric hinderances, the number of antibodies that actually bind to
the epitopes is less than the number of available epitopes (C. A.
Janeway, Jr. and P. Travers, Immuno Biology 2:14, Garland
Publishing Inc., 2nd ed. (1996)). Epitopes may be identified by any
of the methods known in the art.
[0146] Thus, one aspect of the present invention relates to the
antigenic epitopes of the polypeptides of the invention. Such
epitopes are useful for raising antibodies, in particular
monoclonal antibodies, as described in more detail below.
Additionally, epitopes from the polypeptides of the invention can
be used as research reagents, in assays, and to purify specific
binding antibodies from substances such as polyclonal sera or
supernatants from cultured hybridomas. Such epitopes or variants
thereof can be produced using techniques well known in the art such
as solid-phase synthesis, chemical or enzymatic cleavage of a
polypeptide, or using recombinant DNA technology.
[0147] As to the antibodies that can be elicited by the epitopes of
the polypeptides of the invention, whether the epitopes have been
isolated or remain part of the polypeptides, both polyclonal and
monoclonal antibodies may be prepared by conventional techniques.
See, for example, (Kennet et al., Monoclonal Antibodies,
Hybridomas: A New Dimension in Biological Analyses, eds., Plenum
Press, New York (1980); and Harlow and Land, Antibodies: A
Laboratory Manual, eds., Cold Spring Harbor Laboratory Press, Cold
Spring Harbor, N.Y., (1988)).
[0148] Hybridoma cell lines that produce monoclonal antibodies
specific for the polypeptides of the invention are also
contemplated herein. Such hybridomas may be produced and identified
by conventional techniques. One method for producing such a
hybridoma cell line comprises immunizing an animal with a
polypeptide; harvesting spleen cells from the immunized animal;
fusing said spleen cells to a myeloma cell line, thereby generating
hybridoma cells; and identifying a hybridoma cell line that
produces a monoclonal antibody that binds the polypeptide. The
monoclonal antibodies may be recovered by conventional
techniques.
[0149] The monoclonal antibodies of the present invention include
chimeric antibodies, e.g., humanized versions of murine monoclonal
antibodies. Such humanized antibodies may be prepared by known
techniques and offer the advantage of reduced immunogenicity when
the antibodies are administered to humans. In one embodiment, a
humanized monoclonal antibody comprises the variable region of a
murine antibody (or just the antigen binding site thereof) and a
constant region derived from a human antibody. Alternatively, a
humanized antibody fragment may comprise the antigen binding site
of a murine monoclonal antibody and a variable region fragment
(lacking the antigen-binding site) derived from a human antibody.
Procedures for the production of chimeric and further engineered
monoclonal antibodies include those described in (Riechmann et al.,
Nature 332:323 (1988), Liu et al., PNAS 84:3439 (1987), Larrick et
al., Bio/Technology 7:934 (1989), and Winter and Harris, TIPS
14:139 (May 1993)). Procedures to generate antibodies
transgenically can be found in GB 2,272,440, U.S. Pat. Nos.
5,569,825 and 5,545,806 and related patents claiming priority
therefrom, all of which are incorporated by reference herein.
[0150] Antigen-binding fragments of the antibodies, which may be
produced by conventional techniques, are also encompassed by the
present invention. Examples of such fragments include, but are not
limited to, Fab and F(ab').sub.2 fragments. Antibody fragments and
derivatives produced by genetic engineering techniques are also
provided.
[0151] In one embodiment, the antibodies are specific for the
polypeptides of the present invention and do not cross-react with
other proteins. Screening procedures by which such antibodies may
be identified are well known, and may involve immunoaffinity
chromatography, for example.
[0152] The following examples further illustrate preferred aspects
of the invention.
EXAMPLE 1
Cell Culture and Androgen Stimulation
[0153] LNCaP cells (American Type Culture Collection, Rockville,
Md.) were used for SAGE analysis of ARGs. LNCaP cells were
maintained in RPMI 1640 (Life Technologies, Inc., Gaithersburg,
Md.) supplemented with 10% fetal bovine serum (FBS, Life
Technologies, Inc., Gaithersburg, Md.) and experiments were
performed on cells between passages 20 and 30. For the studies of
androgen regulation, charcoal/dextran stripped androgen-free FBS
(cFBS, Gemini Bio-Products, Inc., Calabasas, Calif.) was used.
LNCaP cells were cultured first in RPMI 1640 with 10% cFBS for 5
days and then stimulated with 10-8 M of non-metabolizable androgen
analog, R1881 (DUPONT, Boston, Mass.) for 24 hours. LNCaP cells
identically treated but without R1881 treatment served as control.
Cells were harvested at indicated time and polyA+ RNA was
double-selected with Fast Track kit (Invitrogene). The quality of
polyA+ was checked by Northern hybridization analysis.
EXAMPLE 2
SAGE Analysis
[0154] Two SAGE libraries (library LNCaP-C and library LNCaP-T)
were generated according to the procedure described previously
Velculescu et al. (30). Briefly, biotinylated oligo dT primed cDNA
was prepared from five micrograms of polyA+ RNA from R1881 treated
and control LNCaP cells and biotinylated cDNA was captured on
strepravidin coated magnetic beads (Dynal Corporation, MI). cDNA
bound to the magnetic beads were digested by NlaIII followed by
ligation to synthetic linkers containing a site for anchoring
enzyme, NlaIII and a site for tagging enzyme BsmF1. The restriction
digestion of ligated products with BsmF1 resulted in the capture of
10-11 bp sequences termed as "tags" representing signature sequence
of unique cDNAs. A multi-step strategy combining ligation, PCR,
enzymatic digestion and gel purification yielded two tags linked
together termed as "ditags." Ditags were concatamerized, purified
and cloned in plasmid pZero cloning vector (Invitrogen, Calif.).
The clones containing concatamers were screened by PCR and
sequenced. The sequence and the occurrence of each of the SAGE tags
was determined using the SAGE software kindly provided by Dr.
Kenneth W. Kinzler (Johns Hopkins University School of Medicine,
Baltimore, Md.). All the SAGE tags sequences were analyzed for
identity to DNA sequence in GenBank (National Center for
Biotechnology Information, Bethesda, Md., USA). The relative
abundance of each transcript was determined by dividing the number
of individual tags by total tags in the library. The copy number of
each gene was calculated assuming there are approximately 300,000
transcripts in a cell (Zhang et al., 1997). The differentially
expressed SAGE tags were determined by comparing the frequency of
occurrence of individual tags in the two libraries obtained from
the control (library LNCaP-C) and R1881 treated LNCaP cells
(library LNCaP-T). The results were analyzed with t test, and
p<0.05 was considered as a statistically significant difference
for a specific tag between these two libraries.
EXAMPLE 3
Kinetics of Androgen Regulation ARGs Defined by SAGE Analysis
[0155] LNCaP cells were cultured in RPMI 1640 with 10% cFBS for 5
days, then stimulated with R1881 at 10-10, 10-8, and 10-6 M for 1,
3, 12, 24, 72, 120, 168, and 216 hours. LNCaP cells identically
treated but without R1881 served as control. The cells were
harvested at indicated time and polyA+ RNA was prepared as
described as above. The polyA+ RNA was fractionated (2 .mu.g/lane)
by running through 1% formaldehyde-agarose gel and transferred to
nylon membrane. The cDNA probes of several ARGs were labeled with
.sup.32P-dCTP by random priming (Stratagene Cloning Systems, La
Jolla, Calif.). The nylon membranes were prehybridized for 2 hrs in
hybridization buffer (10 mM Tris-HCl, pH 7.5, 10% Dextran sulfate,
40% Formamide, 5.times.SSC, 5.times. Denhardt's solution and 0.25
mg/ml salmon sperm DNA) and hybridized to the .sup.32P labeled
probes (1.times.10.sup.6 cpm/ml) in the same buffer at 40.degree.
C. for 12-16 hrs. Blots were washed twice in 2.times.SSC/0.1% SDS
for 20 min at room temperature followed by two high-stringency wash
with 0.1.times.SSC/0.1% SDS at 50.degree. C. for 20 min. Nylon
membranes were exposed to X-ray film for autoradiography.
EXAMPLE 4
ARGs Expression Pattern in Cwr22 Model.
[0156] CWR22 (androgen dependent) and CWR22R (androgen relapsed)
tumor specimens were kindly provided by Dr. Thomas Pretlow (Case
Western Reserve University School of Medicine). The tissue samples
were homogenized and polyA+ RNA was extracted with Fast Track kit
(Invitrogen) following manufacture's protocol. Northern blots were
prepared as described in Example 3 and were hybridized with
.sup.32P labeled probes of the cDNA of interest.
[0157] Analysis of SAGE tag libraries from R1881 treated LNCaP
cells. LNCaP cells were maintained in androgen deprived growth
media for five days and were treated with synthetic androgen R1881
(10 nm) for 24 hours. Since a goal of the inventors was to identify
androgen signaling read-out transcripts, we chose conditions of
R1881 treatment of LNCaP cells showing a robust and stable
transcriptional induction of well-characterized prostate-specific
androgen regulated genes, prostate-specific antigen (PSA) and
NKX3.1 genes. A total of 90,236 tags were derived from the two SAGE
libraries. Of 90,236 tags, 6,757 tags corresponded to linker
sequences, and were excluded from further analysis. The remaining
83,489 tags represented a total of 23,448 known genes or ESTs and
1,655 tags did not show any match in the GeneBank data base. The
relative abundance of the SAGE tags varied between 0.0011% and
1.7%. Assuming that there are 18,000 transcripts per cell type and
there are about 83,489 anticipated total transcripts, the estimated
abundance of transcripts will be 0.2-308 copies per cell. This
calculation indicated that single copy genes had high chance to be
recognized by SAGE analysis in this study. The distribution of
transcripts by copy number suggests that the majority (above 90%)
of the genes in our analysis are expressed at 1 or 2 copies
level/cell. A total of 46,186 and 45,309 tags were analyzed in the
control (C) and R1881 (T) groups respectively. Unique SAGE tags
corresponding to known genes, expressed sequence tags (ESTs) and
novel transcripts were 15,593 and 15,920 in the control and
androgen treated groups respectively. About 94% of the unique SAGE
tags in each group showed a match to a sequence in the gene bank
and 6% SAGE tags represented novel transcripts. The most abundant
SAGE tags in both control and androgen treated LNCaP cells
represented proteins involved in cellular translation machinery
e.g., ribosomal proteins, translation regulators, mitochondrial
proteins involved in bio-energetic pathways.
EXAMPLE 5
[0158] Analysis of the ARGs Defined by SAGE Tags
[0159] Of about 15,000 unique tags a total of 136 SAGE tags were
significantly up-regulated in response to R1881 whereas 215 SAGE
tags were significantly down-regulated (p<0.05). It is important
to note that of 15,000 expressed sequences only 1.5% were androgen
responsive suggesting that expression of only a small subset of
genes are regulated by androgen under our experimental conditions.
The ARGs identified by the inventors are anticipated to represent a
hierarchy, where a fraction of ARGs are directly regulated by
androgens and others represent the consequence of the activation of
direct down-stream target genes of the AR. Comparison of SAGE tags
between control and R1881 also revealed that 74 SAGE tags were
significantly up-regulated (p<0.05) by four-fold and 120 SAGE
tags were significantly (p<0.05) down-regulated. Two SAGE tags
corresponding to the PSA gene sequence exhibited highest induction
(16 fold) between androgen treated (T) and control (C) groups.
Another prostate specific androgen regulated gene, NKX3.1 was among
significantly up-regulated ARGs (8 fold). Prostate specific
membrane antigen (PSMA) and Clusterin known to be down-regulated by
androgens were among the SAGE tags exhibiting decreased expression
in response to androgen (PSMA, 4 fold; Clusterin, fold). Therefore,
identification of well characterized up-regulated and
down-regulated ARGs defined by SAGE tags validates the use of LNCaP
experimental model for defining physiologically relevant ARGs in
the context of prostatic epithelial cells. It is important to note
that about 90% of up-regulated ARGs and 98% of the down-regulated
ARGs defined by our SAGE analysis were not known to be
androgen-regulated before.
EXAMPLE 6
Identification of Prostate Specific/Abundant Genes
[0160] LNCaP C/T-SAGE tag libraries were compared to a bank of 35
SAGE tag libraries (http://www.ncbi.nlm.nih.gov/SAGE/) containing
1.5 million tags from diverse tissues and cell types. Our analysis
revealed that known prostate specific genes e.g., PSA and NKX3.1
were found only in LNCaP SAGE tag libraries (this report and one
LNCaP SAGE library present in the SAGE tag bank). We have extended
this observation to the other candidate genes and transcripts. On
the basis of abundant/unique expression of the SAGE tag defined
transcripts in LNCaP SAGE tag libraries relative to other
libraries, we have now identified several candidate genes and ESTs
whose expression are potentially prostate specific or restricted
(Table 4). The utility of such prostate-specific genes includes:
(a) the diagnosis and prognosis of CaP (b) tissue specific
targeting of therapeutic genes (c) candidates for immunotherapy and
(d) defining prostate specific biologic functions.
[0161] Genes with defined functions showing at least five fold up
or down-regulation (p<0.05) were broadly classified on the basis
of their biochemical function, since our results of Northern
analysis of representative SAGE derived ARGs at 5-fold difference
showed most reproducible results. Table 9, presented at the end of
this specification immediately preceding the "References" section,
represents the quantitative expression profiles of a panel of
functionally defined ARGs in the context of LNCaP prostate cancer
cells. ARGs in the transcription factor category include proteins
involved in the general transcription machinery e.g., KAP1/TIF
.beta., CHD4 and SMRT (Douarin et al., 1998; Xu et al., 1999) have
been shown to participate in transcriptional repression. The
mitochondrial transcription factor 1 (mtTF1) was induced by 8 fold
in response to R1881. A recent report describes that another member
of the nuclear receptor superfamily, the thyroid hormone receptor,
also up-regulates a mitochondrial transcription factor expression
through a specific co-activator, PGC-1 (Wu et al., 1999). As shown
in Table 9 a thyroid hormone receptor related gene, ear-2 (Miyajima
et al., 1998) was also upregulated by R1881. It is striking to note
that expression of four [NKX3.1 (He et al., 1997), HOX B 13
(Sreenath et al., 1999), mtTF1 and PDEF (Oettgen et al., 2000)] of
the eight transcription regulators listed in Table 9 appear to be
prostate tissue abundant/specific based on published reports as
well as our analysis described above.
[0162] ARGs also include a number of proteins involved in cellular
energy metabolism and it is possible that some of these enzymes may
be transcriptionally regulated by mtTF1. Components of enzymes
involved in oxidative decaboxylation: dihydrolipoamide succinyl
transferase (Patel et al., 1995), puruvate dehydrogenase E-1
subunit (Ho et al., 1989), and the electron tansport chain: NADH
dehydrogenase 1 beta subcomplex 10 (Ton et al., 1997) were
upregulated by androgen. VDAC-2 (Blachly-Dyson et al., 1994), a
member of small pore forming proteins of the outer mitochondrial
membrane and which may regulate the transport of small metabolites
necessary for oxidative-phosphorylation, was also up regulated by
androgen. Diazepam binding protein (DBI), a previous reported ARG
(Swinnen et al., 1996), known to be associated with the VDAC
complex and implicated in a multitude of functions including
modulation of pheripheral benzodiaepine receptor, acyl-CoA
metabolism and mitochondrial steroidogenesis (Knudsen et al., 1993)
were also induced by androgen in our study. A thioredoxin like
protein (Miranda-Vizuete et al., 1998) which may function in
modulating the cellular redox state was down regulated by androgen.
In general, it appears that modulation of ARGs involved in
regulating cellular redox status and energy metabolism may effect
reactive oxygen species concentrations.
[0163] A number of cell proliferation associated proteins
regulating cell cycle, signal transduction and cellular protein
trafficking were upregulated by androgen, further supporting the
role of androgens in survival and growth of prostatic epithelial
cells. Androgen regulation of two proteins: XRCC2 (Cartwright et
al., 1998) and RPA3 (Umbricht et al., 1993) involved in DNA repair
and recombination is a novel and interesting finding. Induction of
these genes may represent a response to DNA damage due to androgen
mediated pro-oxidant shift, or these genes simply represent
components of genomic surveillance mechanisms stimulated by cell
proliferation. The androgen induction of a p53 inducible gene, PIG
8 (Umbricht et al., 1997), is another intriguing finding as the
mouse homolog of this gene, ei24 (Gu et al., 2000), is induced by
etoposide known to generate reactive oxygen species. In addition,
components of protein kinases modulated by adenyl cyclase, guanyl
cyclase and calmodulin involved in various cellular signal
transduction stimuli were also regulated by androgen.
[0164] Gene expression modulations in RNA processing and
translation components is consistent with increased protein
synthesis expected in cells that are switched to a highly
proliferative state. Of note is nucleolin, one of the highly
androgen induced genes (12 fold) which is an abundant nucleolar
protein associating with cell proliferation and plays a direct role
in the biogenesis, processing and transport of ribosomes to the
cytoplasm (Srivastava and Pollard, 1999). Another androgen
up-regulated gene, exportin, a component of the nuclear pore, may
be involved in the shuttling of nucleolin. Androgen regulation of
SiahBP1 (Page-McCaw et al., 1999), GRSF-1 (Qian and Wilusz, 1994)
and PAIP1 (Craig et al., 1998) suggests a role of androgen
signaling in the processing of newly transcribed RNAs. Two
splicesosomal genes, snRNP-G and snRNP-E coding for small
ribo-nucleoproteins were down-regulated by androgen. The
unr-interacting protein, UNRIP (Hunt et al., 1999) which is
involved in the direct ribosome entry of many viral and some
cellular mRNAs into the translational pathway, was the most
down-regulated gene in response to androgen.
[0165] Quantitative evaluation of gene expression profiles by SAGE
approach have defined yeast transcriptome (Velculescu et al., 1997)
and have identified critical genes in biochemical pathways
regulated by p53 (Polyak et al., 1997), x-irradiation (Hermeking et
al., 1997) and the APC gene (Korinek et al., 1997). Potential tumor
biomarkers in colon (Zhang et al., 1997), lung (Hibi et al., 1998),
and breast (Nacht et al., 1999) cancers and genes regulated by
other cellular stimuli (Waard et al., 1999; Berg et al., 1999) have
also been identified by SAGE. SAGE technology has enabled us to
develop the first quantitative database of androgen regulated
transcripts. Comparison of our SAGE tag libraries to the SAGE
TagBank has also revealed a number of new candidate genes and ESTs
whose expression is potentially abundant or specific to the
prostate. We have also identified a large number of transcripts not
previously defined as ARGs.
[0166] A great majority of functionally defined genes that were
modulated by androgen in our experimental system appear to promote
cell proliferation, cell survival, gain of energy and increased
oxidative reactions shift in the cells. However, a substantial
fraction of these ARGs appears to be androgen specific since they
do not exhibit appreciable change in their expression in other
studies examining cell proliferation associated genes (Iyer et al.,
1999, genome-www.stanford.edu/serum) or estrogen regulated genes in
MCF7 cells (Charpentier et al., 2000). The interesting experimental
observation of Ripple et al. (Ripple et al., 1997) showing a
prooxidant-antioxidant shift induced by androgen in prostate cancer
cells is supported by our identification of specific ARGs
(upregulation of enzymes involved in oxidative reactions, electron
transport chain and lipid metabolism in mitochondria and down
regulation of thioredoxin like protein) that may be involved in the
induction of oxidative stress by androgen.
EXAMPLE 7
Characterization of the Androgen-Regulated Gene PMEPA1
[0167] cDNA library screening and Sequencing of cDNA clone. One of
the SAGE tags (14 bp) showing the highest induction by androgen
(29-fold) exhibited homology to an EST in the GenBank EST database.
PCR primers (5'GGCAGAACACTCCGCGCTTCTTAG3' (SEQ ID NO. 5) and
5'CAAGCTCTCTTAGCTTGTGCATTC3' (SEQ ID NO. 6)) were designed based on
the EST sequence (accession number AA310984). RT-PCR was performed
using RNA from R1881 treated LNCaP cells and the co-identity of the
PCR product to the EST was confirmed by DNA sequencing. Using the
PCR product as probe, the normal prostate cDNA library was screened
through the service provided by Genome Systems (St. Louis, Mo.). An
isolated clone, GS 22381 was sequenced using the 310 Genetic
Analyzer (PE Applied Biosystems, Foster Calif.) and 750 bp of DNA
sequence was defined, which included 2/3 of the coding region of
PMEPA1. A GenBank search with PMEPA1 cDNA sequence revealed one EST
clone (accession number AA088767) homologous to the 5' region of
the PMEPA1 sequence. PCR primers were designed using the EST clone
(5' primer) and PMEPA1 (3' primer) sequence. cDNA from LNCaP cells
was PCR amplified and the PCR product was sequenced using the PCR
primers. The sequences were verified using at least two different
primers. A contiguous sequence of 1,141 bp was generated by these
methods.
Kinetics of Androgen Regulation of PMEPA1 Expression in LNCaP
Cells.
[0168] LNCaP cells (American Type Culture Collection, ATCC,
Rockville Md.) were maintained in RPMI 1640 media (Life
Technologies, Inc., Gaithersburg, Md.) supplemented with 10% fetal
bovine serum (FBS, Life Technologies, Inc., Gaithersburg, Md.) and
experiments were performed on cells cultured between passages 20
and 30. For the studies of androgen regulation, charcoal/dextran
stripped androgen-free FBS (cFBS, Gemini Bio-Products, Inc.,
Calabasas, Calif.) was used. LNCaP cells were cultured first in
RPMI 1640 with 10% cFBS for 5 days, and then stimulated with R1881
(DUPONT, Boston, Mass.) at 10.sup.-10 M and 10.sup.-8 M for 3, 6,
12 and 24 hours. LNCaP cells identically treated but without R1881
served as control. To study the effects of androgen withdrawal on
PMEPA1 gene expression, LNCaP cells were cultured in RPMI 1640 with
10% cFBS for 24, 72 and 96 hours. Poly A+ RNA samples derived from
cells treated with or without R1881 were extracted at indicated
time points with a Fast Track mRNA extraction kit (Invitrogen,
Carlsbad, Calif.) following the manufacturer's protocol. Poly A+
RNA specimens (2 zg/lane) were electrophoresed in a 1%
formaldehyde-agarose gel and transferred to a nylon membrane. Two
PMEPA1 probes used for Northern blots analysis were (a) cDNA probe
spanning nucleotides 3-437 of PMEPA1 cDNA sequence (See Table 1)
and (b) 71-mer oligonucleotide between nucleotides 971 to 1,041 of
PMEPA1 cDNA sequence (See Table 1).
[0169] The cDNA probe was generated by RT-PCR with primers
5'CTTGGGTTCGGGTGAAAGCGCC 3' (SEQ ID NO. 7) (sense) and
5'GGTGGGTGGCAGGTCGATCTCG 3' (SEQ ID NO. 8) (antisense). PMEPA1
oligonucleotide and cDNA probes and glyceraldehyde phosphate
dehydrogenase gene (GAPDH) cDNA probe were labeled with
.sup.32P-dCTP using 3' end tailing for oligonucleotides (Promega,
Madison, Wis.) and random priming for cDNA (Stratagene, La Jolla,
Calif.). The nylon membranes were treated with hybridization buffer
(10 mM Tris-HCl, pH 7.5, 10% Dextran sulfate, 40% Formamide,
5.times.SSC, 5.times. Denhardt's solution and 0.25 mg/ml salmon
sperm DNA) for two hours followed by hybridization in the same
buffer containing the .sup.32P labeled probes (1.times.10.sup.6
cpm/ml) for 12-16 hrs at 40.degree. C. Blots were washed twice in
2.times.SSC/0.1% SDS for 20 min at room temperature followed by two
high-stringency washes with 0.1.times.SSC/0.1% SDS at 58.degree. C.
for 20 min. Nylon membranes were exposed to X-ray film for
autoradiography. The bands on films were then quantified with
NIH-Image processing software.
[0170] PMEPA1 expression analysis in CWR22 tumors. CWR22 is an
androgen-dependent, serially transplantable nude mouse xenograft
derived from a primary human prostate cancer. Transplanted CWR22
tumors are positive for AR and the growth of CWR22 is androgen
dependent. CWR22 tumors regress initially upon castration followed
by a relapse. The recurrent CWR22 tumors (CWR22R) express AR, but
the growth of these tumors become androgen-independent (Gregory et
al., 1998; Nagabhushan et al., 1996). One CWR22 and four CWR22R
tumor specimens were kindly provided by Dr. Thomas Pretlow's
laboratory (Case Western Reserve University School of Medicine).
Tumor tissues were homogenized and poly A+ RNA were extracted as
above. PolyA+ RNA blots were made and hybridized as described
above.
[0171] PMEPA1 expression analysis in multiple human tissues and
cell lines. Multiple Tissue Northern blots containing mRNA samples
from 23 human tissues and Master Dot blots containing mRNA samples
from 50 different human tissues were purchased from ClonTech (Palo
Alto, Calif.). The blots were hybridized with PMEPA1 cDNA and oligo
probes, as described above. The expression of PMEPA1 in normal
prostate epithelial cells (Clonetics, San Diego, Calif.), prostate
cancer cells PC3 (ATCC) and LNCaP cells and breast cancer cells
MCF7 (ATCC) was also analyzed by northern blot.
[0172] In situ hybridization of PMEPA1 in prostate tissues. A 430
bp PCR fragment (PCR sense primer: 5'CCTTCGCCCAGCGGGAGCGC 3', (SEQ
ID NO. 9) PCR antisense primer 5'CAAGCTCTCTTAGCTTGTGCATTC3' (SEQ ID
NO. 10) was amplified from cDNA of LNCaP cells treated by R1881 and
was cloned into a PCR-blunt IITOPO vector (Invitrogen, Carlsbad,
Calif.). Digoxigenin labeled antisense and sense riboprobes were
synthesized using an in vitro RNA transcription kit (Boehringer
Mannheim, GMbH, Germany) and a linearized plasmid with PMEPA1 gene
fragment as templates. Frozen normal and malignant prostate tissues
were fixed in 4% paraformaldehyde for 30 min. Prehybridization and
hybridization were performed at 55.degree. C. After hybridization,
slides were sequentially washed with 2.times.SSC at room
temperature for 30 min, 2.times.SSC at 58.degree. C. for 1 hr and
0.1.times.SSC at 58.degree. C. for 1 hr. Antibody against
digoxygenin was used to detect the signal and NBT/BCIP was used as
substrate for color development (Boehringer Marnnheim, GMbH,
Germany). The slides were evaluated under an Olympus BX-60
microscope. Full-length PMEPA1 coding sequence and chromosomal
localization.
[0173] Analysis of the 1,141 bp PMEPA1 cDNA sequence (SEQ ID NO.1)
revealed an open reading frame of 759 bp nucleotides (SEQ ID NO. 2)
encoding a 252 amino acid protein (SEQ ID NO. 3) with a predicted
molecular mass of 27.8 kDa, as set forth below in Table 1.
TABLE-US-00001 TABLE 1 (SEQ ID NO. 1)
TCCTTGGGTTCGGGTGAAAGCGCCTGGGGGTTCGTGGCCATGATCCCCGAGCTGCTGGAGAACTGAAGGCGGAC-
AGTCTCCTGCGAAAC 90
AGGCAATGGCGGAGCTGGAGTTTGTTCAGATCATCATCATCGTGGTGGTGATGATGGTGATGGTGGTGGTGATC-
ACGTGCCTGCTGAGCC 180 (SEQ ID NO. 3) M A E L E F V Q I I I I V V V M
M V M V V V I T C L L S 28
ACTACAAGCTGTCTGCACGGTCCTTCATCAGCCGGCACAGCCAGGGGCGGAGGAGAGAAGATGCCCTGTCCTCA-
GAAGGATGCCTGTGGC 270 H Y K L S A R S F I S R H S Q G R R R E D A L
S S E G C L W 58
CCTCGGAGAGCACAGTGTCAGGCAACGGAATCCCAGAGCCGCAGGTCTACGCCCCGCCTCGGCCCACCGACCGC-
CTGGCCGTGCCGCCCT 360 P S E S T V S G N G I P E P Q V Y A P P R P T
D R L A V P P 88
TCGCCCAGCGGGAGCGCTTCCACCGCTTCCAGCCCACCTATCCGTACCTGCAGCACGAGATCGACCTGCCACCC-
ACCATCTCGCTGTCAG 450 F A Q R E R F H R F Q P T Y P Y L Q H E I D L
P P T I S L S 118
ACGGGGAGGAGCCCCCACCCTACCAGGGCCCCTGCACCCTCCAGCTTCGGGACCCCGAGCAGCAGCTGGAACTG-
AACCGGGAGTCGGTGC 540 D G E E P P P Y Q G P C T L Q L R D P E Q Q L
E L N R E S V 148
GCGCACCCCCAAACAGAACCATCTTCGACAGTGACCTGATGGATAGTGCCAGGCTGGGCGGCCCCTGCCCCCCC-
AGCAGTAACTCGGGCA 630 R A P P N R T I F D S D L M D S A R L G G P C
P P S S N S G 178
TCAGCGCCACGTGCTACGGCAGCGGCGGGCGCATGGAGGGGCCGCCGCCCACCTACAGCGAGGTCATCGGCCAC-
TACCCGGGGTCCTCCT 720 I S A T C Y G S G G R M E G P P P T Y S E V I
G H Y P G S S 208
TCCAGCACCAGCAGAGCAGTGGGCCGCCCTCCTTGCTGGAGGGGACCCGGCTCCACCACACACACATCGCGCCC-
CTAGAGAGCGCAGCCA 810 F Q H Q Q S S G P P S L L E G T R L H H T H I
A P L E S A A 238
TCTGGAGCAAAGAGAAGGATAAACAGAAAGGACACCCTCTCTAGGGTCCCCAGGGGGGCCGGGCTGGGGCTGCG-
TAGGTGAAAAGGCAGA 900 I W S K E K D K Q K G H P L * 252
ACACTCCGCGCTTCTTAGAAGAGGAGTGAGAGGAAGGCGGGGGGCGCAGCAACGCATCGTGTGGCCCTCCCCTC-
CCACCTCCCTGTGTAT 990
AAATATTTACATGTGATGTCTGGTCTGAATGCACAAGCTAAGAGAGCTTGCAAAAAAAAAAAGAAAAAAGAAAA-
AAAAAAACCACGTTTC 1080
TTTGTTGAGCTGTGTCTTGAAGGCAAAAGAAAAAAAATTTCTACAGTAAAAAAAAAAAAAA
1141
[0174] As indicated above, Table 1 represents the nucleotide and
predicted amino acid sequence of PMEPA1 (GenBank accession No.
AF224278). The potential initiation methionine codon and the
translation stop codons are indicated in bold. The transmembrane
domain is underlined. The locations of the intron/exon boundaries
are shown with arrows, which were determined by comparison of the
PMEPA1 cDNA sequence to the publicly available sequences of human
clones RP5-1059L7 and 718J7 (GenBank accession No. AL121913 and
AL035541).
[0175] A GenBank search revealed a sequence match of PMEPA1 cDNA to
two genomic clones, RP5-1059L7 (accession number AL121913 in the
GenBank/htgc database) and 718J7 (accession number AL035541 in the
GenBank/nr database). These two clones mapped to Chromosome
20q13.2-13.33 and Chromosome 20q13.31-13.33. This information
provided evidence that PMEPA1 is located on chromosome 20q13.
[0176] The intron/exon juctions of PMEPA1 gene were determined
based on the comparison of the sequences of PMEPA1 and the two
genomic clones. A protein motif search using ProfileScan
(http://www.ch.embnet.org/cgi-bin/TMPRED) indicated the existence
of a type Ib transmembrane domain between amino acid residues 9 to
25 of the PMEPA1 sequence. Another GenBank search further revealed
that the PMEPA1 showed homology (67% sequence identity and 70%
positives at protein level) to a recently described novel cDNA
located on chromosome 18 (accession number NM.sub.--004338)
(Yoshikawa et al., 1998), as set forth below in Table 2. In
addition to the sequence similarity, PMEPA1 also shares other
features with C18orf1, e.g., similar size of the predicted protein
and similar transmembrane domain as the 1 isoform of C18orf1.
TABLE-US-00002 TABLE 2 2
AELEFVQIIIIVVVMMVMVVVITCLLSHYKLSARSFISRHSQGRRREDALSSEGCLWPSE 61
PMEPA1 (SEQ ID NO: 11) AELEF QIIIIVVV V VVVITCLL+HYK+S RSFI+R +Q
RRRED L EGCLWPS+ 3
AELEFAQIIIIVVVVTVMVVVIVCLLNHYKVSTRSFINRPNQSRRREDGLPQEGCLWPSD 62
C18orf1 (SEQ ID NO: 12) 62
STVSGNGIPEPQVYAPPRPTDRLAVPPFAQRERFHRFQPTYPYLQHEIDLPPTISLSDGE 121
PMEPA1 S G E + PR DR P F QR+RF RFQPTYPY+QHEIDLPPTISLSDGE 63
SAAPRLGASE--IMHAPRSRDRFTAPSFIQRDRFSRFQPTYPYVQHEIDLPPTISLSDGE 120
C18orf1 122
EPPPYQGPCTLQLRDPEQQLELNRESVRAPPNRTIFDSDLMDSARL-GGPCPPSSNSGIS 180
PMEPA1 EPPPYQGPCTLQLRDPEQQ+ELNRESVRAPPNRTIFDSDL+D A GGPCPPSSNSGIS
121 EPPPYQGPCTLQLRDPEQQMELNRESVRAPPNRTIFDSDLIDIAMYSGGPCPPSSNSGIS
180 C18orf1 181
ATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIW 240
PMEPA1 A+ S GRMEGPPPTYSEV+GH+PG+SF H Q S + G+RL ES + 181
ASTCSSNGRMEGPPPTYSEVMGHHPGASFLHHQRS---NAHRGSRLQFQQ-NNAESTIVP 236
C18orf1 241 SKEKDKQKGH 250 PMEPA1 K KD++ G+ 237 IKGKDRKPGN 246
C18orf1 In Table 2, a "+" denotes conservative substitution.
Analysis of PMEPA1 Expression
[0177] Northern hybridization revealed two transcripts of
.about.2.7 kb and 5 kb using either PMEPA1 cDNA or oligo probe. The
signal intensity of bands representing these two transcripts was
very similar on the X-ray films of the northern blots. RT-PCR
analysis of RNA from LNCaP cells with four pairs of primers
covering different regions of PMEPA1 protein coding region revealed
expected size of bands from PCR reactions, suggesting that two mRNA
species on northern blot have identical sequences in the protein
coding region and may exhibit differences in 5' and/or 3'non-coding
regions. However, the exact relationship between the two bands
remains to be established. Analysis of multiple northern blots
containing 23 human normal tissues revealed the highest level of
PMEPA1 expression in prostate tissue. Although other tissues
expressed PMEPA1, their relative expression was significantly lower
as compared to prostate (FIG. 1). In situ RNA hybridization
analysis of PMEPA1 expression in prostate tissues revealed abundant
expression in the glandular epithelial compartment as compared to
the stromal cells. However, both normal and tumor cells in tissue
sections of primary tumor tissues revealed similar levels of
expression.
Androgen Dependent Expression of PMEPA1
[0178] As discussed above, PMEPA1 was originally identified as a
SAGE tag showing the highest fold induction (29-fold) by androgen.
Androgen depletion of LNCaP cells resulted in decreased expression
of PMEPA1. Androgen supplementation of the LNCaP cell culture media
lacking androgen caused induction of both .about.2.7 and .about.5.0
bp RNA species of PMEPA1 in LNCaP cells in a dose and time
dependent fashion (FIG. 2A). Basal level of PMEPA1 expression was
detected in normal prostatic epithelial cell cultures and
androgen-dependent LNCaP cells cultured in regular medium. PMEPA1
expression was not detected in AR negative CaP cells, PC3 or in the
breast cancer cell line, MCF7 (FIG. 2B).
[0179] Evaluation of PMEPA1 expression in androgen sensitive and
androgen refractory tumors of CWR 22 prostate cancer xenograft
model
[0180] Previous studies have described increased expression of ARGs
in the "hormone refractory" CWR22R variants of the CWR22 xenograft,
suggesting the activation of AR mediated cell signaling in relapsed
CWR22 tumors following castration. The androgen sensitive CWR22
tumor expressed detectable level of PMEPA1 transcripts. However,
three of the four CWR22R tumors exhibited increased PMEPA1
expression (FIG. 8).
EXAMPLE 8
Structural Features of the PMEPA1 Gene.
[0181] Analysis of a 1,141 base pair PMEPA1 cDNA sequence revealed
an open reading frame of 759 nucleotides (SEQ ID NO:2) that encodes
a 252 amino acid protein (SEQ ID NO:3). A protein motif search
using ProfileScan (http://www.ch.embnet.org/cAibin/TMPRED)
indicated the existence of a type Ib transmembrane domain between
amino acid residues 9 to 25 of the PMEPA1 sequence. In addition,
the motif search revealed two PY motifs in the PMEPA1 protein
sequence, PPPY (SEQ ID NO:80) ("PY1") and PPTY (SEQ ID NO:81)
("PY2"). The PY motif is a proline-rich peptide sequence with a
consensus PPXY sequence (where X represents any amino acid) that
can bind to proteins with WW domains [Jolliffe et al., Biochem. J.,
351: 557-565, 2000; Harvey et al., Trends Cell Biol., 9: 166-169,
1999; Hicke, Cell, 106: 527-530, 2001; Kumar et al., Biochem.
Biophys. Res. Commun., 185: 1155-1161, 1992; Kumar et al.,
Genomics, 40: 435-443, 1997; Sudol, Trends Biochem. Sci., 21:
161-163, 1996; Harvey et al., J. Biol. Chem., 277: 9307-9317, 2002;
and Brunschwig et al., Cancer Res., 63: 1568-1575, 2003].
[0182] A protein sequence homology search revealed that PMEPA1 has
an 83% sequence identity with a mouse NEDD4 WW binding protein 4
("N4WBP4," Accession number AK008976) (4), as shown below in Table
10. In Table 2, the + denotes a conservative substitution, and the
PY motifs are underlined. TABLE-US-00003 TABLE 10 Human PMEPA1: 1
MAELEFVQXXXXXXXXXXXXXXXTCLLSHYKLSARSFISRHSQGRRREDALSSEGCLWPS 60 SEQ
ID NO. 3 + ELEFVQ TCLLSHYKLSARSFISRHSQ RRR+D LSSEGCLWPS Mouse
N4WBP4: 18
ITELEFVQIVVIVVVMMVMVVMITCLLSHYKLSARSFISRHSQARRRDDGLSSEGCLWPS 77 SEQ
ID NO. 68 Human PMEPA1: 61
ESTVSGNGIPEPQVYAPPRPTDRLAVPPFAQRERFHRFQPTYPYLQHEIDLPPTISLSDG 120
ESTVSG G+PEPQVYAPPRPTDRLAVPPF QR RFQPTYPYLQHEI LPPTISLSDG Mouse
N4WBP4: 78
ESTVSG-GMPEPQVYAPPRPTDRLAVPPFIQRS---RFQPTYPYLQHEIALPPTISLSDG 133
Human PMEPA1: 121
EEPPPYQGPCTLQLRDPEQQLELNRESVRAPPNRTIFDSDLMDSARLGGPCPPSSNSGIS 180
EEPPPYQGPCTLQLRDPEQQLELNRESVRAPPNRTIFDSDL+DS LGGPCPPSSNSGIS Mouse
N4WBP4: 134
EEPPPYQGPCTLQLRDPEQQLELNRESVRAPPNRTIFDSDLIDSTMLGGPCPPSSNSGIS 193
Human PMEPA1: 181
ATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIW 240
ATCY SGGRMEGPPPTYSEVIGHYPGSSFQHQQS+GP SLLEGTRLHH+HIAPLE Mouse
N4WBP4: 194
ATCYSSGGRMEGPPPTYSEVIGHYPGSSFQHQQSNGPSSLLEGTRLHHSHIAPLE----- 248
Human PMEPA1: 241 SKEKDKQKGHPL 252 +KEK+KQKGHPL Mouse N4WBP4: 249
NKEKEKQKGHPL 260
[0183] The WW domains of NEDD4 protein facilitate its binding to
the target proteins via interaction with the PY motifs of NEDD4
binding proteins [Jolliffe et al., Biochem. J., 351: 557-565, 2000;
Sudol M, Trends Biochem. Sci., 21: 161-163, 1996; Harvey et al., J.
Biol. Chem., 277: 9307-9317, 2002; Macias et al., Nature, 382:
646-649, 1996; Chen et al., Proc. Natl. Acad. Sci., USA., 92:
7819-7823, 1995; and Murillas et al., J. Biol. Chem., 277:
2897-2907, 2002]. The PMEPA1 protein sequence comprises two PY
motifs, i.e., PPPY (SEQ ID NO:80) ("PY1") and PPTY (SEQ ID NO:81)
("PY2"). PY1 is in the central region of the PMEPA1 protein and PY2
is close to the carboxyl terminus of the PMEPA1 protein (Table 2).
Therefore, the high protein sequence identity of PMEPA1 with N4WBP4
and the presence of PY motifs indicates that PMEPA1 is the human
homolog of N4 WBP4 and can bind to the NEDD4 protein and other
proteins containing a WW domain.
EXAMPLE 9
PMEPA1-PY Motifs Interact with the WW Domains of NEDD4
[0184] Plasmids. Mammalian expression vectors encoding PMEPA1-V5
and PMEPA1-GFP fusion proteins were generated by PCR amplification
of the PMEPA1 open reading frame. For PMEPA1-V5-pcDNA3.1 vector the
following primers were used: [0185] 5'-GCTGCTGGAGAACTGAAGGCG-3'
(SEQ ID NO:69) and [0186] 5'-GTGTCCTTTCTGTTTATCCTTC-3' (SEQ ID
NO:70).
[0187] For PMEPA1-GFP-pEGFP-vector the primers used were: [0188]
5'-AAGCTTGCTGCTGGAGAACTGAAGG CG-3' (SEQ ID NO:71) and [0189]
5'-GAATTCGGTGTCCTTTCTGTTTATC-3' (SEQ ID NO:72).
[0190] The V5 tag or GFP protein was fused at the carboxyl terminus
of the PMEPA1 protein. The PCR product for generating PMEPA1-V5 was
inserted into pcDNA3.1-V5-His expression vector (Invitrogen,
Carlsbad, Calif.). The PCR product for generating PMEPA1-GFP was
digested by HindIII and EcoRI and cloned into the same sites of
pEGFP vector (Clontech, Palo Alto, Calif.). PMEPA1-PY motif
mutants, in which the tyrosine residue (Y) was replaced with an
alanine residue (A), were created by using QuikChange Site-Directed
Mutagenesis kit (Stratagene, La Jolla, Calif.) and using the
PMEPA1-V5-pcDNA3.1 vector as a template. The plasmids of PMEPA1-PY
motif mutants are as follows: PMEPA1-PY1m-V5-pcDNA3.1, with the
first PY motif mutation (Y126A), PMEPA1-PY2m-V5-pcDNA3.1, with the
second PY motif mutation (Y197A), and PMEPA1-PY1m/PY2m-V5-pcDNA3.1,
with both the PY motif mutations (Y126A and Y197A). The sequences
of all the inserts in expression vectors were verified by DNA
sequencing.
[0191] A bacterial expression plasmid of human NEDD4 gene
(pNEDD4WW-GSTpGEX-2TK) encoding all four WW-domains (Accession
number XM.sub.--046129) fused to glutathione S-transferase (GST-WW
fusion protein), was generated by PCR amplification of the coding
region of the four WW-domains using the primers: [0192]
5'-GCAGGATCCCAACCAGATGCTGCTTGC-3' (SEQ ID NO:73) and [0193]
5'-GCAGAATTCTTTTGTAATCCCTGGAGTA-3'(SEQ ID NO:74). Normal prostate
tissue derived cDNA was used as a PCR template and the amplified
fragment was cloned into the BamHI/EcoRI sites of pGEX-2TK
(Amersham Biotech, Piscataway, N.J.). A mammalian expression vector
(NEDD4-GFP-pEGFP) encoding NEDD4-GFP fusion protein was generated
using the following primers to generate the NEDD4 gene fragment by
PCR.: [0194] 5'-GCAAAGCTTGTCCGGTTTGCTGGAAGC-3' (SEQ ID NO:75) and
[0195] 5'-GCAGAATTCCCTTTTTGTTCTTATTGGTGAC-3' (SEQ ID NO:76).
[0196] PMEPA.TM. and NEDD4 Protein Binding Assays. The in vitro
binding of PMEPA1 and NEDD4 was assessed by GST pull-down assays.
GST-WW fusion protein was prepared and purified with
glutathione-Sepharose beads per Amersham Biotech instructions.
[.sup.35S]methionine labeled proteins representing PMEPA1 and its
mutants were generated by in vitro transcription/translation (TNT
T7 quick coupled transcription/translation system, Promega,
Madison, Wis.). Briefly, the PMEPA1-V5-pcDNA3.1 or the three
mutants (2 .mu.g) were incubated in 40 .mu.l of reticulocyte lysate
with 40 .mu.Ci of [.sup.35S]methionine for 1.5 hrs at 30.degree.
C.
[0197] [.sup.35S]methionine incorporation into protein was measured
and samples were equalized on the basis of cpm. The GST-WW fusion
protein bound to glutathione-Sepharose beads (5 .mu.g) was
incubated with the [.sup.35S]methionine labeled lysates (12 .mu.l)
in 0.4 ml of phosphate-buffered saline (PBS, pH 7.4), 1 mM
dithiothreitol, and protease inhibitors. The negative control for
each [.sup.35S]methionine labeled lysate represented a reaction
mixture with equivalent amount of the lysate incubated with
glutathione-Sepharose beads without GST-WW fusion protein. After 16
hours of incubation at 4.degree. C., the beads were washed six
times with PBS, resuspended in SDS-PAGE sample buffer and run on
12% SDS-PAGE gel under a reducing condition. The gels were dried
and autoradiographed.
[0198] Results. The interaction of PMEPA1 and NEDD4 proteins in
cells was evaluated by a co-immunoprecipitation assay. 293 cells
(human embryonal kidney cells) were co-transfected with
NEDD4-GFP-pEGFP vector and one of the PMEPA1-V5 expression vectors
encoding either wt PMEPA1-V5 or the PY mutants of PMEPA1.
Thirty-six hours later the cells were collected and lysed and the
lysates were immunoprecipitated with anti-GFP antibody (Clontech,
Palo Alto, Calif.) following the manufacturer's protocol. The
immunoprecipitated proteins were subjected to immunoblotting with
an anti-V5 tag antibody (Invitrogen).
[0199] In vitro translated [.sup.35S]Methionine-labeled PMEPA1-V5
fusion protein, with the two intact PY motifs, showed binding to
the GST-WW fusion protein (FIG. 6, lane 1). PMEPA1 with PY1 or PY2
mutations revealed significantly decreased binding to WW domains
(FIG. 6, lane 2 and lane 3). Further, PMEPA1-V5 and NEDD4-GFP
fusion proteins expressed in 293 cells showed strong association
(FIG. 7, lane 1) and the mutant PMEPA1V5 proteins having single
mutation of PY1 or PY2 motif or double mutations of both PY1 and
PY2 motifs exhibited significantly reduced binding to NEDD4 (FIG.
7, lanes 2, 3, and 4). Thus both in vitro and cell culture data
reveal that PMEPA1 interacts with NEDD4 and this interaction
involves the binding of the PMEPA1 PY motifs to WW domains. The PY2
motif mutation appeared to have a greater effect on binding of
PMEPA1 to the NEDD4 WW domain.
[0200] The high protein sequence identity of PMEPA1 with N4WBP4
suggests that PMEPA1 is the human homolog of N4 WBP4.
EXAMPLE 10
PMEPA1 Down Regulates Androgen Receptor and Affects Transcriptional
Targets of the Androgen Receptor
[0201] LNCaP cells were stably transfected with PMEPA1-GFP
(PMEPA-GFP-LNCaP) and pEGFP control (pEGFP-LNCaP) expression
vectors. To evaluate the effects of exogenous PMEPA1 expression on
androgen receptor in LNCaP transfectants, cells were maintained in
androgen-free media for 5 days which is known to down regulate
endogenous PMEPA1 expression. Androgen receptor expression was
evaluated in these cells after 5 days in the androgen free media
(time, 0 hr). Androgen receptor expression was also evaluated in
cells replenished with 0.11 nM R1881 for different time points (12
hours and 24 hours) after androgen withdrawal. Western blot
analysis revealed reduced expression of androgen receptor protein
in PMEPA-GFP-LNCaP cells (FIG. 4A). Decreased androgen receptor
protein levels in PMEPA1 transfectants correlated with the reduced
levels of PSA protein, a likely consequence of the attenuation of
PSA gene expression due to relatively low levels of androgen
receptor protein. PMEPA1 down-regulation of androgen receptor was
further supported by results of relative increase of PSMA levels
whose expression is normally down regulated by androgen receptor.
These experiments showed that PMEPA1 down regulated androgen
receptor, and androgen receptor transcriptional targets were
affected correspondingly.
[0202] Because PMEPA1 is a NEDD4 binding protein, its effects on
androgen receptor expression may involve the ubiquitin-proteasome
pathway. To show that PMEPA1's effect on androgen receptor
expression does not result from a general or non-specific effect of
the upregulation of a ubiquitin protein ligase in the protein
degradation pathway, we evaluated the effects of PMEPA1 on androgen
receptor and the p27 protein, which is known to be degraded through
a ubiquitin-dependent pathway. We generated a stable
PMEPA1GFP-Tet-LNCaP transfectant, in which the expression of
PMEPA1-GFP fusion protein is regulated by tetracycline (Tet-off
system, Clontech). As shown in FIG. 4B, cells cultured in the
medium with tetracycline lacked PMEPA1 expression (Tet-off) but
overexpressed PMEPA1 when cultured in the medium without
tetracycline. The protein level of androgen receptor decreased
dramatically in PMEPA1-overexpressing cells as compared to the
relative expression of p27 or tubulin (FIG. 4B). Taken together,
these data show that androgen receptor is a specific target of
PMEPA1.
EXAMPLE 11
Golgi Association of PMEPA1 Protein.
[0203] Our studies also revealed that PMEPA1 is a Golgi-associated
protein.
[0204] Immunofluorescence Assays. Plasmids were prepared as
discussed above in Example 9. The immunofluorescent assays were
performed following the procedure described by Harvey et al., J.
Biol. Chem., 277: 9307-9317, 2002. Briefly, stable transfectants of
LNCaP cells harboring PMEPA1-GFP-pEGFP (LNCaP-PMEPA1-GFP
transfectant) were grown on coverslips for two days, fixed in 2%
paraformaldehyde for 15 minutes and permeabilized in 0.2% Triton
X-100 for 2 minutes. Fixed and permeabilized cells were incubated
with anti-GM130 (recognizes a cis-Golgi matrix protein) or
anti-TGN38 (recognizes a protein localizing to Trans-Golgi Network,
TGN) monoclonal antibodies (BD Transduction Laboratory, San Diego,
Calif.) at 6.25 .mu.g/ml for 30 minutes at room temperature. Cells
were then washed to remove excess or non-specifically bound primary
antibody followed by incubation with TRITC conjugated anti-mouse
antibody (Sigma, ST. Louis, Mo.) at 1:100 dilution for 30 minutes
at room temperature. The sections were mounted with fluoromount
(Southern Associates, Birmingham, Ala.) and the images were
processed with a Leica fluoromicroscope and Open-Lab software
(Improvision, Lexington, Mass.).
[0205] Results. PMEPA1-GFP fusion protein showed peri-nuclear
localization with a Golgi-like appearance. The images of
sub-cellular location of GM130, a cis-Golgi protein, showed similar
pattern as PMEPA1-GFP fusion protein. Superimposing the images of
PMEPA1-GFP fusion protein and GM130 in LNCaP-PMEPA1-GFP
transfectants confirmed the localization of PMEPA1-GFP fusion
protein on cis-Golgi structure. We did not observe the
co-localization of PMEPA1-GFP and TGN-38, which localizes to
TGN.
[0206] The sub-cellular localization of PMEPA1 is similar to two
other newly identified NEDD4 WW domain binding proteins, N4WBP5 and
N4WBP5a, which also localize to the Golgi complex [Harvey et al.,
J. Biol. Chem., 277: 9307-9317, 2002; Konstas et al., J. Biol.
Chem., 277: 29406-29416, 2002]. N4WBP5a sequestered the trafficking
of NEDD4/NEDD4-2 thereby increasing the activity of the epithelial
sodium channel (EnaC), a known target down regulated by NEDD4
[Konstas et al., J. Biol. Chem., 277: 29406-29416, 2002]. As a
highly androgen-regulated gene and a NEDD4 binding protein, the
localization of PMEPA1 on the Golgi apparatus suggests that PMEPA1
is involved in protein turn-over of androgen receptor targets.
EXAMPLE 12
[0207] PMEPA1 Inhibits Growth of Prostate Cancer Cells.
[0208] Colony-Forming Assays. To investigate the biologic effects
of PMEPA1 expression in regulating cell growth and the contribution
of PY motifs to such functions, we performed the colony-formation
assay by transfecting various prostate cancer cell lines with
expression vectors of the wild type PMEPA1 ("wt-PMEPA1") and
PMEPA1-PY mutants.
[0209] Prostate cancer cell lines: LNCaP, PC3, and DU145 were
purchased from ATCC (Rockville, Md.) and grown in the cell culture
media as described by the supplier. The LNCaP sub-lines C4,
C.sub.4-2 and C.sub.4-2B [Hsieh et al., Cancer Res., 53: 2852-7,
1993; Thalmann et al., Cancer Res., 54: 2577-81, 1994; and Wu et
al., Int. J. Cancer, 77: 887-94, 1998] were purchased from Urocor
(Oklahoma, Okla.) and cultured in T medium (5% FBS, 80% DMEM, 20%
F12, 5 ug/ml insulin, 13.65 pg/ml Triiodo-Thyronine, 5 ug/ml
apotransferrin, 0.244 ug/ml biotin, 25 ug/ml adenine).
[0210] Three micrograms of plasmids (PMEPA1-V5-pcDNA3.1 or vector
without PMEPA1 insert) were transfected into the 50-70% confluent
cells in triplicate in 60-mm petri dishes with Lipofectamine
(Invitrogen, Carlsbad, Calif.). Tumor suppressor gene p53 (wt), and
mt p53 (R175H and G245D) were also used in parallel as controls.
Approximately 36 hours later, selection with G418 at 800 .mu.g/ml
(DU145 and PC3) or 400 .mu.g/ml (LNCaP and its sublines) was
initiated. Cells were maintained with G418-containing medium that
was changed every 3-4 days. After 2-4 weeks of selection, the cells
were rinsed with 1.times.PBS, fixed with 2% formaldehyde in
1.times.PBS for 15 minutes, stained with 0.5% crystal violet in
1.times.PBS for 15 minutes, and rinsed 1-2 times with distilled
H.sub.2O. Colonies visible in each dish without magnification were
counted by Open-Lab software.
[0211] To assess the effects of the PY motif mutations on the
colony-forming ability of PMEPA1, LNCaP and PC3 cells were also
transfected with PMEPA1 mutants: PMEPA1-PY1m-pcDNA3.1,
PMEPA1-PY2m-pcDNA3.1, or PMEPA1-PY1m/PY2 m-pcDNA3.1.
PMEPA1-V5-pcDNA3.1 and expression vector without insert served as
positive and negative controls, respectively, for the PMEPA1
mutants. Two independent colony-forming assays were performed as
above.
[0212] As shown in FIGS. 3A-F, the colony-forming abilities of
prostate cancer cell lines DU145, PC3, LNCaP, and LNCaP sublines
were significantly suppressed by transfection of the sense version
of the wt-PMEPA1 expression vector. Under these conditions wt-p53
showed similar cell growth inhibition (data not shown).
[0213] In two independent experiments, mutation of the PY1 motif
appears to abolish the inhibition of colony formation by wt-PMEPA1,
emphasizing the role of the PY1 motif in PMEPA1 and NEDD4
interactions and the biologic functions of PMEPA1 (FIG. 3G-H). The
growth inhibitory effect of PMEPA1 appears to be linked to the
interactions of PY1 motif to NEDD4 WW domain. This interpretation
is based on the striking observations showing distinctively more
colonies with PY1 motif mutant in comparison to wt-PMEPA1.
[0214] Cell Proliferation Analysis. To further evaluate the growth
inhibitory effects of PMEPA1 on prostate cancer cells, a stable
PMEPA1-GFP-Tet LNCaP transfectant was generated. Expression of
PMEPA1-GFP fusion protein in these cells was negatively regulated
by tetracycline in the medium (Clontech). For cell proliferation
assays, three thousand PMEPA1-GFP-Tet LNCaP cells were seeded in
96-well plates with or without 1 kg/ml of tetracycline in the
medium. CellTiter 96 Aqueous One Solution kit (Promega, Madison,
Wis.) was used to measure the cell proliferation according to the
manufacturer's instructions.
[0215] The growth inhibitory effect of PMEPA1 has been further
confirmed by the cell proliferation characteristics of stable
PMEPA1-GFP-Tet-LNCaP cells, where exogenous PMEPA1 is upregulated
in the absence of tetracycline. The growth of the PMEPA1-GFP-Tet
LNCaP cells in tetracycline negative medium is significantly slower
than that of PMEPA1-tet LNCaP transfectant in tetracycline positive
medium (FIG. 5). LNCaP cells with PMEPA1 overexpression also
revealed increased RB phosphorylation further confirming the cell
growth inhibitory effect of PMEPA1 (data not shown).
[0216] PMEPA1 is expressed in androgen receptor positive prostate
cancer cell lines, including LNCaP and its sublines (C4, C.sub.4-2
and C.sub.4-2B). LNCaP cells are androgen dependent for growth.
Even though the growth of LNCaP sublines is androgen independent,
androgen receptor is critical for their proliferation [Zegarra-Moro
et al., Cancer Res., 62: 1008-1013, 2002]. We observed that
overexpression of PMEPA1 by transfecting the PMEPA1 expression
vector into LNCaP and its sublines significantly inhibited the cell
proliferation. Since our preliminary observations showed that
PMEPA1 overexpression in LNCaP cells resulted in altered expression
of androgen receptor downstream genes (Xu et al. unpublished data),
we hypothesized that the growth inhibitory effect of PMEPA1 on
LNCaP and its sublines may be mediated directly or indirectly
through affecting androgen receptor functions. Despite the growth
inhibitory effect on androgen receptor positive prostate cancer
cell lines, PMEPA1 was also found to inhibit the growth of androgen
receptor negative prostate tumor cells, DU145 and PC3, suggesting
that the growth inhibitory effects of PMEPA1 on DU145 and PC3 could
be mediated through alternative mechanisms, e.g., regulation of
other nuclear steroid receptors by PMEPA1. Nonetheless, inhibition
of prostate cancer cell growth by PMEPA1 implicates PMEPA1 in
control of prostate cancer development.
EXAMPLE 13
Decreased PMEPA1 Expression in Prostate Tumor Tissues.
[0217] We also evaluated the relationship of alterations in PMEPA1
expression to the clinico-pathologic features of prostate
cancer.
[0218] Prostate Tissue Specimens, Laser Capture Microdissection
(LCM) and Quantitative RT-PCR (QRT-PCR) Assay. Matched prostate
cancer and normal tissues were derived from radical prostatectomy
specimens from 62 CaP patients treated at Walter Reed Army Medical
Center (under an IRB-approved protocol). The procedures of
collecting specimens were previously described [Xu et al., Cancer
Res. 60: 6568-6572, 2000]. Ten micron frozen sections were prepared
and stored at -70.degree. C. Histologically normal prostate
epithelial cells and prostate tumor cells from each patient were
harvested using LCM equipment according to the protocol provided by
the manufacturer (Arcturus Engineering, Mountain View, Calif.).
[0219] Total RNA was prepared from the harvested normal and tumor
prostate epithelial cells as previously described [Xu et al.,
Cancer Res. 60: 6568-6572, 2000] and quantified with Fluorometer
(Bio-Rad, Hercules, Calif.). QRT-PCR was conducted using 0.1 ng of
total RNA from paired normal and tumor cells. PMEPA1 PCR primers
were carefully designed that only amplify PMEPA1 but not STAG1, an
alternatively spliced form of PMEPA1 [Rae et al., Mol. Carcinog.,
32: 44-53, 2001]. The PCR primers were: [0220]
5'-CATGATCCCCGAGCTGCT-3' (SEQ ID NO:77) and [0221]
5'-TGATCTGAACAAACTCCAGCTCC-3' (SEQ ID NO:78), and the labeled probe
was: [0222] 5'-AGGCGGACAGTCTCCTGCGAAAC-3' (SEQ ID NO:79).
[0223] GAPDH gene expression was detected as the internal control
(PE Applied Biosystems, Foster, Calif.). Paired triplicate samples
(one lacking RT and duplicate with RT) were amplified in 50 .mu.l
volumes containing the manufacturer's recommended universal
reagent, proper primers and probe of PMEPA1 or GAPDH using 7700
sequence detection system (PE Applied Biosystems, Foster,
Calif.).
[0224] Results were plotted as average cycle threshold (cT) values
for each duplicate sample minus the average duplicate cT values for
GAPDH. Differences between matched tumor (T) and normal (N) samples
were calculated using 2exp(cT.sub.tumor-cT.sub.normal) and
expressed as fold changes in expression. The expression status of
PMEPA1 was further categorized as either: 1) overexpression in
tumor tissue (T>N), defined as 1+(1.5-3 fold), 2+(3.1-10 fold),
3+(10.1-20 fold) and 4+(>20 fold) increased expression as
compared with matched normal tissue; 2) reduced expression in tumor
tissue (T<N), defined as 1--(1.5-3 fold), 2--(3.1-10 fold),
3--(10.1-20 fold) and 4--(>20 fold) decreased expression as
compared with matched normal tissue; or 3) no change (T=N), defined
as 0 (<1.5 fold). No detectable PMEPA1 expression in one of the
specimens of tumor/normal pairs was scored as 4+for increased or
4--for decreased expression.
[0225] Statistical analysis was performed with the SPSS software
package. The association between PMEPA1 expression and
clinico-pathological features was analyzed using chi-square tests.
The Kaplan-Meier curves were applied to display the
PSA-recurrence-free survival data. A p value<0.05 was considered
as statistically significant.
[0226] The overall expression pattern of PMEPA1 primary prostate
cancer is shown below in Table 11. TABLE-US-00004 TABLE 11 Number
of Degree of PMEPA1 PMEPA1 Patients/ Expression Expression Group
(%) Quantity Number (%) T < N 40 (64.5) 1- 11 (27.5) 2- 17
(42.5) 3- 5 (12.5) 4- 7 (17.5) T > N 10 (16.1) 1+ 6 (60.0) 2+ 4
(40.0) 3+ 4+ T = N 12 (19.4) 0
[0227] Comparison of PMEPA1 expression between tumor and normal
cells revealed tumor cell associated decreased expression (T<N)
in 64.5% tumor specimens (40 of 62), increased expression (T>N)
in 16.1% specimens (10 of 62) and no change (T=N) in 19.4%
specimens (12 of 62). When these expression patterns were
stratified by organ-confined (pT2) and non-organ-confined (pT3)
disease, a higher percentage of PMEPA1 reduction was seen in pT3
(74%) vs. pT2 (48%). Because the T>N group has a small number of
cases, we combined the T>N group and the T=N group (T>N
group). As shown below in Table 12, comparison of the
clinico-pathologic parameters between the T<N group and the
T>N group revealed that the T<N group had a significantly
higher percentage of patients with pT3 tumors (p=0.035) and more
patients in this group had a higher level of preoperative serum
prostate specific antigen (PSA) (p=0.023). TABLE-US-00005 TABLE 12
Time to Pathologic PSA Recurrence Stage PSA Range (%) Recurrence
after Surgery PMEPA1 (%) .ltoreq.4 4.1-10 10.1-20 (%) (month)
Expression T2 T3 ng/ml ng/ml ng/ml No Yes Mean .+-. SE T < N 11
29 1 30 9 29 11 8.2 .+-. (27.5) (72.5) (2.5) (75.0) (22.5) (72.5)
(27.5) 3.4 T .gtoreq. N 12 10 5 15 2 19 3 18.4 .+-. (54.5) (45.5)
(22.7) (68.2) (9.1) (86.4) (13.6) 6.3 pValue 0.035 0.023 0.211
0.18
[0228] Out of 62 patients whose tumors were analyzed for PMEPA1
expression, 14 patients showed prostate cancer recurrence as
defined by serum PSA level equal or higher than 0.2 ng/ml after
prostatectomy. Of the 14 patients, 11 showed reduced tumor
associated PMEPA1 expression (78.5%). Reduced PMEPA1 expression
seems to associate with a higher recurrence rate and a shorter
duration to recurrence after surgery, even through the statistical
analysis did not reveal a significant difference. The absence of a
significant difference might be due to the small number of
patients.
[0229] The specification is most thoroughly understood in light of
the teachings of the references cited within the specification
which are hereby incorporated by reference. The embodiments within
the specification provide an illustration of embodiments of the
invention and should not be construed to limit the scope of the
invention. The skilled artisan readily recognizes that many other
embodiments are encompassed by the invention. TABLE-US-00006 TABLE
3 Genes Regulated by Androgen: SAGE Data Derived from CPDR SAGE
Library Accession Description Effect of Androgen AA310984 EST
Up-regulated by Androgen M26663 prostate-specific antigen mRNA,
Up-regulated by Androgen complete cds.* AA508573 Human nucleolin
gene, complete cds Up-regulated by Androgen AB020637 Homo sapiens
mRNA for KIAA0830 protein, partial Up-regulated by Androgen cds.
AA280663 EST Up-regulated by Androgen U31657 KRAB-associated
protein 1 Up-regulated by Androgen AI879709 EST Up-regulated by
Androgen AA602190 EST Up-regulated by Androgen AF035587 Homo
sapiens X-ray repair cross-complementing Up-regulated by Androgen
protein 2 (XRCC2) AF151898 Homo sapiens CGI-140 protein mRNA
Up-regulated by Androgen AA418786 No reliable matches, only see in
two linberary (1 Up-regulated by Androgen each) AI308812 EST
Up-regulated by Androgen X59408 Membrane cofactor protein (CD46,
trophoblast- Up-regulated by Androgen lymphocyte cross-reactive
antigen) X81817 Accessory proteins BAP31/BAP29 Up-regulated by
Androgen AF071538 Ets transcription factor PDEF Up-regulated by
Androgen (PDEF) mRNA, complete NM_003201 Transcription factor
6-like 1 (mitochondrial Up-regulated by Androgen transcription
factor 1-like) U41387 Human Gu protein mRNA, partial cds.
Up-regulated by Androgen U58855 Guanylate cyclase 1, soluble, alpha
3 Up-regulated by Androgen X12794 Human v-erbA related ear-2 gene.
Up-regulated by Androgen U88542 homeobox protein Nkx3.1
Up-regulated by Androgen D89729 Homo sapiens mRNA for CRM1 protein,
complete Up-regulated by Androgen cds. U75329 TMPRSS2 Up-regulated
by Androgen AA062976 EST Up-regulated by Androgen L12168 Homo
sapiens adenylyl cyclase-associated protein Up-regulated by
Androgen (CAP) mRNA AA043945 EST Up-regulated by Androgen AF026291
Homo sapiens chaperonin containing t-complex Up-regulated by
Androgen polypeptide 1, delta AB002301 Human mRNA for KIAA0303
gene, partial cds. Up-regulated by Androgen D13643 Human mRNA for
KIAA0018 gene, complete cds. Up-regulated by Androgen AI310341 EST
Up-regulated by Androgen U49436 Human translation initiation factor
5 (eIF5) mRNA, Up-regulated by Androgen complete cds S79862
Proteasome (prosome, macropain) 26S subunit, non- Up-regulated by
Androgen ATPase, 5 M14200 Human diazepam binding inhibitor (DBI)
mRNA, Up-regulated by Androgen complete cds. AA653318 FK506-binding
protein 5 Up-regulated by Androgen L07493 Homo sapiens replication
protein A 14 kDa subunit Up-regulated by Androgen (RPA) mRNA,
AJ011916 Homo sapiens mRNA for hypothetical protein. Up-regulated
by Androgen AA130537 EST Up-regulated by Androgen D16373 Human mRNA
for dihydrolipoamide Up-regulated by Androgen succinyltransferase,
complete cds. AL096857 Novel human mRNA from chromosome 1
Up-regulated by Androgen AF007157 Homo sapiens clone 23856 unknown
mRNA, partial Up-regulated by Androgen cds. AA425929 NADH
dehydrogenase (ubiquinone) 1 beta Up-regulated by Androgen
subcomplex, 10 (22 kD, PDSW) AI357815 EST Up-regulated by Androgen
D83778 Human mRNA for KIAA0194 gene, partial cds. Up-regulated by
Androgen AF000979 Homo sapiens testis-specific Basic Protein Y 1
Up-regulated by Androgen (BPY1) mRNA, AA889510 EST Up-regulated by
Androgen AB018330 Homo sapiens mRNA for KIAA0787 protein, partial
Up-regulated by Androgen cds. AA026941 EST Up-regulated by Androgen
AA532377 Chromosome 1 open reading frame 8 Up-regulated by Androgen
AF010313 Homo sapiens Pig8 (PIG8) mRNA (etoposide- Up-regulated by
Androgen induced mRNA), complete cds. L06328 Human
voltage-dependent anion channel isoform 2 Up-regulated by Androgen
(VDAC) mRNA, U41804 Human putative T1/ST2 receptor binding protein
Up-regulated by Androgen precursor mRNA, AB020676 Homo sapiens mRNA
for KIAA0869 protein, partial Up-regulated by Androgen cds. J03503
Human pyruvate dehydrogenase E1-alpha subunit Up-regulated by
Androgen mRNA, cds. AA421098 EST Up-regulated by Androgen AF072836
Sox-like transcriptional factor Up-regulated by Androgen AA115355
EST Up-regulated by Androgen AF118240 Homo sapiens, peroxisomal
biogenesis factor 16 Up-regulated by Androgen (PEX16) mRNA,
complete AA011178 EST Up-regulated by Androgen X15573 Human
liver-type 1-phosphofructokinase (PFKL) Up-regulated by Androgen
mRNA, complete cds. AA120930 EST Up-regulated by Androgen AB002321
Human mRNA for KIAA0323 gene, partial cds Up-regulated by Androgen
AF151837 Homo sapiens CGI-79 protein mRNA, complete cds
Up-regulated by Androgen AA481027 EST Up-regulated by Androgen
AA039343 EST Up-regulated by Androgen U09716 Human mannose-specific
lectin (MR60) mRNA, Up-regulated by Androgen complete cds. AF044773
Homo sapiens breakpoint cluster region protein 1 Up-regulated by
Androgen (BCRG1) mRNA U51586 Human siah binding protein 1 (SiahBP1)
mRNA, Up-regulated by Androgen partial cds. M36341 Human
ADP-ribosylation factor 4 (ARF4) mRNA, Up-regulated by Androgen
complete cds. AI282096 EST Up-regulated by Androgen W45510 RAB7,
member RAS oncogene family-like 1 Up-regulated by Androgen X16135
Human mRNA for novel heterogeneous nuclear RNP Up-regulated by
Androgen protein, L protein AF052134 Homo sapiens clone 23585 mRNA
sequence, Up-regulated by Androgen AF052134 D26068 Williams-Beuren
syndrome chromosome region 1 Up-regulated by Androgen X69433 H.
sapiens mRNA for mitochondrial isocitrate Up-regulated by Androgen
dehydrogenase (NADP+). X61123 B-cell translocation gene 1,
anti-proliferative Up-regulated by Androgen X63423 H. sapiens mRNA
for delta-subunit of mitochondrial Up-regulated by Androgen F1F0
ATP-synthase AJ010025 Homo sapiens mRNA for unr-interacting
protein. Down-regulated by Androgen AF003938 Homo sapiens
thioredoxin-like protein mRNA, Down-regulated by Androgen complete
cds. AB014536 Homo sapiens copine III (CPNE3) mRNA Down-regulated
by Androgen AA504468 EST Down-regulated by Androgen NM_001273
Chromodomain helicase DNA binding protein 4 Down-regulated by
Androgen AA015746 Homo sapiens mRNA; cDNA DKFZp586H0722
Down-regulated by Androgen (from clone DKFZp586H0722) AA552354 EST
Down-regulated by Androgen AA025744 3-prime-phosphoadenosine
5-prime-phosphosulfate Down-regulated by Androgen synthase 2 X71129
H. sapiens mRNA for electron transfer flavoprotein Down-regulated
by Androgen beta subunit AA046050 EST Down-regulated by Androgen
U57052 Human Hoxb-13 mRNA, complete cds Down-regulated by Androgen
AA400137 EST Down-regulated by Androgen AA487586 EST Down-regulated
by Androgen J04208 Human inosine-5'-monophosphate dehydrogenase
Down-regulated by Androgen (IMP) mRNA M64722 Testosterone-repressed
prostate message 2 Down-regulated by Androgen (apolipoprotein J)
AI743483 EST Down-regulated by Androgen AA476914 EST Down-regulated
by Androgen AA026691 EST Down-regulated by Androgen AI014986 EST
Down-regulated by Androgen X85373 Small nuclear ribonucleoprotein
polypeptide G Down-regulated by Androgen U07231 G-rich RNA sequence
binding factor 1 Down-regulated by Androgen T97753 Glycogen
synthase 2 (liver) Down-regulated by Androgen AA234050 EST
Down-regulated by Androgen AI015143 EST Down-regulated by Androgen
U09196 Human 1.1 kb mRNA upregulated in retinoic acid
Down-regulated by Androgen treated HL-60 neutrophilic cells.
AA977749 EST Down-regulated by Androgen NM_006451 Polyadenylate
binding protein-interacting protein 1 Down-regulated by Androgen
AI818296 EST Down-regulated by Androgen AI250561 EST Down-regulated
by Androgen AA063613 EST Down-regulated by Androgen U59209
Hs.183596: UDP glycosyltransferase 2 family, Down-regulated by
Androgen polypeptide B17, U59209 Z11559 Iron-responsive element
binding protein 1 Down-regulated by Androgen AF052578 Homo sapiens
androgen receptor associated protein Down-regulated by Androgen 24
(ARA24) X16312 Human mRNA for phosvitin/casein kinase II beta
Down-regulated by Androgen subunit. H17890 PCTAIRE protein kinase 3
Down-regulated by Androgen AA192312 EST Down-regulated by Androgen
AA043787 EST Down-regulated by Androgen AI052020 EST Down-regulated
by Androgen AB014512 Homo sapiens mRNA for KIAA0612 protein
Down-regulated by Androgen NM_001328 Homo sapiens C-terminal
binding protein 1 (CTBP1) Down-regulated by Androgen mRNA M15919
Human autoimmune antigen small nuclear Down-regulated by Androgen
ribonucleoprotein E mRNA. AF151813 Homo sapiens CGI-55 protein
mRNA, complete cds Down-regulated by Androgen L41351 Protease,
serine, 8 (prostasin) Down-regulated by Androgen AF077046 Homo
sapiens ganglioside expression factor 2 (GEF- Down-regulated by
Androgen 2) homolog U15008 Small nuclear ribonucleoprotein D2
polypeptide Down-regulated by Androgen (16.5 kD), AA938995 N62491
Folate hydrolase (prostate-specific membrane Down-regulated by
Androgen antigen) 1 AI569591 EST Down-regulated by Androgen
AJ131245 Secretory protein 24 (SEC24). Down-regulated by Androgen
U90543 Human butyrophilin (BTF1) mRNA, complete cds. Down-regulated
by Androgen Z47087 Transcription elongation factor B (SIII),
polypeptide Down-regulated by Androgen 1-like M34539 FK506-binding
protein 1A (12 kD) Down-regulated by Androgen N43807 yy19a05.r1
Soares melanocyte 2NbHM Homo Down-regulated by Androgen sapiens
cDNA clone
U03269 Human actin capping protein alpha subunit (CapZ)
Down-regulated by Androgen mRNA, complete AI571685 EST
Down-regulated by Androgen AA010412 EST Down-regulated by Androgen
L40403 Homo sapiens (clone zap3) mRNA, 3' end of cds.
Down-regulated by Androgen NM_006560 CUG triplet repeat,
RNA-binding protein 1 Down-regulated by Androgen NM_004713
Serologically defined colon cancer antigen 1 Down-regulated by
Androgen U36188 Clathrin-associated/assembly/adaptor protein,
Down-regulated by Androgen medium 1 AB020721 KIAA0914 gene product
Down-regulated by Androgen T35365 EST Down-regulated by Androgen
AF029789 Homo sapiens GTPase-activating protein (SIPA1)
Down-regulated by Androgen mRNA, complete cds. AA427857 EST
Down-regulated by Androgen AA910404 EST Down-regulated by Androgen
L42379 Quiescin Q6 (bone-derived growth factor) Down-regulated by
Androgen AL117641 cDNA DKFZp434L235 Down-regulated by Androgen
AI688119 EST Down-regulated by Androgen AA688073 EST Down-regulated
by Androgen NM_002945 Replication protein A1 (70 kD) Down-regulated
by Androgen AI797610 EST Down-regulated by Androgen AF086095 Homo
sapiens full length insert cDNA clone Down-regulated by Androgen
YZ88A07. AF070666 Homo sapiens tissue-type pituitary Kruppel-
Down-regulated by Androgen associated box protein R55128 Proteasome
(prosome, macropain) 26 S subunit, non- Down-regulated by Androgen
ATPase, 2 X75621 Tuberous sclerosis 2 Down-regulated by Androgen
AA019070 EST Down-regulated by Androgen AI089867 EST Down-regulated
by Androgen NM_001003 Homo sapiens ribosomal protein, large, P1
(RPLP1) Down-regulated by Androgen mRNA L05093 Ribosomal protein
L18a Down-regulated by Androgen AA854176 EST Down-regulated by
Androgen AI929622 Homo sapiens clone 23675 mRNA sequence
Down-regulated by Androgen AI264769 ESTs, Weakly similar to ORF
YDL087c Down-regulated by Androgen [S. cerevisiae] L09159 Ras
homolog gene family, member A, may be Down-regulated by Androgen
androgen regulated? AI143187 EST Down-regulated by Androgen H17900
cDNA DKFZp586H051 (from clone Down-regulated by Androgen
DKFZp586H051) NM_005617 Ribosomal protein S14 Down-regulated by
Androgen L49506 Cyclin G2 Down-regulated by Androgen AA614448
Regulator of G-protein signalling 5 Down-regulated by Androgen
S83390 T3 receptor-associating cofactor-1 Down-regulated by
Androgen AA917672 EST Down-regulated by Androgen X52151
Arylsulphatase A Down-regulated by Androgen U09646 Carnitine
palmitoyltransferase II Down-regulated by Androgen Z50853
ATP-dependent protease ClpAP (E. coli), proteolytic Down-regulated
by Androgen subunit, human AB023208 MLL septin-like fusion
Down-regulated by Androgen U92014 Human clone 121711 defective
mariner transposon Down-regulated by Androgen Hsmar2 mRNA AA878293
Alpha-1-antichymotrypsin Down-regulated by Androgen AA554191 EST
Down-regulated by Androgen M55618 Hexabrachion (tenascin C,
cytotactin) Down-regulated by Androgen AA027050 EST Down-regulated
by Androgen AF112472 Homo sapiens calcium/calmodulin-dependent
protein Down-regulated by Androgen kinase II beta AA583866 EST
Down-regulated by Androgen AA115687 EST Down-regulated by Androgen
AA043318 EST Down-regulated by Androgen U90329 Poly(rC)-binding
protein 2 Down-regulated by Androgen Y00815 Protein tyrosine
phosphatase, receptor type, F Down-regulated by Androgen X76013 H.
sapiens QRSHs mRNA for glutaminyl-tRNA Down-regulated by Androgen
synthetase. X75861 Testis enhanced gene transcript Down-regulated
by Androgen AA593078 Homo sapiens PAC clone DJ0167F23 from 7p15
Down-regulated by Androgen J04058 Human electron transfer
flavoprotein alpha-subunit Down-regulated by Androgen mRNA AF026292
Homo sapiens chaperonin containing t-complex Down-regulated by
Androgen polypeptide 1, eta AF068754 Homo sapiens heat shock factor
binding protein 1 Down-regulated by Androgen HSBP1 mRNA, NM_000172
Guanine nucleotide binding protein (G protein), Down-regulated by
Androgen alpha transducing activity polypeptide 1 AI140631 Hs.1915:
folate hydrolase (prostate-specific Down-regulated by Androgen
membrane antigen) 1 Bold font indicates known androgen-regulated
gene based on Medline Search.
[0230] TABLE-US-00007 TABLE 4 Potential Prostate Specific/Abundant
Genes Derived From NCBI and CPDR SAGE Libraries Accession
Description M88700 Human dopa decarboxylase (DDC) gene, complete
cds. W45526 zc26b04.r1 Soares_senescent_fibroblasts_NbHSF Homo
sapiens cDNA, Hs.108981: ficolin (collagen/fibrinogen
domain-containing) 1, AF201077 NADH: ubiquinone oxidoreductase MLRQ
subunit (NDUFA4) mRNA, complete cds with polyA. D55953 HUM407H12B
Clontech human fetal brain polyA + mRNA (#6535) Homo, Hs.118724:
histidine triad nucleotide-binding protein, AJ012499, mRNA
activated in tumor suppression, clone TSAP19 with polyA AA082804
zn41g02.r1 Stratagene endothelial cell 937223 Homo sapiens cDNA,
Hs.110967: ESTs, Weakly similar to KIAA0762 protein [H. sapiens],
Hs.5662: guanine nucleotide binding protein (G protein), beta
polypeptide 2-like 1 in the sequence no tag X05332 Human mRNA for
prostate specific antigen.* AI278854 qo42f01.x1 NCI_CGAP_Lu5 Homo
sapiens cDNA clone IMAGE: 1911193 3', NM_004537, nucleosome
assembly protein 1-like 1 (NAP1L1), tag is at beginning of the
gene. W75950 zd58b02.r1 Soares_fetal_heart_NbHH19W Homo sapiens
cDNA clone, AF151840, CGI- 82 protein mRNA, tag is at 3' end.
F02980 HSC1IC062 normalized infant brain cDNA Homo sapiens cDNA
clone M99487 Human prostate-specific membrane antigen (PSM) mRNA,
complete cds. AL035304 H. sapiens gene from PAC 295C6, similar to
rat PO44. AI088979 ou86f03.s1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo
sapiens cDNA clone AF186249 six transmembrane epithelial antigen of
prostate (STEAP1) mRNA C15801 C15801 Clontech human aorta polyA +
mRNA (#6572) Homo sapiens cDNA L10340 Human elongation factor-1
alpha (ef-1) mRNA, 3' end. NM_004540 Homo sapiens neural cell
adhesion molecule 2 (NCAM2) AA151796 zl39c02.r1
Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone NM_001634 Homo
sapiens S-adenosylmethionine decarboxylase 1 (AMD1) NM_005013 Homo
sapiens nucleobindin 2 (NUCB2)AL121913 in GenBank htgc database)
and 718J7 (Accession number AL035541 AF004828 Homo sapiens rab3-GAP
regulatory domain mRNA, complete cds. X60819 X60 H. sapiens DNA for
monoamine oxidase type A (14) (partial). AA133972 zl38g12.r1
Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone M69226 Human
monoamine oxidase (MAOA) mRNA, complete cds. AA969141 op50c11.s1
Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone AA523652 ni64d09.s1
NCI_CGAP_Pr12 Homo sapiens cDNA clone IMAGE: 981617, mRNA AF078749
Homo sapiens organic cation transporter 3 (SLC22A3) AA583544
nf25h10.s1 NCI_CGAP_Pr1 Homo sapiens cDNA clone IMAGE: 914851, mRNA
AF051894 Homo sapiens 15 kDa selenoprotein mRNA, complete cds.
AF165967 Homo sapiens DDP-like protein mRNA X57129 H. sapiens H1.2
gene for histone H1. AA640928 nr28d08.r1 NCI_CGAP_Pr3 Homo sapiens
cDNA clone IMAGE: 1169295, mRNA U41766 Human
metalloprotease/disintegrin/cysteine-rich protein precursor
AF023676 Homo sapiens lamin B receptor homolog TM7SF2 (TM7SF2)
mRNA, U10691 Human MAGE-6 antigen (MAGE6) gene, complete cds.
M22976 Human cytochrome b5 mRNA, 3' end. L14778 Human
calmodulin-dependent protein phosphatase catalytic subunit AF071538
Ets transcription factor PDEF (PDEF) mRNA, complete U39840 Human
hepatocyte nuclear factor-3 alpha (HNF-3 alpha) mRNA, AA532511
nj54d03.s1 NCI_CGAP_Pr9 Homo sapiens cDNA clone IMAGE: 996293, mRNA
X07166 Human mRNA for enkephalinase (EC 3.4.24.11). M96684 H.
sapiens Pur (pur-alpha) mRNA, complete cds. AI204040 qe77f05.x1
Soares_fetal_lung_NbHL19W Homo sapiens cDNA clone AA577923
nl20a01.s1 NCI_CGAP_HSC1 Homo sapiens cDNA clone IMAGE: 1041192,
AA569633 nm38h09.s1 NCI_CGAP_Pr4.1 Homo sapiens cDNA clone IMAGE:
1062497, U65011 Human preferentially expressed antigen of melanoma
(PRAME) mRNA, U21910 Human basic transcription factor BTF2p44 mRNA,
3' end, partial cds. AA633187 nq07c12.s1 NCI_CGAP_Lu1 Homo sapiens
cDNA clone IMAGE: 1143190 3' AF000993 Homo sapiens ubiquitous TPR
motif, X isoform (UTX) mRNA, W76105 zd65b04.r1
Soares_fetal_heart_NbHH19W Homo sapiens cDNA clone H39906
yo54a07.r1 Soares breast 3NbHBst Homo sapiens cDNA clone AA971717
op95c11.s1 NCI_CGAP_Lu5 Homo sapiens cDNA clone IMAGE: 1584596 3',
M68891 Human GATA-binding protein (GATA2) mRNA, complete cds.
AA310157 EST181013 Jurkat T-cells V Homo sapiens cDNA 5' end, mRNA
sequence. X00948 Human mRNA for prepro-relaxin H2. AB018330 Homo
sapiens mRNA for KIAA0787 protein, partial cds. AA890637 ak11e11.s1
Soares_parathyroid_tumor_NbHPA Homo sapiens cDNA clone M64929 J05
Human protein phosphatase 2A alpha subunit mRNA, complete cds.
W24341 zb81h12.r1 Soares_senescent_fibroblasts_NbHSF Homo sapiens
cDNA AA974479 od58b03.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone
IMAGE: 1372109 3' R31644 yh69e05.r1 Soares placenta Nb2HP Homo
sapiens cDNA clone AA573246 nm52c02.s1 NCI_CGAP_Br2 Homo sapiens
cDNA clone IMAGE: 1071842 3', AA507635 ng84b02.s1 NCI_CGAP_Pr6 Homo
sapiens cDNA clone IMAGE: 941451, mRNA gb|AF008915 Homo sapiens
EVI5 homolog mRNA AL049987 Homo sapiens mRNA; cDNA DKFZp564F112
(from clone DKFZp564F112). U81599 homeodomain protein HOXB13 mRNA
AA641596 nr20f05.s1 NCI_CGAP_Pr2 Homo sapiens cDNA clone IMAGE:
1168545, mRNA D84295 Human mRNA for possible protein TPRDII R13859
yf65d08.r1 Soares infant brain 1NIB Homo sapiens cDNA clone M34840
Human prostatic acid phosphatase mRNA, complete cds. AA572913
nm42f12.s1 NCI_CGAP_Pr4.1 Homo sapiens cDNA clone IMAGE: 1062863,
AA094460 cp0378.seq.F Human fetal heart, Lambda ZAP Express Homo
sapiens AF031166 Homo sapiens SRp46 splicing factor retropseudogene
mRNA. AA625147 af70c07.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone
IMAGE: 1047372 T39510 ya06h07.r1 Stratagene placenta (#937225) Homo
sapiens cDNA clone R35034 yg60h03.r1 Soares infant brain 1NIB Homo
sapiens cDNA clone AI003674 zg01c04.s1 Soares_pineal_gland_N3HPG
Homo sapiens cDNA clone AJ003636 AJ003636 Selected chromosome 21
cDNA library Homo sapiens cDNA AA601385 no16d12.s1 NCI_CGAP_Phe1
Homo sapiens cDNA clone IMAGE: 1100855 3', AF191339 Homo sapiens
anaphase-promoting complex subunit 5 (APC5) AA431822 zw79d02.r1
Soares_testis_NHT Homo sapiens cDNA clone IMAGE: 782403 NM_003909
Homo sapiens copine III (CPNE3) AA484004 ne73f04.s1 NCI_CGAP_Ew1
Homo sapiens cDNA clone IMAGE: 909919 AA535774 nj78f08.s1
NCI_CGAP_Pr10 Homo sapiens cDNA clone IMAGE: 998631, mRNA
NM_000944.1 Homo sapiens protein phosphatase 3 (formerly 2B)
AA702811 zi90c11.s1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens
cDNA X95073 H. sapiens mRNA for translin associated protein X.
AA029039 zk12b07.s1 Soares_pregnant_uterus_NbHPU Homo sapiens cDNA
clone AF032887 Homo sapiens forkhead (FKHRL1P1) pseudogene N46609
yy48h08.r1 Soares_multiple_sclerosis_2NbHMSP Homo sapiens cDNA
U58855 Homo sapiens soluble guanylate cyclase large subunit
(GC-S-alpha-1) AA255486 zr83d03.s1 Soares_NhHMPu_S1 Homo sapiens
cDNA clone IMAGE: 682277 AA128153 zl15c06.s1
Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone AA016039
ze31c05.s1 Soares retina N2b4HR Homo sapiens cDNA clone R88520
ym91e09.s1 Soares adult brain N2b4HB55Y Homo sapiens cDNA clone
M26624 Human CALLA/NEP gene encoding neutral endopeptidase, exon
20. AA026997 ze99e01.r1 Soares_fetal_heart_NbHH19W Homo sapiens
cDNA clone W48775 zc44b08.r1 Soares_senescent_fibroblasts_NbHSF
Homo sapiens cDNA AA074407 zm15c08.r1 Stratagene pancreas (#937208)
Homo sapiens cDNA clone L13972 Homo sapiens beta-galactoside
alpha-2,3-sialyltransferase (SIAT4A) D14661 Human mRNA for KIAA0105
gene, complete cds. AA115452 zk89a08.r1
Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone AA495742
zw04b12.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE: 768287
5' R13416 yf75h09.r1 Soares infant brain 1NIB Homo sapiens cDNA
clone AA046369 zk77h07.r1 Soares_pregnant_uterus_NbHPU Homo sapiens
cDNA clone T35440 EST85129 Human Lung Homo sapiens cDNA 5' end
similar to None, mRNA AI075860 oz25b05.x1
Soares_total_fetus_Nb2HF8_9w Homo sapiens cDNA clone W56437
zc57g05.r1 Soares_parathyroid_tumor_NbHPA Homo sapiens cDNA clone
AI583880 tt70b02.x1 NCI_CGAP_HSC3 Homo sapiens cDNA clone IMAGE:
2246091 3', D85181 Homo sapiens mRNA for fungal
sterol-C5-desaturase homolog, complete AF105714 Homo sapiens
protein kinase PITSLRE (CDC2L2) gene, exon 3. AA401802 zt60c12.r1
Soares_testis_NHT Homo sapiens cDNA clone IMAGE: 726742 AB002301
Human mRNA for KIAA0303 gene, partial cds. U75667 Human arginase II
mRNA, complete cds. AA585183 JTH089 HTCDL1 Homo sapiens cDNA 5'/3',
mRNA sequence. AF191771 Homo sapiens CED-6 protein (CED-6) mRNA
AA650252 ns93g05.s1 NCI_CGAP_Pr3 Homo sapiens cDNA clone IMAGE:
1191224, mRNA R64618 yi19b09.r1 Soares placenta Nb2HP Homo sapiens
cDNA clone N24627 yx89a09.s1 Soares melanocyte 2NbHM Homo sapiens
cDNA clone AB028951 Homo sapiens mRNA for KIAA1028 protein N75608
yw37a07.r1 Morton Fetal Cochlea Homo sapiens cDNA clone N53899
yy98e03.r1 Soares_multiple_sclerosis_2NbHMSP Homo sapiens cDNA
N46696 yy50f07.r1 Soares_multiple_sclerosis_2NbHMSP Homo sapiens
cDNA AA419522 zv03d05.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone
IMAGE: 752553 M61906 Human P13-kinase associated p85 mRNA sequence.
C16570 C16570 Clontech human aorta polyA + mRNA (#6572) Homo
sapiens cDNA X63105 H. sapiens tpr mRNA. AA315855 EST187656 Colon
carcinoma (HCC) cell line II Homo sapiens cDNA 5' L18920 Human
MAGE-2 gene exons 1-4, complete cds. M25161 Human Na, K-ATPase beta
subunit (ATP1B) gene AA164865 zq41g07.r1 Stratagene hNT neuron
(#937233) Homo sapiens cDNA clone N40094 yx98g07.r1 Soares
melanocyte 2NbHM Homo sapiens cDNA clone N98940 yy71a07.r1
Soares_multiple_sclerosis_2NbHMSP Homo sapiens cDNA AF049907 Homo
sapiens zinc finger transcription factor (ZNF-X) mRNA, M78806
EST00954 Hippocampus, Stratagene (cat. #936205) Homo sapiens cDNA
AA040819 zk47b03.r1 Soares_pregnant_uterus_NbHPU Homo sapiens cDNA
clone C15445 C15445 Clontech human aorta polyA + mRNA (#6572) Homo
sapiens cDNA AB018309 Homo sapiens mRNA for KIAA0766 protein,
complete cds. AJ011497 Homo sapiens mRNA for Claudin-7. X00949
Human mRNA for prepro-relaxin H1. AA418633 zv93d09.r1
Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE: 767345 5' AI146806
qb83h04.x1 Soares_fetal_heart_NbHH19W Homo sapiens cDNA clone
X82942 H. sapiens satellite 3 DNA. AA456383 aa14f03.r1
Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE: 813245 AA019341
ze57e04.s1 Soares retina N2b4HR Homo sapiens cDNA clone AB027466
Homo sapiens SPON2 mRNA for spondin 2 AF038170 Homo sapiens clone
23817 mRNA sequence. NM_000240 Homo sapiens monoamine oxidase A
(MAOA) N34126 yx76c01.r1 Soares melanocyte 2NbHM Homo sapiens cDNA
clone N41339 yw68g06.r1 Soares_placenta_8to9weeks_2NbHP8to9W Homo
sapiens cDNA R34783 yh87b05.r1 Soares placenta Nb2HP Homo sapiens
cDNA clone N75858 yw32a03.r1 Morton Fetal Cochlea Homo sapiens cDNA
clone AA633887 ac32h04.s1 Stratagene hNT neuron (#937233) Homo
sapiens cDNA clone N53723 yz06d03.r1
Soares_multiple_sclerosis_2NbHMSP Homo sapiens cDNA AI187365
qf29b12.x1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE: 1751423
Genes in bold type are known prostate-specific genes.
[0231] TABLE-US-00008 TABLE 5 Genes/ESTs as Defined by
Publications: Including Androgen Signaling, Prostate Specificity,
Prostate Cancer Association, and Nuclear Receptors/Regulators with
Potential Interaction with Androgen Receptor Cluster ID Gene Name
Description References Hs.81988 DOC-2 deliion of ovarian
Up-regulated by Androgen Ablation Endocrinology, carcinoma 2
139,3542,98 Hs.155389 RAR a Up-regulated by Androgen Ablation
endocrinology, 138,553,97 Hs.12601 AS3 DNA binding protein
Up-regulated by Androgen Ablation J Steroid Biochem Mol Biol
68,41,99 Hs.181426 EST Up-regulated by Androgen Ablation Hs.2391
apical protein Up-regulated by Androgen Ablation Hs.109530 KGF/FGF7
keratinocyte growth factor Up-regulated by Androgen BBRC
220,858,96, Can Res, 54,5474,94 Hs.1104 TGF beta 1 Up-regulated by
Androgen Endocrinology, 137,99,96, Endocrinology, 139,378,98
Hs.75525 Calreticulin Calreticulin Up-regulated by Androgen Can Res
59,1896,99 Hs.78888 DBI/ACBP Diazepam-binding Up-regulated by
Androgen JBC, 237,19938,98 inhibitor/acyl-CoA binding Protein
Hs.41569 Phosphatidic acid Up-regulated by Androgen JBC,
273,4660,98 phosphatase type 2a isozyme Hs.83190 Fatty acid
synthase Up-regulated by Androgen Can Res, 57,1086,97 Hs.99915
Androgen Receptor Up-regulated by Androgen Steroids 9,531,96
Hs.2387 prostate-restricted Up-regulated by Androgen Biochem J
315,901,96 transglutaminase Hs.78996 PCNA proliferating cell
Up-regulated by Androgen Can Res 56,1539,96 nuclear antigen
Hs.74456 GAPDH Up-regulated by Androgen Can Res 55,4234,95 Hs.82004
E cadherin Up-regulated by Androgen BBRC, 212,624,95 Hs.57710 AIGF
Androgen-induced Up-regulated by Androgen FEBS lett 363,226,95
growth factor Hs.118618 MIC2 humanpseudoautosom Up-regulated by
Androgen Mol Carcinog, al gene? 23,13,98 Hs.18420 Talin
cytoskeletal protein Up-regulated by Androgen FEBS lett 434,66,98
Hs.54502 clathrin heavy chain Up-regulated by Androgen
Endocrinology, 139,2111,98 Hs.73919 clathrin light chain b
Up-regulated by Androgen Endocrinology, 139,2111,98 Hs.76506
L-plastin ESTs, Moderately Up-regulated by Androgen Am J Pathol,
150, similar to L- 2009,97 PLASTIN [H. sapiens] Hs.82173 EGR alpha
TGFB inducible early Up-regulated by Androgen Mol Endocrinol,
growth response 9,1610,95 ND FGF10 Up-regulated by Androgen JBC,
274,12827,99 Hs.107169 IGFBP5 Up-regulated by Androgen
Endocrinology, 140,2372,99 Hs.179665 p21 Up-regulated by Androgen
Mol Endocrinol, 13,376,99 Hs.51117 BMP-7 Up-regulated by Androgen
Prostate, 37,236,98 Hs.73793 VEGF vascular endothelial Up-regulated
by Androgen Endocrinol, 139,4672,98, growth factor BBRC, 251,287,98
Hs.166 SREBPs sterol regulatory Up-regulated by Androgen J Steroid
Biochem Mol element binding Biol, 65,191,98 transcription factor1
Hs.116577 PDF prostate Up-regulated by Androgen JBC, 273,13760,98
differentiation factor Hs.1905 prolactin Prolactin Up-regulated by
Androgen FEBS J, 11,1297,97 Hs.19192 CDK2 Up-regulated by Androgen
Can Res, 57,4511,97 Hs.95577 CDK4 cyclin-dependent Up-regulated by
Androgen Can Res, 57,4511,97 kinase 4 Hs.183596 UGT2B17 uridine
Up-regulated by Androgen Endocrinology, diphosphoglucronosyl
138,2998,97 transferase Hs.150207 UGT2B15 UDP- Up-regulated by
Androgen Can Res 57,4075,97 glucronosyltransferase 2B15 ND prostate
binding protein Up-regulated by Androgen PNAS, 94,12999,97 C2A
(RAT) ND Probasin (RAT) Up-regulated by Androgen PNAS, 94,12999,97
Hs.7719 prostatein C3 (RAT) Up-regulated by Androgen PNAS,
94,12999,97 ND Cystatin related protein 1 Up-regulated by Androgen
PNAS, 94,12999,97 (RAT) ND Cystatin related protein 2 Up-regulated
by Androgen PNAS, 94,12999,97 (RAT) Hs.394 Adrenomedulin (RAT)
Up-regulated by Androgen PNAS, 94,12999,97 Hs.77393 farnesyl
diphosphate Up-regulated by Androgen PNAS, 94,12999,97 synthase
(farnesyl pyrophosphate synthetase, dimethylallyltranstransferase)
Hs.153468 LDL receptor (Rat) Up-regulated by Androgen PNAS,
94,12999,97 N.D. Hysto-blood group A Up-regulated by Androgen PNAS,
94,12999,97 transferase (RAT) Hs.196604 Sex limited protein
Up-regulated by Androgen PNAS, 94,12999,97 (RAT) slp ND prostatic
spermine Up-regulated by Androgen Mol Cell Endocrinol, binding
protein(RAT) 108, R1, 95 Hs.76353 Protein C Inhibitor Up-regulated
by Androgen FEBS lett, 492,263,98 Hs.203602 enolase alpha
Up-regulated by Androgen Can Res, 58,5718,98 Hs.169476 tubulin
alpha Up-regulated by Androgen Can Res, 58,5718,98 Hs.184572 Cdk1
Up-regulated by Androgen Can Res, 58,5718,98 Hs.107528 EST EST
similar to Up-regulated by Androgen androgen-regulated protein
FAR-17 Hs.28309 UDP-glucose Up-regulated by Androgen Endocrinology,
dehydrogenase 140,10,4486,(99) Hs.194270 secretory component
Up-regulated by Androgen Mol endocrinol, gene 13,9,1558,(99)
Hs.76136 Thioredoxin Up-regulated by Androgen J steroid Biochem Mol
Biol, 68, 5-6, 203, (99) Hs.3561 p27 Kip1 cyclin-dependent
Up-regulated by Androgen Mol kinase inhibitor 1B Endocrinol,
12,941,98 (p27, Kip1) Hs.1867 progastricsin Up-regulated by
Androgen J.B.C. 271,15175,(99) (pepsinogen C) Hs.97411 hamster
Androgen- Up-regulated by Androgen Genebank dependent Expressed
Protein like protein gene Hs.155140 Protein kinase CK2 casein
kinase 2, alpha Translocated by Androgen Can Res 59,1146,99 1
polypeptide IMAGE: 953262 DD3 Prostate Specific Eur Urol, 35,408,99
Hs.218366 Prostase Prostate Specific PNAS, 96,3114,99 Hs.20166 PSCA
prostate stem cell Prostate Specific PNAS, 95,1735,98 antigen
Hs.171995 PSA kallikrein 3, (prostate Prostate Specific PNAS,
95,300,98, specific antigen) DNA Cell Biol, 16,627,97 Hs.183752
PSSPP prostate-secreted Prostate Specific PNAS, 95,300,98 seminal
plasma protein, nc50a10, microsemnoprotein beta, PSP94 Hs.1852 PAP
prostatic acid Prostate Specific PNAS, 95,300,98 phosphatase
Hs.52871 SYT Prostate Specific PNAS, 95,300,98 Hs.158309 Homeobox
HOX D13 Prostate Specific PNAS, 95,300,98 Hs.1968 Semenogelin 1
Prostate Specific PNAS, 95,300,98 Hs.76240 Adenylate kinase
adenylate kinase 1 Prostate Specific PNAS, 95,300,98 isoenzyme1
Hs.184376 SNAP23 Prostate Specific PNAS, 95,300,98 Hs.82186 ERBB-3
receptor Prostate Specific PNAS, 95,300,98 protein-tyrosin kinase
Hs.180016 Semenogelin 2 Prostate Specific Hs.1915 PSMA folate
hydrolase Prostate Specific (prostate-specific membrane antigen) 1
Hs.181350 KLK2 Prostate Specific Hs.73189 NKX3.1 Prostate Specific
HPARJ1 Prostate Specific IMAGE: 565779 Hs.76053 p68 RNA helicase
Potential interaction with AR MCB, 19,5363,(99) Hs.111323 ARIP3
Potential interaction with AR JBC, 274,3700,99 Hs.25511 ARA54
Potential interaction with AR JBC274,8319,99 Hs.28719 ARA55
Potential interaction with AR JBC, 274,8570,99 HS. 999908 ARA70
Potential interaction with AR PNAS, 93,5517,96 Hs.29131 TIF2
transcriptional Potential interaction with AR EMBO, 15,3667,96,
intermediary factor 2 EMBO, 17,507,98 Hs.66394 SNURF ring finger
protein 4 Potential interaction with AR MCB, 18,5128,98 Hs.75770 RB
retinoblastoma 1 Potential interaction with AR (including
osteosarcoma) Hs.74002 SRC-1 steroid receptor Potential interaction
with AR coactivator 1 Hs.155017 RIP140 nuclear receptor Potential
interaction with AR EMBO, 14,3741,95, interacting protein 1 Mol
Endocrinol, 12,864,98 Hs.23598 CBP CREB binding Potential
interaction with AR protein (Rubinstein- Taybi syndrome) Hs.25272
p300 E1A binding protein Potential interaction with AR p300
Hs.78465 c-JUN Potential interaction with AR Hs.199041 ACTR AIB1,
mouse Potential interaction with AR M.C.B, 17,2735,97, GRIP1, pCIP
PNAS, 93,4948,96 Hs.6364 TIP60 Human tat interactive Potential
interaction with AR JBC, 274,17599,99 protein mRNA, complete cds
Hs.32587 SRA Potential interaction with AR Cell, 97,17,99 Hs.155302
PCAF Potential interaction with AR Hs.10842 ARA24 Potential
interaction with AR Hs.41714 BAG-IL Potential interaction with AR
JBC, 237,11660,98 Hs.82646 dnaJ, HSP40 DNAJ PROTEIN Potential
interaction with AR HOMOLOG 1 Hs.43697 ERM ets variant gene 5
Potential interaction with AR JBC, 271,23907,96 (ets-related
molecule) Hs.75772 GR Potential interaction with AR JBC,
272,14087,97 Hs.77152 MCM7 Potential interaction with AR ND NJ
Potential interaction with AR ND RAF Potential interaction with AR
JBC, 269,20622,94 ND TFIIF Potential interaction with AR PNAS,
94,8485,97 Hs.90093 hsp70 Potential interaction with AR Hs.206650
hsp90 Potential interaction with AR Hs.848 hsp56(FKBP52, Potential
interaction with AR FKBP59, HBI)) Hs.143482 Cyp40(cyclophilin40)
Potential interaction with AR p23 Potential interaction with AR
Hs.84285 ubiquitin-conjugating Potential Interaction with AR J.B.C.
274,19441(99) enzyme Hs.182237 POU domain, class 2, Potential
interaction with AR transcr Hs.1101 POU domain, class 2, Potential
interaction with AR transcr Hs.2815 POU domain, class 6, Potential
interaction with AR transcr IMAGE: 1419981 Potential interaction
with AR Hs.227639 ARA160 Potential interaction with AR JBC,
274,22373(99) Hs.83623 CAR-beta Xist locus Nuclear receptor gene
family Hs.2905 PR Nuclear receptor gene family Hs.1790 MR
mineralocorticoid Nuclear receptor gene family receptor
(aldosterone receptor) Hs.1657 ER alpha Nuclear receptor gene
family Hs.103504 ER beta Nuclear receptor gene family Hs.110849
ERR1 Nuclear receptor gene family Hs.194667 ERR2 Nuclear receptor
gene family Hs.724 TR a thyroid hormone Nuclear receptor gene
family receptor, alpha (avian erythroblastic leukemia viral (v-erb-
a) oncogene homolog) Hs.121503 TR b Nuclear receptor gene family
Hs.171495 RAR b retinoic acid receptor, Nuclear receptor gene
family beta Hs.1497 RAR g retinoic acid receptor, Nuclear receptor
gene family
gamma Hs.998 PPAR a Nuclear receptor gene family Hs.106415 PPAR b
Human peroxisome Nuclear receptor gene family proliferator
activated receptor mRNA, complete cds Hs.100724 PPAR g peroxisome
Nuclear receptor gene family proliferative activated receptor,
gamma Hs.100221 LXR b Nuclear receptor gene family Hs.81336 LXR a
liver X receptor, Nuclear receptor gene family alpha Hs.171683 FXR
farnesoid X-activated Nuclear receptor gene family receptor Hs.2062
VDR vitamin D (1,25- Nuclear receptor gene family dihydroxyvitamin
D3) receptor Hs.118138 PXR Nuclear receptor gene family ND SXR
Nuclear receptor gene family ND BXR Nuclear receptor gene family ND
CAR b? CAR a Nuclear receptor gene family Hs.196601 RXRA Nuclear
receptor gene family Hs.79372 RXRB Human retinoid X Nuclear
receptor gene family receptor beta (RXR- beta) mRNA, complete cds
Hs.194730?TR1? EAR1 Nuclear receptor gene family Hs.204704 EAR1
beta Nuclear receptor gene family E75 Nuclear receptor gene family
Hs.2156 ROR alpha Nuclear receptor gene family Hs.198481 ROR beta
Nuclear receptor gene family Hs.133314 ROR gammma Nuclear receptor
gene family Hs.100221 NER1 Nuclear receptor gene family Hs.54424
HNF4A Nuclear receptor gene family Hs.202659 HNF4G Nuclear receptor
gene family Hs.108301 TR2 Nuclear receptor gene family Hs.520 TR4
Nuclear receptor gene family Hs.144630 COUP-TF1 Nuclear receptor
gene family Hs.1255 COUP-TF2 Nuclear receptor gene family Hs.155286
EAR2 Nuclear receptor gene family Hs.1119 TR3 hormone receptor
Nuclear receptor gene family (growth factor- inducible nuclear
protein N10) Hs.82120 NURR1 IMMEDIATE- Nuclear receptor gene family
EARLY RESPONSE PROTEIN NOT Hs.97196 SF1 Nuclear receptor gene
family Hs.183123 FTF fetoprotein-alpha 1 Nuclear receptor gene
family (AFP) transcription factor Hs.46433 DAX1 Nuclear receptor
gene family Hs.11930 SHP Homo sapiens nuclear Nuclear receptor gene
family hormone receptor (shp) gene, 3' end of cds Hs.83623,
CAR-beta Nuclear receptor gene family IMAGE 1761923, or 1868028, or
1563505, or 1654096 Hs.199078 Sin3 Nuclear receptor co-repressor
complex Nature, 387,43,97, Nature, 387,49,97 Hs.120980 SMRT Nuclear
receptor co-repressor complex Nature, 377,454,95 Hs.144904 N-CoR
Nuclear receptor co-repressor complex Nature, 377,297,95 Hs.188055
highly homologue gene Nuclear receptor co-repressor complex to
N-CoR in prostate and testis Hs.180686 E6-AP Angelman syndrome
Nuclear receptor co-activator complex MCB, 19,1182,99 associated
protein Hs.199211?Hs. hBRM ESTs, Highly similar Nuclear receptor
co-activator complex 198296? to HOMEOTIC GENE REGULATOR [Drosophila
melanogaster] Hs.78202 hBRG1 Nuclear receptor co-activator complex
Hs.11861 TRAP240 DRIP250, ARCp250 Nuclear receptor co-activator
complex Mol Cell, 3,361,99 Hs.85313 TRAP230 ARCp240, DRIP240
Nuclear receptor co-activator complex Mol Cell, 3,361,99 Hs.15589
TRAP220 RB18A, PBP, Nuclear receptor co-activator complex CRSP200,
TRIP2, ARCp205, DRIP205 Hs.21586 TRAP170 RGR, CRSP150, Nuclear
receptor co-activator complex DRIP150, ARCp150 chromosomeX
Hs.108319 TRAP150 ESTs Nuclear receptor co-activator complex Mol
Cell, 3,361,99 Hs.193017 CRSP133 ARCp130, DRIP130 Nuclear receptor
co-activator complex Nature, 397,6718,99 Hs.23106 TRAP100 ARCp100,
DRIP100, Nuclear receptor co-activator complex ND DRIP97 TRAP97
Nuclear receptor co-activator complex Hs.24441 TRAP95 ESTs Nuclear
receptor co-activator complex Mol Cell, 3,361,99 ND TRAP93 Nuclear
receptor co-activator complex Hs.31659 DRIP92 ARCp92? Nuclear
receptor co-activator complex Hs.22630 TRAP80 ARCp77, Nuclear
receptor co-activator complex Mol Cell, 3,361,99 CRSP77,
DRIP80(77)? Hs.204045 ARCp70 CRSP70, DRIP70 Nuclear receptor
co-activator complex ND ARCp42 Nuclear receptor co-activator
complex ND ARCp36 Nuclear receptor co-activator complex Hs.184947
MED6 ARCp33 Nuclear receptor co-activator complex Mol Cell, 3,97,99
Hs.7558 MED7 CRSP33, ARCp34, Nuclear receptor co-activator complex
Nature, 397,6718,99 DRIP36 ND ARCp32 Nuclear receptor co-activator
complex ND SRB10 Nuclear receptor co-activator complex ND SRB11
Nuclear receptor co-activator complex ND MED10 NUT2 Nuclear
receptor co-activator complex Hs.27289 SOH1 (yeast?) Nuclear
receptor co-activator complex Mol Cell, 3,97,99 ND p26 Nuclear
receptor co-activator complex ND p28 Nuclear receptor co-activator
complex ND p36 Nuclear receptor co-activator complex ND p37 Nuclear
receptor co-activator complex ND but 2 TRFP human homologue of
Nuclear receptor co-activator complex IMAGE clones Drosophila TRF
proximal protein ND VDR interacting subunit 180 kDa, HAT Nuclear
receptor co-activator complex Genes Dev, 12,1787,98 activity
Hs.143696, or Coactivator associated Nuclear receptor co-activator
complex Science, 284,2174,99 IMAGE: 23716 methyltransferase 1 96?
Hs.79387 SUG1 TRIP1 Nuclear receptor co-activator complex EMBO,
15,110,96 ND TRUP Nuclear receptor co-activator complex PNAS,
92,9525,95 Hs.28166 CRSP34 Nuclear receptor co-activator complex
Nature, 397,6718,99 Hs.63667 transcriptional adaptor 3 Nuclear
receptor co-activator complex (A Hs.196725 ESTs, Highly similar to
Nuclear receptor co-activator complex P300 Hs.131846 PCAF
associated factor Nuclear receptor co-activator complex 65 al
Hs.155635 ESTs, Moderately Nuclear receptor co-activator complex
similar to PCAF associated factor 65 beta Hs.26782 PCAF associated
factor Nuclear receptor co-activator complex 65 beta Hs.118910
tumor suscitibility Modifying AR function Cancer 15,86,689, protein
101 (99) Hs.82932 Cyclin D1 cyclin D1 (PRADI: Modifying AR function
Can Res, 59,2297,99 parathyroid adenomatosis 1) Hs.173664 HER2/Neu
v-erb-b2 avian Modifying AR function PNAS, 9,5458,99 erythroblastic
leukemia viral oncogene homolog 2 Hs.77271 PKA protein kinase,
Modifying AR function JBC 274,7777,99 cAMP-dependent, catalytic,
alpha Hs.85112 IGF1 insulin-like growth Modifying AR function Can
Res, 54,5474,94 factor 1 (somatomedin C) Hs.2230 EGF Modifying AR
function Can Res, 54,5474,94 Hs.129841 MEKK1 MAPKKK1 Modifying AR
function Mol Cell Biol, 19,5143,99 Hs.83173 Cyclin D3 Modifying AR
function Can Res, 59,2297,99 Hs.75963 IGF2 Modifying AR function
Hs.89832 Insulin Modifying AR function Hs.115352 GH Modifying AR
function Hs.1989 5 alpha reductase type2 Involved in Androgen
metabolism Hs.76205 Cytochrome P450, Involved in Androgen
metabolism subfamily XIA Hs.1363 Cytochrome P450, Involved in
Androgen metabolism subfamily XVII, (steroid 17-alpha-hydroxylase),
Hs.477 Hydroxysteroid (17- Involved in Androgen metabolism beta)
dehydrogenase 3 Hs.75441 Hydroxysteroid (17- Involved in Androgen
metabolism beta) dehydrogenase 4 Hs.38586 Hydroxy-delta-5-steroid
Involved in Androgen metabolism dehydrogenase, 3 beta- and steroid
delta- isomerase 1 Hs.46319 Sex hormone-binding Involved in
Androgen metabolism globulin Hs.552 SRD5A1 Involved in Androgen
metabolism Hs.50964 C-CAM epithelial cell Down-regulated by
Androgen Oncogene, 18,3252,99 adhesion molecule Hs.7833 hSP56
selenium binding Down-regulated by Androgen Can Res, 58,3150,98
protein Hs.77432 EGFR epidermal growth Down-regulated by Androgen
Endocrinology, factor receptor 139,1369,98 Hs.1174 p16
Down-regulated by Androgen Can Res, 57,4511,97 Hs.55279 maspin
Down-regulated by Androgen PNAS, 94,5673,97 Hs.75789 TDD5 (mouse)
Human mRNA for Down-regulated by Androgen PNAS, 94,4988,97 RTP,
complete cds Hs.75106 TRPM-2 clusterin ( Down-regulated by Androgen
testosterone-repressed prostate message 2, apolipoprotein J)
Hs.25640 rat ventral prostate gene 1 claudin3 Down-regulated by
Androgen PNAS, 94,12999,97 ND glutathione S-transferase
Down-regulated by Androgen PNAS, 94,12999,97 Hs.25647 c-fos v-fos
FBJ murine Down-regulated by Androgen PNAS, 94,12999,97
osteosarcoma viral oncogene homolog N.D. matrix carboxyglutamic
Down-regulated by Androgen PNAS, 94,12999,97 acid protein (RAT)
Hs.2962 S100P calcium binding Down-regulated by Androgen Prostate
29,350,96 prottein Hs.75212 ornithine decarboxilase ornithine
Down-regulated by Androgen J Androl, 19,127,98 decarboxylase 1
Hs.84359 Androge withdrawal Down-regulated by Androgen apoptosis
RVP1 Hs.79070 c-myc v-myc avian Down-regulated by Androgen
myelocytomatosis viral oncogene homolog Hs.139033 partially
expressed gene 3 Down-regulated by Androgen Mol Cell Endocrinol
155,69,(99) Hs.20318 PLU-1 Associated with Prostate Cancer JBC,
274,15633.99 Hs.18910 POV1(PB39) unique Associated with Prostate
Cancer Genomics, 51,282,98 Hs.119333 caveolin Associated with
Prostate Cancer Clin Can Res, 4, 1873,98 ND, but 1 EST R00540(2.6
kbp) = 1M Associated with Prostate Cancer Urology, 50,302,97 IMAGE
AGE: 123822 CLONE Hs.184906 PTI-1 prostate tumor Associated with
Prostate Cancer Can Res, 57,18,97, inducing gene, PNAS, 92,6778,95
trancated and mutated human elongation factor 1 alpha Hs.74649
cytochrome c oxidase Associated with Prostate Cancer Can Res,
56,3634,96 subunit VI c Hs.4082 PCTA-1 prostate carcinoma
Associated with Prostate Cancer PNAS, 92,7252,96 tumor antigen,
galectin family
ND pp32r1 Associated with Prostate Cancer Nature Medicine, 5,275,99
ND pp32r2 Associated with Prostate Cancer Nature Medicine, 5,275,99
Hs.184945 GBX2 Associated with Prostate Cancer The prostate
journal, 1,61,99 Hs.8867 Cyr61 inmmediate early Associated with
Prostate Cancer Prostate, 36,85,98 protein Hs.77899 epithelial
tropomyosin actin binding protein Associated with Prostate Cancer
Can Res, 56,3634,96 Hs.76689 pp32 Associated with Prostate Cancer
Nature Medicine, 5,275,99 Hs.10712 PTEN Associated with Prostate
Cancer Hs.194110 KAI1 Associated with Prostate Cancer Hs.37003
H-ras Associated with Prostate Cancer Hs.184050 K-ras Associated
with Prostate Cancer Hs.69855 N-ras neuroblastoma RAS Associated
with Prostate Cancer viral (v-ras) oncogene homolog Hs.220 TGFbeta
receptor1 Associated with Prostate Cancer Hs.77326 IGFBP3
insulin-like growth Associated with Prostate Cancer factor binding
protein 3 Hs.79241 bcl-2 Associated with Prostate Cancer Hs.159428
Bax Associated with Prostate Cancer Hs.206511 bcl-x Associated with
Prostate Cancer Hs.86386 mcl-1 myeloid cell leukemia Associated
with Prostate Cancer sequence 1 (BCL2- related) Hs.1846 p53 tumor
protein p53 Associated with Prostate Cancer (Li-Fraumeni syndrome)
Hs.38481 CDK6 cyclin-dependent Associated with Prostate Cancer
kinase 6 Hs.118630 Mxi.1 Associated with Prostate Cancer Hs.184794
GAGE7 Associated with Prostate Cancer Hs.118162 fibronectin
Associated with Prostate Cancer Am J Pathol 154,1335,99 Hs.128231
PAGE-1 Associated with Prostate Cancer JBC, 237,17618,98 Hs.75875
UEV1 ubiquitin-conjugating Associated with Prostate Cancer Am J
Pathol enzyme E2 variant 1 154,1335,99 Hs.75663 PM5 Human mRNA for
Associated with Prostate Cancer Am J Pathol pM5 protein 154,1335,99
Hs.180842 BBC1 breast basic Associated with Prostate Cancer Am J
Pathol conserved gene 154,1335,99 Hs.198024 JC19 Associated with
Prostate Cancer Can Res 57,4075,97 N.D. GC79 novel gene Associated
with Prostate Cancer Can Res 57,4075,97 Hs.77054 B cell
translocation gene 1 Associated with Prostate Cancer Can Res
57,4075,97 Hs.78122 Regulatory factor X- Associated with Prostate
Cancer associated ankyrin- containing protein Hs.3337 transmembranc
4 Associated with Prostate Cancer superfamily member1 Hs.76698 TL5
Associated with Prostate Cancer Genebank Hs.3776 TL7 Associated
with Prostate Cancer Genebank Hs.170311 TL35 Associated with
Prostate Cancer Genebank Hs.184914 Human mRNA for T1- Associated
with Prostate Cancer 227H Hs.62954 ferritin, heavy Associated with
Prostate Cancer polypeptide Hs.71119 N33 Associated with Prostate
Cancer Genomics, 35,45(96)
[0232] TABLE-US-00009 TABLE 6 Genes/ESTs as defined by
publications: Differentially expresed genes in prostate cancer from
CGAP database (NIH) Cluster.ID Gene name Hs.179809 EST Hs.193841
EST Hs.99949 prolactin-induced protein Hs.101307 EST Hs.111256
arachidonate 15-lipoxygenase Hs.185831 EST Hs.115173 EST Hs.193988
EST Hs.159335 EST Hs.191495 EST Hs.187694 EST Hs.191848 EST
Hs.193835 EST Hs.191851 EST Hs.178512 EST Hs.222886 EST Hs.210752
EST Hs.222737 EST Hs.105775 EST Hs.115129 EST Hs.115671 EST
Hs.116506 EST Hs.178507 EST Hs.187619 EST Hs.200527 EST Hs.179736
EST Hs.140362 EST Hs.209643 EST Hs.695559 EST Hs.92323 MAT8
Hs.178391 BTK Hs.55999 EST Hs.171185 Desmin Hs.54431 SGP28
Hs.182624 EST Hs.112259 T cell receptor gammma Hs.76437 EST
Hs.104215 EST Hs.75950 MLCK Hs.154103 LIM Hs.9542 JM27 Hs.153179
FABP5 Hs.195850 EST Hs.105807 EST Hs.115089 EST Hs.116467 EST
Hs.222883 EST
[0233] TABLE-US-00010 TABLE 7 Androgen regulated Genes Defined by
CPDR Genes/ESTs Derived from CPDR-Genome Systems ARG Database
Cluster Gene Name Description Hs.152204 TMPRSS2 Up-regulated by
Androgen Hs.123107 KLK1 Up-regulated by Androgen Hs.173334
elongation factor ell2 Up-regulated by Androgen Hs.151602
epithelial V-like antigen Up-regulated by Androgen Hs.173231 IGFRI
Up-regulated by Androgen Hs.75746 aldehyde dehydrogenase 6
Up-regulated by Androgen Hs.97708 EST prostate and testis
Up-regulated by Androgen Hs.94376 proprotein convertase
subtilisin/kexin type 5 Up-regulated by Androgen AF017635 Homo
sapiens Ste-20 related kinase SPAK mRNA, complete cds {Incyte PD:
Up-regulated by Androgen 60737} Hs.2798 leukemia inhibitory factor
receptor Up-regulated by Androgen Hs.572 orosomucoid 1 Up-regulated
by Androgen Hs.35804 KIAA0032 gene product Up-regulated by Androgen
Hs.114924 solute carrier family 16 (monocarboxylic acid
transporters), member 6 Up-regulated by Androgen Hs.37096 zinc
finger protein 145 (Kruppel-like, expressed in promyelocytic
leukemia) Up-regulated by Androgen R07295 sterol O-acyltransferase
(acyl-Coenzyme A: cholesterol acyltransferase) 1 Up-regulated by
Androgen {Incyte PD: 2961248} Hs.11899
3-hydroxy-3-methylglutaryl-Coenzyme A reductase Up-regulated by
Androgen Hs.216958 Human mRNA for KIAA0194 gene, partial cds
Up-regulated by Androgen Hs.76901 for protein disulfide
isomerase-related Up-regulated by Androgen Hs.180628 dynamin-like
protein Up-regulated by Androgen Hs.81328 nuclear factor of kappa
light polypeptide gene enhancer in B-cells inhibitor, Up-regulated
by Androgen alpha Hs.159358 acetyl-Coenzyme A carboxylase alpha
Up-regulated by Androgen N24233 IMAGE: 262457 Up-regulated by
Androgen Hs.188429 EST Up-regulated by Androgen Hs.77508 glutamate
dehydrogenase 1 Up-regulated by Androgen Hs.12017 Homo sapiens
KIAA0439 mRNA Up-regulated by Androgen Hs.10494 EST Up-regulated by
Androgen Hs.20843 EST Up-regulated by Androgen Hs.153138 origin
recognition complex, subunit 5 (yeast homolog)-like Up-regulated by
Androgen Hs.79136 Human breast cancer, estrogen regulated LIV-1
protein (LIV-1) mRNA, partial Up-regulated by Androgen cds Hs.35750
anthracycline resistance-associated Up-regulated by Androgen
Hs.56729 lymphocyte-specific protein 1 Up-regulated by Androgen
Hs.17631 EST Up-regulated by Androgen Hs.46348 bradykinin receptor
B1 Up-regulated by Androgen Hs.172851 arginase, type II
Up-regulated by Androgen Hs.66744 twist (Drosophila) homolog
Up-regulated by Androgen Hs.185973 membrane fatty acid (lipid)
desaturase Up-regulated by Androgen Hs.26 ferrochelatase
(protoporphyria) Up-regulated by Androgen Hs.169341 ESTs, Weakly
similar to phosphatidic acid phosphohydrolase type-2c Up-regulated
by Androgen [H. sapiens] Hs.119007 S-phase response
(cyclin-related) Up-regulated by Androgen Hs.76285 H. sapiens gene
from PAC 295C6, similar to rat PO44 Up-regulated by Androgen
Hs.167531 Homo sapiens mRNA full length insert cDNA clone EUROIMAGE
195423 Up-regulated by Androgen Hs.9817 arg/Abl-interacting protein
ArgBP2 Up-regulated by Androgen Hs.28241 EST Down-regulated by
Androgen Hs.25925 Homo sapiens clone 23860 mRNA Down-regulated by
Androgen Hs.10319 UDP glycosyltransferase 2 family, polypeptide B7
Down-regulated by Androgen Hs.155995 Homo sapiens mRNA for KIAA0643
protein, partial cds Down-regulated by Androgen Hs.23552 EST
Down-regulated by Androgen Hs.41693 DnaJ-like heat shock protein 40
Down-regulated by Androgen Hs.90800 matrix metalloproteinase 16
(membrane-inserted) Down-regulated by Androgen Hs.2996
sucrase-isomaltase Down-regulated by Androgen Hs.166019 regulatory
factor X, 3 (influences HLA class II expression) Down-regulated by
Androgen Hs.27695 midline 1 (Opitz/BBB syndrome) Down-regulated by
Androgen Hs.183738 chondrocyte-derived ezrin-like protein
Down-regulated by Androgen Hs.75761 SFRS protein kinase 1
Down-regulated by Androgen Hs.197298 NS1-binding protein
Down-regulated by Androgen Hs.149436 kinesin family member 5B
Down-regulated by Androgen Hs.81875 growth factor receptor-bound
protein 10 Down-regulated by Androgen Hs.75844 ESTs, Weakly similar
to (defline not available 5257244) [H. sapiens] Down-regulated by
Androgen Hs.30464 cyclin E2 Down-regulated by Androgen Hs.198443
inositol 1,4,5-triphosphate receptor, type 1 Down-regulated by
Androgen Hs.177959 a disintegrin and metalloproteinase domain 2
(fertilin beta) Down-regulated by Androgen Hs.44197 Homo sapiens
mRNA; cDNA DKFZp564D0462 (from clone Down-regulated by Androgen
DKFZp564D0462) Hs.150423 cyclin-dependent kinase 9 (CDC2-related
kinase) Down-regulated by Androgen Hs.78776 Human putative
transmembrane protein (nma) mRNA, complete cds Down-regulated by
Androgen Hs.25740 ESTs, Weakly similar to !!!! ALU SUBFAMILY SQ
WARNING ENTRY !!!! Down-regulated by Androgen [H. sapiens]
Hs.131041 EST Down-regulated by Androgen Hs.19222 ecotropic viral
integration site 1 Down-regulated by Androgen Hs.9879 EST
Down-regulated by Androgen Hs.118722 fucosyltransferase 8 (alpha
(1,6) fucosyltransferase) Down-regulated by Androgen Hs.47584
potassium voltage-gated channel, delayed-rectifier, subfamily S,
member 3 Down-regulated by Androgen Hs.115945 mannosidase, beta A,
lysosomal Down-regulated by Androgen Hs.171740 ESTs, Weakly similar
to Zic2 protein [M. musculus] Down-regulated by Androgen Hs.32970
signaling lymphocytic activation molecule Down-regulated by
Androgen Hs.196349 EST Down-regulated by Androgen Hs.182982 Homo
sapiens mRNA for KIAA0855 protein, partial cds Down-regulated by
Androgen Hs.72918 small inducible cytokine A1 (I-309, homologous to
mouse Tca-3) Down-regulated by Androgen Hs.84232 transcobalamin II;
macrocytic anemia Down-regulated by Androgen Hs.10086 EST
Down-regulated by Androgen Hs.1327 Butyrylcholinesterase
Down-regulated by Androgen Hs.166684 serine/threonine kinase 3
(Ste20, yeast homolog) Down-regulated by Androgen AA558631 EST
Down-regulated by Androgen Hs.150403 dopa decarboxylase (aromatic
L-amino acid decarboxylase) Down-regulated by Androgen Hs.177548
postmeiotic segregation increased (S. cerevisiae) 2 Down-regulated
by Androgen
[0234] TABLE-US-00011 TABLE 8 Other Genes Associated with Cancers
Cluster Gene name Description Hs.146355 c-Abl v-abl Abelson murine
leukemia viral oncogene homolog 1 Hs.96055 E2F1 Hs.170027 MDM2
Hs.1608 RPA replication protein A3 (14 kD) Hs.99987 XPD ERCC2
Hs.77929 XPB ERCC3 Hs.1100 TBP TATA box binding protein Hs.60679
TAFII31 TATA box binding protein (TBP)-associated factor, RNA
polymerase II, G, 32 kD Hs.78865 TAFII70 Human TBP-associated
factor TAFII80 mRNA, complete cds Hs.178112 DP1 deleted in
poliposis Hs.119537 p62 Hs.48576 CSB excision repair
cross-complementing rodent repair deficiency, complementation group
5 Hs.73722 Ref-1 Hs.194143 BRCA1 breast cancer 1, early onset
Hs.184760 CBF Hs.1145 WT-1 Wilms tumor 1 Hs.2021 Sp1 Hs.144477 CK I
Hs.155627 DNA-PK Hs.170263 p53BP1 Human clone 53BP1 p53-binding
protein mRNA, partial cds Hs.44585 p53BP2 tumor protein p53-binding
protein, 2 Hs.6241 p85 alpha PI3 kinase Hs.23707 p85 beta PI3
kinase Hs.194382 ATM Hs.184948 BIN1 Hs.137569 p51B p63 Hs.1334 bmyb
v-myb avian myeloblastosis viral oncogene homolog Hs.81942 DNA
polymerase polymerase (DNA directed), alpha alpha Hs.180952 Beta
actin Hs.93913 IL-6 interleukin 6 (interferon, beta 2) Hs.190724
MAP4 microtubule-associated protein 4 Hs.1384 MGMT
o-6-methylguanine-DNA methyltransferase Hs.79572 Cathepsin D
cathepsin D (lysosomal aspartyl protease) Hs.111301 Collagenase IV
Hs.151738 Collagenase IV Hs.51233 DR5 Hs.82359 FAS Hs.80409 GADD45
DNA-damage-inducible transcript 1 Hs.86161 GML GPI-anchored
molecule like protein Hs.50649 PIG3 quinone oxidoreductase homolog
Hs.184081 Siah seven in absentia (Drosophila) homolog 1 Hs.56066
bFGF fibroblast growth factor 2 (basic) Hs.205902 IGF1-R Hs.21330
MDR1 P glycoprotein 1/multiple drug resistance 1 Hs.74427 PIG11
Homo sapiens Pig11 (PIG11) mRNA, complete cds Hs.76507 PIG7
LPS-induced TNF-alpha factor Hs.8141 PIG8 Hs.146688 PIG12 Hs.104925
PIG10 Hs.202673 PIG6 Hs.80642 STAT4 Hs.72988 STAT2 Hs.167503 STAT5A
Hs.738 early growth response 1 Hs.85148 villin2 Hs.109012 MAD
Hs.75251 DEAD/H box binding protein 1 Hs.181015 STAT6 Hs.199791
SSI-3 STAT induced STAT inhibitor 3 Hs.21486 STAT1 Hs.142258 STAT3
Hs.76578 PIAS3 Protein inhibitor of activated STAT3 Hs.44439 CIS4
STAT induced STAT inhibitor 4 Hs.50640 SSI-1 JAK binding protein
Hs.54483 NMI N-Myc and STAT interactor Hs.105779 PIASy Protein
inhibitor of activated STAT Hs.110776 STATI2 STAT induced STAT
inhibitor 2 Hs.181112 EST similar to STAT5A
[0235] TABLE-US-00012 TABLE 9 Functional Categories of ARGs Tag T/C
Access # Name, Description Transcription Regulators GCCAGCCCAG (SEQ
ID NO: 13) 11/1 H41030 KAP1/TIF1beta, KRAB-associated protein 1
GTGCAGGGAG (SEQ ID NO: 14) 18/2 AF071538 PDEF, ets transcription
factor GACAAACATT (SEQ ID NO: 15) 8/1 NM_003201 mtTF1,
mitochondrial transcription factor 1 ATGACTCAAG (SEQ ID NO: 16) 8/1
X12794 ear-2, v-erbA related GAAAAGAAGG (SEQ ID NO: 17) 8/1 U80669
Nkx3.1, homeobox CCTGTACCCC (SEQ ID NO: 18) 5/1 AF072836 Sox-like
transcriptional factor CCTGAACTGG (SEQ ID NO: 19) 1/8 NM_001273
CHD4/Mi2-beta, histone acetylase/deacetylase, chromodomain helicase
TGACAGCCCA (SEQ ID NO: 20) 1/7 U81599 Hox B13, homeobox RNA
Processing and Translational Regulators TACAAAACCA (SEQ ID NO: 21)
12/1 NM_005381 NCL, Nucleolin AATTCTCCTA (SEQ ID NO: 22) 8/1 U41387
GURDB, nucleolar RNA helicase TGCATATCAT (SEQ ID NO: 23) 8/1 D89729
XPO1, exportin 1 CTTGACACAC (SEQ ID NO: 24) 14/2 AL080102 EIF5,
translation initiation factor 5 TGTCTAACTA (SEQ ID NO: 25) 5/1
AF078865 CGI-79, RNA-binding protein GTGGACCCCA (SEQ ID NO: 26)
10/2 AF190744 SiahBP1/PUF60, poly-U binding splicing factor
ATAAAGTAAC (SEQ ID NO: 27) 1/11 NM_007178 UNRIP, unr-interacting
protein. TACATTTTCA (SEQ ID NO: 28) 1/7 X85373 SNRPG, small nuclear
RNP polypeptide G TCAGAACAGT (SEQ ID NO: 29) 1/7 NM_002092 GRSF-1,
G-rich RNA binding factor 1 CAACTTCAAC (SEQ ID NO: 30) 0/5
NM_006451 PAIP1, poly A BP-interacting protein 1 GATAGGTCGG (SEQ ID
NO: 31) 0/5 Z11559 IREBP1, Iron-responsive element BP 1 CTAAAAGGAG
(SEQ ID NO: 32) 2/10 M15919 SNRPE, small nuclear RNP polypeptide E
Genomic Maintenance and Cell Cycle Regulation GTGGTGCGTG (SEQ ID
NO: 33) 10/1 AF035587 XRCC2, X-ray repair protein 2 TCCCCGTGGC (SEQ
ID NO: 34) 7/1 D13643 KIAA0018, Dimunuto-like ATTGATCTTG (SEQ ID
NO: 35) 6/1 NM_002947 RPA3, Replication protein A 14kDa subunit
AGCTGGTTTC (SEQ ID NO: 36) 16/3 NM_004879 PIG8, p53 induced protein
CCTCCCCCGT (SEQ ID NO: 37) 10/2 AF044773 BAF,
barrier-to-autointegration factor ATGTACTCTG (SEQ ID NO: 38) 1/7
NM_000884 IMPDH2, IMP dehydrogenase 2 GATCAAATAC (SEQ ID NO: 39)
0/5 NM_006325 ARA24, androgen receptor assoc protein 24 GTGCATCCCG
(SEQ ID NO: 40) 0/5 X16312 Phosvitin/casein kinase II beta subunit
Protein Trafficking and Chaperoning GAAATTAGGG (SEQ ID NO: 41) 12/1
AB020637 KIAA0830, similar to golgi antigen TTTCTAGGGG (SEQ ID NO:
42) 10/1 AF15189 CGI-140, lysosomal alpha B mannosidase CCCAGGGAGA
(SEQ ID NO: 43) 7/1 AF026291 CCT, chaperonin t-complex polypeptide
1 GTGGCGCACA (SEQ ID NO: 44) 13/2 S79862 26 S protease subunit 5b
TTGCTTTTGT (SEQ ID NO: 45) 15/3 NM_001660 ARF4, ADP-ribosylation
factor 4 ATGTCCTTTC (SEQ ID NO: 46) 10/2 NM_005570 LMAN1, mannose
BP involved in EPR/Golgi traffic Energy Metabolism, Apoptosis and
Redox Regulators TGTTTATCCT (SEQ ID NO: 47) 13/2 M14200 DBI,
diazepam binding inhibitor GCTTTGTATC (SEQ ID NO: 48) 6/1 D16373
dihydrolipoamide succinyltransferase GTTCCAGTGA (SEQ ID NO: 49) 6/1
AA653318 FKBP5, FK506-binding protein 5 TAGCAGAGGC (SEQ ID NO: 50)
6/1 AA425929 NDUFB10, NADH dehydrogenase 1 beta subcomplex 10
ACAAATTATG (SEQ ID NO: 51) 5/1 NM_003375 VDAC, voltage-dependent
anion channel CAGTTTGTAC (SEQ ID NO: 52) 5/1 NM_000284 PDHA1,
Pyruvate dehydrogenase E1-alpha subunit GATTACTTGC (SEQ ID NO: 53)
5/1 NM_004813 PEX16, peroxisomal membrane biogenesis factor
GGCCAGCCCT (SEQ ID NO: 54) 5/1 X15573 PFKL, 1-phosphofructokinase
CAATTGTAAA (SEQ ID NO: 55) 1/10 NM_004786 TXNL, thioredoxin-like
protein AAAGCCAAGA (SEQ ID NO: 56) 2/15 NM_001985 ETFB, electron
transfer flavoprotein beta subunit CAACTAATTC (SEQ ID NO: 57) 1/7
NM_001831 CLU, Clustrin AAGAGCTAAT (SEQ ID NO: 58) 0/5 NM_004446
EPRS, glutamyl-prolyl-tRNA synthetase Signal Transduction
CTTTTCAAGA (SEQ ID NO: 59) 9/1 X59408 CD46, complement system
membrane cofactor GTGTGTAAAA (SEQ ID NO: 60) 9/1 NM_005745
BAP31/BAP29 IgD accessory proteins ACAAAATGTA (SEQ ID NO: 61) 8/1
NM_000856 GUCY1A3, Guanylate cyclase 1, alpha 3 AAGGTAGCAG (SEQ ID
NO: 62) 7/1 NM_006367 CAP, Adenylyl cyclase-associated protein
GGCGGGGCCA (SEQ ID NO: 63) 7/1 AB002301 microtubule assoc.
serine/threonine kinase GGCCAGTAAC (SEQ ID NO: 64) 6/1 AL096857
similar to BAT2, integrin receptor AACTTAAGAG (SEQ ID NO: 65) 12/2
AB018330 calmodulin-dependent protein kinase kinase .beta.
AGGGATGGCC (SEQ ID NO: 66) 5/1 NM_006858 IL1RL1LG, Putative T1/ST2
receptor CTTAAGGATT (SEQ ID NO: 67) 2/10 AF151813 CGI-55
protein
[0236] The "tag to gene" identification is based on the analysis
performed by SAGE software and/or "tag to gene" application of the
NIH SAGE Website. T/C represent the number of tags for each
transcript in androgen treated (T) and control (C) LNCaP libraries.
The differences in expression levels of genes identified by tags
shown here were statistically significant (p<0.05) as determined
by the SAGE software.
REFERENCES
[0237] 1. Landis S H, Murray T, Bolden S, and Wingo P A: Cancer
statistics. CA Cancer J. Clin., 49:8-31, 1999. [0238] 2. Pannek J
and Partin A W: Prostate-specific Antigen: What is new in 1977.
Oncology 11, 1273-1282, 1997. [0239] 3. Small E J: Update on the
diagnosis and treatment of prostate cancer: Curr. Opin. Oncol.,
10:244-252, 1998. [0240] 4. Krongrad A, Lai H, and Lai S: Survival
after radical prostatectomy. JAMA, 278:44-46, 1997. [0241] 5.
Garwick, M B and Fair W R: Prostate Cancer, Scientific American,
75-83, 1998. [0242] 6. Augustus M, Moul J W, and Srivastava S: The
molecular phenotype of the malignant prostate. Molecular pathology
of early cancer (in press), 1999. [0243] 7. Sakr W A, Macoska J A,
Benson P, Benson D J, Wolman S R, Pontes J E, and Crissman: Allelic
loss in locally metastatic, multi-sampled prostate cancer. Cancer
Res., 54:3273-3277, 1994. [0244] 8. Mirchandani D, Zheng J, Miller
G L, Ghosh A K, Shibata D K, Cote R J and Roy-Burman P:
Heterogeneity in intratumor distribution of p53 mutations in human
prostate cancer. Am. J. Path. 147:92-101, 1995. [0245] 9. Bauer J
J, Moul J W, and McLeod D G: CaP: Diagnosis, treatment, and
experience at one tertiary medical center, 1989-1994. Military
Medicine, 161:646-653,1996. [0246] 10. Moul J W, Gaddipati J, and
Srivastava S: 1994. Molecular biology of CaP. Oncogenes and tumor
suppressor genes. Current Clinical Oncology: CaP. (Eds. Dawson, N.
A. and Vogelzang, N. J.), Wiley-Liss Publications, 19-46. [0247]
11. Lalani E-N, Laniado M E and Abel P D: Molecular and cellular
biology of prostate cancer. Cancer and Mets. Rev., 16:29-66, 1997.
[0248] 12. Shi X B, Gumerlock P H, deVere White R W: Molecular
Biology of CaP. World J. Urol; 14, 318-328, 1996. [0249] 13.
Heidenberg H B, Bauer J J, McLeod D G, Moul J W and Srivastava S:
The role of p53 tumor suppressor gene in CaP: a possible biomarker?
Urology, 48:971-979, 1996. [0250] 14. Bova G S and Issacs W B:
Review of allelic loss and gain in prostate cancer. World J Urol.,
14:338-346, 1996. [0251] 15. Issacs W B and Bova G S: Prostate
Cancer: The Genetic Basis of Human Cancer. Eds. Vogelstein B, and
Kinzler K W, McGraw-Hill Companies, Inc., pp. 653-660, 1998. [0252]
16. Heidenberg H B, Sesterhenn I A, Gaddipati J, Weghorst C M,
Buzard G S, Moul J W, and Srivastava S: Alterations of the tumor
suppressor gene p53 in a high fraction of treatment resistant
prostate cancer. J. Urol., 154:414-421, 1995. [0253] 17. Bauer J J,
Sesterhenn I A, Mostofi F K, McLeod D G, Srivastava S, Moul J W:
p53 protein expression is an independent prognostic marker in
clinically localized prostate cancer patients. Clin. Cancer Res.,
1:1295-1300, 1995. [0254] 18. Bauer J J, Sesterhenn I A, Mostofi F
K, McLeod D G, Srivastava S, Moul, J W: Elevated levels of
apoptosis regulator proteins p53 and bcl-2 are independent
prognostic biomarkers in surgically treated clinically localized
prostate cancer patients. J. Urol., 1511-1516,1996. [0255] 19. Yang
G, Stapleton A M, Wheeler T M, Truong L D, Timme T O, Scardino T P,
and Thompson T O: Clustered p53 immunostaining. A novel pattern
associated with prostate cancer progression. Clin. Cancer Res.,
2:399-401, 1996. [0256] 20. Cairns P, Okami K, Halachmi S, Halachmi
N, Esteller M, Herman J G, Jen J, Isaacs W B, Bova G S, and
Sidransky D: Frequent inactivation of PTEN/MMAC1 in primary
prostate cancer. Cancer Res, 57:4997-5000, 1997. [0257] 21. Suzuki
H, Freije D, Nusskern D R, Okami K, Cairns P, Sidransky D, Isaacs W
B, and Bova G S: Interfocal heterogeneity of PTEN/MMAC 1 gene
alterations in multiple metastatic prostate cancer tissues: Cancer
Res, 58:204-209, 1998. [0258] 22. Jenkins R B, Qian J, Lieber M M
and Bostwick D G: Detection of c-myc oncogene amplification and
chromosomal abnormalities in metastatic prostatic carcinoma by
fluorescence in situ hybridization. Cancer Res, 57:524-531, 1997.
[0259] 23. Reiter R E, Gu Z, Watabe T., Thomas G, Szigeti K, Davis
E, Wahl M, Nisitani S, Yamashiro I, LeBeau M M, Loda M and Witte O
N: Prostate stem cell antigen: a cell surface marker overexpressed
in prostate cancer. Proc Natl Acad Sci, 95:1735-40, 1998. [0260]
24. Visakorpi T, Kallioniemi A H, Syvanen A, Hyytinen E R, Karhu R,
Tammela T, Isola J J and Kallioniemi O--P: Genetic changes in
primary and recurrent prostate cancer. Cancer Res, 55:342-347,
1995. [0261] 25. Cher M L, Bova G S, Moore D H, Small E J, Carroll
P A, Pinn S S, Epstein J L, Isaacs W B and Jensen R H: Genetic
alterations in untreated metastases and androgen-independent
prostate cancer detected by comparative genomic hybridization and
allotyping. Cancer Res, 56:3091-3102, 1996. [0262] 26. Srikantan V,
Sesterhenn I A, David L, Hankins G R, Avallone F A, Livezey J R,
Connelly R, Mostofi F K, McLeod D G, Moul J W, Chandrasekharappa, S
C, and Srivastava S: Chromosome 6q alterations in human prostate
cancers. Int J Cancer (in press), 1999. [0263] 27. Smith J R,
Freije D, Carpten J D, Gronberg H, et al: Major susceptibility
locus for prostate cancer on chromosome 1 suggested by a
genome-wide search. Science, 276:1371-1374, 1996. [0264] 28. Xu J,
Meyers D, Freije D, Issacs S, et al: Evidence for a prostate cancer
susceptibility locus on x chromosome. Nat. Genet, 20: 175-179,
1998. [0265] 29. Liang, Peng, and Pardee A B: Differential display
of eukaryotic messenger RNA by means of the polymerase chain
reaction. Science 257:967-971, 1992. [0266] 30. Velculescu V E,
Zhang L, Vogelstein B, and Kinzler K W: Serial analysis of gene
expression Science, 270:484-487, 1995. [0267] 31. Chena M, Shalon D
S, Davis R W, and Brown P O: Quantitative monitoring of gene
expression patterns with a complementary DNA microarrays. Science,
270:467-470, 1995. [0268] 32. Srikantan V., Zou Z, Davis L D,
Livezey J, Sesterhenn I A, Xu L, Mostofi F K, McLeod D G, Moul J W,
and Srivastava S: Structure and expression of a novel prostate
specific gene PCGEM1. American Assoc. Cancer Res. Meeting,
Philadelphia, Pa., 1999. [0269] 33. Xu, L, Su Y, Labiche R, McLeod
D G, Moul J W and Srivastava S: Probing the androgen regulated
genes (ARGs) in prostate cancer cells by serial analysis of gene
expression (SAGE). American Assoc. of Cancer Research Meeting,
1999. [0270] 34. Huggins, C., Hodges, C. V. Studies on prostate
cancer, effects of castration, of estrogens and androgen injection
on serum phosphatase in metastatic carcinoma of the prostate.
Cancer Res, 1:293-297,1941. [0271] 35. Moul J W: Contemporary
hormonal management of advanced prostate cancer. Oncology, 12:
499-505, 1998. [0272] 36. Veldscholte, J, Ris-Stalpers C, Kulper G
GJM, Jenster G, Berre-voets C, Classen E, Van Roooj H C J, Trapman
J, Brinkmann A O, Mulder E. A mutation in the ligand binding domain
of the androgen receptor of human LNCaP cells affects steroid
binding characteristics and response to anti-androgens. Biochem.
Biophys. Res. Commun., 173:534-540, 1990. [0273] 37. Newmark J R,
Hardy 0, Tonb D C, Carter B S, Epstein J I, Isaacs W B, Brown T R,
Barrack E R. Androgen receptor gene mutations in human prostate
cancer. Proc Natl Acad Sci USA, 89:6319-6323, 1992. [0274] 38.
Culig Z, Hobisch A, Cronauer M V, Cato A C B, Hittmair A, Radmayr
C, Eberie J, Bartsch G, Klocker H. Mutant androgen receptor
detected in an advanced stage prostatic carcinoma is activated by
adrenal androgens and progesterone. Mol. Endocrinol, 7:1541-1550,
1993. [0275] 39. Suzuki H, Sato N, Watabe Y, Masai M, Seino S,
Shimazaki S. Androgen receptor gene mutations in human prostate
cancer. J Steroid Biochem Mol Biol, 46:759-765, 1993. [0276] 40.
Gaddipatti J P, McLeod D G, heidenberg H B, Sesterhann I A, Finger
M J, Moul J W, Srivastava S. Frequent detection of codon 877
mutation in the androgen receptor gene in advanced prostate
cancers. Cancer Res, 54:2861-2864.1994. [0277] 41. Peterziel H,
Culig Z, Stober J, Hobisch A, Radmayr C, Bartsch G, Klocker, Cato A
C B. Mutant androgen receptors in prostate cancer distinguish
between amino acid sequence requirements for transactivation and
ligand binding. Int J Cancer, 63:544-550, 1995. [0278] 42. Taplin
M-E, Bubley G J, Shuster T D, Frantz M E, Spooner A E, Ogata G K,
Keer H N, Balk S P. Mutation of the androgen receptor gene in
metastatic androgen independent prostate cancer. N Engl J Med,
332:1393-1398. [0279] 43. Tilley W D, Buchanan G, Hickey T E,
Bental J M. Mutation in the androgen receptor gene are associated
with progression of human prostate cancer to androgen independence.
Clin Cancer Res, 2: 277-285,1994. [0280] 44. Visakorpi T, Hyytinen
E, Koivisto P, tanner M, Keinanen R, Palmberg C, Tammela T, Isola
J, Kallioniemi O P. In vivo amplification of the androgen receptor
gene and progression of human prostate cancer. Nature Genet,
9:401-406, 1995. [0281] 45. Koivisto P, Kononen J, Palmberg C,
Tammela T, Hyytinen E, Isola J, Trapman J, Cleutjens K, Noordzij A,
Visakorpi T, Kallioniemi O P. Androgen receptor gene amplification:
a possible molecular mechanism for androgen deprivation therapy
failure in prostate cancer. Cancer Res, 57:314-318, 1997. [0282]
46. Culig Z, Hobisch A, Cronauer M V, Radmayr C, Trapman J,
Hittmair A, Bartsch G, Klocker H. Androgen receptor activation in
prostate tumor cell lines by insulin-like growth factor-1,
keratinocyte growth factor, and epidermal growth factor. Cancer
Res, 54:5474-5478, 1994. [0283] 47. Yeh S, Chang C. Cloning and
characterization of a specific coactivator, ARA70, for the androgen
recptor in human prostate cells. Proc Natl Acad Sci USA,
93:5517-5521,1996. [0284] 48. Nagabhushan M, Miller C M, Pretlow T
P, Giaconia J M, Edgehouse N L, Schwartz S, Kung H-J, deVere White
R W, Gumerlock P H, Resnick M I, Amini S B, Pretlow T G. CWR22: The
first human prostate cancer Xenograft with strongly
androgen-independent and relapsed strains both in vivo and in soft
agar. Cancer Res, 56:3402-4306, 1996. [0285] 49. Gregory C W, Hamil
K G, Kim D, Hatt S H, Pretlow T G, Mohler J L, French F S. Androgen
receptor expression in androgen independent cancer is associated
with increased expression of androgen regulated genes. Cancer Res,
58:5718-5724,1998. [0286] 50. Noble R L: The development of
prostatic adenocarcinoma in Nb rats following prolonged sex hormone
administration. Cancer Res, 37:1929-1933,1977. [0287] 51. Pollard
M: Lobund-Wistar rat model of prostate cancer in man. Prostate,
37:1-4, 1998. [0288] 52. Pollard M, Luckert P H, and Snyder D L:
The promotional effect of testosterone on induction of prostate
cancer in MNU-sensitized L-W rats. Cancer Lett, 45:209-212, 1989.
[0289] 53. Gann P H, Hennekens C H, Ma J, Longcope C, Stampfer M J:
Prospective study of sex hormone levels and risk of prostate cancer
J Natl Cancer Inst, 88:1118-1126,1996. [0290] 54. Hakimi J M,
Schoenberg M P, Rondinelli R H, Piantadosi S, Barrack E R. Androgen
receptor variants with short glutamine or glycine repeats may
identify unique subpopulations of men with prostate cancer. Clin
Cancer Res, 9:1599-1608, 1997. [0291] 55. Giovanucci E, Stampfer M
J, Krithivas K, Brown M, Brafsky A, Talcott J, Hennekens C H,
Kantoff P W. The CAG repeat within the androgen receptor gene and
its relationship to prostate cancer. Proc Natl Acad Sci USA,
94:3420-3423,1997. [0292] 56. Coetzee G A, Ross R K. Prostate
cancer and the androgen receptor. J. Natl Cancer Inst, 86:872-873,
1994. [0293] 57. Moul J W. Increased risk of prostate cancer in
African men. Mol. Urol, 1:119-127,1997. [0294] 58. Chamberlain N L,
Driver E D, Miesfeld R L. The length and location of CAG
trinucleotide repeats in the androgen receptor N-terminal domain
affect transactivation function. Nucleic Acids Res, 22:3181-3186,
1994. [0295] 59. Trapman J, Cleutzens KBJM. Androgen regulated gene
expression in prostate cancer. Seminars in Canc Biol, 8:29-36,1997.
[0296] 60. Yuan S, Trachtenberg J, Mills G B, Brown T J, and
Keating A: Androgen-induced inhibition of cell proliferation in an
androgen-insensitive prostate cancer cell line (PC3) transfected
with human androgen receptor complementary DNA. Cancer Res,
53:1304-1311, 1993. [0297] 61. Velculescu V E, Zhang L, Vogelstein
B, and Kinzler K W: Serial Analysis of Gene Expression. Science,
270, 484-487, 1995 [0298] 62. Polyak K, Yong X, Zweier J L, Kinzler
K W, and Vogelstein B: A model for p53 induced apoptosis. Nature,
389, 300-306, 1997. [0299] 63. Hermeking H, Lengauer C, Polyak C,
He T-C, Zhang L, Thiagalingam S, Kinzler KW, and Vogelstein B:
14-3-3 is a p53-regulated inhibitor of G2/M progression. Molecular
Cell, 1: 3-11, 1997. [0300] 64. He T-C, Sparks A B, Rago C,
Hermeking H, Zawel L, da Costa L T, Morin P J, Vogelstein B, and
Kinzler K W: Identification of c-myc as a target of the APC
pathway. Science, 281;1438-1441, 1998. [0301] 65. Bieberich, C. J.,
Fujita, K., He, W. W., and Jay, G.: Prostate-specific and
androgen-dependent expression of a novel homeobox gene. J Biol
Chem, 271: 31779-31782, 1996. [0302] 66. Sciavolino, P. J., Abrams,
E. W., Yang, L., Austenberg, L. P., Shen, M. M., and Abate-Shen,
C.: Tissue-specific expression of murine Nkx3.1 in the male
urogenital sinus. Dev Dyn, 209: 127-138, 1997. [0303] 67. He, W.
W., Sciavolino, P. J., Wing, J., Augustus, M., Hudson, P.,
Meissner, S. P., Curtis, R. T., Shell, B. K., Bostwick, D. G.,
Tindall, D. J., Gelmann, E. P., Abate-Shen, C., and Carter, K. C.:
A novel human prostate-specific androgen-regulated homeobox gene
(NKX3.1) that maps to 8p21, a region frequently deleted in prostate
cancer. Genomics, 43: 69-77, 1997. [0304] 68. Prescott J. L., Blok
L., and Tindall D. J.: Isolation and androgen regulation of the
human homeobox cDNA, NKX3.1. The Prostate, 35: 71-80, 1998. [0305]
69. Xu L, Srikantan V, Sesterhenn I A, Augustus M, Sui D, Moul J W,
Carter KC and Srivastava S: Evaluation of expression of androgen
regulated prostate specific homeobox gene, NKX3.1 in human prostate
cancer. Int. Symp. on Biol. of Prostate Growth, Bethesda, 176,
1998; Manuscript submitted to J Urol, 1999. [0306] 70. Voeller, H.
J, Augustus, M, Madike, V., Bova, G. S., Carter, K. C., and
Gelmann, E. P.: Coding region of NKX3.1, a prostate-specific
homeobox gene on 8p21, is not mutated in human prostate cancers.
Cancer Res, 57: 4455-4459, 1997. [0307] 71. Song, K., Wang, Y., and
Sassoon, D.: Expression of Hox-7.1 in myoblasts inhibits terminal
differentiation and induces cell transformation. Nature, 360:
477-481, 1992. [0308] 72. Maulbecker, C. C., and Gruss, P.: The
oncogenic potential of deregulated homeobox genes. Cell Growth
Differ, 4: 431-441,1993. [0309] 73. Krosl, J., Baban, S., Krosl,
G., Rozenfeld, S., Largman, C., and Sauvageau, G.: Cellular
proliferation and transformation induced by HOXB4 and HOXB3
proteins involves cooperation with PBX1. Oncogene, 16: 3403-3412,
1998. [0310] 74. Kaighn M E, Reddel R R, Lechner J F, Peehl D M,
Camalier R F, Brash D E, Saffioti U, and Harris C C: Transformation
of human neonatal prostate epithelial cells strontium phosphate
transfection with plasmid containing SV40 early region genes.
Cancer Res, 49: 3050-3056,1989.
[0311] 75. Kuettel M R, Thraves P J, Jung M, Varghese S P, Prasad S
C, Rhim J S, and Dritschilo A: Radiation-induced neoplastic
transformation of human prostate epithelial cells. Cancer Res,
56:5-10,1996. [0312] 76. Srivastava S, Wheelock RHP, Eva A, and
Aaronson S A: Identification of the protein encoded by novel human
diffuse B cell lymphoma oncogene. Proc Natl Acad Sci, USA,
83:8868-8872, 1986. [0313] 77. Graziani G, Ron D, Eva A, and
Srivastava: The human dbl proto-oncogene product is a cytoplasmic
phosphoprotein which is associated with cytoskeletal matrix.
Oncogene, 4:823-829, 1989. [0314] 78. Srivastava S, Zou Z, Pirollo
K, Blattner W, and Chang E S: Germ-line transmission of a mutated
p53 gene in a cancer-prone family with Li-Fraumeni syndrome.
Nature, 348:747-749, 1990. [0315] 79. Srivastava, S., Wang, S.,
Tong, Y. A., Hao, Z. M. and Chang, E. H.: Dominant negative effect
of a germ-line mutant p53: a step fostering tumorigenesis. Cancer
Res, 53:4452, 1993. [0316] 80. Gaddipati J P, Mcleod D G,
Sesterhenn I A, Hussussian C J, Tong Y A, Seth P, Dracopoli N C,
Moul J M, and Srivastava, S: Mutations of p16 gene are rare in
prostate cancer. Prostate, 30:188-194, 1997. [0317] 81. Bonner R F,
Emmert-Buck M, Cole K, Pohida T, Chuaqi R, Goldstein S, and Liotta
L A: Laser capture microdissection: molecular analysis of tissue.
Science, 278:1481-1483, 1997. [0318] Bastian, B. C., Le Boit, P.
E., Hamm, H., Brocker, E. B., and Pinkel, D. (1998). Chromosomal
gains and losses in primary cutaneous melanomas detected by
comparative genomic hybridization. Cancer Res. 58: 2170-2175.
[0319] Bentel, J. M., Tilley, W. D. (1996). Androgen receptors in
prostate cancer. J Endocrinology 151: 1-11. [0320] Brothman, A. R.,
Peehl, D. M., Patel, A. M., and McNeal, J. E. (1990). Frequency and
pattern of karyotypic abnormalities in human prostate cancer.
Cancer Res. 50: 3795-3803. [0321] Cuthill, S. (1999). Dominant
genetic alterations in immortalization: Role for 20q gain. Genes
Chromosomes Cancer 26: 304-311. [0322] Gregory, C. W., Hamil, K.
G., Kim, D., Hall, S. H., Pretlow, T. G., Mohler, J. L., and
French, F. S. (1998). Androgen receptor expression in
androgen-independent prostate cancer is associated with increased
expression of androgen-regulated genes. Cancer Res. 58: 5718-5724.
[0323] Jarrard, D. F., Sarkar, S., Shi, T., Teager, T. R., Magrane,
G., Kinoshita, H., Nassif, N., Meisner, L., Newton, M. A., and
Waldman, F. M. (1999). p16/pRb pathway alterations are required for
bypassing senescence in human prostate epithelial cells. Cancer
Res. 59: 2957-2964. [0324] Jenster G. (1999). The role of the
androgen receptor in the development and progression of prostate
cancer. Semin. Oncol. 26: 407-421. [0325] Koivisto, P., Kolmer, M.,
Visakorpi, T., and Kallioniemi O. P. (1996). Androgen receptor gene
and hormonal therapy failure of prostate cancer. Am. J. Pathol.
152: 1-9. [0326] Korn, W. M., Yasutake, T., Kuo, W. L., Warren, R.
S., Collins, C., Tomita, M., Gray, J., and Waldman, F. M. (1999).
Chromosome arm 20q gains and other genomic alterations in
colorectal cancer metastatic to liver, as analyzed by comparative
genomic hybridization and fluorescence in situ hybridization. Genes
Chromosomes Cancer. 25: 82-90. [0327] Lin, B., Ferguson, C., White,
J. T., Wang, S., Vessella, R., True, L. D., Hood, L., and Nelson,
P. (1999). Prostate-localized and androgen-regulated expression of
the membrane-bound serine protease TMPRSS2. Cancer Res. 59:
4180-4184. [0328] Mahlamaki, E. H., Hoglund, M., Gorunova, L.,
Karhu, R., Dawiskiba, S., AndrenSandberg, A., Kallioniemi, P. P.,
and Johansson, B. (1997). Comparative genomic hybridization reveals
frequent gains of 20q, 8q, 11q, 12p, and 17q, and losses of 18q,
9p, and 15q in pancreatic cancer. Genes Chromosomes Cancer. 24:
383-391. [0329] Moul J. W. (1998). Contemporary hormonal management
of advanced prostate cancer. Oncology, 12: 499-505. [0330]
Nagabhushan, M., Miller, C. M., Pretlow, T. P., Ciacomia, J. M.,
Edgehouse, N. L., Schwarts, S., Kung, H., White, R. W., Gumerlock,
P. H., Resnick, M. I., Amini, S. B., and Pretlow, T. G. (1996).
CWR22: the first human prostate cancer xenograft with strongly
androgen-dependent and relapsed strains both in vivo and in soft
agar. Cancer Res. 56: 3042-3046. [0331] Richter, J., Beffa, L.,
Wagner, U., Schraml, P., Gasser, T. C., Moch, H., Mihatsch, M. J.,
and Sauter, G. (1998). Patterns of chromosomal imbalances in
advanced urinary bladder cancer detected by comparative genomic
hybridization. Am. J. Pathol. 153: 1615-1621. [0332] Stubbs, A. P.,
Abel, P. D., Golding, M., Bhangal, G., Wang, Q., Waxman, J., Stamp,
G. W., and Lalani, E. N. (1999). Differentially expressed genes in
hormone refractory prostate cancer: association with chromosomal
regions involved with genetic aberrations. Am. J. Pathol. 154:
1335-1343. [0333] Tanner, M. M., Tirkkonen, M., Kallioniemi, A.,
Isola, J., Kuukasjarvi, T., Collins, C., Kowbel, D., Guan, X. Y.,
Trent, J., and Gray, J. W. (1996). Independent amplification and
frequent co-amplification of three nonsyntenic regions on the long
arm of chromosome 20 in human breast cancer. Cancer Res. 56:
3441-3445. [0334] Zhang, L., Zhou, W., Velculescu, V. E., Kern, S.
E., Hruban, R. H., Hamilton, S. R., Vogelstein, B., And Kinzler, K.
W. (1997). Gene expression profiles in normal and cancer cells.
Science, 276: 1268-1272. [0335] Douarin, B. L., You, J., Nielsen,
A. L., Chambon, P., and Losson, R., Tif1.alpha.: a possible link
between KRAB zinc finger proteins and nuclear receptors. J. Steroid
Biochem. Molec. Biol., 65, 43-50 (1998). [0336] Xu, L., Su, Y.,
Labiche, R., Mcleod, D. G., Moul, J. W., and Srivastava, S.,
Quantitative Evaluation of the Expression Profile of the Androgen
Regulated Genes (ARGs) in Prostate Cancer Cells. AACR annual
meeting (1999). [0337] Xu, L., Glass, C. K., and Rosenfeld, M. G.,
Coactivator and corepressor complexes in nuclear receptor function.
Curr. Opin. Genet. Dev., 9, 140-147 (1999). [0338] Miyajima, N.,
Kadowaki, Y., Fukushige, S., Shimizu, S., Semba, K., Yamanashi, Y.,
Matsubara, K., Toyoshima, K., and Yamamoto, T., Identification of
two novel members of erbA superfamily by molecular cloning: the
gene products of the two are highly related to each other. Nucleic
Acids Res., 16, 11057-11074 (1998). [0339] Sreenath, T., Orosz, A.,
Fujita, K., and Bieberich, C. J., Androgen-independent expression
of hoxb-13 in the mouse prostate. Prostate, 41, 203-207 (1999).
[0340] Patel, M. S., and Harris, R. A., Mammalian alpha-keto acid
dehydrogenase complexes: gene regulation and genetic defects. FASEB
J., 9, 1164-1172 (1995). [0341] Ho, L., Wexler, I. D., Liu, T. C.,
Thekkumkara, T. J., and Patel, M. S., Characterization of cDNAs
encoding human pyruvate dehydrogenase alpha subunit. Proc. Nat.
Acad. Sci., 86, 5330-5334 (1989). [0342] Ton, C., Hwang, D. M.,
Dempsey, A. A., and Liew, C. C., Identification and primary
structure of five human NADH-ubiquinone oxidoreductase subunits.
Biochem. Biophys. Res. Commun., 241, 589-594 (1997). [0343]
Blachly-Dyson, E., Baldini, A., Litt, M., Mccabe, E. R. B., and
Forte, M., Human genes encoding the voltage-dependent anion channel
(VDAC) of the outer mitochondrial membrane: mapping and
identification of two new isoforms. Genomics, 20, 62-67 (1994).
[0344] Swinnen, J. V., Vercaeren, I., Esquenet, M., Heyns, W., and
Verhoeven, G., Androgen regulation of the messenger RNA encoding
diazepam-binding inhibitor/acyl-CoA-binding protein in the rat.
Mol. Cell Endocrinol., 118, 65-70 (1996). [0345] Knudsen, J.,
Mandrup, S., Rasmussen, J. T., Andreasen, P. H., Poulsen, F., and
Kristiansen, K., The function of acyl-CoA-binding protein
(ACBP)/diazepam binding inhibitor (DBI). Mol. Cell Biochem., 123,
129-138 (1993). [0346] Miranda-Vizuete, A., Gustafsson, J. A., and
Spyrou, G., Molecular cloning and expression of a cDNA encoding a
human thioredoxin-like protein. Biochem. Biophys. Res. Commun.,
243, 284-288 (1998). [0347] Cartwright, R., Tambini, C. E.,
Simpson, P. J., and Thacker, J., The XRCC2 DNA repair gene from
human and mouse encodes a novel member of the recA/RAD51 family.
Nucleic Acids Res., 26, 3084-3089 (1998). [0348] Umbricht, C. B.,
Erdile, L. F., Jabs, E. W., and Kelly, T. J., Cloning,
overexpression, and genomic mapping of the 14-kDa subunit of human
replication protein A. J. Biol. Chem., 268, 6131-6138 (1993).
[0349] Gu, Z., Flemington, C., Chittenden, T., and Zambetti, G. P.,
ei24, a p53 response gene involved in growth suppression and
apoptosis. Mol. Cell. Biol., 20, 233-241 (2000). [0350] Srivastava,
M., and Pollard, H. B., Molecular dissection of nucleolin's role in
growth and cell proliferation: new insights. FASEB J., 13,
1911-1922 (1999). [0351] Page-Mccaw, P. S., Amonlirdviman, K., and
Sharp, P. A., Puf60: A U2AF65 homolog that binds the pyrimidine
tract. RNA, 5, 1548-1560 (1999). [0352] Qian, Z., and Wilusz, J.,
Grsf-1: a poly (A)+ mRNA binding protein which interacts with a
conserved G-rich element. Nucleic Acids Res., 22, 2334-2343 (1994).
[0353] Craig, A. W., Haghighat, A., Yu, A. T., and Sonenberg, N.,
Interaction of polyadenylate-binding protein with the eIF4G
homologue PAIP enhances translation. Nature, 392, 520-523 (1998).
[0354] Hunt, S. L., Hsuan, J. J., Totty, N., and Jackson, R. J.,
unr, a cellular cytoplasmic RNAbinding protein with five cold-shock
domains, is required for internal initiation of translation of
human rhinovirus RNA. Genes Dev., 13, 437-448 (1999). [0355]
Velculescu, V. E., Zhang, L., Zhou, W., Vogelstein, J., Basrai, M.
A., Bassett, D. E. Jr., Hieter, P., Vogelstein, B., and Kinzler, K.
W., Characterization of the yeast transcriptome. Cell, 88, 243-251
(1997). [0356] Polyak, K., Xia, Y., Zweier, J. L., Kinzler, K. W.,
and Vogelstein, B., A model for p53-induced apoptosis. Nature, 389,
300-305 (1997). [0357] Hermeking, H., Lengauer, C., Polyak, K., He,
T. C., Zhang, L., Thiagalingam, S., Kinzler, K. W., and Vogelstein,
B. 14-3-3-.sigma. is a p53-regulated inhibitor of G2/M progression.
Molecular Cell, 1, 3-11 (1997). [0358] Korinek, V., Barker, N.,
Morin, P. J., Wichen, D., Weger, R., Kinzler, K. W., Vogelstein,
B., and Clevers, H., Constitutive transcriptional activation by a
.beta.-Catenin-Tcf complex in APC.sup.-/- colon carcinoma. Science,
275, 1784-1787 (1997). [0359] Zhang, L., Zhou, W., Velculescu, V.
E., Kern, S. E., Hruban, R. H., Hamilton, S. R., Vogelstein, B.,
and Kinzler, K. W., Gene expression profiles in normal and cancer
cells. Science, 276, 1268-1272 (1997). [0360] Hibi, K., Liu, Q.,
Beaudry, G. A., Madden, S I., Westra, W. H., Wehage, S. L., Yang,
S. C., Heitmiller, R. F., Bertelsen, A. H., Sidransky, D., and Jen,
J. Serial analysis of gene expression in non-small cell lung
cancer. Cancer Res., 58, 5690-5694 (1998). [0361] Nacht, M.,
Ferguson, A. T., Zhang, W., Petroziello, J. M., Cook, B. P., Gao,
Y. H., Maguire, S., Riley, D., Coppola, G., Landes, G. M., Madden,
S. L., and Sukumar, S., Combining serial analysis of gene
expression and array technologies to identify genes differentially
expressed in breast cancer. Cancer Res., 59, 5464-5470 (1999).
[0362] Waard, V., Berg, B. M. M., Veken, J., Schultz-Heienbrok, R.,
Pannekoek, H., and Zonneveld, A., Serial analysis of gene
expression to asssess the endothelial cell response to an
atherogenic stimulus. Gene, 226, 1-8 (1999). [0363] Berg, A.,
Visser, L., and Poppema, S., High expression of the CC chemokine
TARC in reed-sternberg cells. A possible explanation for the
characteristic T-cell infiltrate in hodgkin" lymphoma. Am. J.
Pathol., 154, 1685-1691 (1999). [0364] Iyer, V. R., Eisen, M. B.,
Ross, D. T., Schuler, G., Moore, T., Lee, J. C. F., Trent, J. M.,
Staudt, L. M., Hudson, J. Jr., Boguski, M. S., Lashkari, D.,
Shalon, D., Botstein, D., and Brown, P. O., The trancriptional
program in the response of human fibroblasts to serum. Science,
283, 83-87 (1999). [0365] Charpentier, A. H., Bednarek, A. K.,
Daniel, R. L., Hawkins, K. A., Laflin, K. J., Gaddis, S., Macleod,
M. C., and Aldaz, C. M., Effects of estrogen on global gene
expression: identification of novel targets of estrogen action.
Cancer Res., 60, 5977-5983 (2000). [0366] Ripple, M. O., Henry, W.
F., Rago, R. P., and Wilding, G., Prooxidant-antioxidant shift
induced by androgen treatment of human prostate carcinoma cells. J.
Nat. Cancer Inst., 89, 40-48 (1997).
Sequence CWU 1
1
81 1 1140 DNA Homo sapiens CDS (95)..(850) 1 tccttgggtt cgggtgaaag
cgcctggggg ttcgtggcca tgatccccga gctgctggag 60 aactgaaggc
ggacagtctc ctgcgaaaca ggca atg gcg gag ctg gag ttt gtt 115 Met Ala
Glu Leu Glu Phe Val 1 5 cag atc atc atc atc gtg gtg gtg atg atg gtg
atg gtg gtg gtg atc 163 Gln Ile Ile Ile Ile Val Val Val Met Met Val
Met Val Val Val Ile 10 15 20 acg tgc ctg ctg agc cac tac aag ctg
tct gca cgg tcc ttc atc agc 211 Thr Cys Leu Leu Ser His Tyr Lys Leu
Ser Ala Arg Ser Phe Ile Ser 25 30 35 cgg cac agc cag ggg cgg agg
aga gaa gat gcc ctg tcc tca gaa gga 259 Arg His Ser Gln Gly Arg Arg
Arg Glu Asp Ala Leu Ser Ser Glu Gly 40 45 50 55 tgc ctg tgg ccc tcg
gag agc aca gtg tca ggc aac gga atc cca gag 307 Cys Leu Trp Pro Ser
Glu Ser Thr Val Ser Gly Asn Gly Ile Pro Glu 60 65 70 ccg cag gtc
tac gcc ccg cct cgg ccc acc gac cgc ctg gcc gtg ccg 355 Pro Gln Val
Tyr Ala Pro Pro Arg Pro Thr Asp Arg Leu Ala Val Pro 75 80 85 ccc
ttc gcc cag cgg gag cgc ttc cac cgc ttc cag ccc acc tat ccg 403 Pro
Phe Ala Gln Arg Glu Arg Phe His Arg Phe Gln Pro Thr Tyr Pro 90 95
100 tac ctg cag cac gag atc gac ctg cca ccc acc atc tcg ctg tca gac
451 Tyr Leu Gln His Glu Ile Asp Leu Pro Pro Thr Ile Ser Leu Ser Asp
105 110 115 ggg gag gag ccc cca ccc tac cag ggc ccc tgc acc ctc cag
ctt cgg 499 Gly Glu Glu Pro Pro Pro Tyr Gln Gly Pro Cys Thr Leu Gln
Leu Arg 120 125 130 135 gac ccc gag cag cag ctg gaa ctg aac cgg gag
tcg gtg cgc gca ccc 547 Asp Pro Glu Gln Gln Leu Glu Leu Asn Arg Glu
Ser Val Arg Ala Pro 140 145 150 cca aac aga acc atc ttc gac agt gac
ctg atg gat agt gcc agg ctg 595 Pro Asn Arg Thr Ile Phe Asp Ser Asp
Leu Met Asp Ser Ala Arg Leu 155 160 165 ggc ggc ccc tgc ccc ccc agc
agt aac tcg ggc atc agc gcc acg tgc 643 Gly Gly Pro Cys Pro Pro Ser
Ser Asn Ser Gly Ile Ser Ala Thr Cys 170 175 180 tac ggc agc ggc ggg
cgc atg gag ggg ccg ccg ccc acc tac agc gag 691 Tyr Gly Ser Gly Gly
Arg Met Glu Gly Pro Pro Pro Thr Tyr Ser Glu 185 190 195 gtc atc ggc
cac tac ccg ggg tcc tcc ttc cag cac cag cag agc agt 739 Val Ile Gly
His Tyr Pro Gly Ser Ser Phe Gln His Gln Gln Ser Ser 200 205 210 215
ggg ccg ccc tcc ttg ctg gag ggg acc cgg ctc cac cac aca cac atc 787
Gly Pro Pro Ser Leu Leu Glu Gly Thr Arg Leu His His Thr His Ile 220
225 230 gcg ccc cta gag agc gca gcc atc tgg agc aaa gag aag gat aaa
cag 835 Ala Pro Leu Glu Ser Ala Ala Ile Trp Ser Lys Glu Lys Asp Lys
Gln 235 240 245 aaa gga cac cct ctc tagggtcccc aggggggccg
ggctggggct gcgtaggtga 890 Lys Gly His Pro Leu 250 aaaggcagaa
cactccgcgc ttcttagaag aggagtgaga ggaaggcggg gggcgcagca 950
acgcatcgtg tggccctccc ctcccacctc cctgtgtata aatatttaca tgtgatgtct
1010 ggtctgaatg cacaagctaa gagagcttgc aaaaaaaaaa agaaaaaaga
aaaaaaaaaa 1070 ccacgtttct ttgttgagct gtgtcttgaa ggcaaaagaa
aaaaaatttc tacagtaaaa 1130 aaaaaaaaaa 1140 2 759 DNA Homo sapiens 2
atggcggagc tggagtttgt tcagatcatc atcatcgtgg tggtgatgat ggtgatggtg
60 gtggtgatca cgtgcctgct gagccactac aagctgtctg cacggtcctt
catcagccgg 120 cacagccagg ggcggaggag agaagatgcc ctgtcctcag
aaggatgcct gtggccctcg 180 gagagcacag tgtcaggcaa cggaatccca
gagccgcagg tctacgcccc gcctcggccc 240 accgaccgcc tggccgtgcc
gcccttcgcc cagcgggagc gcttccaccg cttccagccc 300 acctatccgt
acctgcagca cgagatcgac ctgccaccca ccatctcgct gtcagacggg 360
gaggagcccc caccctacca gggcccctgc accctccagc ttcgggaccc cgagcagcag
420 ctggaactga accgggagtc ggtgcgcgca cccccaaaca gaaccatctt
cgacagtgac 480 ctgatggata gtgccaggct gggcggcccc tgccccccca
gcagtaactc gggcatcagc 540 gccacgtgct acggcagcgg cgggcgcatg
gaggggccgc cgcccaccta cagcgaggtc 600 atcggccact acccggggtc
ctccttccag caccagcaga gcagtgggcc gccctccttg 660 ctggagggga
cccggctcca ccacacacac atcgcgcccc tagagagcgc agccatctgg 720
agcaaagaga aggataaaca gaaaggacac cctctctag 759 3 252 PRT Homo
sapiens 3 Met Ala Glu Leu Glu Phe Val Gln Ile Ile Ile Ile Val Val
Val Met 1 5 10 15 Met Val Met Val Val Val Ile Thr Cys Leu Leu Ser
His Tyr Lys Leu 20 25 30 Ser Ala Arg Ser Phe Ile Ser Arg His Ser
Gln Gly Arg Arg Arg Glu 35 40 45 Asp Ala Leu Ser Ser Glu Gly Cys
Leu Trp Pro Ser Glu Ser Thr Val 50 55 60 Ser Gly Asn Gly Ile Pro
Glu Pro Gln Val Tyr Ala Pro Pro Arg Pro 65 70 75 80 Thr Asp Arg Leu
Ala Val Pro Pro Phe Ala Gln Arg Glu Arg Phe His 85 90 95 Arg Phe
Gln Pro Thr Tyr Pro Tyr Leu Gln His Glu Ile Asp Leu Pro 100 105 110
Pro Thr Ile Ser Leu Ser Asp Gly Glu Glu Pro Pro Pro Tyr Gln Gly 115
120 125 Pro Cys Thr Leu Gln Leu Arg Asp Pro Glu Gln Gln Leu Glu Leu
Asn 130 135 140 Arg Glu Ser Val Arg Ala Pro Pro Asn Arg Thr Ile Phe
Asp Ser Asp 145 150 155 160 Leu Met Asp Ser Ala Arg Leu Gly Gly Pro
Cys Pro Pro Ser Ser Asn 165 170 175 Ser Gly Ile Ser Ala Thr Cys Tyr
Gly Ser Gly Gly Arg Met Glu Gly 180 185 190 Pro Pro Pro Thr Tyr Ser
Glu Val Ile Gly His Tyr Pro Gly Ser Ser 195 200 205 Phe Gln His Gln
Gln Ser Ser Gly Pro Pro Ser Leu Leu Glu Gly Thr 210 215 220 Arg Leu
His His Thr His Ile Ala Pro Leu Glu Ser Ala Ala Ile Trp 225 230 235
240 Ser Lys Glu Lys Asp Lys Gln Lys Gly His Pro Leu 245 250 4 8 PRT
Artificial Sequence Description of Artificial Sequence FLAG peptide
4 Asp Tyr Lys Asp Asp Asp Asp Lys 1 5 5 24 DNA Artificial Sequence
Description of Artificial Sequence Primer 5 ggcagaacac tccgcgcttc
ttag 24 6 24 DNA Artificial Sequence Description of Artificial
Sequence Primer 6 caagctctct tagcttgtgc attc 24 7 22 DNA Artificial
Sequence Description of Artificial Sequence Primer 7 cttgggttcg
ggtgaaagcg cc 22 8 22 DNA Artificial Sequence Description of
Artificial Sequence Primer 8 ggtgggtggc aggtcgatct cg 22 9 20 DNA
Artificial Sequence Description of Artificial Sequence Primer 9
ccttcgccca gcgggagcgc 20 10 24 DNA Artificial Sequence Description
of Artificial Sequence Primer 10 caagctctct tagcttgtgc attc 24 11
249 PRT Homo sapiens 11 Ala Glu Leu Glu Phe Val Gln Ile Ile Ile Ile
Val Val Val Met Met 1 5 10 15 Val Met Val Val Val Ile Thr Cys Leu
Leu Ser His Tyr Lys Leu Ser 20 25 30 Ala Arg Ser Phe Ile Ser Arg
His Ser Gln Gly Arg Arg Arg Glu Asp 35 40 45 Ala Leu Ser Ser Glu
Gly Cys Leu Trp Pro Ser Glu Ser Thr Val Ser 50 55 60 Gly Asn Gly
Ile Pro Glu Pro Gln Val Tyr Ala Pro Pro Arg Pro Thr 65 70 75 80 Asp
Arg Leu Ala Val Pro Pro Phe Ala Gln Arg Glu Arg Phe His Arg 85 90
95 Phe Gln Pro Thr Tyr Pro Tyr Leu Gln His Glu Ile Asp Leu Pro Pro
100 105 110 Thr Ile Ser Leu Ser Asp Gly Glu Glu Pro Pro Pro Tyr Gln
Gly Pro 115 120 125 Cys Thr Leu Gln Leu Arg Asp Pro Glu Gln Gln Leu
Glu Leu Asn Arg 130 135 140 Glu Ser Val Arg Ala Pro Pro Asn Arg Thr
Ile Phe Asp Ser Asp Leu 145 150 155 160 Met Asp Ser Ala Arg Leu Gly
Gly Pro Cys Pro Pro Ser Ser Asn Ser 165 170 175 Gly Ile Ser Ala Thr
Cys Tyr Gly Ser Gly Gly Arg Met Glu Gly Pro 180 185 190 Pro Pro Thr
Tyr Ser Glu Val Ile Gly His Tyr Pro Gly Ser Ser Phe 195 200 205 Gln
His Gln Gln Ser Ser Gly Pro Pro Ser Leu Leu Glu Gly Thr Arg 210 215
220 Leu His His Thr His Ile Ala Pro Leu Glu Ser Ala Ala Ile Trp Ser
225 230 235 240 Lys Glu Lys Asp Lys Gln Lys Gly His 245 12 244 PRT
Homo sapiens 12 Ala Glu Leu Glu Phe Ala Gln Ile Ile Ile Ile Val Val
Val Val Thr 1 5 10 15 Val Met Val Val Val Ile Val Cys Leu Leu Asn
His Tyr Lys Val Ser 20 25 30 Thr Arg Ser Phe Ile Asn Arg Pro Asn
Gln Ser Arg Arg Arg Glu Asp 35 40 45 Gly Leu Pro Gln Glu Gly Cys
Leu Trp Pro Ser Asp Ser Ala Ala Pro 50 55 60 Arg Leu Gly Ala Ser
Glu Ile Met His Ala Pro Arg Ser Arg Asp Arg 65 70 75 80 Phe Thr Ala
Pro Ser Phe Ile Gln Arg Asp Arg Phe Ser Arg Phe Gln 85 90 95 Pro
Thr Tyr Pro Tyr Val Gln His Glu Ile Asp Leu Pro Pro Thr Ile 100 105
110 Ser Leu Ser Asp Gly Glu Glu Pro Pro Pro Tyr Gln Gly Pro Cys Thr
115 120 125 Leu Gln Leu Arg Asp Pro Glu Gln Gln Met Glu Leu Asn Arg
Glu Ser 130 135 140 Val Arg Ala Pro Pro Asn Arg Thr Ile Phe Asp Ser
Asp Leu Ile Asp 145 150 155 160 Ile Ala Met Tyr Ser Gly Gly Pro Cys
Pro Pro Ser Ser Asn Ser Gly 165 170 175 Ile Ser Ala Ser Thr Cys Ser
Ser Asn Gly Arg Met Glu Gly Pro Pro 180 185 190 Pro Thr Tyr Ser Glu
Val Met Gly His His Pro Gly Ala Ser Phe Leu 195 200 205 His His Gln
Arg Ser Asn Ala His Arg Gly Ser Arg Leu Gln Phe Gln 210 215 220 Gln
Asn Asn Ala Glu Ser Thr Ile Val Pro Ile Lys Gly Lys Asp Arg 225 230
235 240 Lys Pro Gly Asn 13 10 DNA Artificial Sequence Description
of Artificial Sequence Synthetic oligonucleotide 13 gccagcccag 10
14 10 DNA Artificial Sequence Description of Artificial Sequence
Synthetic oligonucleotide 14 gtgcagggag 10 15 10 DNA Artificial
Sequence Description of Artificial Sequence Synthetic
oligonucleotide 15 gacaaacatt 10 16 10 DNA Artificial Sequence
Description of Artificial Sequence Synthetic oligonucleotide 16
atgactcaag 10 17 10 DNA Artificial Sequence Description of
Artificial Sequence Synthetic oligonucleotide 17 gaaaagaagg 10 18
10 DNA Artificial Sequence Description of Artificial Sequence
Synthetic oligonucleotide 18 cctgtacccc 10 19 10 DNA Artificial
Sequence Description of Artificial Sequence Synthetic
oligonucleotide 19 cctgaactgg 10 20 10 DNA Artificial Sequence
Description of Artificial Sequence Synthetic oligonucleotide 20
tgacagccca 10 21 10 DNA Artificial Sequence Description of
Artificial Sequence Synthetic oligonucleotide 21 tacaaaacca 10 22
10 DNA Artificial Sequence Description of Artificial Sequence
Synthetic oligonucleotide 22 aattctccta 10 23 10 DNA Artificial
Sequence Description of Artificial Sequence Synthetic
oligonucleotide 23 tgcatatcat 10 24 10 DNA Artificial Sequence
Description of Artificial Sequence Synthetic oligonucleotide 24
cttgacacac 10 25 10 DNA Artificial Sequence Description of
Artificial Sequence Synthetic oligonucleotide 25 tgtctaacta 10 26
10 DNA Artificial Sequence Description of Artificial Sequence
Synthetic oligonucleotide 26 gtggacccca 10 27 10 DNA Artificial
Sequence Description of Artificial Sequence Synthetic
oligonucleotide 27 ataaagtaac 10 28 10 DNA Artificial Sequence
Description of Artificial Sequence Synthetic oligonucleotide 28
tacattttca 10 29 10 DNA Artificial Sequence Description of
Artificial Sequence Synthetic oligonucleotide 29 tcagaacagt 10 30
10 DNA Artificial Sequence Description of Artificial Sequence
Synthetic oligonucleotide 30 caacttcaac 10 31 10 DNA Artificial
Sequence Description of Artificial Sequence Synthetic
oligonucleotide 31 gataggtcgg 10 32 10 DNA Artificial Sequence
Description of Artificial Sequence Synthetic oligonucleotide 32
ctaaaaggag 10 33 10 DNA Artificial Sequence Description of
Artificial Sequence Synthetic oligonucleotide 33 gtggtgcgtg 10 34
10 DNA Artificial Sequence Description of Artificial Sequence
Synthetic oligonucleotide 34 tccccgtggc 10 35 10 DNA Artificial
Sequence Description of Artificial Sequence Synthetic
oligonucleotide 35 attgatcttg 10 36 10 DNA Artificial Sequence
Description of Artificial Sequence Synthetic oligonucleotide 36
agctggtttc 10 37 10 DNA Artificial Sequence Description of
Artificial Sequence Synthetic oligonucleotide 37 cctcccccgt 10 38
10 DNA Artificial Sequence Description of Artificial Sequence
Synthetic oligonucleotide 38 atgtactctg 10 39 10 DNA Artificial
Sequence Description of Artificial Sequence Synthetic
oligonucleotide 39 gatgaaatac 10 40 10 DNA Artificial Sequence
Description of Artificial Sequence Synthetic oligonucleotide 40
gtgcatcccg 10 41 10 DNA Artificial Sequence Description of
Artificial Sequence Synthetic oligonucleotide 41 gaaattaggg 10 42
10 DNA Artificial Sequence Description of Artificial Sequence
Synthetic oligonucleotide 42 tttctagggg 10 43 10 DNA Artificial
Sequence Description of Artificial Sequence Synthetic
oligonucleotide 43 cccagggaga 10 44 10 DNA Artificial Sequence
Description of Artificial Sequence Synthetic oligonucleotide 44
gtggcgcaca 10 45 10 DNA Artificial Sequence Description of
Artificial Sequence Synthetic oligonucleotide 45 ttgcttttgt 10 46
10 DNA Artificial Sequence Description of Artificial Sequence
Synthetic oligonucleotide 46 atgtcctttc 10 47 10 DNA Artificial
Sequence Description of Artificial Sequence Synthetic
oligonucleotide 47 tgtttatcct 10 48 10 DNA Artificial Sequence
Description of Artificial Sequence Synthetic oligonucleotide 48
gctttgtatc 10 49 10 DNA Artificial Sequence Description of
Artificial Sequence Synthetic oligonucleotide 49 gttccagtga 10 50
10 DNA Artificial Sequence Description of Artificial Sequence
Synthetic oligonucleotide 50 tagcagaggc 10 51 10 DNA Artificial
Sequence Description of Artificial Sequence
Synthetic oligonucleotide 51 acaaattatg 10 52 10 DNA Artificial
Sequence Description of Artificial Sequence Synthetic
oligonucleotide 52 cagtttgtac 10 53 10 DNA Artificial Sequence
Description of Artificial Sequence Synthetic oligonucleotide 53
gattacttgc 10 54 10 DNA Artificial Sequence Description of
Artificial Sequence Synthetic oligonucleotide 54 ggccagccct 10 55
10 DNA Artificial Sequence Description of Artificial Sequence
Synthetic oligonucleotide 55 caattgtaaa 10 56 10 DNA Artificial
Sequence Description of Artificial Sequence Synthetic
oligonucleotide 56 aaagccaaga 10 57 10 DNA Artificial Sequence
Description of Artificial Sequence Synthetic oligonucleotide 57
caactaattc 10 58 10 DNA Artificial Sequence Description of
Artificial Sequence Synthetic oligonucleotide 58 aagagctaat 10 59
10 DNA Artificial Sequence Description of Artificial Sequence
Synthetic oligonucleotide 59 cttttcaaga 10 60 10 DNA Artificial
Sequence Description of Artificial Sequence Synthetic
oligonucleotide 60 gtgtgtaaaa 10 61 10 DNA Artificial Sequence
Description of Artificial Sequence Synthetic oligonucleotide 61
acaaaatgta 10 62 10 DNA Artificial Sequence Description of
Artificial Sequence Synthetic oligonucleotide 62 aaggtagcag 10 63
10 DNA Artificial Sequence Description of Artificial Sequence
Synthetic oligonucleotide 63 ggcggggcca 10 64 10 DNA Artificial
Sequence Description of Artificial Sequence Synthetic
oligonucleotide 64 ggccagtaac 10 65 10 DNA Artificial Sequence
Description of Artificial Sequence Synthetic oligonucleotide 65
aacttaagag 10 66 10 DNA Artificial Sequence Description of
Artificial Sequence Synthetic oligonucleotide 66 agggatggcc 10 67
10 DNA Artificial Sequence Description of Artificial Sequence
Synthetic oligonucleotide 67 cttaaggatt 10 68 243 PRT Mus sp. 68
Ile Thr Glu Leu Glu Phe Val Gln Ile Val Val Ile Val Val Val Met 1 5
10 15 Met Val Met Val Val Met Ile Thr Cys Leu Leu Ser His Tyr Lys
Leu 20 25 30 Ser Ala Arg Ser Phe Ile Ser Arg His Ser Gln Ala Arg
Arg Arg Asp 35 40 45 Asp Gly Leu Ser Ser Glu Gly Cys Leu Trp Pro
Ser Glu Ser Thr Val 50 55 60 Ser Gly Gly Met Pro Glu Pro Gln Val
Tyr Ala Pro Pro Arg Pro Thr 65 70 75 80 Asp Arg Leu Ala Val Pro Pro
Phe Ile Gln Arg Ser Arg Phe Gln Pro 85 90 95 Thr Tyr Pro Tyr Leu
Gln His Glu Ile Ala Leu Pro Pro Thr Ile Ser 100 105 110 Leu Ser Asp
Gly Glu Glu Pro Pro Pro Tyr Gln Gly Pro Cys Thr Leu 115 120 125 Gln
Leu Arg Asp Pro Glu Gln Gln Leu Glu Leu Asn Arg Glu Ser Val 130 135
140 Arg Ala Pro Pro Asn Arg Thr Ile Phe Asp Ser Asp Leu Ile Asp Ser
145 150 155 160 Thr Met Leu Gly Gly Pro Cys Pro Pro Ser Ser Asn Ser
Gly Ile Ser 165 170 175 Ala Thr Cys Tyr Ser Ser Gly Gly Arg Met Glu
Gly Pro Pro Pro Thr 180 185 190 Tyr Ser Glu Val Ile Gly His Tyr Pro
Gly Ser Ser Phe Gln His Gln 195 200 205 Gln Ser Asn Gly Pro Ser Ser
Leu Leu Glu Gly Thr Arg Leu His His 210 215 220 Ser His Ile Ala Pro
Leu Glu Asn Lys Glu Lys Glu Lys Gln Lys Gly 225 230 235 240 His Pro
Leu 69 21 DNA Artificial Sequence Description of Artificial
Sequence Primer 69 gctgctggag aactgaaggc g 21 70 22 DNA Artificial
Sequence Description of Artificial Sequence Primer 70 gtgtcctttc
tgtttatcct tc 22 71 27 DNA Artificial Sequence Description of
Artificial Sequence Primer 71 aagcttgctg ctggagaact gaaggcg 27 72
25 DNA Artificial Sequence Description of Artificial Sequence
Primer 72 gaattcggtg tcctttctgt ttatc 25 73 27 DNA Artificial
Sequence Description of Artificial Sequence Primer 73 gcaggatccc
aaccagatgc tgcttgc 27 74 28 DNA Artificial Sequence Description of
Artificial Sequence Primer 74 gcagaattct tttgtaatcc ctggagta 28 75
27 DNA Artificial Sequence Description of Artificial Sequence
Primer 75 gcaaagcttg tccggtttgc tggaagc 27 76 31 DNA Artificial
Sequence Description of Artificial Sequence Primer 76 gcagaattcc
ctttttgttc ttattggtga c 31 77 18 DNA Artificial Sequence
Description of Artificial Sequence Primer 77 catgatcccc gagctgct 18
78 23 DNA Artificial Sequence Description of Artificial Sequence
Primer 78 tgatctgaac aaactccagc tcc 23 79 23 DNA Artificial
Sequence Description of Artificial Sequence Primer 79 aggcggacag
tctcctgcga aac 23 80 4 PRT Artificial Sequence Description of
Artificial Sequence Synthetic motif 80 Pro Pro Pro Tyr 1 81 4 PRT
Artificial Sequence Description of Artificial Sequence Synthetic
motif 81 Pro Pro Thr Tyr 1
* * * * *
References