U.S. patent application number 11/711741 was filed with the patent office on 2009-01-15 for allergy vaccines and their preparation.
This patent application is currently assigned to SHAN-Beteiligungsgesellschaft m.b.H.. Invention is credited to Margarete Focke, Dietrich Kraft, Vera Mahler, Wolfgang R. Sperr, Peter Valent, Rudolf Valenta.
Application Number | 20090017051 11/711741 |
Document ID | / |
Family ID | 8170853 |
Filed Date | 2009-01-15 |
United States Patent
Application |
20090017051 |
Kind Code |
A1 |
Focke; Margarete ; et
al. |
January 15, 2009 |
Allergy vaccines and their preparation
Abstract
The present invention relates to a pharmaceutical composition
containing a peptide and a pharmaceutically acceptable carrier or
diluent wherein the peptide has a length of 8 to 50 amino acids, at
least three preferably consecutive amino acids of the peptide are
identical to at least three amino acids which appear in close
vicinity on the molecular surface of an allergenic protein, and
said at least three amino acids are solvent-exposed amino acids in
the allergenic protein. The invention also concerns a method for
the preparation of the pharmaceutical composition.
Inventors: |
Focke; Margarete; (Wien,
AT) ; Mahler; Vera; (Eriangen, DE) ; Sperr;
Wolfgang R.; (Wien, AT) ; Valent; Peter;
(Wein, AT) ; Kraft; Dietrich; (Wein, AT) ;
Valenta; Rudolf; (Theresienfeld, AT) |
Correspondence
Address: |
DOBE LAW GROUP, LLC
7207 HANOVER PARKWAY, SUITE C/D
GREENBELT
MD
20770
US
|
Assignee: |
SHAN-Beteiligungsgesellschaft
m.b.H.
|
Family ID: |
8170853 |
Appl. No.: |
11/711741 |
Filed: |
February 28, 2007 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
10026911 |
Dec 27, 2001 |
7244431 |
|
|
11711741 |
|
|
|
|
Current U.S.
Class: |
424/185.1 ;
424/275.1; 435/7.92 |
Current CPC
Class: |
A61K 39/36 20130101;
A61P 37/08 20180101; A61K 39/35 20130101; Y10S 530/868 20130101;
C07K 14/415 20130101; Y10S 424/81 20130101 |
Class at
Publication: |
424/185.1 ;
435/7.92; 424/275.1 |
International
Class: |
A61K 39/35 20060101
A61K039/35; G01N 33/566 20060101 G01N033/566; A61K 39/36 20060101
A61K039/36; A61P 37/08 20060101 A61P037/08 |
Foreign Application Data
Date |
Code |
Application Number |
Dec 28, 2000 |
EP |
00128659.0 |
Claims
1-38. (canceled)
39. A method of screening peptides for use as immunotherapeutic
agents against pollen allergenic proteins comprising the steps of:
a) providing a peptide with an amino acid sequence obtained from
the pollen allergenic protein wherein said peptide, b) has a length
of at least 8 and no more than 50 amino acids; c) has at least
three consecutive amino acids identical to at least three
solvent-exposed amino acids of the allergenic protein which appear
in close vicinity on the molecular surface of the allergenic
protein; d) administering said peptide to a test animal; e)
selecting as candidate immunotherapeutic agents, those peptides
which are capable of inducing IgG antibodies to the allergenic
protein and e) do not induce any substantial IgE-mediated allergic
reaction.
40. The method of claim 39, wherein said at least three
solvent-exposed amino acids appear on the molecular surface of the
allergenic protein within a surface patch of approximately 500
square Angstrom.
41. The method of claim 39, wherein at least five consecutive amino
acids of the peptide are identical to at least five consecutive
solvent-exposed amino acids of the allergenic protein.
42. The method of claim 39, wherein the peptide amino acid sequence
comprises at least the N-terminal or C-terminal five amino acids of
the allergenic protein amino acid sequence.
43. The method of claim 39, wherein all amino acids of the peptide
except one are identical to the amino acids of an amino acid
sequence which is part of the allergenic protein amino acid
sequence.
44. The method of claim 43, wherein the one amino acid which
deviates from the amino acid sequence of the allergenic protein is
the N-terminal or C-terminal amino acid of the peptide amino acid
sequence.
45. The method of claim 39, wherein the amino acid sequence of the
peptide is identical to an amino acid sequence which is part of the
allergenic protein amino acid sequence.
46. The method of claim 39, wherein the allergenic protein is the
birch pollen allergen Bet v 1.
47. The method of claim 39, wherein the peptide amino acid sequence
comprises at least the N-terminal or C-terminal five amino acids of
the allergenic protein amino acid sequence.
48. The method of claim 39, wherein the solvent-exposed amino acids
of the allergenic protein are determined by determining the
hydrophilicity profile of the allergenic protein.
49. The method of claim 39, wherein the solvent-exposed amino acids
of the allergenic protein are determined from the three-dimensional
structure of the allergenic protein.
50. A pharmaceutical composition comprising the immunotherapeutic
agent of claim 39 and a pharmaceutically acceptable carrier or
diluent.
51. The pharmaceutical composition of claim 50, further comprising
an adjuvant.
52. A method for treating an allergic disease, comprising
administering to a patient in need thereof the pharmaceutical
composition of claim 50.
51. The method of claim 39, wherein the peptide does not induce an
IgE-mediated allergic reaction.
52. The pharmaceutical composition of claim 50, wherein the amino
acid sequence of the peptide is identical to an amino acid sequence
which is part of the allergenic protein amino acid sequence.
53. The pharmaceutical composition of claim 50, wherein all amino
acids of the peptide except one are identical to the amino acids of
an amino acid sequence which is part of the allergenic protein
amino acid sequence.
54. The pharmaceutical composition of claim 53, wherein the one
amino acid which deviates from the amino acid sequence of the
allergenic protein is the N-terminal or C-terminal amino acid of
the peptide amino acid sequence, wherein said amino acid is a
cysteinyl residue.
55. The pharmaceutical composition of claim 50, wherein the at
least three amino acids identical to the at least three
solvent-exposed amino acids of an allergenic protein are not
consecutive.
Description
[0001] Almost 500 million individuals suffer from Type I allergy, a
genetically determined hypersensitivity disease which is based on
the formation of IgE antibodies against per se harmless antigens
(i.e., allergens). In sensitized patients, allergen contact can
induce a variety of symptoms ranging from allergic
rhinoconjunctivitis, atopic dermatitis, diarrhea, bronchial asthma,
and sometimes life-threatening anaphylaxis. The immediate symptoms
of allergic disease are caused by crosslinking of effector
cell-bound IgE antibodies by allergens which triggers the release
of biologically active mediators (e.g., histamine, leukotrienes).
In addition, allergen presentation to T cells may be also mediated
by IgE antibodies and induce chronic symptoms of allergic disease
(e.g., atopic dermatitis, chronic asthma) via T cell activation and
release of proinflammatory cytokines.
[0002] The only curative approach towards allergy treatment,
allergen-specific immunotherapy, is based on the continuous
administration of the disease-eliciting allergens to the patients
in order to induce allergen-specific non-responsiveness. Multiple
studies document the clinical efficacy of specific immunotherapy,
but two major disadvantages must be overcome: First, systemic
administration of allergens can induce life-threatening
anaphylactic side effects. Second, immunotherapy is performed with
allergen extracts consisting of difficult to standardize mixtures
of allergenic and non-allergenic components which cannot be
tailored to the individual patients' specific sensitization
profile.
[0003] It is an object of the invention to provide an advantageous
pharmaceutical composition for the treatment of allergic
disorders.
[0004] Surprisingly, it has been found that the administration of
peptides comprising solvent-exposed amino acids of an allergen lead
to the production of protective antibodies.
[0005] Therefore, the present invention relates to a method for the
preparation of a pharmaceutical composition which comprises as a
first step the determination which amino acids of a given
allergenic protein are solvent-exposed on the surface of the
allergenic protein. As a second step the method comprises the
preparation of a peptide having a length of 8 to 50 amino acids
wherein at least three preferably consecutive amino acids of the
peptide are identical to at least three amino acids which appear in
close vicinity on the molecular surface of the allergenic protein
with at least three amino acids being solvent-exposed amino acids
of the allergenic protein. The peptide may then be admixed with a
pharmaceutically acceptable carrier (e.g., KLH) or diluent, e.g.
with a buffer and/or salt solutions. Preferably, said at least
three amino acids appear on the molecular surface of the allergenic
protein within a surface patch of approximately 500 square
Angstrom.
[0006] More preferably, the present invention relates to a method
for the preparation of a pharmaceutical composition which comprises
as a first step the determination which amino acids of a given
allergenic protein are solvent-exposed on the surface of the
allergenic protein. As a second step the method comprises the
preparation of a peptide having a length of 8 to 50 amino acids
wherein at least five consecutive amino acids of the peptide are
identical to at least five consecutive amino acids of the amino
acid sequence of the allergenic protein with the at least five
consecutive amino acids being solvent-exposed amino acids of the
allergenic protein. The peptide may then be admixed with a
pharmaceutically acceptable carrier or diluent, e.g. with a buffer
and/or salt solution.
[0007] In another preferred embodiment the method comprises as a
further step the addition of an adjuvant. Adjuvants that are known
in the art and may be used according to the invention are e.g.
Al(OH).sub.3.
[0008] The peptide may be prepared by synthetic methods known in
the art such as solid phase synthesis. The peptide may also be
prepared by expression of recombinant DNA. A cDNA sequence encoding
the peptide may be introduced into a host such as E. coli cells and
expressed. Following expression, the peptides are recovered by
known purification methods. The method of recombinant production of
peptides may be preferred when longer peptides are used for the
preparation of the pharmaceutical composition. The method of
synthetically preparing the peptides is preferred when shorter
peptides are employed.
[0009] In the first step of the method of the invention, it is
determined which amino acids of a given allergenic protein are
solvent-exposed on the surface of the allergenic protein. Any known
allergenic protein may be used for the design of the peptides. An
allergen source may be selected against which a high percentage of
allergic patients is sensitized. Preferred allergenic proteins are
derived from plants. A preferred allergen source is the birch
pollen, because it is widely distributed in Europe, North America
and Australia. Almost 25% of allergic patients suffer from allergy
to the major birch pollen allergen Bet v 1. Bet v 1 contains most
of the IgE epitopes present in pollens of trees belonging to the
Fagales order (birch, alder, hazel, oak, hornbeam) and in
plant-derived fruit. The cDNA and amino acid sequence as well as
the three-dimensional structure of Bet v 1 have been determined and
recombinant Bet v 1 which equals the natural Bet v 1 wild type has
been produced by recombinant DNA technology. Further allergenic
proteins that can be envisaged are e.g. the major grass pollen
(e.g. group 1, group 2, group 5 etc.) mite (e.g., Der p 2), bee
venom (e.g., phospholipase) and animal hair dander allergens (e.g.,
Cat: Fel d 1).
[0010] In one embodiment the solvent-exposed amino acids are
determined by examination of the three-dimensional structure of the
allergenic protein. Amino acids which are on the surface of the
protein and not buried in the protein are considered as being
solvent-exposed. Within the meaning of this application an amino
acid is solvent exposed if it has a relative solvent accessibility
of at least 16%, preferably at least 25%. Solvent accessibility can
be determined according to residue hydrophobicity as described in
Rost and Sander (1994) Proteins 20, 216-226. The three-dimensional
structure of the protein may be determined by X-ray crystallography
or NMR.
[0011] If the amino acid sequence of the protein is known, it is
also possible to perform a hydrophilicity analysis to determine
which amino acids within the sequence have a high hydrophilicity
index and thus a high probability of being exposed on the surface.
Another possibility is to perform a "surface probability analysis"
to find out which amino acids have the highest probability to be
exposed to the solvent.
[0012] If neither the sequence nor the three-dimensional structure
of the allergenic protein is known, it is usually necessary to
clone the gene encoding the allergenic protein. This can be done by
methods known in the art.
[0013] In some cases IgE epitopes have been determined for an
allergen. Such epitopes may also be used for the design of
peptides, since these epitopes are on the surface of the allergenic
protein.
[0014] Once it is known which amino acids within the amino acid
sequence of the allergenic protein are solvent-exposed, a peptide
is prepared comprising at least five consecutive amino acids which
are identical to at least five consecutive solvent-exposed amino
acids of the allergenic protein. The peptide has a length of 8 to
50 amino acids. Preferably, the minimum length of the peptide is
twelve, more preferably 15, still more preferably 18, most
preferably 21 amino acids. The maximum length of a peptide
preferably is 45, more preferably 40, most preferably 35 amino
acids. The most preferred length of the peptide is within a range
of 21 to 35 amino acids.
[0015] It is also preferred that at least eight consecutive amino
acids of the peptide are identical to at least eight consecutive
solvent-exposed amino acids of the allergenic protein. Most
preferably at least ten consecutive amino acids of the peptide are
identical to at least 10 consecutive solvent-exposed amino acids of
the allergenic protein.
[0016] The peptides used for the preparation of the pharmaceutical
composition may also comprise amino acids which are not derived
from the allergenic protein. N-terminal or C-terminal to the at
least five consecutive solvent-exposed amino acids, amino acids
derived from another source or artificially designed amino acids
may be added. It is preferred, however, that almost the complete
sequence of the peptide is derived from the allergenic protein. In
a particular embodiment, only one amino acid within the peptide
sequence is not derived from the amino acid sequence of the
allergenic protein. Preferably, this is the N-terminal or the
C-terminal amino acid of the peptide. Most preferably, this amino
acid is a cysteine residue which allows coupling of the peptide to
various carrier molecules such as keyhole limpet hemocyanin
(KLH).
[0017] In a further embodiment the peptide comprises at least the
N-terminal or C-terminal five amino acids of the allergenic
protein. The N- and C-termini often are solvent-exposed.
[0018] In another embodiment the complete peptide sequence is
derived from the amino acid sequence of the allergenic protein.
[0019] Preferably, the peptides prepared according to the invention
upon administration lead to the production of IgG antibodies which
react with the protein from which the peptides are derived. More
preferably, these IgG antibodies are "blocking antibodies" or
"protective antibodies" which prevent IgE antibodies from binding
to the respective allergenic protein from which the peptides are
derived. A significant reduction of allergic symptoms may be
achieved in this way.
[0020] Another preferred feature of the peptides is that they do
not elicit an IgE response against themselves upon administration,
i.e. they are hypoallergenic or non-allergenic.
[0021] The amount of the peptide administered can be 0.1 .mu.g to
500 .mu.g. The amount may vary depending on the mode of treatment.
During immunotherapy treatment about 50 .mu.g can be administered
in a volume of 100 .mu.l per injection. In a particular embodiment,
more than one peptide is contained in the pharmaceutical
composition. It is preferred that two, three, four, five or six
different peptides are contained. These different peptides may be
derived from the same allergen, it is also possible, however, that
they are derived from different proteins. Thus, by administration
of a single pharmaceutical composition an antiallergic effect with
respect to different allergens can be achieved.
[0022] Another aspect of the present invention is a pharmaceutical
composition prepared by a method described supra. The
pharmaceutical composition contains a peptide having a length of 8
to 50 amino acids characterized in that at least five consecutive
amino acids of the peptide are identical to at least five
consecutive solvent-exposed amino acids of an allergenic protein.
The preferred properties and characteristics of the peptide
contained in the pharmaceutical composition of the invention have
been described for the method for its preparation.
[0023] The pharmaceutical composition preferably is a vaccine
composition. It may be administered to allergic patients via
various routes. Preferably, the pharmaceutical composition is
administered by subcutaneous injection. Other modes of
administration are intramuscular or intravenous injection. Other
preferred modes are sublingual, oral or nasal administration.
[0024] The systemic administration of allergens to allergic
patients in the course of specific immunotherapy as practiced in
the art harbors the risk of inducing life-threatening anaphylactic
reactions. Furthermore, allergen extracts currently used for
treatment contain a variety of allergenic and non-allergenic
components which cannot be tailored according to the individual
patient's sensitization profile. Improvement of safety and
specificity of allergy vaccines has therefore been a long sought
goal. The vaccination strategy of the present invention allows to
generate safe, hypoallergenic allergy vaccines whenever the
sequence, three-dimensional structure and/or IgE epitopes of an
allergen molecule is available.
[0025] Birch pollen allergic patients IgE antibodies primarily
recognize conformational Bet v 1 IgE epitopes. Surprisingly, it has
been found by the inventors that hypoallergenic peptides can also
be synthesized for allergens containing continuous (i.e.
sequential, linear) IgE epitopes. The inventors succeeded in
producing a set of hypoallergenic peptides for the major timothy
grass pollen allergen, Phl p 1, which contains continuous
epitopes.
[0026] Unexpectedly, peptide immunization of mice and rabbits with
the peptides used in the present invention resulted in the
production of IgG antibodies specific for the complete Bet v 1 wild
type allergy although the peptides were rather short in length (25
to 32 amino acids) and despite the fact that certain of the
peptides (P1-P3) lacked Bet v 1 specific T cell epitopes.
[0027] It was also found that peptide-induced IgG antibodies
crossreacted with Bet v 1 related allergens from alder, hazel and
hornbeam pollen, indicating that peptide immunotherapy may also
protect against allergy to allergen sources containing a related
allergen.
[0028] The peptide immunotherapy approach of the present invention
is different from previously made attempts to use T cell epitope
containing peptides for a modulation of allergen specific T cell
responses. While administration of free, soluble T cell epitope
containing peptides either aims at inducing tolerance or at
switching towards Th1-responses, the inventors used adjuvant-bound,
surface-exposed peptides for the focusing of blocking IgG
antibodies to solvent-exposed allergen domains which can be
principle targets for IgE antibodies. Since preferably
adjuvant-bound peptides are used for the induction of blocking
antibodies, it is unlikely that injection of peptides even when
they contain T cell epitopes will cause T cell-mediated systemic
reaction as has been reported for the major cat allergen, Fel d
1.
[0029] Hypoallergenic surface-exposed allergen peptides can be
produced in a well controlled manner and represent therapeutic
reagents which can be easily purified and standardized. Such
peptides can be administered in high doses with low risk of
inducing anaphylactic side effects, particularly when they are
bound to adjuvants. Administration of high peptide doses is
expected to induce a vigorous production of IgG antibodies which is
accompanied by a Th1 immune response. The approach of selecting
surface-exposed peptides according to the three-dimensional
structure of important crossreactive allergens is of general
applicability and allows a rational design of safe peptide-based
vaccines for many other forms of type I allergy.
DESCRIPTION OF THE TABLES AND FIGURES
[0030] Table 1 summarizes the characteristics of non-allergenic Bet
v 1-derived synthetic peptides. Posibon, sequence, length,
molecular weight, isoelectric point, residual fold, presence of T
cell epitopes and AGADIR prediction of six Bet v 1-derived peptides
are displayed.
[0031] Table 2 shows the serological characterization of 60 birch
pollen allergic patients and a non-allergic control individual
(NHS). Sex, age, total serum IgE levels (kU/L), birch pollen
extract-specific IgE levels (kUA/L) are displayed. IgE antibodies
specific for rBet v 1 and the Bet v 1-derived peptides were
measured by ELISA and OD (optical densities) are shown. Dashes
indicate reactivibes below the cut-off level (OD=0.050).
[0032] Table 3 summarizes immediate type skin reactions to complete
rBet v 1 and Bet v 1-derived peptides. Five birch pollen allergic
patients (#1-5) and an allergic individual without birch pollen
allergy (#6) were tested. The mean wheal diameters (mm) are
displayed for different concentrations of rBet v 1, for birch
pollen extract, histamine, the individual peptides and a mixture of
the six peptides.
[0033] Table 4. IgG reactivity of anti-peptide antisera with
complete rBet v 1 wildtype. The upper panel shows the mean IgG
reactivities (OD values) to rBet v 1 in 4 serum samples (bleeding
1: preimmune serum; bleedings 2-4: serum samples obtained in
monthly intervals) of mice which were immunized with KLH-coupled
peptides (P1-KLH to P6-KLH). In the lower panel, IgG reactivities
to rBet v 1 are shown for 3 serum samples (bleeding 1: preimmune
serum; bleedings 2-3: serum samples collected in monthly intervals)
obtained from 6 rabbits of which each was immunized with one of the
KLH-conjugated peptides.
[0034] Table 5. Crossreactivity of anti-Bet v 1 peptide antisera
with natural allergens from birch, alder, hazel and hombeam. IgG
reactivities of peptide antisera (anti-P1 to anti-P6) to pollen
extracts from birch, alder, hazel and hombeam (mean OD
values+/-SEM) are displayed for 6 groups of mice which were
immunized with Bet v 1 peptides (P1-P6).
[0035] Table 6. Rabbit anti-Bet v 1 peptide antisera inhibit serum
IgE binding of birch pollen allergic patients to rBet v 1. The
percentage inhibition of IgE binding to complete rBet v 1 obtained
with the individual anti-peptide antisera (anti-P1 to anti-P6) and
a mixture of the anti-peptide antisera (anti-P1 to anti-P6) are
displayed for sera from 60 birch pollen allergic patients. The
bottom line summarizes the mean percentages of inhibition obtained
for all serum samples.
[0036] FIG. 1 shows 1H 1 D-spectra of the amide regions of the six
peptides. The spectra were recorded at 20.degree. C. on a 600 MHz
spectrometer.
[0037] FIG. 2 shows induction of histamine release from basophils
of a birch pollen allergic patient. Granulocytes of a birch pollen
allergic patient were incubated with various concentrations
(x-axis) of rBet v 1 wildtype, Bet v 1 derived peptides (P1, P2,
P3, P4, P5, P6) and an equimolar mix of the 6 peptides (P1-P6). The
percentage of histamine released into the cell-free culture
supernatant is displayed on the y-axis.
[0038] FIG. 3 shows the reactivity of peptide antisera with
nitrocellulose-blotted natural Bet v 1. Nitrocellulose-blotted
birch pollen extract was incubated with sera from six
peptide-immunized mice (lanes i; panels 1-6: peptides 1-6). Lanes p
show the corresponding preimmune sera. The position of nBet v 1 (17
kDa) is indicated.
[0039] The following examples further illustrate the invention.
EXAMPLE 1
Characteristics of Six Synthetic Peptides Spanning the Surface of
the Bet v 1 Allergen
[0040] Six Bet v 1-derived peptides of a length between 25 (P1:
2809.3 Dalton) to 32 (P5: 3556.1 Dalton) amino acids spanning
solvent-exposed areas of the Bet v 1 molecule were selected
according to the three-dimensional structure of Bet v 1 determined
by x-ray crystallography and NMR (Gajhede, M. et al. (1996 X-ray
and NMR structure of Bet v 1, the origin of birch pollen allergy.
Nat. Struct. Biol. 3, 1040-1045).
[0041] The isoelectric points calculated for the 6 peptides ranges
from 4.70 (P6) to 8.63 (P2) (Table 1). Three of the peptides (P4,
P5, P6) comprise sequence motifs which were found to stimulate Bet
v 1-specific human T cells whereas the other three peptides (P1,
P2, P3) do not contain Bet v 1-specific T cell epitopes (Table
1).
TABLE-US-00001 TABLE 1 Characteristics of non-allergenic Bet v 1 -
derived synthetic peptides Isoelectric Position Number Molecular
Point Fold T cell Agadir aa Sequence of aa Weight (pI) (NMR)
epitope % Peptide 1 1-24 MGVFNYETETTSVIPAARLFKAFIC 25 2809.3 6.28 -
- 0.86 Peptide 2 30-59 LFPKVAPQAISSVENIEGNGGPGTIKKISFC 31 3202.7
8.63 - - 0.56 Peptide 3 50-79 CGPGTIKKISFPEGFPFKYVKDRVDEVDH TN 31
3525 7.00 - - 0.5 Peptide 4 110-139 DGGSILKISNKYHTKGDHEVKAEQVKASKEC
31 3400.8 8.44 - + 0.85 Peptide 5 130-160
CKAEQVKASKEMGETLLRAVESYLLAHSDAYN 32 3556.1 5.49 +/- + 12.09 Peptide
6 75-104 CVDHTNFKYNYSVIEGGPI GDTLEK I SNEIK 31 3484.9 4.70 - +
1
a) Peptide Synthesis
[0042] Peptides were synthesized using Fmoc
(9-fluorenylmethoxycarbonyl)-strategy with HBTU
(2-(1H-Benzotriazol-1-yl) 1,1,3,3 tetramethyluronium
hexafluorophosphat)-activation (0.1 mmol small-scale cycles) on the
Applied Biosystems peptide synthesizer Model 433A (Foster City,
Calif.). Preloaded PEG-PS (polyethylenglycol polysterene) resins
(0.15-0.2 mmol/g loading) (Per Septive Biosystems, Warrington, UK)
were used as solid phase to build up the peptides. Chemicals were
purchased from Applied Biosystems. Coupling of amino acids was
confirmed by conductivity monitoring in a feedback control system.
One cysteine residue was added to each peptide to facilitate
coupling of the peptides to carriers. Peptides were cleaved from
the resins with a mixture of: 250 .mu.l dest. water, 250 .mu.l
Triisopropylsilan (Fluka, Buchs, Switzerland), 9.5 ml TFA for 2 h
and precipitated in tert-Butylmethylether (Fluka, Buchs,
Switzerland). The identity of the peptides was checked by
mass-spectrometry and they were purified to >90% purity by
preparative HPLC (PiChem, Graz, Austria).
b) Secondary Structure Analysis
[0043] The six Bet v 1-derived peptides resemble almost all primary
structure elements of the Bet v 1 allergen but according to AGADIR
prediction and NMR analysis lack secondary structure. The AGADIR
program is based on the helix-to-coil transition theory and
estimates the propensity of a sequence to adopt an alpha-helical
conformation irrespective of other secondary structures (Munoz, V.
& Serrano, L. (1994) Elucidating the folding problem of helical
peptides using empirical parameters. Nat. Struct. Biol. 1,
399-409). It has been shown to correctly estimate the helical
behavior of a database of peptides as compared to CD (circular
dichroism) and NMR data. Because it calculates the helical tendency
for each amino acid in a given sequence, AGADIR may predict both
the average helical population of a peptide and the propensity to
populate the helical conformation for each residue. Results from
these calculations are reported in Table 1. Of the peptides, only
P5 shows an appreciable tendency to form a helical
conformation.
c) NMR Analysis
[0044] NMR was then used to check for residual secondary or
tertiary structure. Compared to other spectroscopical approaches,
this technique has the advantage that it provides positional
information along the sequence.
[0045] Peptides were examined for tertiary and/or secondary
structure by one and two-dimensional nuclear magnetic resonance
(NMR) on a UNITY VARIAN 600 MHz spectrometer equipped with
z-shielded gradient coils using 0.8-1.0 mM samples in 90%
H.sub.2O/10% D20, 20 mM potassium phosphate buffer pH 7.0, at
20.degree. C. Water suppression was achieved with WATERGATE. Mixing
times used were 70 ms and 150 or 200 ms for TOCSY and NOESY
experiments, respectively.
[0046] The appearance of the 1D experiments clearly shows absence
of tertiary structure in all of the six peptides: all the
resonances have poor spectral dispersion as expected for a mixture
of amino acids or peptides without tertiary fold (FIG. 1). The
absence of ring current shifted peaks in the region of the spectra
below 0.5 ppm typical of well folded proteins is also a feature
common to the spectra of the Bet v 1 peptides (data not shown).
However, the spectrum of P5 contains unusually broad resonances
suggesting aggregation of this peptide. This peptide (P5), that in
the Bet v 1 structure spans the whole C-terminal helix probably
tends to form helical structures that aggregate in water
solution.
EXAMPLE 2
Surface Exposed Bet v 1-Derived Peptides Lack IgE Binding Capacity
and Allergenic Activity
a) IgE Binding Capacity
[0047] The IgE binding capacity of the six Bet v 1-derived peptides
was compared with that of the complete rBet v 1 wildtype allergen
using sera from 60 birch pollen allergic patients (Table 2).
Characterization of Allergic Patients and Patients Sera:
[0048] Birch pollen allergic patients suffering from allergic
rhinoconjunctivitis and/or asthma to birch pollen and related
allergens were selected according to case history indicative for
seasonal birch pollinosis and characterized by skin prick testing
with birch pollen extract and serological CAP RAST (Pharmacia
Diagnostics, Uppsala, Sweden) testing. Total IgE levels in the sera
were determined by CAP RIST measurements (Pharmacia). IgE
antibodies specific for rBet v 1 were determined by ELISA
(Niederberger et al. (1998) IgE antibodies to recombinant pollen
allergens (PhI p 1, Phi p 2, Phi p 5, and Bet v 2) account for a
high percentage of grass pollen-specific IgE. J. Allergy Clin.
Immunol. 101, 258-264). Sera from 60 birch pollen allergic patients
and a non-atopic individual were used for IgE competition studies.
The birch pollen allergic patients group consisted of 25 males and
35 females with a mean age of 37 years (ranging from 19-60 years)
(Table 2).
Result:
[0049] Total IgE levels and IgE levels specific for birch pollen
extract ranged from 24-2000 kU/L (mean: 300) and 3-100 kUA/L (mean:
47), respectively. All patients contained rBet v1-specific IgE
antibodies ranging between 0.081-2.530 OD units (mean: 1.416 OD
units) (Table 2). When tested for IgE reactivity to ELISA plate
bound peptides (P1-P6) no serum showed significant IgE reactivity
above the cut off level determined with serum from a non-atopic
person (NHS) (Table 2).
TABLE-US-00002 TABLE 2 Serological characterization of birch pollen
allergic patients IgE total birch Pa- IgE (kUA/ IgE (OD) tient sex
age (kU/L) L) rBet v 1 P1 P2 P3 P4 P5 P6 1 w 27 204 27.2 0.829 --
-- -- -- -- -- 2 w 54 617 69.9 1.380 -- -- -- -- -- -- 3 m 55 592
100.0 2.144 -- -- -- -- -- -- 4 w 35 109 34.9 0.701 -- -- -- -- --
-- 5 w 35 41.5 21.1 0.344 -- -- -- -- -- -- 6 m 27 1642 77.0 2.300
-- -- -- -- -- -- 7 m 24 2000 96.9 2.245 -- -- -- -- -- -- 8 m 60
235 49.6 0.950 -- -- -- -- -- -- 9 w 56 35.4 8.7 0.196 -- -- -- --
-- -- 10 w 32 46.6 5.8 0.097 -- -- -- -- -- -- 11 w 23 121 23.4
0.428 -- -- -- -- -- -- 12 m 24 122 17.6 0.271 -- -- -- -- -- -- 13
w 21 238 55.4 0.281 -- -- -- -- -- -- 14 w 26 124 41.7 0.704 -- --
-- -- -- -- 15 m 38 95.3 41.6 0.606 -- -- -- -- -- -- 16 m 37 147
11.7 0.215 -- -- -- -- -- -- 17 m 20 206 5.0 0.622 -- -- -- -- --
-- 18 w 43 135 50.9 0.663 -- -- -- -- -- -- 19 w 39 287 79.8 1.166
-- -- -- -- -- -- 20 w 50 28.1 13.2 0.249 -- -- -- -- -- -- 21 m 60
36.9 26.1 0.461 -- -- -- -- -- -- 22 w 44 59.7 23.5 0.258 -- -- --
-- -- -- 23 m 34 153 30.8 1.555 -- -- -- -- -- -- 24 w 35 84.6 16.4
0.237 -- -- -- -- -- -- 25 w 55 152 39.2 0.5 -- -- -- -- -- -- 26 m
53 31.5 8.5 0.191 -- -- -- -- -- -- 27 m 41 89.9 33.0 0.535 -- --
-- -- -- -- 28 w 37 61.6 39.8 0.492 -- -- -- -- -- -- 29 w 50 65.2
10.0 0.154 -- -- -- -- -- -- 30 m 41 260 87.5 0.061 -- -- -- -- --
-- 31 m 52 450 73.5 1.168 -- -- -- -- -- -- 32 w 34 70.2 13.7 0.195
-- -- -- -- -- -- 33 w 30 293 9.9 0.106 -- -- -- -- -- -- 34 m 24
309 32.0 0.377 -- -- -- -- -- -- 35 w 39 273 84.6 0.601 -- -- -- --
-- -- 36 m 39 257 31.1 0.306 -- -- -- -- -- -- 37 m 49 208 68.9
0.227 -- -- -- -- -- -- 38 w 46 206 79.7 1.571 -- -- -- -- -- -- 39
m 53 125 51.3 0.620 -- -- -- -- -- -- 40 w 23 121 5.7 0.084 -- --
-- -- -- -- 41 w 29 490 100.0 1.193 -- -- -- -- -- -- 42 w 51 370
100.0 1.119 -- -- -- -- -- -- 43 m 19 1234 100.0 0.363 -- -- -- --
-- -- 44 w 23 589 100.0 2.386 -- -- -- -- -- -- 45 w 25 278 54.5
0.289 -- -- -- -- -- -- 46 w 35 184 47.5 0.892 -- -- -- -- -- -- 47
m 23 207 30.2 0.381 -- -- -- -- -- -- 48 w 33 200 47.5 1.422 -- --
-- -- -- -- 49 w 24 297 23.4 0.379 -- -- -- -- -- -- 50 w 26 24
11.5 0.220 -- -- -- -- -- -- 51 m 29 543 100.0 0.307 -- -- -- -- --
-- 52 w 48 178 17.5 0.208 -- -- -- -- -- -- 53 w 33 152 100.0 1.256
-- -- -- -- -- -- 54 w 36 187 64.7 1.310 -- -- -- -- -- -- 55 m 26
2000 100.0 2.489 -- -- -- -- -- -- 56 m 35 1733 100.0 2.530 -- --
-- -- -- -- 57 w 28 270 62.5 0.741 -- -- -- -- -- -- 58 m 41 80 3.0
0.072 -- -- -- -- -- -- 59 m 49 41.9 12.9 0.168 -- -- -- -- -- --
60 w 35 84.6 16.4 0.237 -- -- -- -- -- -- NHS w 40 5 <0.35 0.048
-- -- -- -- -- --
b) Histamine Release
[0050] Next the Bet v 1-derived peptides were compared with
complete rBet v 1 for their capacity to induce histamine release
from basophilic granulocytes of 3 birch pollen allergic
individuals.
Basophil Histamine-Release Assay:
[0051] Granulocytes were isolated from heparinized blood samples of
3 birch pollen allergic individuals by dextran sedimentation
(Valent, P. et al. (1989) Interleukin 3 activates human blood
basophils via high-affinity binding sites. Proc. Natl. Sci. USA 86,
5542-5547). Cells were incubated with increasing concentrations
(10.sup.-3-10 .mu.g/ml) of each peptide, an equimolar mix of the 6
peptides, and, for control purposes, with complete rBet v 1.
Histamine released in the cell-free culture supernatant was
measured by radioimmunoassay (Immunotech, Marseille, France). Total
histamine was determined after freezing and thawing of cells.
Results are displayed as mean values of triplicate
determinations.
Result:
[0052] As exemplified in FIG. 2 it was found that none of the
peptides induced release of histamine up to concentrations of 10
.mu.g/ml whereas complete rBet v 1 wildtype induced a
dose-dependent release of histamine with a maximum release already
at a concentration of 1 ng/ml.
c) Allergenic Activity In Vivo
[0053] In vivo testing in birch pollen allergic patients confirmed
the lack of allergenic activity of the Bet v 1-derived
peptides.
Skin Prick Testing of Allergic Patients:
[0054] The in vivo allergenic activity of the peptides was studied
by skin prick testing (SPT) in 5 birch pollen allergic patients and
a non-atopic grass pollen allergic patient without birch pollen
allergy. SPTs were performed on the individuals forearms as
described (Vrtala, S. et al. (1997) J. Clin Invest 99, 1673-168;
Dreborg S: (1989) J. Am. Acad. Dermatol. 21, 820-821). Twenty
microliter aliquots containing 6 concentrations of complete rBet v
1 (0.78 .mu.g/ml, 1.56 .mu.g/ml, 3.12 .mu.g/ml, 6.25 .mu.g/ml, 12.5
.mu.g/ml, 25 .mu.g/ml), 100 .mu.g/ml of each peptide and an
equimolar peptide mix were applied. In addition standardized skin
prick solutions (birch pollen extract and histamine)
(Allergopharma, Reinbek, Germany) were tested. Reactions were
recorded 20 minutes after SPT by photography and by transferring
the ballpoint pen-surrounded wheal area with a scotch tape to
paper. The mean wheal diameter (Dm) was calculated by measuring the
maximal longitudinal and transversal diameter and dividing their
sum by 2.
Result:
[0055] Skin prick tests were performed in 5 birch pollen allergic
patients and an allergic individual without birch pollen allergy
with rBet v 1 and Bet v 1-derived peptides (Table 3). None of the
Bet v 1-derived peptides induced any immediate skin reaction when
applied at a concentration of 100 .mu.g/ml or as peptide mixture
containing 100 .mu.g/ml of each peptide (Table 3). Complete rBet v
1 wildtype already induced immediate type skin reactions in three
patients (Table 3: #1-3) at a concentration of <0.78 .mu.g/ml. A
concentration of 3.12 .mu.g/ml was sufficient to induce wheal
reactions in all five birch pollen allergic patients (Table 3). All
birch pollen allergic patients displayed immediate skin reactions
to birch pollen extract. The grass pollen allergic patient without
birch pollen allergy (Table 3: #6) showed no reactions to birch
pollen extract, rBet v 1 and Bet v 1-derived peptides (Table 3) but
exhibited a wheal reaction after prick testing with timothy grass
pollen extract (5.5 mm mean diameter) (data not shown). All
individuals reacted after testing with histamine, used as a
positive control (Table 3). Since local and even systemic late
phase reactions to allergens and in particular to allergen-derived
non-allergenic peptides have been reported we checked the
application sites 24-48 hours after skin prick testing but found no
evidence for peptide-induced late phase reactions in any of the
tested individuals (data not shown).
TABLE-US-00003 TABLE 3 Induction of immediate skin reaction with
rBet v 1 and Bet v 1-derived peptides mean wheal diameter rBet v 1
.mu.g/ml 100 .mu.g/ml Individual 0.19 0.39 0.78 1.56 3.12 6.25 12.5
25 birch histamine P1 P2 P3 P4 P5 P6 P1-P6 mix 1 0 2.5 4 4.5 5 6 13
n.d. 5.5 5 0 0 0 0 0 0 0 2 0 2 3.5 5 5.5 7 7.5 8 7.5 6 0 0 0 0 0 0
0 3 n.d. n.d. 2 3 4 6 6.5 8 8 7 0 0 0 0 0 0 0 4 n.d. n.d. 0 0 2 3 4
4.5 8 5 0 0 0 0 0 0 0 5 n.d. n.d. 0 2 2.5 4 11 5 9 5.5 0 0 0 0 0 0
0 6 n.d. n.d. 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0
EXAMPLE 3
Immunization with Bet v 1-Derived Peptides Induces IgG Antibodies
Reactive with Complete Bet v 1 and Bet v 1-Related Plant
Allergens
a) Induction of IgG Antibodies
[0056] In order to test whether immunization with Bet v 1-derived
peptides will induce IgG antibodies that react with the complete
Bet v 1 molecule and Bet v 1-related allergens mice and rabbits
were immunized with the KLH-conjugated peptides using different
adjuvants (Aluminiumhydroxide, Freund's adjuvant).
Immunization of Mice and Rabbits:
[0057] HPLC-purified peptides were coupled to KLH (keyhole limpet
hemocyanin, MW 4.5.times.10.sup.3-1.3.times.10.sup.7, Pierce,
Rockford, Ill.) according to the manufacturers advice and purified
using a Conjugation Kit (Sigma, St. Louis). KLH-conjugated peptides
were used to immunize mice and rabbits using Al(OH).sub.3 and CFA
as adjuvant, respectively. Six week old female BALB/c mice were
purchased from Charles River (Kislegg, Germany). Animals were
maintained in the animal care unit of the Department of
Pathophysiology, University of Vienna, according to the local
guidelines for animal care. Groups of 5 animals were immunized with
conjugated and unconjugated peptides adsorbed to AluGel (Serva,
Heidelberg, Germany). Each mouse received four 100 .mu.l-injections
(20 .mu.g peptide or peptide-KLH conjugate adsorbed to 15 .mu.g of
Al(OH).sub.3) subcutaneously in the neck in four week intervals.
Shortly before each injection and four weeks after the last
immunization, mice were bled from the tail veins. Sera were stored
at -20.degree. C. until analysis.
[0058] In parallel six rabbits were immunized with one of the
peptide-KLH conjugates (200 .mu.g/injection) using Freunds complete
and incomplete adjuvants (Charles River, Ki.beta.legg, Germany).
Serum samples were obtained in four week intervals.
Crossreactivity of Anti-Peptide Antisera:
[0059] Reactivity of peptide-induced IgG antibodies to rBet v 1,
natural Bet v 1 and Bet v 1-related pollen and plant food allergens
was studied by ELISA and immunoblotting. For ELISA detection,
plates (Nunc Maxisorp, Roskilde, Denmark) were coated with pollen
allergen extracts (100 .mu.g/ml: Betula verrucosa, Alnus glutinosa,
Corylus avellana and Carpinus betulus) or purified allergens (5
.mu.g/ml: rBet v 1). ELISA plates were washed and blocked as
described (Niederberger, V. et al. (1998). J. Allergy Clin.
Immunol. 101, 258-264) and subsequently incubated with mouse
anti-peptide antisera diluted 1:500. Bound mouse IgG.sub.1
antibodies were detected with a monoclonal rat anti mouse IgG.sub.1
antibody (Pharmingen, San Diego, Calif.) diluted 1:1000 followed by
a 1:2000 diluted HRP-coupled sheep anti-rat Ig antiserum (Amersham
Pharmacia Biotech, Uppsala, Sweden). Results represent means of
duplicate determination with an error of <5% and are displayed
as means+/-SEM for the group of 5 mice. ELISAs with rabbit
anti-peptide antisera were performed as described for the mouse
sera with the exception that rabbit sera were diluted 1:1000 and
bound rabbit antibodies were detected with a HRP-coupled goat
anti-rabbit Ig antiserum (Jackson Immunresearch, Pennsylvania).
[0060] Immunoblotting experiments were performed with
nitrocellulose-blotted allergens. Pollen extracts and plant food
extracts were separated by 12.5% preparative SDS-PAGE (12 .mu.g/cm
gel) and blotted onto nitrocellulose membranes (Schleicher &
Schuell, Dassel, Germany). Nitrocellulose membranes were exposed to
1:1000 diluted rabbit sera (preimmune, immune sera) and in certain
experiments, with sera from mice which were immunized with
unconjugated Al(OH).sub.3-adsorbed peptides. Bound rabbit
antibodies were detected with a 1:2000 diluted .sup.125I-labeled
donkey anti-rabbit IgG antiserum (Amersham Pharmacia Biotech).
Bound mouse antibodies were detected with a 1:2500 diluted rabbit
anti-mouse IgG antiserum (Jackson Immunresearch) followed by 1:2000
diluted 125-labeled donkey anti-rabbit IgG antiserum
(Amersham).
Result:
[0061] Table 4A shows the development of IgG anti-rBet v 1 antibody
responses in groups of mice which were immunized with
Al(OH).sub.3-adsorbed, KLH-conjugated peptides. All 6 peptides
induced IgG anti-rBet v 1 antibody responses which could be
detected 4-8 weeks after the first immunization (Table 4A: bleeding
2-3). Peptide-induced IgG anti-rBet v 1 responses constantly
increased during the immunization. Using unconjugated peptides,
anti-rBet v 1 IgG antibody responses could be induced, albeit of a
lower magnitude (data not shown).
[0062] Similar results were obtained after immunization of rabbits
with KLH-conjugated peptides which were administered s. c. together
with Freund's adjuvant (Table 4B). All 6 peptides induced IgG
anti-rBet v 1 antibody responses which increased during the course
of immunization. Peptide-induced mouse IgG antibodies reacted also
with nitrocellulose-blotted pollen-derived natural Bet v 1 whereas
no signals were obtained with the corresponding preimmune sera
(FIG. 3).
TABLE-US-00004 TABLE 4 IgG reactivity of mouse anti-peptide
antisera with rBet v 1 P1- P6- bleeding KLH P2-KLH P3-KLH P4-KLH
P5-KLH KLH 1 0.040 0.040 0.040 0.040 0.042 0.040 2 0.057 0.335
1.150 0.433 0.872 0.152 3 0.289 0.858 1.380 1.177 1.621 0.705 4
0.394 1.182 2.025 1.965 2.274 1.337
TABLE-US-00005 IgG reactivity of rabbit anti-peptide antisera with
rBet v 1 P1- P6- bleeding KLH P2-KLH P3-KLH P4-KLH P5-KLH KLH 1
0.170 0.044 0.046 0.044 0.033 0.051 2 0.642 0.702 0.511 0.501 0.917
0.997 3 0.751 1.201 0.961 0.926 1.503 0.751
b) Reactivity of Induced IgG Antibodies with Bet v 1-Related Plant
Allergens
[0063] Next it was investigated whether anti-Bet v 1 peptide
antisera crossreact with Bet v 1-related allergens present in
pollens of alder, hazel and hornbeam.
Allergen Extracts:
[0064] Pollen from trees of the order Fagales (birch: Betula
verrucosa; alder Alnus glutinosa; hazel: Corylus avellana;
hornbeam: Carpinus betulus) were purchased from Allergon (Valinge,
Sweden). Aqueous pollen extracts were prepared and checked for
quantity and quality of proteins by SDS-PAGE and Coomassie blue
staining (Vrtala, S. et al. (1993) Int. Arch. Allergy Immunol. 102,
160-169). Purified recombinant Bet v 1 was purchased from BIOMAY
(Linz, Austria).
Result:
[0065] Table 5 shows that almost all anti-Bet v 1 peptide antisera
contained IgG antibodies to natural Bet v 1 and Bet v 1-related
Fagales pollen allergens. Only anti-peptide 4 antibodies showed
weak reactivity with the major hazel pollen allergen, Cor a 1, and
anti-peptide 6 antibodies reacted weakly with the major alder and
hazel pollen allergen, Aln g 1 and Cor a 1, respectively.
TABLE-US-00006 TABLE 5 Crossreactivity of anti-Bet v 1 peptide
antisera with natural allergens from birch, alder, hazel and
hornbeam anti-P1 anti-P2 anti-P3 anti-P4 anti-P5 anti-P6 birch
0.301 .+-. 0.198 0.841 .+-. 0.465 1.330 .+-. 0.172 1.135 .+-. 0.312
1.945 .+-. 0.329 0.898 .+-. 0.434 alder 0.307 .+-. 0.232 0.875 .+-.
0.453 0.619 .+-. 0.314 0.330 .+-. 0.265 1.613 .+-. 0.477 0.084 .+-.
0.032 hazel 0.217 .+-. 0.200 0.350 .+-. 0.297 0.071 .+-. 0.018
0.073 .+-. 0.022 1.239 .+-. 0.397 0.060 .+-. 0.007 hornbeam 0.253
.+-. 0.209 0.559 .+-. 0.373 0.183 .+-. 0.117 0.233 .+-. 0.145 1.369
.+-. 0.234 0.449 .+-. 0.490
EXAMPLE 4
Anti-Peptide Antisera Inhibit the Binding of Birch Pollen Allergic
Patients IgE to Complete Bet v 1
[0066] The capacity of anti-Bet v 1 peptide antibodies to inhibit
the binding of allergic patients IgE to complete rBet v 1 was
studied by ELISA competition using sera from 60 birch pollen
allergic patients' (Tables 2 and 6).
[0067] ELISA Detection of Peptide and rBet v 1-Specific IgE
Antibodies:
[0068] inhibition of allergic patients IgE binding to rBet v 1 by
peptide-induced IgG. ELISA plates (Nunc Maxisorp, Roskilde,
Denmark) were coated with Bet v 1-derived peptides (5 .mu.g/ml) or
rBet v 1 as control (5 .mu.g/ml), washed and blocked as described
in Example 3. Subsequently, plates were incubated with 1:3 diluted
sera from 60 birch pollen allergic patients and from a non-atopic
individual overnight at 4.degree. C. Bound IgE antibodies were
detected with a 1:1000 diluted alkaline-phosphatase-coupled mouse
monoclonal anti-human IgE antibody (Pharmingen, San Diego,
Calif.).
[0069] The ability of peptide-induced rabbit Ig to inhibit the
binding of allergic patients' IgE to complete rBet v 1 was
investigated by ELISA competition assay as described (Denepoux et
al. (2000) FEBS Lett. 465, 39-46). ELISA plates were coated with
rBet v 1 (1 .mu.g/ml) and preincubated either with a 1:250 dilution
of each of the anti-peptide antisera (anti-P1-anti-P6), a mixture
containing equal volumes of the anti-peptide antisera and, for
control purposes, with the corresponding preimmune sera and a
mixture of the preimmune sera as described. After washing plates
were incubated with 1:3 diluted sera from 60 birch pollen allergic
patients and bound IgE antibodies were detected with the alkaline
phosphatase-coupled mouse monoclonal anti-human IgE antibody
(Pharmingen). The percentage inhibition of IgE binding achieved by
preincubation with the anti-peptide antisera was calculated as
follows: % inhibition of IgE
binding=100-OD.sub.I/OD.sub.P.times.100. OD.sub.I and OD.sub.P
represent the extinctions after preincubation with the rabbits
immune and preimmune serum, respectively.
Result:
[0070] All birch pollen allergic patients tested exhibited
immediate type skin reactions to birch pollen extract. For all but
three sera (serum #9, 10, 38), preincubation with peptide-induced
rabbit IgG inhibited considerably the binding of human IgE to Bet v
1. The strongest inhibition of IgE binding was observed after
preincubation with anti-P2 (68% average inhibition), anti-P6 (60%
average inhibition), anti-P3 (53.6% average inhibition) and anti-P5
(41.6% average inhibition). Anti-P4 antibodies exhibited a lower
capacity to inhibit serum IgE binding to Bet v 1 (average
inhibition 28.5%) and anti-P1 antibodies raised against the
N-terminus of Bet v 1 weakly inhibited IgE binding to Bet v 1
(average inhibition 11.4%). Interestingly, a mixture of anti-P1 to
anti-P6 antibodies did not exhibit a stronger inhibition of IgE
binding (average Inhibition 56.9%) than antibodies induced against
single peptides (e.g., anti-P2-, anti-P6 antibodies) (Table 6). No
association between the levels of rBet v 1-specific IgE in the sera
and the degree of inhibition of IgE binding by the anti-peptide
antisera was observed.
TABLE-US-00007 TABLE 6 Rabbit anti-Bet v 1 peptide antisera inhibit
serum IgE binding of birch pollen allergic patients to rBet v 1 %
inhibition anti- Patient anti-P1 anti-P2 anti-P3 anti-P4 anti-P5
anti-P6 P1-6 1 16 82 76 59 72 80 86 2 0 88 78 49 70 76 85 3 16 92
86 50 76 85 92 4 39 66 47 28 38 60 67 5 0 75 44 60 31 62 48 6 0 88
75 38 59 76 90 7 20 92 80 40 68 86 93 8 17 68 69 44 66 65 67 9 13 0
0 0 0 0 0 10 0 0 0 0 0 0 0 11 34 70 55 0 13 56 62 12 10 44 41 24 27
28 0 13 18 54 62 31 33 53 0 14 12 72 51 0 52 61 48 15 0 51 6 18 14
51 6 16 13 81 56 27 52 72 69 17 13 87 75 48 46 80 86 18 15 89 73 44
65 85 90 19 46 82 35 0 51 61 92 20 0 85 61 34 59 77 84 21 14 69 54
13 44 56 53 22 0 72 62 35 52 65 71 23 17 86 74 51 69 81 87 24 11 68
39 19 43 51 37 25 15 83 73 48 67 77 78 26 8 51 37 31 29 51 0 27 0
79 65 33 60 78 84 28 5 72 59 17 45 70 75 29 0 66 44 21 38 41 33 30
0 40 18 0 0 31 13 31 6 79 80 25 66 46 82 32 7 79 67 38 51 68 78 33
0 22 21 4 20 21 0 34 0 62 44 7 47 51 65 35 0 72 57 16 45 64 61 36
13 69 52 12 46 57 54 37 2 22 23 7 12 14 0 38 0 0 0 0 0 0 0 39 0 89
66 0 50 80 87 40 9 78 63 32 61 79 68 41 16 90 80 64 49 87 91 42 11
89 76 49 45 79 86 43 25 80 69 28 3 81 74 44 0 67 28 17 8 50 62 45
23 82 73 37 76 76 80 46 23 84 85 47 76 82 86 47 5 73 64 18 32 60 42
48 7 82 65 38 20 71 83 49 2 74 68 38 56 63 48 50 13 64 42 35 29 62
58 51 20 47 42 15 0 28 27 52 14 55 38 35 15 48 13 53 7 87 69 52 34
80 85 54 37 82 81 71 79 78 74 55 16 82 52 29 39 72 85 56 21 87 74
51 61 81 68 57 30 75 80 45 55 66 65 58 4 23 0 0 0 28 9 59 7 62 43
17 41 59 13 60 11 68 39 19 43 51 37 mean 11.4 68.0 53.6 28.5 41.6
60.0 56.9
Sequence CWU 1
1
6125PRTArtificial SequenceDescription of Artificial Sequence
solvent-exposed peptide 1Met Gly Val Phe Asn Tyr Glu Thr Glu Thr
Thr Ser Val Ile Pro Ala 1 5 10 15Ala Arg Leu Phe Lys Ala Phe Ile
Cys 20 25231PRTArtificial SequenceDescription of Artificial
Sequence solvent-exposed peptide 2Leu Phe Pro Lys Val Ala Pro Gln
Ala Ile Ser Ser Val Glu Asn Ile 1 5 10 15Glu Gly Asn Gly Gly Pro
Gly Thr Ile Lys Lys Ile Ser Phe Cys 20 25 30331PRTArtificial
SequenceDescription of Artificial Sequence solvent-exposed peptide
3Cys Gly Pro Gly Thr Ile Lys Lys Ile Ser Phe Pro Glu Gly Phe Pro 1
5 10 15Phe Lys Tyr Val Lys Asp Arg Val Asp Glu Val Asp His Thr Asn
20 25 30431PRTArtificial SequenceDescription of Artificial Sequence
solvent-exposed peptide 4Asp Gly Gly Ser Ile Leu Lys Ile Ser Asn
Lys Tyr His Thr Lys Gly 1 5 10 15Asp His Glu Val Lys Ala Glu Gln
Val Lys Ala Ser Lys Glu Cys 20 25 30532PRTArtificial
SequenceDescription of Artificial Sequence solvent-exposed peptide
5Cys Lys Ala Glu Gln Val Lys Ala Ser Lys Glu Met Gly Glu Thr Leu 1
5 10 15Leu Arg Ala Val Glu Ser Tyr Leu Leu Ala His Ser Asp Ala Tyr
Asn 20 25 30631PRTArtificial SequenceDescription of Artificial
Sequence solvent-exposed peptide 6Cys Val Asp His Thr Asn Phe Lys
Tyr Asn Tyr Ser Val Ile Glu Gly 1 5 10 15Gly Pro Ile Gly Asp Thr
Leu Glu Lys Ile Ser Asn Glu Ile Lys 20 25 30
* * * * *