U.S. patent application number 11/542774 was filed with the patent office on 2008-12-11 for method of passive immunization.
This patent application is currently assigned to The Rockefeller University. Invention is credited to Jason D. Bannan, Kumar Visvanathan, John B. Zabriskie.
Application Number | 20080305109 11/542774 |
Document ID | / |
Family ID | 25277036 |
Filed Date | 2008-12-11 |
United States Patent
Application |
20080305109 |
Kind Code |
A1 |
Bannan; Jason D. ; et
al. |
December 11, 2008 |
Method of passive immunization
Abstract
This invention relates to compositions and methods which provide
protection against, or reduce the severity of toxic shock and
septic shock from bacterial infections. More particularly it
relates to peptides derived from homologous sequences of the family
of staphylococcal and streptococcal toxins, which may be polymeric,
and carrier-conjugates thereof. The invention also relates to serum
antibodies induced by the peptides and carrier-conjugates and their
use to prevent, treat, or protect against the toxic effects of
most, if not all, of the staphylococcal and streptococcal toxins.
The invention also relates to diagnostic assays and kits to detect
the presence of staphylococcal and streptococcal toxins, or
antibodies thereto. The invention also relates isolated and
purified to nucleic acids encoding the peptides of the invention
and Transformed host cells containing those nucleic acids.
Inventors: |
Bannan; Jason D.;
(Centreville, VA) ; Visvanathan; Kumar; (New York,
NY) ; Zabriskie; John B.; (New York, NY) |
Correspondence
Address: |
COOPER & DUNHAM, LLP
1185 AVENUE OF THE AMERICAS
NEW YORK
NY
10036
US
|
Assignee: |
The Rockefeller University
|
Family ID: |
25277036 |
Appl. No.: |
11/542774 |
Filed: |
October 3, 2006 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
09335581 |
Jun 18, 1999 |
7115268 |
|
|
11542774 |
|
|
|
|
09168303 |
Oct 7, 1998 |
|
|
|
09335581 |
|
|
|
|
PCT/US98/06663 |
Apr 1, 1998 |
|
|
|
09168303 |
|
|
|
|
08838413 |
Apr 7, 1997 |
6075119 |
|
|
PCT/US98/06663 |
|
|
|
|
Current U.S.
Class: |
424/139.1 |
Current CPC
Class: |
A61P 31/00 20180101;
A61K 38/00 20130101; C07K 16/1275 20130101; C07K 16/1271 20130101;
A61P 31/04 20180101; C07K 14/315 20130101; C07K 14/31 20130101;
A61P 43/00 20180101; A61K 39/00 20130101; A61P 37/04 20180101 |
Class at
Publication: |
424/139.1 |
International
Class: |
A61K 39/40 20060101
A61K039/40; A61P 31/04 20060101 A61P031/04 |
Claims
1-19. (canceled)
20. A method of passively immunizing a mammal against the toxic
effects of staphylococcal and streptococcal toxins comprising
administering in vivo to the mammal an immunologically sufficient
amount of an antibody directed to a peptide comprising a consensus
amino acid sequence selected from the group consisting of
X.sub.25X.sub.26YGGX.sub.1TX.sub.2X.sub.3X.sub.4X.sub.5N (SEQ ID
NO: 28) and
KX.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11X.sub.12X.sub.13DX.sub.1-
4X.sub.15X.sub.16RX.sub.17X.sub.8X.sub.27X.sub.19X.sub.20X.sub.21X.sub.22X-
.sub.23X.sub.24Y (SEQ ID NO:29), wherein X.sub.1, X.sub.8, X.sub.13
and X.sub.24 are each independently selected from the group
consisting of L, I and V; X.sub.2, X.sub.4, X.sub.5, X.sub.6,
X.sub.7, X.sub.9, X.sub.10, X.sub.11, X.sub.12, X.sub.14, X.sub.15,
X.sub.16, X.sub.17, X.sub.18 X.sub.19, X.sub.20, X.sub.21,
X.sub.22, and X.sub.23 are each independently selected from the
group consisting of any amino acid; X.sub.3, X.sub.25 and X.sub.26
are each independently selected from the group consisting of any
amino acid and of no amino acid; and X.sub.27 is selected from the
group consisting of L and Y.
21. A method of claim 20 wherein said antibody is directed to a
peptide having a sequence selected from the group consisting of SEQ
ID NO:4; SEQ ID NO:5; SEQ ID NO:6; SEQ ID NO:7; and SEQ ID
NO:8.
22. The method of claim 21 wherein the peptide comprises the amino
acid sequence TABLE-US-00012 (SEQ ID NO:8)
CMYGGVTEHEGNKKNVTVQELDYKIRKYLVDNKKLYGC.
23. The method of claim 20 wherein the antibody is administered at
a dose in the range of from about 1 mg/kg to about 10 mg/kg body
weight of the mammal.
24. The method of claim 20 wherein the mammal is a human.
25-49. (canceled)
50. The method of claim 21 wherein the antibody is administered at
a dose in the range of from about 1 mg/kg to about 10 mg/kg body
weight of the mammal.
51. The method of claim 21 wherein the mammal is a human.
Description
RELATED APPLICATIONS
[0001] This is a continuation-in-part application of co-pending
U.S. application Ser. No. 09/168,303 filed Oct. 7, 1998, which is
in turn a continuation-in-part of co-pending U.S. application Ser.
No. 08/838,413 filed Apr. 7, 1997. Pursuant to 35 USC 365, U.S.
application Ser. No. 09/168,303 is also a continuation-in-part of
co-pending International Application PCT/US98/06663, filed Apr. 1,
1998. The entire disclosure of U.S. application Ser. No. 08/838,413
and U.S. application Ser. No. 09/168,303 are incorporated herein by
reference.
FIELD OF THE INVENTION
[0002] This invention relates to compositions and methods for
protecting against, or reducing the severity, of toxic shock
syndrome and septic shock from bacterial infections. More
particularly it relates to peptides, which may be polymeric, and
carrier-conjugates thereof, derived from homologous sequences of
the family of staphylococcal and streptococcal pyrogenic toxins.
The peptides of the invention are useful to prevent, treat, or
protect against the toxic effects of bacterial toxins, including
most, if not all, of the staphylococcal and streptococcal pyrogenic
toxins. These are also useful to induce serum antibodies and Ray
also be useful in diagnostic assays.
[0003] The invention also relates to antibodies induced by the
peptides and/or carrier-conjugates and their use to prevent, treat,
or protect against the toxic effects of bacterial toxins, including
most, if not all, of the staphylococcal and streptococcal pyrogenic
toxins.
[0004] The invention also relates to compositions and methods to
protect against, or ameliorate the effects of, autoimmune diseases
which are associated with, or are the result of, the presence of
staphylococcal or streptococcal toxins.
[0005] The invention also relates to diagnostic assays and kits to
detect the presence of staphylococcal and streptococcal pyrogenic
toxins, or antibodies thereto.
[0006] The invention also relates to isolated and purified nucleic
acids encoding the peptides of the invention and transformed host
cells containing those nucleic acids.
BACKGROUND OF THE INVENTION
[0007] The pyrogenic exotoxins of Group A streptococci and the
enterotoxins of Staphylococcus aureus, which are also pyrogenic
exotoxins, constitute a family of structurally related toxins which
share similar biological activities (11, 13). The staphylococcal
and streptococcal pyrogenic exotoxins also share significant amino
acid homology throughout their sequences (11, 19, 40). This
pyrogenic exotoxin family contains nine main toxin types, and
several allelic variants (subtypes) have been described. Several
studies have shown that the toxins share common motifs based on
immunologic cross reactivity between the toxins (26, 27). They
stimulate CD4.sup.+, CD8.sup.+ and .gamma..delta..sup.+ T cells by
a unique mechanism. These toxins share the ability to bind the
.beta. chain variable region (V.sub..beta.) elements on the lateral
face of the T cell receptor (TCR) and simultaneously bind to the
lateral face of the class II major histocompatibility complex (MHC)
of antigen presenting cells (FIG. 1), causing an aberrant
proliferation of specific T-cell subsets (3, 4, 12). This property
of the toxins has labeled them as "superantigens" (36) since they
do not interact with the MHC and TCR molecules in the manner of
conventional antigens (14, 18) and produce a massive proliferation
of T cells.
[0008] The variability of the sequences in the TCR-binding region
and within the MHC-II-binding regions most likely provides the
different superantigen toxins their specificities for different
V.sub..beta. molecules and variable affinities for MHC-II
types.(69-70)
[0009] The cross-linking of TCR with MHC-II molecules by
superantigens causes a profound blastogenesis of lymphocytes and
antigen-presenting cells. The resulting stimulation of leukocytes
leads to a significant increase in cytokine production.
[0010] Monocytes stimulated with bacterial superantigens produce
the Th1 cytokines IL-2 and IFN-.gamma. and the anti-inflammatory
cytokines IL-10 and IL-1 receptor antagonist. (71). T cells
activated by superantigen stimulation produce IL-12. (72). Whole
preparations of peripheral blood mononuclear cells containing
lymphocytes and antigen-presenting cells elicited a wide range of
inflammatory cytokines in significant amounts. The generation of
monocyte cytokines such as IL-1, IL-6, TNF-.alpha., and TNF-.beta.
was dependent on the presence of T cells. (73).
[0011] Costimulatory molecules important in conventional immune
responses also play a significant role in the response of immune
cells to superantigens. The costimulatory T cell antigen, CD28, and
its corresponding ligand on MHC-II-bearing cells, B7, contribute to
superantigen mitogenicity. (74, 75). Other costimulatory molecules,
such as LFA-1/ICAM-1 and VLA-4/VCAM-1, also contribute to the
activation of immune cells by superantigens. (76, 77). These
immunostimulatory activities of superantigens are crucial to their
ability to cause injury to the host.
[0012] The bacterial toxins cause a variety of syndromes in humans.
Staphylococcal enterotoxins have been implicated in staphylococcal
food poisoning (26), as well as toxic shock like syndromes (1). The
gene sequences and deduced amino acid sequences of at least six
staphylococcal enterotoxins ("SE"): A, B, C, D, E and H, are known,
i.e., SEA, SEB, SEC, SED, SEE, and SEH (19, 23). The streptococcal
pyrogenic exotoxins ("SPE") have been implicated in causing the
symptoms of scarlet fever and toxic shock like syndrome (3, 20,
30). The sequences of three members of this family are known: SPEA,
SPEC, and SSA (5, 23, 35).
[0013] Toxic shock syndrome toxin (TSST-1) from S. aureus shares
similar biological activity with the SE's and SPE's, however amino
acid sequences of this toxin are significantly different from these
two classes of toxins (2). Structural analysis suggests that,
despite the differences in amino acid composition, the overall
topology of TSST-1 and the SE/SPE family of toxins is similar (41).
The molecular structure of SE's and SPE's has been determined by
various methods. Reviews concerning the molecular structures are
available (19, 62). Molecular evolution studies of the SE/SPE
family of toxins suggests that the toxins can be grouped into two
main clades(34). All these toxins are highly resistant to
denaturation by heat and to proteases. With the exception of
TSST-1, they are soluble proteins of approximately 230 amino acids
and have a central disulphide loop. In contrast TSST-1 has only 194
amino acids and does not possess any cysteines.
[0014] It has been suggested that the conservation of amino acids
is important to maintaining the structure necessary for the
biological activity of the toxins (32). Mutations constructed in
various positions throughout the SPEA and SEB molecules were
sufficient to inactivate biological activity (6, 15). Mutations at
various points throughout the molecules often had different
effects, suggesting that functional activities could not be
attributed to any one region of the toxins (7). These results
suggested that a functional tertiary structure must be maintained.
Chemical modifications of highly conserved histidine residues
inactivated biologic activity (29). The high conservation of the
disulfide loop in the SE's and SPE's suggests an important role in
the structure of the SE/SPE family of toxins. Studies show the
disulfide loop is required for mitogenic activity of SEA and SEB.
Reduction of the disulfide loop inactivated T cell stimulatory
activity, but did not affect MHC-II binding and stimulation of
monocytes (54). Peptide cleavages within the loop had no effect on
T-cell mitogenicity, however cleavage of conserved sequences
outside the loop of SEA resulted in loss of mitogenic activity. The
loop and conserved adjacent sequences appear to be associated with
avidity of the toxins to the TCR, and do not contribute to the
specificity of toxins for a particular V.sub..beta. type (6).
Residues determining TCR V.sub..beta. specificity appear to be
located within the carboxy-terminus of the SE/SPE toxins (59),
while residues critical for MHC-II binding appear to be located in
the amino-terminal region, and the central portion of the molecule
near the disulfide loop (53). The dusulfide loop and the adjacent
highly conserved sequences contribute to the structura; integrity
of the toxins, and serve to bring the TCR and MHC binding regions
in functional proximity to each other (65).
[0015] the SEs are named for their ability to induce
gastrointestinal illness upon oral intake of a few micrograms of
the toxin. The clinical effect appears in 2 to 4 hours and is
manifested by nausea and diarrhea. These symptoms appear to be
caused by leukotrienes and histamine released from mast cells.
Additionally, both the staphylococcal and streptococcal exotoxins
are implicated in gram-positive shock. Although
superantigen-related septic shock appears to be primarily mediated
by tumor necrosis factor (TNF)-.alpha.and interleukin (IL) 12, the
contribution of other cytokines cannot be discounted. (78, 79,
80).
[0016] The physiologic response to superantigens is similar to
septic shock induced by gram-negative endotoxin
(lipopolysaccharide, LPS). In fact, LPS and superantigens can work
synergistically to produce lethal toxic shock. (81, 82, 83). Toxic
shock syndrome can be exacerbated by the synergistic effects of
TSST-1 with the SE/SPE family of toxins. (84, 85). Superantigen
stimulation of immune cells can exacerbate autoimmune sysndromes by
causing the expansion of autoreactive T cell subsets, upregulation
of MHC-II expression, and the potentiation of ctotoxic T cell
response (86, 87, 88, 89, 90, 91).
[0017] Toxic shock syndrome is a specific syndrome caused by either
the Stapylococcal or Streptococcal organisms. It is specifically
caused by the toxins produced by these bacteria. Clinically it
often occurs in young women and children and is characterized by a
raised temperature, low blood pressure, a rash that eventually
leads to skin loss especially on the palms and the soles and
multi-organ involvement.
[0018] Septic Shock on the other hand involves both gram negative
as well as gram positive organisms, occurs in all groups of
patients especially the elderly and post-surgical. It has similar
symptoms except for the lack of a skin losing rash. Both diseases
have a high mortality-however there are many more cases of septic
shock as compared to toxic shock. The term "septic shock" is used
herein to describe hypotension and organ failure associated with
bacterial infections.
[0019] "Toxic shock like syndrome" is the term previously used to
describe the syndromes caused by staphyloccal and streptococcal
pyrogenic bacterial exotoxins other than toxic shock syndrome toxin
(TSST-1) from S. aureus. Currently, the term "toxic shock syndrome"
is used to describe the syndromes caused by TSST-1 and the other
pyrogenic exotoxins, and is the terminology used hereinafter.
[0020] Toxic shock syndrome can be exacerbated by the synergistic
effects of TSST-1 with the enterotoxin/pyrogenic toxin family of
toxins (9, 25). Gram negative bacterial endotoxin and the pyrogenic
toxins can work synergistically to produce intractable shock (17,
30).
[0021] With respect to septic shock, lipopolysaccharide (LPS) is an
Integral part of the cell wall of Gram-negative bacteria and is a
potent inducer of cytokine release by macrophages (52). During the
induction phase of septicemia, LPS binds to the CD14 receptors of
macrophages and triggers the release of a number of cytokines
including Interleukin-1 (IL-1), and Tumor Necrosis
Factor-.alpha.(TNF-.alpha.) (49). Accordingly, therapeutic
strategies for septic shock have centered on the neutralization of
LPS or LPS-induced cytokines (64). Unfortunately, trials using
either monoclonal antibodies directed against part of the LPS
molecule or the use of CD14 soluble receptors have not been very
promising (45). The reasons for these failures might be: 1. The
type of patient selected (many were already in irreversible shock).
2. The monoclonal antibody did not block all sites of LPS. 3.
Soluble CD14 receptors did not block all LPS molecules.
[0022] Toxic shock syndrome and septic shock are still among the
most life threatening syndromes affecting humans. It is estimated
that approximately 20,000 cases of toxic shock syndrome occur each
year of with a 10% mortality rate (66). With respect to septic
shock approximately 400,000-500,000 cases occur each year with a
50% mortality (63). Present therapy is primarily symptomatic with
administration of fluids, antibiotics, pressor agents and
occasionally steroids (56). There is no vaccine available for toxic
shock syndrome since all of the superantigens are antigenically
distinct even though there is some sequence homology present in all
the superantigens. There have been numerous vaccine trials for
septic shock none of which have been successful.
[0023] With respect to the failed vaccine trials for septic shock,
we believe that there was a failure to recognize that the
interaction between the superantigens described above and LPS
enhances the lethal potency of both these antigens by about 1000
fold. In contrast, each antigen when given alone requires a much
higher dose for lethal septic shock (46).
[0024] Hence, it is proposed that at least two independent pathways
of lethal septic shock can occur. LPS and peptidoglycan interact
with macrophages. The superantigens interact with T cells. In both
cases target cells are induced to release large amounts of
cytokines. There is increasing evidence that gram-positive
infections frequently accompany gram-negative infections in
patients with septic shock (see article by Rangel-Frausto, pages
299-312) (96). Exposure to gram-negative endotoxin produces a state
of macrophage hyperesponsiveness on subsequent stimulation (92). A
similar state is seen with monocytes in septic shock. Our group and
others have shown that LPS and superantigens can act
synergistically to produce lethal septic shock in animal models
(93). It is our hypothesis that a significant amount of septic
shock involves an early gram-negative infection that causes
significant symptoms of vasodilation and hypotension. This is then
treated with fluids and antibiotics, leading to early recovery by
the patient. Some days later, a gram-positive insult either via a
line sepsis of the skin or gastrointestinal flora may cause severe
reversible shock in a previously LPS-sensitized patient. This model
is depicted graphically in FIG. 2 herein (94).
[0025] In other words, since Gram-negative and Gram-positive
organisms can be recovered from patients with sepsis, it appears
that it is the "two hit" hypothesis that is operative and the
interaction between LPS and the superantigens markedly enhances the
lethal properties of both molecules. In this model, the
interruption of the toxin pathway by anti-peptide antibody(ies) or
by peptide(s) of the invention prevents the onset of lethal shock
induced by the combination of the LPS and one or more of the
superantigens.
SUMMARY OF THE INVENTION
[0026] The present invention relates to the identification of
consensus sequences derived from two conserved regions of the
staphylococcal enterotoxins and streptococcal pyrogenic toxins
(hereinafter called "region 1" and "region 2") and the discovery
that compositions comprising amino acid sequences based on these
two conserved regions of the staphylococcal enterotoxins and
streptococcal pyrogenic exotoxins are capable of inducing
antibodies which react with a variety of staphylococcal and
streptococcal pyrogenic exotoxins and are also capable of
ameliorating or preventing diseases related to the deleterious
effects of these toxins.
[0027] The invention also relates to compositions and methods for
preventing and treating diseases related to the release of certain
pyrogenic exotoxins from bacteria.
[0028] This invention provides peptides comprising amino acid
sequences which reduce, inhibit or eliminate the deleterious
effects of bacterial toxins and/or are capable of inducing
antibodies that reduce, inhibit or eliminate the deleterious
effects of bacterial toxins, such as those of staphylococcus and a
variety of streptococci. Antibodies may be induced by
administration of a pharmaceutical composition and/or vaccine
containing a composition comprising a peptide derived from one or
both of the two conserved regions described herein, or a
structurally and/or immunologically related antigen.
[0029] The amino acid sequences provided by this invention are
sufficiently common to all members of this family of pyrogenic
exotoxins to be useful for eliciting antibodies which are
cross-reactive with toxins derived from various bacteria.
[0030] The amino acid sequences provided by this invention are also
useful for new methods of preventing and treating symptoms
associated with the bacterial release of the staphylococcal
enterotoxins and the streptococcal pyrogenic exotoxins. Such
methods include, for example, administering to an individual who is
suspected of having an infection or developing and/or having a
toxic or septic reaction, a compound comprising at least one of the
consensus amino acid sequences of this invention in an amount
sufficient to inhibit superantigen stimulation of T-cells,
preferably an amount sufficient to reduce, inhibit or eliminate the
deleterious effects of the exotoxins. Such methods also include
administering to an individual at risk of infection or developing a
toxic reaction to the exotoxins at least one of the consensus amino
acid sequences of this invention in an amount sufficient to elicit
the production of antibodies to the exotoxins.
[0031] In a preferred embodiment of this invention, an individual
at risk for developing toxic or septic shock syndrome or an
individual with symptoms of toxic shock syndrome or septic shock
may be treated by administering to such individual a composition
comprising at least one of the peptides of this invention and/or
carrier-conjugate thereof.
[0032] In another preferred embodiment of this invention, an
individual at risk for developing toxic shock syndrome or septic
shock, or an individual with symptoms of toxic shock syndrome or
septic shock, may be treated by administering to such individual
antibodies which have been generated in a mammal immunized with at
least one of the compositions of this invention.
[0033] Vaccines and pharmaceutical compositions comprising at least
one of the consensus amino acid sequences and a physiologically
acceptable carrier and optionally an adjuvant are also part of this
invention.
[0034] Another object of the invention is to provide antibodies
induced by the peptides and carrier-conjugates thereof. These
antibodies may be used to prevent, treat, or protect against the
toxic effects of most, if not all, of the staphylococcal and
streptococcal pyrogenic exotoxins. The antibodies may also be
useful to protect against, or ameliorate the effects of, autoimmune
diseases which are associated with, or are the result of, the
presence of staphylococcal or streptococcal pyrogenic exotoxins.
These antibodies are also useful in diagnostic assays and kits to
detect the presence of staphylococcal and streptococcal pyrogenic
exotoxins and to aid in the diagnosis of diseases related to the
presence of those toxins.
[0035] Another object of the invention is to provide isolated and
purified nucleic acids encoding the amino acid sequences of the
invention, as well as suitable expression systems, vector
components and transformed host cells containing those nucleic
acids.
BRIEF DESCRIPTION OF THE DRAWINGS
[0036] FIG. 1. Schematic diagram of the interaction between a T
cell receptor, superantigen, and a class II MHC molecule.
Superantigens bind to common sequences in class II MHC molecules
and T cell receptors that lie outside the normal antigen-binding
sites. T cell activation by superantigens is not limited by the
antigenic specificity of the T cell.
[0037] FIG. 2. Diagram of the "two hit" model of septic shock.
[0038] FIG. 3. Comparison of the synthetic peptide sequences to
conserved regions 1 and 2 of the staphylococcal enterotoxins (SEA,
SEB, SEC, SED, SEE, and SEH), and streptococcal pyrogenic exotoxins
(SPEA, SPEC, and SSA). Staphylococcal toxic shock syndrome toxin 1
(TSST-1) was compared with the region 2 peptide. Numbers represent
the residue positions as a reference to where these regions exist
in the whole toxin molecules. Sequences are from either the Swiss
protein or GenBank databases under the following accession numbers.
Swiss protein: SPEA, P08095; SPEC, P13380; SEA, P13163; SEB,
P01552; SEC, P01553; SED, P20723; SEE, P12993. GenBank: SEH,
U11702; SSA, L29565; TSST1, J02615.
[0039] FIG. 4. ELISA titers of antibodies from rabbits immunized
with polymeric peptide #6348. The peptide was diluted so that it
was delivered to each well to give a final concentration of 2
.mu.g/100 .mu.l. The serum was then diluted to 1:1,000; 1:10,000;
1:100,000; 1:500,000; and 1:1,000,000 and 100 .mu.l of each
dilution of serum was placed in each well. Experiments were run in
triplicate for each dilution of serum. Note the 1 log higher titers
of rabbit #443 serum as compared to rabbit #442 serum. Cut off
readings were at O.D. 0.6.
[0040] FIG. 5. 12% SDS PAGE gel immunoblot of a variety
staphylococcal and streptococcal toxins developed with the
anti-peptide 6348 antibody. Note bands of correct molecular weight
(M.W.) of each toxin identified by the anti-peptide antibody. Lane
1: SPEA, lane 2: SEA, lane 3: SEB, lane 4: SED, lane 5: SEE, lane
6: SEC and lane 7 TssT-1. Note bands at appropriate M.W. in lanes
1-4. Fainter bands are seen in lanes 5 and 7.
[0041] FIG. 6. Bar graphs of blastogenesis assays of human
mononuclear cell populations stimulated by various toxins in the
presence of normal rabbit serum and anti-peptide 6348 serum. Note
the marked inhibition of SEB, SEC, SEE, SPEA and SPEC by the
anti-peptide antibody. Less, but definite, inhibition of SEA by the
anti-peptide antibody was also seen.
[0042] FIG. 7. Bar graphs of blastogenesis assays of human
mononuclear cell populations stimulated by SEB in the presence of
(A) peptide 6343 (i.e., CMYGGVTEHEGN, SEQ ID NO:3), (B) peptide
6346 (i.e., CGKKNVTVQELDYKIRKYLVDNKKLYGC, SEQ ID NO: 6)) and (C)
peptide 6348 (i.e., CMYGGVTEHEGNKKNVTVQELDYKIRKYLVDNKKLYGC, SEQ ID
NO:8).
[0043] FIG. 8. Inhibition of SEB, SEC, SED, SPEC, SPEA and TSST-1
toxin blastogenesis of peripheral blood mononuclear cells (PBMC) by
the 6343 peptide. 2.times.10.sup.5 PBMC were stimulated with either
2 .mu.g of the indicated toxin or a combination of 2 .mu.g of the
toxin with 150 .mu.g of the 6343 peptide. These were incubated for
72 hours and the results were measured via tritiated thymidine
incorporation. CPM represents counts per minute. Note that the
single peptide (6343) inhibited all of the superantigens
tested.
[0044] FIG. 9. Inhibition of SPEG, SPEH, and SPEZ toxin
blastogenesis of peripheral blood mononuclear cells (PBMC) by the
6343 peptide. 2.times.10.sup.5 PBMC were stimulated with either 2
.mu.g of the indicated toxin or a combination of 2 .mu.g of the
toxin with the indicated amount of the 6343 peptide. These were
incubated for 72 hours and the results were measured via tritiated
thymidine incorporation. CPM represents counts per minute. Normal
represents normal media. Note that the single peptide (6343)
inhibited the superantigens SPEG, SPEH and SPEZ.
[0045] FIG. 10. (A). Binding of peptide 6343 to the MHC complex as
measured by ELISA. (B). Inhibition of binding of SEB toxin biding
by peptide 6343 as measured by decreased anti-SEB binding at
increased concentrations of added peptide 6343.
[0046] FIG. 11. Confocal microscope pictures. (A) Binding of
peptide 6343 is indicated by the green color. (B) Binding of
anti-MHC peptide is indicated by the red color. (C) Combined
picture showing stippled pattern of red and green color. Binding of
peptide 6343 is indicated by the green color and binding of
anti-MHC peptide is indicated by the red color.
DETAILED DESCRIPTION OF THE INVENTION
[0047] It is to be understood that both the foregoing general
description and the following detailed description are exemplary
and explanatory only, and are not restrictive of the invention, as
claimed. The accompanying drawings, which are incorporated in and
constitute a part of the specification, illustrate an embodiment of
the invention and, together with the description, serve to explain
the principles of the invention.
[0048] Two consensus patterns, corresponding to conserved region 1
and region 2, respectively, are identified as common to members of
the staphylococcal enterotoxin and streptococcal pyrogenic toxin
family of toxins when the program "Motifs" in a software package
from the Genetics Computer Group, Inc. ("GCG") is run using the
streptococcal SPEC toxin as an example. "Program Manual for the
Wisconsin Package, Version 8, September 1994, Genetics Computer
Group, 575 Science Drive, Madison, Wis., USA 53711", incorporated
herein by reference.
[0049] The first consensus sequence ("GCG consensus #1") identified
by the Motifs program has the amino acid sequence YGG(LIV)TXXXXN,
which is rewritten herein as
YGGX.sub.1TX.sub.2X.sub.3X.sub.4X.sub.5N (SEQ ID NO:1), wherein
X.sub.1 is selected from the group consisting of L, I, or V; and
X.sub.2, X.sub.3, X.sub.4 and Xs are each independently selected
from the group consisting of any amino acid. This pattern is
present in the staphylococcal enterotoxins and streptococcal
pyrogenic exotoxins, but not in TSST-1. The sequence begins
immediately at the COOH-terminal side of the cysteine loop. The
second consensus sequence ("GCG consensus #2") identified by the
Motifs program has the amino acid sequence
KXX(LIV)XXXX(LIV)DXXXRXXLXXXXX (LIV) Y, rewritten herein as
KX.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11X.sub.12X.sub.13DX.sub.14X.s-
ub.15X.sub.16RX.sub.17X.sub.18LX.sub.19X.sub.20X.sub.21X.sub.22X.sub.23X.s-
ub.24Y (SEQ ID NO: 2), wherein X.sub.8, X.sub.13 and X.sub.24 are
each independently selected from the group consisting of L, I and
V, and X.sub.6, X.sub.7, X.sub.9, X.sub.10, X.sub.11, X.sub.12,
X.sub.14, X.sub.15, X.sub.16, X.sub.17, X.sub.18, X.sub.19,
X.sub.20, X.sub.21, X.sub.22 and X.sub.23 are each independently
selected from the group consisting of any amino acid. This pattern
is present in the staphylococcal enterotoxins, streptococcal
pyrogenic exotoxins, and TSST-1.
[0050] One object of the invention is to provide compositions
comprising peptides comprising amino acid sequences based on these
two conserved regions of the staphylococcal enterotoxins and
streptococcal pyrogenic toxins. These peptides may be used for
eliciting an immunogenic response in mammals, including responses
which provide protection against, or reduce the severity, of toxic
shock or septic shock from staphylococcal or streptococcal
infections. These peptides may also be useful to protect against,
or ameliorate the effects of, autoimmune diseases which are
associated with, or are the result of, the presence of
staphylococcal or streptococcal pyrogenic exotoxins. These peptides
are also useful in diagnostic assays and kits to detect the
presence of antibodies to staphylococcal and streptococcal
pyrogenic exotoxins and to aid in the diagnosis of diseases related
to the presence of those toxins.
[0051] The peptides of the invention are those derived from either
one or both of the following two consensus sequences:
YGGX.sub.1TX.sub.2X.sub.3X.sub.4X.sub.5N (SEQ ID NO:1), wherein
X.sub.1 is selected from the group consisting of L, I, or V; and
X.sub.2, X.sub.3, X.sub.4 and Xs are each independently selected
from the group consisting of any amino acid.
KXX(LIV)XXXX(LIV)DXXXRXXLXXXXX(LIV)Y, rewritten herein as
KX.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11X.sub.12X.sub.13DX.sub.14X.s-
ub.15X.sub.16RX.sub.17X.sub.18LX.sub.19X.sub.20X.sub.21X.sub.22X.sub.23X.s-
ub.24Y (SEQ ID NO: 2), wherein X.sub.8, X.sub.13 and X.sub.24 are
each independently selected from the group consisting of L, I and
V, and X.sub.6, X.sub.7, X.sub.9, X.sub.10, X.sub.11, X.sub.12,
X.sub.14, X.sub.15, X.sub.16, X.sub.17, X.sub.18, X.sub.19,
X.sub.20, X.sub.21, X.sub.22 and X.sub.23 are each independently
selected from the group consisting of any amino acid.
[0052] A preferred consensus sequence of the invention from Region
1 (consensus #1a) has the amino acid sequence
X.sub.25X.sub.26YGGX.sub.1TX.sub.2X X.sub.4X.sub.5N (SEQ ID NO:
28), wherein X.sub.1 is selected from the group consisting of L, I,
and V; X.sub.2, X.sub.4 and X.sub.5 are each independently selected
from the group consisting of any amino acid; and X.sub.3, X.sub.25
and X.sub.26 are each independently selected from the group
consisting of any amino acid and of no amino acid; but preferably
X.sub.1 is selected from the group consisting of I and V; X.sub.2
is selected from the group consisting of L, E, K, P and N; X.sub.3
is selected from the group consisting of H and A and no amino acid;
X.sub.4 is selected from the group consisting of D, N, E, Q, and H;
X.sub.5 is selected from the group consisting of N, G, S, and R;
X.sub.25 is selected from the group consisting of C and Y and no
amino acid; and X.sub.26 is selected from the group consisting of
M, T, L, I, and no amino acid.
[0053] A preferred consensus sequence of the invention from region
2 (consensus #2a) has the amino acid sequence:
KX.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11X.sub.12X.sub.13DX.sub.14X.s-
ub.15X.sub.16RX.sub.17,X.sub.18X.sub.27X.sub.19X.sub.20X.sub.21X.sub.22X.s-
ub.23X.sub.24Y (SEQ ID NO: 29), wherein X.sub.8, X.sub.13 and
X.sub.24 are each independently selected from the group consisting
of L, I and V; X.sub.6, X.sub.7, X.sub.9, X.sub.10, X.sub.11,
X.sub.12, X.sub.14, X.sub.15, X.sub.16, X.sub.17, X.sub.18
X.sub.19, X.sub.20, X.sub.21, X.sub.22, and X.sub.23 are each
independently selected from the group consisting of any amino acid;
and X.sub.27 is selected from the group consisting of L and Y; but
preferably X.sub.6 is selected from the group consisting of K and
D; X.sub.7 is selected from the group consisting of N, K, S, E, M,
I and Q; X.sub.8 is selected from the group consisting of L and V;
X.sub.9 is selected from the group consisting of T and A; X.sub.10
is selected from the group consisting of V, A, L, F and I; X.sub.11
is selected from the group consisting of Q and S; X.sub.12 is
selected from the group consisting of E and T; X.sub.13 is selected
from group consisting of L and I; X.sub.14 is selected from the
group consisting of L, Y, I, A, F and C; X.sub.15 is selected from
the group consisting of Q, L, K and E; X.sub.16 is selected from
the group consisting of A, T, I and V; X.sub.17 is selected from
the group consisting of R, H, N and K; X.sub.18 is selected from
the group consisting of Y, F, I, L and Q; X.sub.19 is selected from
the group consisting of Q, V, I, H, S, T and M; X.sub.20 is
selected from the group consisting of E, K, N, G, D, S and Q;
X.sub.21 is selected from the group consisting of K, N, D, R and I;
X.sub.22 is selected from the group consisting of Y, K, L, F and H;
X.sub.23 is selected from the group consisting of N, K, G and Q;
X.sub.24 is selected from the group consisting of L and I; and
X.sub.27 is L.
[0054] The following Table 1 lists the amino acids that are found
at each of the variable positions in the sequences shown in FIG. 3,
and the number of times they appear at that position:
TABLE-US-00001 TABLE 1 Frequency of the amino acids in the variable
positions in the sequences shown in FIG. 3 X.sub.1 6V 3I X.sub.2 3L
2E 1K 2P 1N X.sub.3 7H 1A one deletion (no amino acid) X.sub.4 2D
2N 3E 1Q 1H X.sub.5 3N 4G 1S 1R X.sub.6 9K 1D X.sub.7 3N 1K 1S 1E
1M 1I 1Q X.sub.8 9V 1L X.sub.9 9T 1A X.sub.10 4V 3A 1L 1F 1I
X.sub.11 9Q 1S X.sub.12 9E 1T X.sub.13 9L 1I X.sub.14 2L 2Y 2I 1A
2F 1C X.sub.15 3Q 1L 5K 1E X.sub.16 4A 2T 3I 1V X.sub.17 2R 3H 1N
4K X.sub.18 5Y 1F 2I 1L 1Q X.sub.19 2Q 2V 1I 1H 1S 2T 1M X.sub.20
1E 2K 1N 1G 3D 1S 1Q X.sub.21 4K 3N 1D 1R 1I X.sub.22 3Y 4K 1L 1F
1H X.sub.23 3N 4K 2G 1Q X.sub.24 8L 2I X.sub.25 8C 1Y x.sub.26 5M
2I 1L 1T X.sub.27 9L 1Y
[0055] In the peptides of the present invention, X.sub.1, X.sub.8,
X.sub.13 and X.sub.24 may each independently be selected from the
group consisting of L, I and V; X.sub.2, X.sub.3, X.sub.4, X.sub.5,
X.sub.6, X.sub.7, X.sub.9, X.sub.10, X.sub.11, X.sub.12, X.sub.14,
X.sub.15, X.sub.16, X.sub.17, X.sub.18 X.sub.19, X.sub.20,
X.sub.21, X.sub.22, X.sub.23, X.sub.25 and X.sub.26 may each
independently be any amino acid; X.sub.3, X.sub.25 and X.sub.26 may
also each independently be no amino acid; and X.sub.27 is selected
from the group consisting of L and Y. However, in general, the
amino acids present at the positions X.sub.1 to X.sub.27 in the
toxins shown in FIG. 3 (and listed in Table 1) are preferred for
those positions, and the amino acids present most often at those
positions in the toxins shown in FIG. 3 (and listed in Table 1) are
more preferred. For example, from FIG. 3, and Table 1, it can be
determined that H (histidine) is present in seven toxins at
position X.sub.3 and A (alanine) is present in one toxin at
position X.sub.3, and there is no amino acid present in one toxin
at X.sub.3. These are the preferred amino acids for position
X.sub.3. The more preferred amino acid for position X.sub.3 in a
peptide of the invention is H (histidine). The more preferred amino
acids for X.sub.1 through X.sub.26 are: X.sub.1=valine;
X.sub.2=leucine; X.sub.3=histidine; X.sub.4=glutamic acid;
X.sub.5=glycine; X.sub.6=lysine; X.sub.7=asparagine;
X.sub.8=valine; X.sub.9=threonine; X.sub.10=valine;
X.sub.11=glutamine; X.sub.12=glutamic acid; X.sub.13=leucine;
X.sub.14=leucine, tyrosine, isoleucine or phenylalanine;
X.sub.15=lysine; X.sub.16=alanine; X.sub.17=lysine;
X.sub.18=tyrosine; X.sub.19 glutamine, valine or threonine;
X.sub.20=aspartic acid; X.sub.21=lysine; X.sub.22=lysine;
X.sub.23=lysine; X.sub.24=leucine; X.sub.25=cysteine;
X.sub.26=methionine; and X.sub.27=leucine. But note that in the
exemplified peptides of the invention described hereinbelow, i.e.,
SEQ ID NOS: 6, 7 and 8, inosine (I) is used at position X.sub.16
instead of the more frequently found alanine (A).
[0056] As is evident from FIG. 3 and the above Table 1, some amino
acid residues are much more highly conserved than suggested by the
GCG package data provided by the "Motifs" program.
[0057] In region 1, the preferred consensus is larger (consensus
#1a), and usually includes a C in the first position (X.sub.25).
The second residue (X.sub.26) is most often a M, but this can vary.
In the ninth position (X.sub.3), H is the most highly conserved.
The eleventh residue (X.sub.5) is most often a G.
[0058] In region 2, the preferred consensus (consensus #2a) is much
more highly conserved than suggested by the GCG program, especially
if one excludes TSST-1 sequences from consideration, as follows:
The second position (X.sub.6) is more highly conserved than
suggested, being almost exclusively a K; the fourth residue
(X.sub.8) is always a V followed exclusively by a T in the fifth
position (X.sub.9); the sixth position (X.sub.10) is somewhat
variable; but the seventh position (X.sub.11) is always a Q,
followed by E (X.sub.12). The next position is almost always an L
(X.sub.13), and the second to last position (X.sub.24) is almost
always an L.
[0059] Thus, additional modified consensus sequences for region 1
and region 2, which are of narrower scope than the GCG consensus
sequences #1 and #2 and the modified consensus sequences #1a and
#2a, are as follows:
Consensus #1b:
TABLE-US-00002 [0060] CMYGGX.sub.1TX.sub.2HX.sub.4GN (SEQ ID
NO:30)
wherein
[0061] X.sub.1 is V or I, preferably V;
[0062] X.sub.2 is L, E, K, P or N, preferably E or L; and
[0063] X.sub.4 is D, N, E, Q or H, preferably E.
Consensus #2b:
TABLE-US-00003 [0064] (SEQ ID NO:31)
KKX.sub.7VTX.sub.10QELDX.sub.14X.sub.15X.sub.16RX.sub.17X.sub.18X.sub.27X.-
sub.19X.sub.20X.sub.21X.sub.22X.sub.23LY
wherein
[0065] X.sub.7 is N, K, S, E, M, I or Q, preferably N;
[0066] X.sub.10 is V, A, L, F or I, preferably V;
[0067] X.sub.14 is L, Y, I, A, F or C, preferably Y;
[0068] X.sub.15 is Q, L, K or E, preferably K;
[0069] X.sub.16 is A, T, I or V, preferably I;
[0070] X.sub.17 is R, H, N or K, preferably K;
[0071] X.sub.18 is Y, F, I, L or Q, preferably Y; [0072] X.sub.19
is Q, V, I, H, S, T or M, preferably V; [0073] X.sub.20 is E, K, N,
D, G, S or Q, preferably D; [0074] X.sub.21 is K, N, D, R or I,
preferably N; [0075] X.sub.22 is Y, K, L, F or H, preferably K;
[0076] X.sub.23 is N, K, G or Q, preferably K; and [0077] X.sub.27
is L or Y, preferably L.
[0078] Peptides exemplified herein are CMYGGVTEHEGN (SEQ ID NO: 3),
CMYGGVTEHEGNGC* (SEQ ID NO: 5), KKNVTVQELDYKIRKYLVDNKKLY (SEQ ID
NO: 4), CGKKNVTVQELDYKIRKYLVDNKKLYGC* (SEQ ID NO: 6),
CMYGGVTEHEGNKKNVTVQELDYKIRKYLVDNKKLY (SEQ ID NO: 7) and
CMYGGVTEHEGNKKNVTVQELDYKIRKYLVDNKKLYGC* (SEQ ID NO: 8), wherein an
asterisk indicates that the peptide is a randomly cross-linked
polymer. The exemplified polymer peptides are at least 6,000 to
8,000 daltons. The average size of the exemplified polymer peptides
is about 12,000 to 15,000 daltons. Small peptides and/or
contaminants may be removed by dialysis or other methods available
in the art. Similarly, larger aggregates may be removed using,
e.g., a 0.25 micron filter, which can also be used to sterilize the
peptides.
[0079] Note that the amino acids cysteine and methionine, "CM", are
present at the amino terminus of the exemplified region 1 peptides
since those amino acids are most often found in that position in
nature. Note also that the amino acids cysteine and glycine, "CG"
and "GC", are used at the amino and/or carboxy-termini of some of
the exemplified region 2 peptides. The amino acid cysteine "C" is
used to facilitate cross-linking through the formation of disulfide
bonds. The amino acid glycine, "G", is used as a spacer
residue.
[0080] The preferred peptides of the invention are those which
exclude full length native toxin molecules. The preferred peptides
of this invention are not toxic, but toxic peptides maybe useful in
this invention, for example, in eliciting antibodies in a non-human
system. The most preferred peptides of the invention do not contain
amino acid sequences in the sequence in which they are found in any
particular native toxin molecule.
[0081] The present invention encompasses monomers of the peptides
derived from either one or both of the two consensus regions
described herein. These monomers may comprise one or more sequences
derived from either region 1 or region 2 or both, such as consensus
sequences #1 and 42, preferably consensus sequences #1a and/or #2a,
more preferably consensus sequences #1b and/or #2b, most preferably
one or more of the exemplified consensus sequence peptides. If the
monomer contains more than one consensus sequence, these sequences
may be immediately adjacent to each other or separated by a linker.
In addition, different orientations of the peptides are within the
scope of this invention. Furthermore, the order of the consensus
peptides within the full peptide may be variable.
[0082] The present invention also encompasses homogeneous or
heterogeneous polymers of the peptides disclosed herein (e.g.,
concatenated, cross-linked and/or fused identical peptide units or
concatenated, cross-linked and/or fused diverse peptide units), and
mixtures of the peptides, polymers, and/or conjugates thereof.
[0083] Linkers useful in the invention may, for example, be simply
peptide bonds, or may comprise amino acids, including amino acids
capable of forming disulfide bonds, but may also comprise other
molecules such as, for example, polysaccharides or fragments
thereof.
[0084] In the peptides exemplified herein, sequences derived from
consensus region 1 and consensus region 2 may be immediately
adjacent to each other, linked by peptide bonds, (see, e.g., SEQ ID
NO:7) and/or connected via amino acid linkers capable of forming
di-sulfide bonds via cysteine residues (see, e.g., SEQ ID NO: 8).
In the native toxin molecules, the sequences of region 1 and region
2 are separated by about 27 amino acids. When the linkers are
additional amino acids, they are most preferably 1 to 27 amino
acids in length, although longer linkers may also be used in
accordance with this invention.
[0085] The linkers for use with this invention may be chosen so as
to contribute their own immunogenic effect which may be either the
same, or different, than that elicited by the consensus sequences
of the invention. For example, such linkers may be bacterial
antigens which also elicit the production of antibodies to
infectious bacteria. In such instances, for example, the linker may
be a protein or protein fragment of an infectious bacteria, or a
bacterial polysaccharide or polysaccharide fragment.
[0086] A peptide of the invention includes any substituted analog
or chemical derivative of a peptide derived from one or both of the
two consensus regions described herein, most preferably of the
exemplified peptides described herein, so long as the peptide is
capable of inhibiting binding of staphylococcal and streptococcal
pyrogenic exotoxins to the MHC complex; inhibiting blastogenesis of
human mononuclear cells in the presence of any one of the toxins;
eliciting the production of antibodies capable of binding to most
of the staphylococcal and streptococcal pyrogenic exotoxins; or
reacting with (i.e., specifically binding to) antibodies that react
with most of the staphylococcal and streptococcal pyrogenic
exotoxins. Therefore, a peptide can be subject to various changes
that provide for certain advantages in its use. For example, D
amino acids can be substituted for L amino acids to increase in
vivo stability of the peptides, while still retaining biological
activity. See, e.g., Senderoff et al. (1998) (95). Likewise,
retro-inverso peptides, which contain NH--CO bonds instead of
CO--NH peptide bonds, are much more resistant to proteolysis than
L-peptides. Moreover, they have been shown to mimic natural
L-peptides with respect to poly- and monoclonal antibodies (48).
Therefore, peptides having at least one D amino acid on the amino
terminal and/or carboxy terminal end of the molecule and which
retain biological activity are considered part of the invention. In
addition, retro-inverso peptides which contain one or more of the
amino acid sequences of the invention and which retain biological
activity are also considered part of the invention.
[0087] The peptides of the invention are useful for providing
active immunization for the prevention of disease related to the
deleterious effects of staphylococcal and streptococcal pyrogenic
exotoxins and for preparation of antibodies as a passive
immunization therapy. When used to prepare antibodies, the peptides
are designed to induce antibodies which react with a variety of
staphylococcal and streptococcal pyrogenic exotoxins (preferably
with at least two, more preferably with at least four, and most
preferably with at least seven of the pyrogenic exotoxins) for use
in therapy to increase resistance to, prevent and/or treat toxic
shock syndrome and septic shock.
[0088] The peptides may also be useful to protect against, or
ameliorate the effects of, autoimmune diseases which are associated
with, or are the result of, the presence of staphylococcal or
streptococcal exotoxins.
[0089] The peptides of the invention will also be useful in
diagnostic tests for detecting antibodies to staphylococcal and
streptococcal pyrogenic exotoxins.
[0090] The peptide may be mixed with an adjuvant. The peptide also
may be bound to a non-toxic non-host protein carrier to form a
conjugate or it may be bound to a saccharide carrier and/or a
non-toxic non-host protein carrier to form a conjugate.
[0091] The molecular weight of the peptide monomers having one
consensus sequence of the invention range from about 1000 to 5000
daltons. Such lower molecular weight species of the invention are
useful themselves to inhibit superantigen induced T cell
proliferation and/or reduce, inhibit or eliminate the deleterious
effects of bacterial exotoxins in vivo, either when used alone or
in combination with another form of therapy, e.g., anticytokine
antibodies.
[0092] Such lower molecular weight species of the invention may
also be useful as immunogens themselves or, more preferably, may be
used as haptens conjugated to a larger carrier molecule, such as,
for example, a protein. As with other peptides, the molecular
weight of the peptide alone, or when conjugated to a carrier, or in
the presence of an adjuvant, is related to its immunogenicity.
Thus, the peptide may vary in molecular weight in order to enhance
its antigenicity or immunogenicity. In an exemplified embodiment,
the molecular weight of the peptide, in polymeric form, is greater
than about 6000 to 8000 daltons, with an average weight of 12,000
to 15,000 daltons. The total size of the peptide is only limited to
its ability to be physiologically tolerated.
[0093] The invention also relates to isolated and purified nucleic
acid molecules which code for the peptides of the invention to
produce the encoded peptides. The encoded peptides may be monomers,
polymers or linked to other peptide sequences (e.g., they may be
fusion proteins). Other features of the invention include vectors
which comprise the nucleic acid molecules of the invention operably
linked to promoters, as well as cell lines, such as prokaryotic
(e.g., E. coli) and eukaryotic (e.g., CHO and COS) cells
transfected with the nucleic acid molecules of the invention.
Vectors and compositions for enabling production of the peptides in
vivo, i.e., in the individual to be treated or immunized, are also
within the scope of this invention.
[0094] The nucleic acids encoding the peptides of the invention can
be introduced into a vector such as a plasmid, cosmid, phage, virus
or mini-chromosome and inserted into a host cell or organism by
methods well known in the art. In general, the vectors containing
these nucleic acids can be utilized in any cell, either eukaryotic
or prokaryotic, including mammalian cells (e.g., human. (e.g.,
HeLa), monkey (e.g., COS), rabbit (e.g., rabbit reticulocytes),
rat, hamster (e.g., CHO and baby hamster kidney cells) or mouse
cells (e.g., L cells), plant cells, yeast cells, insect cells or
bacterial cells (e.g., E. coli). The vectors which can be utilized
to clone and/or express these nucleic acids are the vectors which
are capable of replicating and/or expressing the nucleic acids in
the host cell in which the nucleic acids are desired to be
replicated and/or expressed. See, e.g., F. Ausubel et al., Current
Protocols in Molecular Biology, Greene Publishing Associates and
Wiley-Interscience (1992) and Sambrook et al. (1989) for examples
of appropriate vectors for various types of host cells. Strong
promoters compatible with the host into which the gene is inserted
may be used. These promoters may be inducible. The host cells
containing these nucleic acids can be used to express large amounts
of the protein useful in pharmaceuticals, diagnostic reagents,
vaccines and therapeutics.
[0095] The nucleic acids could be used, for example, in the
production of peptides for diagnostic reagents, vaccines and
therapies for pyrogenic exotoxin related diseases.
[0096] For example, vectors expressing high levels of peptide can
be used in immunotherapy and immunoprophylaxis, after expression in
humans. Such vectors include retroviral vectors and also include
direct injection of DNA into muscle cells or other receptive cells,
resulting in the efficient expression of the peptide, using the
technology described, for example, in Wolff et al., Science
247:1465-1468 (1990), Wolff et al., Human Molecular Genetics
1(6):363-369 (1992) and Ulmer et al., Science 259:1745-1749 (1993).
See also, for example, WO 96/36366 and WO 98/34640.
[0097] In another embodiment of this invention antibodies are
provided which react with peptides of the invention, as well as a
variety of staphylococcal and streptococcal pyrogenic exotoxins
(preferably with at least two, more preferably with at least four,
and most preferably with at least seven of the pyrogenic
exotoxins). These antibodies will be useful for passive
immunization therapy to increase resistance to or prevent toxic
shock syndrome or septic shock or other diseases related to the
presence of bacterial pyrogenic exotoxin. The antibodies may also
be useful to protect against, or ameliorate the effects of,
autoimmune diseases which are associated with, or are the result
of, the presence of staphylococcal or streptococcal pyrogenic
exotoxins. The antibodies of the invention will also be useful in
diagnostic tests and kits for detecting the presence of
staphylococcal and streptococcal pyrogenic exotoxins. These uses
are discussed in more detail below.
Methods for Preparing Peptides of the Invention
[0098] The peptides of the invention may be prepared by synthetic
methods or by recombinant DNA methods, as known in the art and as
described herein.
Pharmaceutical Compositions
[0099] The pharmaceutical compositions of this invention contain a
pharmaceutically and/or therapeutically effective amount of at
least one peptide and/or carrier thereof, antibody, or nucleic acid
encoding a peptide of this invention. In one embodiment of the
invention, the effective amount or peptide per unit dose is an
amount sufficient to inhibit T-cell proliferation by staphylococcal
and/or streptococcal pyrogenic exotoxins. In another embodiment of
the invention, the effective amount of peptide per unit dose is an
amount sufficient to prevent, treat or protect against the toxic
effects of bacterial toxins, including diarrhea and/or
cardiopulmonary depression or lethal shock. The effective amount of
peptide per unit dose depends, among other things, on the species
of mammal inoculated, the body weight of the mammal and the chosen
inoculation regimen, as is well known in the art.
[0100] In such circumstances, inocula for a human or similarly
sized mammal typically contain peptide concentrations of 100 to 500
mgs/kg, body weight of the mammal per inoculation dose.
[0101] Preferably, the route of inoculation of the peptide will be
subcutaneous or intravenous. The dose is administered at least
once.
[0102] When the peptide of the invention is used as immunogen, the
pharmaceutical composition contains an effective, immunogenic,
amount of peptide of the invention. The effective amount of peptide
per unit dose sufficient to induce an immune response depends,
among other things, on the species of mammal inoculated, the body
weight of the mammal and the chosen inoculation regimen, as well as
the presence or absence of an adjuvant, as is well known in the
art. Inocula typically contain peptide concentrations of about 1
microgram to about 1000 micrograms per inoculation (dose),
preferably about 3 micrograms to about 100 micrograms per dose,
most preferably about 5 micrograms to 50 micrograms. The use of
higher amounts is envisaged. In Example 1, rabbits were injected
twice with 500 micrograms of polymeric peptide in the presence of
adjuvant. In Example 5, an example in which the peptide is
administered directly to prevent toxic or septic shock, which may
not be dependent on the production of antibodies, mice were
injected twice with 1.5 mg of monomer peptide for a total of 3 mgs.
Standard procedures to determine dose response relationships known
to those skilled in the art may be used to determine optimum doses
of peptide to be used either to prevent or treat toxic or septic
shock, or to raise antibodies for its prevention or treatment.
[0103] The term "unit dose" as it pertains to the inocula refers to
physically discrete units suitable as unitary dosages for mammals,
each unit containing a predetermined quantity of active material
(e.g., peptide, antibody or nucleic acid) calculated to produce the
desired immunogenic effect in association with the required
diluent.
[0104] Inocula are typically prepared as a solution in a
physiologically acceptable carrier such as saline,
phosphate-buffered saline and the like to form an aqueous
pharmaceutical composition.
[0105] The peptides of the invention are generally administered
with a physiologically acceptable carrier or vehicle therefor. A
physiologically acceptable carrier is one that does not cause an
adverse physical reaction upon administration and one in which the
antibodies are sufficiently soluble and retain their activity to
deliver a therapeutically effective amount of the compound. The
therapeutically effective amount and method of administration of a
peptide of the invention may vary based on the individual patient,
the indication being treated and other criteria evident to one of
ordinary skill in the art. A therapeutically effective amount of a
peptide of the invention is one sufficient to attenuate the
dysfunction without causing significant side effects such as
non-specific T cell lysis or organ damage. The route(s) of
administration useful in a particular application are apparent to
one or ordinary skill in the art.
[0106] Routes of administration of the peptides include, but are
not limited to, parenteral, and direct injection into an affected
site. Parenteral routes of administration include but are not
limited to intravenous, intramuscular, intraperitoneal and
subcutaneous. The route of inoculation of the peptides of the
invention is typically parenteral and is preferably intramuscular,
sub-cutaneous and the like.
[0107] The present invention includes compositions of the peptides
described above, suitable for parenteral administration including,
but not limited to, pharmaceutically acceptable sterile isotonic
solutions. Such solutions include, but are not limited to, saline
and phosphate buffered saline for nasal, intravenous,
intramuscular, intraperitoneal, subcutaneous or direct injection
into a joint or other area.
[0108] A system for sustained delivery of the peptides of the
invention may also be used. For example, a delivery system based on
containing a peptide in a polymer matrix of biodegradable
microspheres may be used (57). One such polymer matrix includes the
polymer poly(lactide-co-glycolide) (PLG). PLG is biocompatible and
can be given intravenously or orally. Following injection of the
microspheres into the body, the encapsulated protein is released by
a complex process involving hydration of the particles and drug
dissolution. The duration of the release is mainly governed by the
type of PLG polymer used and the release of modifying excipients
(44).
[0109] The dose is administered at least once. When a composition
of the invention is used to induce antibodies, at least one booster
dose may be administered after the initial injection, preferably at
about 4 to 6 weeks after the first dose, in order to increase the
antibody level. Subsequent doses may be administered as
indicated.
[0110] To monitor the antibody response of individuals administered
the compositions of the invention, antibody titers may be
determined. In most instances it will be sufficient to assess the
antibody titer in serum or plasma obtained from such an individual.
Decisions as to whether to administer booster inoculations or to
change the amount of the composition administered to the individual
may be at least partially based on the titer.
[0111] The titer may be based on either an immunobinding assay
which measures the concentration of antibodies in the serum which
bind to a specific antigen, i.e. peptide or toxin; or bactericidal
assays which measure the ability of the antibodies to participate
with complement in killing bacteria. The ability to neutralize in
vitro and in vivo biological effects of the pyrogenic exotoxins may
also be assessed to determine the effectiveness of the treatment.
See, e.g., the examples herein.
Antibodies
[0112] The term "antibodies" is used herein to refer to
immunoglobulin molecules and immunologically active portions of
immunoglobulin molecules. Exemplary antibody molecules are intact
immunoglobulin molecules, substantially intact immunoglobulin
molecules and portions of an immunoglobulin molecule, including
those portions known in the art as Fab, Fab', F(ab').sub.2 and F(v)
as well as chimeric antibody molecules.
[0113] An antibody of the present invention is typically produced
by immunizing a mammal with an immunogen or vaccine containing one
or more peptides of the invention, or a structurally and/or
antigenically related molecule, to induce, in the mammal, antibody
molecules having immunospecificity for the immunizing peptide or
peptides. The peptide(s) or related molecule(s) may be monomeric,
polymeric, conjugated to a carrier, and/or administered in the
presence of an adjuvant. The antibody molecules may then be
collected from the mammal if they are to be used in immunoassays or
for providing passive immunity.
[0114] The antibody molecules of the present invention may be
polyclonal or monoclonal. Monoclonal antibodies may be produced by
methods known in the art. Portions of immunoglobulin molecules may
also be produced by methods known in the art.
[0115] The antibody of the present invention may be contained in
various carriers or media, including blood, plasma, serum (e.g.,
fractionated or unfractionated serum), hybridoma supernatants and
the like. Alternatively, the antibody of the present invention is
isolated to the extent desired by well known techniques such as,
for example, by using DEAE Sephadex, or affinity chromatography.
The antibodies may be purified so as to obtain specific classes or
subclasses of antibody such as IgM, IgG, IgA, IgG.sub.1, IgG.sub.2,
IgG.sub.3, IgG.sub.4 and the like. Antibody of the IgG class are
preferred for purposes of passive protection.
[0116] The presence of the antibodies of the present invention,
either polyclonal or monoclonal, can be determined by various
assays. Assay techniques include, but are not limited to,
immunobinding, immunofluorescence (IF), indirect
immunofluorescence, immunoprecipitation, ELISA, agglutination and
Western blot techniques.
[0117] The antibodies of the present invention have a number of
diagnostic and therapeutic uses. The antibodies can be used as an
in vitro diagnostic agent to test for the presence of various
staphylococcal and streptococcal pyrogenic exotoxins in biological
samples in standard immunoassay protocols and to aid in the
diagnosis of various diseases related to the presence of bacterial
pyrogenic exotoxins. Preferably, the assays which use the
antibodies to detect the presence of bacterial pyrogenic exotoxins
in a sample involve contacting the sample with at least one of the
antibodies under conditions which will allow the formation of an
immunological complex between the antibody and the toxin that may
be present in the sample. The formation of an immunological complex
if any, indicating the presence of the toxin in the sample, is then
detected and measured by suitable means. Such assays include, but
are not limited to, radioimmunoassays, (RIA), ELISA, indirect
immunofluorescence assay, Western blot and the like. The antibodies
may be labeled or unlabeled depending on the type of assay used.
Labels which may be coupled to the antibodies include those known
in the art and include, but are not limited to, enzymes,
radionucleotides, fluorogenic and chromogenic substrates,
cofactors, biotin/avidin, colloidal gold and magnetic particles.
Modification of the antibodies allows for coupling by any known
means to carrier proteins or peptides or to known supports, for
example, polystyrene or polyvinyl microliter plates, glass tubes or
glass beads and chromatographic supports, such as paper, cellulose
and cellulose derivatives, and silica.
[0118] Such assays may be, for example, of direct format (where the
labelled first antibody reacts with the antigen), an indirect
format (where a labelled second antibody reacts with the first
antibody), a competitive format (such as the addition of a labelled
antigen), or a sandwich format (where both labelled and unlabelled
antibody are utilized), as well as other formats described in the
art. In one such assay, the biological sample is contacted to
antibodies of the present invention and a labelled second antibody
is used to detect the presence of staphylococcal and streptococcal
pyrogenic exotoxins, to which the antibodies are bound.
[0119] The antibodies of the present invention are also useful as
therapeutic agents in the prevention and treatment of diseases
caused by the deleterious effects of staphylococcal and
streptococcal pyrogenic exotoxins.
[0120] The antibodies are generally administered with a
physiologically acceptable carrier or vehicle therefor. A
physiologically acceptable carrier is one that does not cause an
adverse physical reaction upon administration and one in which the
antibodies are sufficiently soluble and retain their activity to
deliver a therapeutically effective amount of the compound. The
therapeutically effective amount and method of administration of
the antibodies may vary based on the individual patient, the
indication being treated and other criteria evident to one of
ordinary skill in the art. A therapeutically effective amount of
the antibodies is one sufficient to inhibit superantigen
stimulation of T-cells and/or attenuate the dysfunction caused by
the presence of bacterial toxins without causing significant side
effects such as non-specific T cell lysis or organ damage. The
route(s) of administration useful in a particular application are
apparent to one or ordinary skill in the art.
[0121] Routes of administration of the antibodies include, but are
not limited to, parenteral, and direct injection into an affected
site. Parenteral routes of administration include but are not
limited to intravenous, intramuscular, intraperitoneal and
subcutaneous.
[0122] The present invention includes compositions of the
antibodies described above, suitable for parenteral administration
including, but not limited to, pharmaceutically acceptable sterile
isotonic solutions. Such solutions include, but are not limited to,
saline and phosphate buffered saline for nasal, intravenous,
intramuscular, intraperitoneal, subcutaneous or direct injection
into a joint or other area.
[0123] Antibodies for use to elicit passive immunity in humans are
preferably obtained from other humans previously inoculated with
compositions comprising one or more of the consensus amino acid
sequences of the invention. Alternatively, antibodies derived from
other species may also be used. Such antibodies used in
therapeutics suffer from several drawbacks such as a limited
half-life and propensity to elicit an immune response. Several
methods have been proposed to overcome these drawbacks. Antibodies
made by these methods are encompassed by the present invention and
are included herein. One such method is the "humanizing" of
non-human antibodies by cloning the gene segment encoding the
antigen binding region of the antibody to the human gene segments
encoding the remainder of the antibody. Only the binding region of
the antibody is thus recognized as foreign and is much less likely
to cause an immune response. An article describing such antibodies
is Reichmann et al., "Reshaping Human Antibodies for Therapy",
Nature 332:323-327 (1988), which is incorporated herein by
reference. See also, Queen et al., U.S. Pat. No. 5,585,089, which
is incorporated herein by reference.
[0124] In providing the antibodies of the present invention to a
recipient mammal, preferably a human, the dosage of administered
antibodies will vary depending upon such factors as the mammal's
age, weight, height, sex, general medical condition, previous
medical history and the like.
[0125] In general, it is desirable to provide the recipient with a
dosage of antibodies which is in the range of from about 5 mg/kg to
about 20 mg/kg body weight of the mammal, although a lower or
higher dose may be administered. In general, the antibodies will be
administered intravenously (IV) or intramuscularly (IM).
Intravenous immunoglobulin (IVIG) can generally be given with a
loading dose of 200 mg/kg, with monthly injections of 100 mg/kg.
High-dose IVIG may be given at 400-800 mg/kg for antibody-deficient
patients. See, e.g., The Merck Manual of Diagnosis and Therapy,
16.sup.th Edition, (Berkow R and Fletcher A J, Eds.), Merck
Research Laboratories, Rahway, N.J. (1992).
[0126] The peptides and/or antibodies of the present invention are
intended to be provided to the recipient subject in an amount
sufficient to prevent, or attenuate the severity, extent or
duration of the deleterious effects of staphylococcal and
streptococcal pyrogenic exotoxins.
[0127] The administration of the agents including peptide and
antibody compositions of the invention may be for either
"prophylactic" or "therapeutic" purpose. When provided
prophylactically, the agents are provided in advance of any
symptom. The prophylactic administration of the agent serves to
prevent or ameliorate any subsequent deleterious effects of
staphylococcal and streptococcal pyrogenic exotoxins. When provided
therapeutically, the agent is provided at (or shortly after) the
onset of a symptom of infection with bacteria expressing
staphylococcal or streptococcal pyrogenic exotoxins. The agent of
the present invention may, thus, be provided either prior to the
anticipated exposure to bacteria expressing staphylococcal or
streptococcal pyrogenic exotoxin (so as to attenuate the
anticipated severity, duration or extent of disease symptoms) or
after the initiation of the infection. The agent may also be
provided to individuals at high risk for getting an infection with
bacteria expressing staphylococcal or streptococcal pyrogenic
exotoxins.
[0128] Also envisioned are therapies based upon vectors, such as
viral vectors containing nucleic acid sequences coding for the
peptides described herein. These molecules, developed so that they
do not provoke a pathological effect, will stimulate the immune
system to respond to the peptides.
[0129] For all therapeutic, prophylactic and diagnostic uses, the
peptide of the invention, alone or linked to a carrier, as well as
antibodies and other necessary reagents and appropriate devices and
accessories may be provided in kit form so as to be readily
available and easily used.
[0130] Where immunoassays are involved, such kits may contain a
solid support, such as a membrane (e.g., nitrocellulose), a bead,
sphere, test tube, rod, and so forth, to which a receptor such as
an antibody specific for the target molecule will bind. Such kits
can also include a second receptor, such as a labelled antibody.
Such kits can be used for sandwich assays to detect toxins. Kits
for competitive assays are also envisioned.
[0131] The following examples illustrate certain embodiments of the
present invention, but should not be construed as limiting its
scope in any way. Certain modifications and variations will be
apparent to those skilled in the art from the teachings of the
foregoing disclosure and the following examples, and these are
intended to be encompassed by the spirit and scope of the
invention.
EXAMPLE 1
[0132] Peptides whose sequences are based on the two highly
conserved regions of the staphylococcal and streptococcal pyrogenic
exotoxins described herein were constructed. The sequences were
based on alignments of the streptococcal pyrogenic exotoxins with
the staphylococcal enterotoxins, and the amino acids used in
positions with possible degeneracy were the amino acids most
frequently found in these positions. Three of the peptides were
then catenated and polymerized to produce peptides of greater than
8000 daltons (i.e., peptides 6343, 6345 and 6348, described below).
As described further below, peptide 6348 was used to immunize
rabbits, which produced high titer antibodies to this peptide.
These antibodies were tested for the ability to recognize the
streptococcal and staphylococcal pyrogenic exotoxins. Immunological
assays (immunoblots) revealed that these antibodies recognized
regions common to all the pyrogenic exotoxins. These antibodies
were also tested for the ability to neutralize in vitro and in vivo
biological activity of the pyrogenic exotoxins. These antibodies
protected against the biological T-cell proliferation of these
toxins in an in vitro blastogenesis assay using human mononuclear
cell populations. The lethal effects of staphylococcal toxin SEB
and streptococcal pyrogenic toxin SPEA in vivo were also completely
blocked by mixing the antibodies with the toxin prior to
injection.
Materials and Methods
Construction of Synthetic Peptides:
[0133] Peptides were constructed by solid phase synthesis (20)
using the modifications described by Houghton (10).
TABLE-US-00004 1. GCG Consensus #1
YGGX.sub.1TX.sub.2X.sub.3X.sub.4X.sub.5N (SEQ ID NO: 1) peptide #1
CMYGGVTEHEGN (SEQ ID NO: 3) 2. GCG Consensus #2
KX.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11X.sub.12X.sub.13DX.sub.14X.s-
ub.15X.sub.16RX.sub.17X.sub.18
LX.sub.19X.sub.20X.sub.21X.sub.22X.sub.23X.sub.24Y (SEQ ID NO: 2)
peptide #2 KKNVTVQELDYKIRKYLVDNKKLY (SEQ ID NO: 4)
[0134] As is evident above, synthetic peptides #1 and #2 are not
native peptides, i.e., their sequences differ from those found in
native toxins. Variations of these peptides have also been
constructed in order to generate concatenated polymers of the
peptides. These polymers were constructed by the addition of
glycine and of additional cysteine residues to the amino- and/or
carboxyl-termini of the initial 2 peptides, thus facilitating
concatenation via disulfide bond formation (37, 38, 39). The
polymerized molecules were then dialyzed to remove molecules with
molecular weights less than 6000-8000 daltons. One polymeric
construct is composed of the monomer: CMYGGVTEHEGNGC (SEQ ID NO:5).
An additional polymer is composed of the peptide:
TABLE-US-00005 CGKKNVTVQELDYKIRKYLVDNKKLYGC. (SEQ ID NO:6)
[0135] In the native toxin molecules, consensus region #1 precedes
consensus region #2 by 27 amino acid residues (e.g. [consensus
region 1] x27 [consensus region 2]). We have constructed the
peptide: CMYGGVTEHEGNKKNVTVQELDYKIRKYLVDNKKLY (SEQ ID NO:7). Like
the native toxin molecule, this peptide is representative of the
two consensus regions joined together in the proper order (region 1
in the N terminal half, and region 2 in the C-terminal half of the
molecule), however they are not separated by an additional 27
residues as they are in the native toxins. We have also constructed
concatenated polymers based on the monomer:
TABLE-US-00006 (SEQ ID NO:8)
CMYGGVTEHEGNKKNVTVQELDYKIRKYLVDNKKLYGC.
TABLE-US-00007 ID# Peptide 6343 CMYGGVTEHEGN (SEQ ID NO:3) 6344
CMYGGVTEHEGNGC* (SEQ ID NO:5) 6345 KKNVTVQELDYKIRKYLVDNKKLY (SEQ ID
NO:4) 6346 CGKKNVTVQELDYKIRKYLVDNKKLYGC* (SEQ ID NO:6) 6347
CMYGGVTEHEGNKKNVTVQELDYKIRKYLVDNKKLY (SEQ ID NO:7) 6348
CMYGGVTEHEGNKKNVTVQELDYKIRKYLVDNKKLYGC* (SEQ ID NO: 8) Peptides
with an (*) are cross-linked polymers composed of the described
sequence. It is expected that monomers of these peptides will also
be useful in the present invention.
Generation of Anti-Peptide Sera.
[0136] New Zealand White rabbits were immunized by subcutaneous
injection with 500 .mu.g of peptide in complete Freund's adjuvant.
Additional booster injections of 500 .mu.g in incomplete adjuvant
was administered 4 weeks after the primary injections. Ten days
after booster injections, the rabbits were bled, and the
anti-peptide titers were determined by ELISA.
[0137] Staphylococcal enterotoxins, TSST-1, and streptococcal
pyrogenic exotoxins were purchased from Toxin Technology Inc.
(Sarasota, Fla.).
Immunoblots
[0138] Each of the staphylococcal and streptococcal pyrogenic
exotoxins were electrophoresed through 10% SDS PAGE gels (16) and
transferred to nitrocellulose for western blots (33). The western
blots were developed using the rabbit anti-peptide 6348 serum
(anti-pep 6348 or AP6348) diluted 1:5000, followed by goat
anti-rabbit (IgG) alkaline phosphate conjugate (Sigma).
Inhibition of Blastogenesis
[0139] Human peripheral blood mononuclear cell (PBMC) preparations
were stimulated by each of the staphylococcal enterotoxins and
streptococcal pyrogenic exotoxins. 100 ng of toxin was used to
stimulate PBMC preparations at cell concentrations of 10.sup.5
cells per well in 96 well microliter plates. Phytohemagglutinin
(PHA) was used in place of the toxins as a positive mitogenic
control. Cell culture medium was supplemented with either 10%
normal rabbit serum (NRS) or AP6348 serum. Blastogenesis was
assayed by incorporation of tritiated thymidine after 5 days of
culture (22). All experiments were performed in triplicate.
Passive Protection of Rabbits
[0140] Female New Zealand White rabbits >1 yr old were obtained
from Hazelton Dutchland Labs, Inc. (Denver, Pa.). Rabbits were
challenged with staphylococcal or streptococcal toxins at doses
ranging from 50 to 100 .mu.g/kg, as previously described (24).
Briefly, pyrogenic toxins were incubated with either 200 ul of
normal rabbit serum or 200 ul of anti-pep #6348 serum for one hour
prior to challenge. Toxin-serum mixtures were administered
intravenously through the marginal ear veins. Normal control
rabbits were treated in an identical manner, with isotonic saline
substituted for the pyrogenic toxin. Four hours later, rabbits were
given a sub-lethal dose (5 .mu.g/kg) of endotoxin (E. coli LPS,
List Biological Laboratories, Inc., Campbell, Calif.). Rabbits were
monitored 72 h for clinical signs of toxic shock. These included
elevated temperature, diarrhea, cardiopulmonary distress, and
conjunctival injection. Rabbits with severe toxic shock exhibiting
cyanosis and temperatures less than 97.degree. F. were declared
moribund. Moribund rabbits were euthanized by administration of 5
ml pentobarbital sodium. All animal protocols were reviewed by the
Laboratory Animal Research Center at the Rockefeller
University.
Results
ELISA Assays
[0141] As seen in FIG. 4, rabbits raised significant antibody
titers to peptide 6348. Similarly, rabbits receiving immunizations
with peptides 6344 and 6346 also developed high titers.
Recognition of Staphylococcal and Streptococcal Toxins by Anti-pep
6348 Serum
[0142] Western blots of the staphylococcal and streptococcal toxins
were developed with anti-peptide 6348 serum followed by an
anti-rabbit IgG alkaline phosphatase conjugate (Sigma). The results
of the western blot shown in FIG. 5 indicate the anti-peptide 6348
serum recognizes the conserved regions of the bacterial toxin
molecules; SEA, SEB, SED, SEE, SPEA, and TSST-1. SEC did not show a
significant reaction with anti-peptide 6348.
Blastogenesis Inhibition
[0143] The percentage of inhibition, of toxin mediated
blastogenesis, by AP6348 was assayed. Tritiated thymidine
incorporation by human PBMC stimulated with staphylococcal and
streptococcal pyrogenic toxins was significantly inhibited by the
addition of AP6348 compared to normal rabbit serum (NRS) (FIG. 6).
This suggests blastogenesis of PBMC in response to the toxins was
inhibited by AP6348. The AP6348 serum did not affect the
blastogenesis of human PBMC in response to PHA, suggesting a
specific inhibition of toxin biologic activity.
In Vivo Protection of Rabbits
[0144] We tested the ability of AP6348 serum to prevent severe
toxic shock in rabbits challenged with SEB and NRS. Rabbits
challenged intravenously with a mixture of SEB and NRS developed
symptoms of severe toxic shock (Table 2). One rabbit receiving 50
.mu.g/kg SEB with NRS, and two receiving 100 .mu.g/kg of SEB with
NRS, developed severe toxic shock and were declared moribund within
30 hrs. In contrast, two rabbits challenged with 50 .mu.g/kg and
100 .mu.g/kg SEB with AP6348 developed fever, but this returned to
normal by 32 hours. No diarrhea or cardiopulmonary depression was
observed. Rabbits were followed for a total of 5 days (data not
shown) and appeared fully recovered.
TABLE-US-00008 TABLE 2 Passive Protection of Rabbits Challenged
with SEB, SPEA and LPS Toxin LPS Temperature .degree. F.
.mu.g/kg\Serum .mu.g/kg Diarrhea 0 hr 4 hr 24 hr 32 hr 48 hr SEB
ns.sup.f\NRS 5 - 100.4 102 101.4 101.2 NT 50\NRS 5 + 101 104.4
102.8 96.diamond. 100\NRS 5 + 102 104.6 103 97.diamond. 100\NRS 5 +
101 104.5 102.6 97.diamond. 50\APS 5 - 101.4 103.8 103 102 101
100\APS 5 - 100.4 104.4 103 102 101 SPEA 50\NRS 5 + 101 104.2
NT.diamond. 100\NRS 5 + 102 104.8 NT.diamond. 50\APS 5 - 102 104
103 102 102 100\APS 5 + 101.6 104.4 104 100 97.diamond. ns.sup.f =
control rabbit given isotonic saline in place of SEB or SPEA NRS =
Normal rabbit serum APS = Anti-peptide 6348 serum .diamond. =
animals were declared moribund NT = not taken
Discussion
[0145] Our results demonstrate that antibodies rabbit antiserum
generated to peptides representative of two regions with highly
conserved amino acid sequences (AP6348) are capable of recognizing
most of the staphylococcal enterotoxins and streptococcal pyrogenic
exotoxins (e.g. SEA, SEB, SEC, SEE, SPEA, SPEC), as well as TSST-1,
using Western blots. We expect that other, more sensitive assays,
will result in the demonstration of binding of these antibodies to
additional members, probably all members, of the staphylococcal and
streptococcal pyrogenic toxin family.
[0146] Since recognition of the toxins by AP6348 was successful, we
tested this serum for the ability to inhibit the biological effects
of these pyrogenic toxins. AP6348 was capable of inhibiting in
vitro blastogenesis of human PBMCs by many of the pyrogenic toxins
(e.g., SEA, SEB, SEC, SEE, SPEA, and SPEC).
[0147] AP6348 was also able to provide passive in vivo protection
of animals challenged with lethal doses of SEB and SPEA. These
animals developed fever, however the fever returned to normal
within 30 hours and remained normal. Rabbits appeared to be fully
recovered within days of challenge.
[0148] In contrast, rabbits receiving similar doses of SEB and SPEA
pre-incubated with NRS developed severe toxic shock as evidenced by
high fevers, diarrhea, and cardiopulmonary distress. The illness
progressed and these animals were declared moribund.
[0149] The therapeutic and biological implications of these
observations are as follows: (i) antibodies prepared against this
peptide may be administered during the early stages of toxic shock
or septic shock irrespective of the toxin causing the symptoms and
(ii) the peptide may be used as an immunogen to block the toxic
effects of this family of superantigens.
EXAMPLE 2
[0150] PBMCs were isolated via Ficoll-Hypaque Solution. The
appropriate concentration of nonpolymeric peptide and
2.times.10.sup.5 cells in 200 .mu.L of RPMI solution was plated in
each well. The cells were Incubated for one hour at 37 degrees
Centigrade, with mild agitation every 15 minutes. After one hour, 2
.mu.g of SEB was added in each well. The PBMCs were incubated for
72 hours and the results were measured via tritiated thymidine
incorporation. The cells were collected and read on a beta counter.
The results are shown in FIG. 7. Note the dose-response inhibition
of blastogenesis demonstrated in FIG. 7A. Peptide 6343 (i.e.,
CMYGGVTEGEGN, SEQ ID NO:3) (FIG. 7A) showed more inhibitory
activity of SEB than peptide 6346 (i.e.,
CGKKNVTVQELDYKIRKYLVDNKKLYGC, SEQ ID NO:6) (FIG. 7B) or peptide
6348 (i.e., CMYGGVTEHEGNKKNVTVQELDYKIRKYLVDNKKLYGC, SEQ ID NO:8)
(FIG. 7C).
EXAMPLE 3
[0151] PBMCs were isolated via Ficoll-Hypaque Solution. 150 .mu.g
of nonpolymeric 6343 peptide (i.e., CMYGGVTEGEGN, SEQ ID NO:3) and
2.times.10.sup.5 cells in 200 .mu.L of RPMI solution was plated in
each well. The cells were incubated for one hour at 37 degrees
Centigrade, with mild agitation every 15 minutes. After one hour, 2
.mu.g of either SEB, SEC, SED, SPEC, SPEA, or TSST-1 was added to
each well. The PBMCs were incubated for 72 hours and the results
were measured via tritiated thymidine incorporation. The cells were
collected and read on a beta counter. All experiments were run in
triplicate. The results are shown in FIG. 8. Note that peptide 6313
inhibited blastogenesis of PBMCs by all of the superantigens
tested.
EXAMPLE 4
Two-Hit Septic Shock Model
[0152] Based on the two hit septic shock hypothesis described in
the background and FIG. 2 we have created a model of septic shock.
While the amounts of either SPEA or SEB superantigens used in the
rabbit model were relatively high, the amounts used in the mouse
model were much lower due to D-galactosamine priming, size of
animals and synergy between the toxins and LPS. BALB/c mice
challenged intra-peritoneally after priming with D-galactosamine
(20 mg/mouse) concurrently with LPS followed by SEB, showed that
extremely small amounts of LPS and SEB were needed to effect
lethality (46). The synergy between these two mediators of shock
was extremely impressive and extended for at least an 18 hour
period. We chose an 8 hour delay between the two toxins for our
model. We established and optimized doses of toxin for SEA, SEB,
SPEA, SPEC, and TSST-1 that would lead to 100% lethality. The doses
of the various toxins are shown in Table 3.
TABLE-US-00009 TABLE 3 Doses of various toxins and
LPS/D-galactosamine used in the lethal two hit septic shock model
SEA SPEA SEB SPEC TSST-1 Toxin (.mu.g) 2.5 2.0 0.02 2.5 2.0 LPS
(.mu.g) 0.001 0.001 0.001 0.001 0.001 D-galactosamine 20 20 20 20
20 mg (mg)
EXAMPLE 5
[0153] All mice were sensitized with 0.001 .mu.g Lipopolysaccharide
(LPS) and 20 mg of D-Galactosamine via intraperioneal injection.
The results are shown in Table 4. After six hours, saline or 1.5 mg
of the nonpolymeric peptide 6343 was administered to the
experimental mice by subcutaneous injection. One hour later, the
mice were injected again with either saline or 1.5 mg peptide (3.0
mg total). One hour later, all mice were challenged with 0.02 .mu.g
SEB, SPEA or TSST-1 (via intraperitoneal injection) and the mice
were observed overnight. In this model, it has been observed that
peptide 6343, given one and two hours before administration of the
toxic dose of the indicated toxin, protected 5 out of 6 mice
exposed to toxin SEB; 2 out of 2 mice exposed to the toxin SPEA and
2 out of two mice exposed to the toxin TSST-1.
TABLE-US-00010 TABLE 4 The Use of Peptide 6343 to Block the
Superantigen Induction of Septic Shock in a Mouse Model Dose and
Alive/Total Alive/Total Alive/Total Mice Administration SEB SPEA
TSST-1 Control Saline 0/6 (0%) 0/2 (0%) 0/2 (0%) subcutaneous
injection Peptide 3.0 mg 5/6 (83%) 2/2 (100%) 2/2 (100%) 6343
subcutaneous injection
EXAMPLE 6
[0154] Two streptococcal antigens SEG and SEH have recently been
synthesized and three new streptococcal exotoxins, i.e., SPEG, SPEH
and SPEZ, have recently been described by Dr. Fraser and colleagues
(61).
[0155] In order to determine whether 6343 peptide is capable of
inhibiting the toxic effects of the streptococcal exotoxins SPEG,
SPEH and SPEZ, experiments similar to those described above were
conducted.
[0156] In a similar manner as above, PBMCs were isolated via
Ficoll-Hypaque Solution. Either 0 .mu.g, 75 .mu.g, 100 .mu.g or 150
.mu.g of nonpolymeric 6343 peptide (i.e., CMYGGVTEGEGN, SEQ ID
NO:3) and 2.times.10.sup.5 cells in 200 .mu.L of RPMI solution was
plated in each well. The cells were incubated for one hour at 37
degrees Centigrade, with mild agitation every 15 minutes. After one
hour, 2 .mu.g of the recombinant forms of either SPEG, SPEH, SPEZ,
which were provided by Dr. Fraser of the University of Auckland,
New Zealand, was added to each well. The PBMCs were incubated for
72 hours and the results were measured via tritiated thymidine
incorporation. The cells were collected and read on a beta counter.
The results are shown in FIG. 9. Note that peptide 6343 inhibited
blastogenesis of PBMCs by the bacterial superantigens SPEG, SPEH
and SPEZ.
EXAMPLE 7
[0157] To determine the nature of the inhibition of superantigen
stimulation by the inhibitory peptides and antigens, purified MHC
class II molecules (obtained from J. Strominger, Harvard
University) were used in a competitive ELISA to determine binding
to this molecule. The purified MHC were immobilized on a 96 well
plate and 4 .mu.g SEB was added. After appropriate washing a rabbit
monoclonal anti-SEB antibody (Toxin Tech) was added to the ELISA
followed by a calorimetric reagent. The plate was read on an ELISA
plate reader. In similar experiments various concentrations of the
peptide 6343 (i.e., 0 .mu.g, 50 .mu.g, 75 .mu.g, 100 .mu.g, or 150
.mu.g) were added to the immobilized MHC before the addition of
SEB. Binding of the peptide to the MHC was demonstrated by the
decreased amount of SEB bound to the MHC, as indicated by a
decreased amount of antibody binding measured by a decreased color
reaction. The results are shown in FIG. 11. The results indicate
that peptide 6343 binds very strongly to the MHC complex and is
able to compete effectively for the site of SEB binding.
[0158] The binding of the peptide to the MHC complex of monocytes
was supported by con-focal microscopy results of experiments using
a method described in Ojcius et al. (68) using fluorinated peptides
constructed for us by NEN LifeSciences, antibodies directed against
MHC class II proteins, and a phycoerythrin (PE) antibody directed
to the anti-MHC antibody. Various doses of the peptide and various
concentrations of the cells were titrated to achieve optimum
binding of the peptide. Confocal microscope pictures (FIG. 11) show
similar patterns of binding for anti-MHC antibodies and for the
flourinated peptides, supporting the determination that the peptide
binds to the cells' MHC complex.
Discussion
[0159] In the experiments described herein, the dose of peptide
6343 used directly for the prevention of toxic and septic shock was
3 mgs per mouse. Thus, the direct use of peptides in septic or
toxic shock would be expected to involve doses in the range of
several grams for the acute treatment of shock in humans. Peptide
6343, possibly because of its small size, does not induce
detectable antibodies in rabbits and mice, yet it still has all the
therapeutic properties described for the anti-peptide antibodies.
Therefore, if desired, it is expected that the peptide can be used
repeatedly in the same individual without raising anti-peptide
antibodies.
REFERENCES
[0160] 1. Bergdoll, M. S. 1985. The staphylococcal enterotoxins-an
update., 247-254. In J. Jeljaszewicz (ed.). The staphylococci.
Gustav Fischer Verlag, New York, N.Y. [0161] 2. Blomster-Hautamaa,
D. A., B. N. Kreiswirth, J. S. Kornblum, R. P. Novick and P. M.
Schlievert. 1986. The nucleotide and partial amino acid sequence of
toxic shock syndrome toxin-1. Journal of Biological Chemistry.
261:15783-15786. [0162] 3. Choi, Y., B. Kotzin, L. Herron, J.
Callahan, P. Marrack and J. Kappler. 1989. Interaction of
staphylococcus aureus toxin superantigens with human T cells. Proc.
Natl. Acad. Sci. USA. 86:8941. [0163] 4. Fleischer, B. and H.
Schrezenmeier. 1988. T cell stimulation by staphylococcal
enterotoxins. Clonally variable response and requirement for major
histocompatibility complex class II molecules on accessory or
target cells. Journal of Experimental Medicine. 167:1697. [0164] 5.
Goshorn, S. C. and P. M. Schlievert. 1988. Nucleotide sequence of
streptococcal exotoxin type C. Infect. Immun. 56:2518-2520. [0165]
6. Grossman, D., M. Van, J. A. Mollick, S. K. Highlander and R. R.
Rich. 1991. Mutation of the disulfide loop in staphylococcal
enterotoxin A. Consequences for T cell recognition. J. Immunol.
147:3274-3281. [0166] 7. Hartwig, U. F. and B. Fleisher. 1993.
Mutations affecting MHC class II binding of the superantigen
streptococcal erythrogenic toxin A. International Immunology.
5:869-875. [0167] 8. Hauser, A. R., D. L. Stevens, E. L. Kaplan and
P. M. Schlievert. 1991. Molecular analysis of pyrogenic exotoxins
from streptococcus pyogenes isolates associated with toxic
shock-like syndrome. Journal of Clinical Microbiology.
29:1562-1567. [0168] 9. Hensler, T., M. Koller, C. Geoffroy, J. E.
Alouf and W. Konig. 1993. Staphylococcus aureus toxic shock
syndrome toxin 1 and streptococcus pyogenes erythrogenic toxin A
modulate inflammatory mediator release from human neutrophils.
Infect. Immun. 61:1055-1061. [0169] 10. Houghten, R. A. 1985.
General method for the rapid solid phase synthesis of large numbers
of peptides: specificity of antigen-antibody interactions at the
level of individual amino acids. Proc. Natl. Acad. Sci. USA. 82:
5131-5135. [0170] 11. Hynes, W. L., C. R. Weeks, J. J. Iandolo and
J. J. Ferretti. 1987. Immunologic cross-reactivity of type A
streptococcal exotoxin (erythrogenic toxin) and staphylococcal
enterotoxins B and Cl. Infect. Immun. 55:837-840. [0171] 12.
Janeway, C. A. J., J. Yagi, P. J. Conrad, M. E. Katz, B. Jones, S.
Vroegop and S. Buxser. 1989. T-cell responses to Mls and to
bacterial proteins that mimic its behavior. Immunology Reviews.
107:61. [0172] 13. Johnson, L. P., J. J. L'Italien and P. M.
Schlievert. 1986. Streptococcal pyrogenic exotoxin type A (scarlet
fever toxin) is related to staphylococcus aureus enterctoxin B.
Molecular and General Genetics. 203:354-356. [0173] 14. Kappler,
J., B. L. Kotzin, L. Herron, E. W. Gelfand, R. D. Bigler, A.
Boylston, S. Carrell, D. N. Posnett, Y. Choi and P. Marrack. 1989.
V.beta.-specific stimulation of human T-cells by staphylococcal
toxins. Science. 248:705. [0174] 15. Kappler, J. W., A. Herman, J.
Clements and P. Marrack. 1992. Mutations defining functional
regions of the superantigen staphylococcal enterotoxin B. Journal
of Experimental Medicine. 175:387-396. [0175] 16. Laemmli, U. K.
1970. Cleavage of structural proteins during the assembly of the
head of bacteriophage T4. Nature. 227:680. [0176] 17. Leonard, B.
A. and P. M. Schlievert. 1992. Immune cell lethality induced by
streptococcal pyrogenic exotoxin A and endotoxin. Infect. Immun.
60:3747-3755. [0177] 18. Marrack, P., M. Blackman, E. Kushnir and
J. Kappler. 1990. The toxicity of staphylococcal enterotoxin B in
mice is mediated by T cells. Journal of Experimental Medicine.
171:455. [0178] 19. Marrack, P. and J. Kappler. 1990. The
staphylococcal enterotoxins and their relatives. Science.
248:705-711. [0179] 20. Merrifield, R. B. 1963. Solid-phase peptide
synthesis I. The synthesis of a tetrapeptide. J. Am. Chem. Soc.
85:2149-2154. [0180] 21. Musser, J. M., A. R. Hauser, M. H. Kim, P.
M. Schlievert, K. Nelson and R. K. Selander. 1991. Streptococcus
pyogenes causing toxic-shock-like syndrome and other invasive
diseases: clonal diversity and pyrogenic exotoxin expression.
Proceedings of the National Academy of Sciences of the United
States of America. 88:2668-2672. [0181] 22. Read, S. E., H. F. M.
Reid, V. A. Fischetti, T. Pcon-King, R. Ramkissoon, M. McDowell and
J. B. Zabriskie. 1986. Serial studies on the cellular immune
response to streptococcal antigens in acute and convalescent
rheumatic fever patients in Trinidad. Journal of Clinical
Immunology. 6:433-441. [0182] 23. Reda, K. B., V. Kapur, J. A.
Mollick, J. G. Lamphear, J. M. Musser and R. R. Rich. 1994.
Molecular characterization and phylogenetic distribution of the
streptococcal superantigen gene (ssa) from streptococcus pyogenes.
Infect. Immun. 62:1867-1874. [0183] 24. Ren, K., J. D. Bannan, V.
Pancholi, A. L. Cheung, J. C. Robbins, V. A. Fischetti and J. B.
Zabriskie. 1994. Characterization and biological properties of a
new staphylococcal exotoxin. Journal of Experimental Medicine.
130:1675-1683. [0184] 25. Smith, R. J., P. M. Schlievert, I. M.
Himelright and L. M. Baddour. 1994. Dual infections with
staphylococcus aureus and streptococcus pyogenes causing toxic
shock syndrome. Possible synergistic effects of toxic shock
syndrome toxin 1 and streptococcal pyrogenic exotoxin C. Diagnostic
Microbiology & Infectious Disease. 19:245-247. [0185] 26.
Spero, L., B. Morlock and J. Metzger. 1978. On the cross-reactivity
of staphylococcal enterotoxins A, B, and C. J. Immunol. 120:86-89.
[0186] 27. Spero, L. and B. A. Morlock. 1978. Biological activities
of the peptides of staphylococcal enterotoxin C formed by limited
tryptic hydrolysis. Journal of Biological Chemistry. 253:8787-8791.
[0187] 28. Spero, L. and B. A. Morlock. 1979. Cross-reactions
between tryptic polypeptides of staphylococcal enterotoxins B and
C. J. Immunol. 122:1285-1289. [0188] 29. Stelma, G. N., Jr. and M.
S. Bergdoll. 1982. Inactivation of staphylococcal enterotoxin A by
chemical modification. Biochemical and Biophysical Research
Communications. 105:121-126. [0189] 30. Stevens, D. L., M. H.
Tanner, J. Winship, R. Swarts, K. M. Ries, P. M. Schlievert and E.
Kaplan. 1989. Severe group A streptococcal infections associated
with a toxic shock-like syndrome and scarlet fever toxin A. The New
England Journal of Medicine. 321:1-7. [0190] 31. Sugiyama, H., E.
M. J. McKissic, M. S. Bergdoll and B. Heller. 1964. Enhancement of
bacterial endotoxin lethality by staphylococcal enterotoxin. J.
Infect. Dis. 114:111-118. [0191] 32. Swaminathan, S., W. Furey, J.
Pletcher and M. Sax. 1992. Crystal structure of staphylococcal
enterotoxin B, a superantigen. Nature. 359:801-806. [0192] 33.
Towbin, H., T. Staehlin and J. Gordon. 1979. Electrophoretic
transfer of proteins from polyacrylamide gels to nitrocellulose
sheets. Procedure and some applications. Proceedings of the
National Academy of Sciences, USA. 76:4350. [0193] 34. Van den
Bussche, R. A., J. D. Lyon and G. A. Bohac. 1993. Molecular
evolution of the staphylococcal and streptococcal pyrogenic toxin
gene family. Molecular Phylogenetics and Evolution. 2:281-292.
[0194] 35. Weeks, C. R. and J. J. Ferretti. 1986. Nucleotide
sequence of the type A streptococcal exotoxin (erythrogenic toxin)
gene from streptococcus pyogenes bacteriophage T12. Infect. Immun.
52:144-150. [0195] 36. White, J., A. Herman, A. M. Pullen, R. Kubo,
J. W. Kappler and P. Marrack. 1989. The V beta-specific
superantigen staphylococcal enterotoxin B: stimulation of mature T
cells and clonal deletion in neonatal mice. Cell. 56:27-35. [0196]
37. Patarroyo, M. E., R. Amador, P. Clavijo, A. Moreno, F. Guzman,
P. Romero, R. Tascon, A. Franco, L. A. Murillo, G. Ponton and G.
Trujillo. 1988. A synthetic vaccine protects humans against
challenge with Plasmodium falciparum malaria. Nature. 332:158-161.
[0197] 38. Lopez, M. C., Y. Silva, M. C. Thomas, A. Garcia, M. J.
Faus, P. Alonso, F. Martinez, G. Del Real and C. Alonso. 1994.
Characterization of SPf(66)n: a chimeric molecule used as a malaria
vaccine. Vaccine. 12:585-591. [0198] 39. Rodriguez, R., A. Moreno,
F. Guzman, M. Calvo and M. E. Patarroyo. 1990. Studies in owl
monkeys leading to the development of a synthetic vaccine against
the asexual blood stages of Plasmodium falciparum. Am. J. Trop.
Med. Hyg. 43:339-354. [0199] 40. Hoffman, M. L., L. M. Jablonski,
K. K. Crum, S. P. Hackett, Y.-I. Chi, C. V. Stauffacher, D. L.
Stevens and G. A. Bohach. 1994. Predictions of T-cell receptor and
Major Histocompatibility Complex-binding sites on staphylococcal
enterotoxin Cl. Infection and Immunity. 62:3396-3407. [0200] 41.
Acharya, K. R., E. F. Passalacqua, E. Y. Jones, K. Harlos, D. I.
Stuart, R. D. Brehm and H. S. Tranter (1994). "Structural basis of
superantigen action inferred from crystal structure of toxic-shock
syndrome toxin-1." Nature 367: 94-97. [0201] 42. DELETED [0202] 43.
Bannan, J. D., F. Mingo, A. Viteri and J. B. Zabriskie (1997).
"Neutralization of streptococcal pyrogenic exotoxins and
staphylococcal enterotoxins by antisera to synthetic peptides
representing conserved amino acid motifs." Adv Exp Med Biol 418:
903-907. [0203] 44. Bartus, R. T., M. A. Tracy, D. F. Emerich and
S. E. Zale (1998). "Sustained delivery of proteins for novel
therapeutic agents." Science 281(5380): 1161-2. [0204] 45.
Baumgartner, J. D. (1990). "Monocolonal anti-endotoxin antibodies
for the treatment of gram-negative bacteremia and septic shock."
Eur J Clin Microbiol Infect Dis 9(10): 711-6. [0205] 46. Blank, C.,
A. Luz, S. Bendigs, A. Erdmann, H. Wagner and K. Heeg (1997).
"Superantigens and endotoxin synergize in the induction of lethal
shock." Eur J Immunol 27(4): 825-833. [0206] 47. Bohach, G. A., C.
J. Hovde, J. P. Handley and P. M. Schlievert (1988).
"Cross-Neutralizaton of staphylococcal and streptococcal pyrogenic
toxins by monoclonal and polyclonal antibodies." Infect Immun
56(2): 400-404. [0207] 48. Chorev, M. and M. Goodman (1995).
"Recent developments in retro peptides and proteins--an ongoing
topochemical exploration." Trends Biotechnol 13(10): 438-45. [0208]
49. Cohen, L., B. David and J. M. Cavaillon (1991). "Interleukin-3
enhances cytokine production by LSP-stimulated macrophages."
Immunol Lett 28(2): 121-6. [0209] 50. Edwin, C., S. R. Tatini and
S. K. Maheswaran (1986). "Specificity and cross-reactivity of
staphylococcal enterotoxin A monoclonal antibodies with
enterotoxins B, C1, D, and E." App Environ Micro 52(6): 1253-7.
[0210] 51. Fleischer, B., D. Gerlach, A. Fuhrmann and K. H. Schmidt
(1995). "Superantigens and pseudosuperantigens of gram-positive
cocci." Med Micro Immunol 184(1): 1-8. [0211] 52. Glauser, M. P.
(1996). "The inflammatory cytckines. New developments in the
pathophysiology and treatment of septic shock." Drugs 52 Suppl 2:
9-17. [0212] 53. Griggs, N. D., C. H. Pontzer, M. A. Jarpe and H.
M. Johnson (1992). "Mapping of multiple binding domains of the
superantigen staphylococcal enterotoxin A for HLA." Immunol 148(8):
2516-2521. [0213] 54. Grossman, D., R. G. Cook, J. T. Sparrow, J.
A. Mollick and R. R. Rich (1990). "Dissociatioin of the stimulatory
activities of staphylococcal enterotoxins for T cells and
monocytes." J Exp Med 172(6): 1831-1841. [0214] 55. Hoffmann, M.
L., L. M. Jablonski, K. K. Crum, S. P. Hackett, Y.-I. Chi, C. V.
Stauffacher, D. L. Stevens and G. A. Bohach (1994). "Predictions of
T-cell receptor and major histocompatibility complex-binding sites
on staphylococcal enterotoxin C1." Infect Immun 62: 3396-3407.
[0215] 56. Howe, L. M. (1998). "Treatment of endotoxic shock:
glucocorticoids, lazaroids, nonsteroidals, others." Vet Clin North
Am Small Anim Pract 28(2): 249-67. [0216] 57. Jeong, B., Y. H. Bae,
D. S. Lee and S. W. Kim (1997). "Biodegradable block copolymers as
injectable drug-delivery systems." Nature 388(6645): 860-2. [0217]
58. Jett, M., R. Neill, C. Welch, T. Boyle, E. Bernton, D. Hoover,
G. Lowell, R. E. Hunt, S. Chatterjee and P. Gemski (1994).
"Identification of staphylococcal enterotoxin B sequences important
for induction of lymphocyte proliferation by using synthetic
peptide fragments of the toxin." Infect Imun 62(8): 3408-3415.
[0218] 59. Mollick, J. A., R. L. McMasters, D. Grossman and R. R.
Rich (1993). "Localization of site on bacterial superantigens that
determines T cell receptor beta chain specificity." J Exp Med
177(2): 282-293. [0219] 60. Pontzer, C. H., N. D. Griggs and H. M.
Johnson (1993). "Agonist properties of a microbial superantigen
peptide." Biochem Biophys Res Commun 193(3): 1191-1197. [0220] 61.
Proft, T., S. L. Moffat, C. J. Berkahn and J. D. Fraser (1999).
"Identification and Characterization of Novel Superantigens from
Streptococcus pyogenes." J Exp Med. 189(1):89-102. [0221] 62.
Schlievert, P. M., G. A. Bohach, D. H. Ohlendorf, C. V.
Stauffacher, D. Y. Leung, D. L. Murray, C. A. Earhart, L. M.
Jablonski, M. L. Hoffmann and Y. I. Chi (1995). "Molecular
structure of staphylococcus and streptococcus superantigens." J
Clin Immunol 15(69suppl.)): 4s-10s. [0222] 63. Schoenberg, M. H.,
M. Weiss and P. Radermacher (1998). "Outcome of patients with
sepsis and septic shock after ICU treatment." Langenbecks Arch Surg
383(1): 44-8. [0223] 64. Wang, M. H., H. D. Flad, W. Feist, J.
Musehold, S. Kusumoto, H. Brade, J. Gerdes, H. T. Rietschel and A.
J. Ulmer (1992). "Inhibition of endotoxin or lipid A-induced tumor
necrosis factor production by synthetic lipid A partial structures
in human peripheral blood mononuclear cells." Lymphokine Cytokine
Res 11(1): 23-31. [0224] 65. Warren, J. R., L. Spero and J. F.
Metzger (1974). "Stabilization of native structure by the closed
disulfide loop of staphylococcal enterotoxin B." Bioch Biophys Acta
359: 351-363. [0225] 66. Weiss, K. A. and M. Layerdiere (1997).
"Group A Streptococcus invasive infections: a review." Can Surg
40(1): 18-25. [0226] 67. Woodley, J. F. (1994). "Enzymatic barriers
for GI peptide and protein delivery." Crit. Rev Ther Drug Carrier
Syst 11(2-3): 61-95. [0227] 68. Ojcius, D. M., F. Niedergang, A.
Subtil, R. Hellio, and A. Dautry-Varsat (1996). "Immunology and the
confocal microscope." Research in Immunology 147(3):175-188. [0228]
69. Soos, J M, Johnson H M: Multiple binding sites on the
superantigen, staphylococcal enterotoxin B, imparts versatility in
binding to MHC class II molecules. Biochem biophys Res commun
201:596-602, 1994. [0229] 70. Yagi J, Rath S, Janeway C A, Jr:
Control of T cell responses to staphylococcal enterotoxins by
stimulator cell MHC class II polymorphism. J Immunol
147:13998-11405, 1991. [0230] 71. Muller-Alouf H, Alouf J E,
Gerlach D, et al: Human pro- and anti-inflammatory cytokine
patterns induced by Streptococcus pyogenes erythrogenic (pyrogenic)
exotoxin A and C superantigens. Infect Immun 64:1450-1453, 1996.
[0231] 72. Leung D Y, Travers J B, Giorno R, et al: Evidence for a
streptococcal superantigen-driven process in acute guttate
psoriasis. J Clin Invest 96:2106-2112, 1995.
[0232] 73. Muller-Alouf H, Alouf J E, Gerlach D, et al: Comparative
study of cytokine release by human peripheral blood mononuclear
cells stimulated with Streptococcus pyogenes superantigenic
erythrogenic toxins, heat killed streptococci, and
lipopolysaccharide. Infect Immun 62:4915-4921, 1994. [0233] 74.
Blankson J N, Morse S S: The CD28/B7 pathway cosimulates the
response of primary murine T cells to superantigens as well as to
conventional antigens. Cell Immunol 157:306-312, 1994. [0234] 75.
Fleischer B, Schrezenmeier H: T cell stimulation by staphylococcal
enterotoxins. Clonally variable response and requirement for major
histocompatibility complex class II molecules on accessory or
target cells. J Exp Med 167:1697, 1988. [0235] 76. Krakauer T: Cell
adhesion molecules are co-receptors for staphylococcal enterotoxin
B-induced T-cell activation and cytokine production. Immunol Lett
39:121-125, 1994. [0236] 77. van Seventer G A, Newman W, Shimizu Y,
et al: Analysis of T cell stimulation by superantigen plus major
histoccmpatibility complex class II molecules or by CD3 monoclonal
antibody: Costimulation by purified adhesion ligands VCAM-1 ICAM-1
but not ELAM-1. J Exp Med 174:901-913, 1991. [0237] 78. Chapes S K,
Beharka A A, Hart M E, et al: Differential RNA regulation by
staphylococcal enterotoxins A and B in murine macrophages. J Leukoc
Biol 55:523-529, 1994. [0238] 79. Hackett S P, Stevens D L:
Superantigens associated with staphylococcal and streptococcal
toxic shock syndrome are potent inducers of tumor necrosis factor
beta synthesis. J Infect Dis 168:232-235, 1993. [0239] 80. Imanishi
K, Akatsuka H, Inada K, et al: IFN-gamma-stimulated human vascular
endothelial cells function as accessory cells for
superantigen-induced TNF production in human T-cells. Int Arch
Allergy Immunol 106:163-165, 1995. [0240] 81. Blank C, Luz A,
Bendigs S, et al: superantigens and endotoxin synergize in the
induction of lethal shock. Eur J Immunol 27:825-833, 1997 82.
Leonard BA, Schlievert PM: Immune cell lethality induced by
streptococcal pyrogenic exotoxin A and endotoxin. Infect Immun
60:3747-3755, 1992. [0241] 83. Sugiyama H, McKissic EMJ, Bergdoll M
S, et al: Enhancement of bacterial endotoxin lethality by
staphylococcal enterotoxin. J Infect Dis 114:111-118, 1964. [0242]
84. Hensler T, Koller M, Geoffroy C, et al: Staphylococcus aureus
toxic shock syndrome toxin 1 and Streptococcus pyogenes
erythrogenic toxin A modulate inflammatory mediator release from
human neutrophils. Infect Immun 61:1055-1061, 1993. [0243] 85.
Smith R J, Schlievert P M, Himelright I M, et al: Dual infections
with Staphylococcus aureus and Streptococcus pyogenes causing toxic
shock syndrome. Possible synergistic effects of toxic shock
syndrome toxin 1 and streptococcal pyrogenic exotoxin C. Diagn
Microbiol Infect Dis 19:245-247, 1994. [0244] 86. Brocke S, Gaur A,
Piercy C, et al: Induction of relapsing paralysis in experimental
autoimmune encephalomyelitis by bacterial superantigen. Nature
365:642-644, 1993. [0245] 87. Kotzin B L, Leung D Y, Kappler J, et
al: Superantigens and their potential role in human disease. Adv
Immunol 54:99-166, 1993. [0246] 88. Li S, Quayle A J, Thoen J E, et
al: Superantigen-mediated proliferation and cytotoxicity of T cells
isolated from the inflammatory tissues and peripheral blood of
arthritis patients. Clin Immunol Immunopathol 79:278-287, 1996.
[0247] 89. Schiffenbauer J, Johnson H M, Butfiloski E J, et al:
Staphylococcal enterotoxins can reactivate experimental allergic
encephalomyelitis. Proc Natl Acad Sci USA 90:8543-8546, 1993.
[0248] 90. Schleivert P M: Role of superantigens in human disease.
J Infect Dis 167:997-1002, 1993. [0249] 91. Schwab J, Brown R,
Anderle S, et al: Superantigen can reactivate baacterial cell
wall-induced arthritis. J Immunol 150:4151-4159, 1993. [0250] 92.
Astiz M, Saha D, Lustbader D, et al: Monocyte response to bacterial
toxins, expression of cell surface receptors, and release of
anti-inflammatory cytokines during sepsis. J Lab Clin Med
128:594-600, 1996. [0251] 93. Schleivert P M, Bohach G A, Ohlendorf
D H, et al: Molecular structure of staphylococcus and streptococcus
superantigens. J Clin Immunol 15:4s-10s, 1995. [0252] 94. Bannan J,
Visvanathan K, and Zabriskie J B. "Structure and function of
streptococcal and staphylococcal superantigens in Septic Shock,"
Infectious Disease Clinics of North America 13(2):387-396, 1999.
[0253] 95. Senderoff R I, Kontor K M, Kreilgaard L, Chang J J,
Patel S, Krakcver J, Heffernan J K, Snell L B, Rosenberg G B.
Consideration of conformational transitions and racemization during
process development of recombinant glucagon-like peptide-1. Journal
of Pharmaceutical Sciences. 87(2):183-9, 1998 [0254] 96.
Rangel-Frausto M S, Pittet D, Costigan M, Hwang T, Davis C S,
Wenzel R P. The natural history of the systemic inflammatory
response syndrome (SIRS). A prospective study. JAMA 273(2):117-23,
1995
[0255] Every reference cited hereinbefore is hereby incorporated by
reference in its entirety.
[0256] Modifications of the above described modes for carrying out
the invention that are obvious to those of skill in the fields of
immunology, protein chemistry, microbiology, medicine, and related
fields are intended to be within the scope of the following
claims.
[0257] The data suggest a theory for a possible mechanism of action
which is discussed in the application. However, the application
describes how to make and use the invention. This description is
not dependent upon theory and, accordingly, the claims are not
bound by theory.
[0258] The following table shows the correspondence between
peptides in FIG. 3 and their sequence identification numbers:
TABLE-US-00011 TABLE 5 Correspondence between Sequence
Identification Numbers and Peptides in FIG. 3 FIG. 3 Sequence ID
Nos. Region 1 PEP CMYGGVTEHEGN SEQ ID NO:3 SEA 130 CMYGGVTLHDNN 141
SEQ ID NO:9 SEB 140 CMYGGVTEHNGN 151 SEQ ID NO:10 SEC 137
CMYGGITKHEGN 148 SEQ ID NO:11 SED 131 CTYGGVTPHEGN 142 SEQ ID NO:12
SEE 130 CMYGGVTLHDNN 141 SEQ ID NO:13 SEH 116 CLYGGITL.NSE 126 SEQ
ID NO:14 SPEA 128 CIYGGVTNHEGN 139 SEQ ID NO:15 SPEC 112
YIYGGITPAQNN 123 SEQ ID NO:16 SSA 134 CMYGGVTEHHRN 145 SEQ ID NO:17
Region 2 PEP KKNVTVQELDYKIRKYLVDNKKLY SEQ ID NO:4 SEA 171
KKNVTVQELDLQARRYLQEKYNLY 194 SEQ ID NO:18 SEB 179
KKKVTAQELDYLTRHYLVKNKKLY 202 SEQ ID NO:19 SEC 178
KKSVTAQELDIKARNFLINKKNLY 201 SEQ ID NQ:20 SED 172
KKNVTVQELDAQARRYLQKDLKLY 195 SEQ ID NO:21 SEE 171
KKEVTVQELDLQARHYLHGKFGLY 194 SEQ ID NO:22 SEH 151
KKNVTLQELDIKIRKILSDKYKIY 174 SEQ ID NO:23 SPEA 167
KKMVTAQELDYKVRKYLTDNKQLY 190 SEQ ID NO:24 SPEC 151
KDIVTFQEIDFKIRKLYMDNYKIY 174 SEQ ID NO:25 SSA 174
KKQVTVQELDCKTRKILVSRKNLY 197 SEQ ID NO:26 TSST1 161
KKQLAISTLDFEIRHQLTQIHGLY 184 SEQ ID NO:27
SEQUENCE LISTING
[0259] (1) GENERAL INFORMATION: [0260] (i) APPLICANT: [0261] (A)
NAME: BANNAN, JASON D. [0262] (B) STREET: 5713 CEDAR WALK, NO. 401
[0263] (C) CITY: CENTREVILLE [0264] (D) STATE OR PROVINCE: VIRGINIA
[0265] (E) COUNTRY: UNITED STATES OF AMERICA [0266] (F) POSTAL
CODE: 20121 [0267] (i) APPLICANT: [0268] (A) NAME: VISVANATHAN,
KUMAR [0269] (B) STREET: 450 EAST 63RD STREET, APT. 4H [0270] (C)
CITY: NEW YORK [0271] (D) STATE OR PROVINCE: NEW YORK [0272] (E)
COUNTRY: UNITED STATES OF AMERICA [0273] (F) POSTAL CODE: 10021
[0274] (i) APPLICANT: [0275] (A) NAME: ZABRISKIE, JOHN D. [0276]
(B) STREET: 1385 YORK AVENUE [0277] (C) CITY: NEW YORK [0278] (D)
STATE OR PROVINCE: NEW YORK [0279] (E) COUNTRY: UNITED STATES OF
AMERICA [0280] (F) POSTAL CODE: 10021 [0281] (ii) TITLE OF
INVENTION: PEPTIDES USEFUL FOR REDUCING SYMPTOMS OF TOXIC SHOCK
SYNDROME AND SEPTIC SHOCK [0282] (iii) NUMBER OF SEQUENCES: 31
[0283] (iv) CORRESPONDENCE ADDRESS: [0284] (A) ADDRESSEE: MORGAN
& FINNEGAN [0285] (B) STREET: 345 PARK AVENUE [0286] (C) CITY:
NEW YORK [0287] (D) STATE: NEW YORK [0288] (E) COUNTRY: USA [0289]
(F) ZIP: 10154 [0290] (v) COMPUTER READABLE FORM: [0291] (A) MEDIUM
TYPE: FLOPPY DISK [0292] (B) COMPUTER: IBM PC COMPATIBLE [0293] (C)
OPERATING SYSTEM: MS-WINDOWS [0294] (D) SOFTWARE: MS WORD 95 [0295]
(vi) CURRENT APPLICATION DATA: [0296] (A) APPLICATION NUMBER: TO BE
ASSIGNED [0297] (B) FILING DATE: 18 JUN. 1999 [0298] (C)
CLASSIFICATION: [0299] (vii) PRIOR APPLICATION DATA: [0300] (A)
APPLICATION NUMBER: 09/168,303 [0301] (B) FILING DATE: 07 OCT. 1998
[0302] (C) CLASSIFICATION: [0303] (vii) PRIOR APPLICATION DATA:
[0304] (A) APPLICATION NUMBER: PCT/US98/06663 [0305] (B) FILING
DATE: 01 APR. 1998 [0306] (C) CLASSIFICATION: [0307] (vii) PRIOR
APPLICATION DATA: [0308] (A) APPLICATION NUMBER: 08/838,413 [0309]
(B) FILING DATE: 07 APR. 1997 [0310] (C) CLASSIFICATION: [0311]
(viii) ATTORNEY/AGENT INFORMATION: [0312] (A) NAME: MORRY, MARY J.
[0313] (B) REGISTRATION NUMBER: 34,398 [0314] (C) REFERENCE/DOCKET
NUMBER: 2016-4010US2 [0315] (ix) TELECOMMUNICATION INFORMATION:
[0316] (A) TELEPHONE: (212)758-4800 [0317] (B) TELEFAX:
(212)751-6849
[0318] (2) INFORMATION FOR SEQ ID NO: 1: [0319] (i) SEQUENCE
CHARACTERISTICS: [0320] (A) LENGTH: 10 [0321] (B) TYPE: AMINO ACID
[0322] (C) STRANDEDNESS: UNKNOWN [0323] (D) TOPOLOGY: UNKNOWN
[0324] (ii) MOLECULE TYPE: PEPTIDE [0325] (xi) SEQUENCE
DESCRIPTIONS:SEQ ID NO: 1: Tyr Gly Gly Xaa Thr Xaa Xaa Xaa Xaa Asn
5 10
[0326] (3) INFORMATION FOR SEQ ID NO: 2: [0327] (i) SEQUENCE
CHARACTERISTICS: [0328] (A) LENGTH: 24 [0329] (B) TYPE: AMINO ACID
[0330] (C) STRANDEDNESS: UNKNOWN [0331] (D) TOPOLOGY: UNKNOWN
[0332] (ii) MOLECULE TYPE: PEPTIDE [0333] (xi) SEQUENCE
DESCRIPTIONS:SEQ ID NO: 2: Lys Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Asp
Xaa Xaa 5 10 Xaa Arg Xaa Xaa Leu Xaa Xaa Xaa Xaa Xaa Xaa Tyr 15
20
[0334] (4) INFORMATION FOR SEQ ID NO: 3: [0335] (i) SEQUENCE
CHARACTERISTICS: [0336] (A) LENGTH: 12 [0337] (B) TYPE: AMINO ACID
[0338] (C) STRANDEDNESS: UNKNOWN [0339] (D) TOPOLOGY: UNKNOWN
[0340] (ii) MOLECULE TYPE: PEPTIDE [0341] (xi) SEQUENCE
DESCRIPTIONS:SEQ ID NO: 3: Cys Met Tyr Gly Gly Val Thr Glu His Glu
Gly Asn 5 10
[0342] (5) INFORMATION FOR SEQ ID NO: 4: [0343] (i) SEQUENCE
CHARACTERISTICS: [0344] (A) LENGTH: 24 [0345] (B) TYPE: AMINO ACID
[0346] (C) STRANDEDNESS: UNKNOWN [0347] (D) TOPOLOGY: UNKNOWN
[0348] (ii) MOLECULE TYPE: PEPTIDE [0349] (xi) SEQUENCE
DESCRIPTIONS:SEQ ID NO: 4: Lys Lys Asn Val Thr Val Gln Glu Leu Asp
Tyr Lys Ile Arg Lys Tyr Leu Val Asp Asn Lys Lys Leu Tyr 15 20
[0350] (6) INFORMATION FOR SEQ ID NO: 5: [0351] (i) SEQUENCE
CHARACTERISTICS: [0352] (A) LENGTH: 14 [0353] (B) TYPE: AMINO ACID
[0354] (C) STRANDEDNESS: UNKNOWN [0355] (D) TOPOLOGY: UNKNOWN
[0356] (ii) MOLECULE TYPE: PEPTIDE [0357] (xi) SEQUENCE
DESCRIPTIONS:SEQ ID NO: 5: Cys Met Tyr Gly Gly Val Thr Glu His Glu
Gly Asn 5 10 Gly Cys
[0358] (7) INFORMATION FOR SEQ ID NO: 6: [0359] (i) SEQUENCE
CHARACTERISTICS: [0360] (A) LENGTH: 28 [0361] (B) TYPE: AMINO ACID
[0362] (C) STRANDEDNESS: UNKNOWN [0363] (D) TOPOLOGY: UNKNOWN
[0364] (ii) MOLECULE TYPE: PEPTIDE [0365] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 6: Cys Gly Lys Lys Asn Val Thr Val Gln Glu
Leu Asp 5 10 Tyr Lys Ile Arg Lys Tyr Leu Val Asp Asn Lys Lys 15 20
Leu Tyr Gly Cys 25
[0366] (8) INFORMATION FOR SEQ ID NO: 7: [0367] (i) SEQUENCE
CHARACTERISTICS: [0368] (A) LENGTH: 36 [0369] (B) TYPE: AMINO ACID
[0370] (C) STRANDEDNESS: UNKNOWN [0371] (D) TOPOLOGY: UNKNOWN
[0372] (ii) MOLECULE TYPE: PEPTIDE [0373] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 7: Cys Met Tyr Gly Gly Val Thr Glu His Glu
Gly Asn 5 10 Lys Lys Asn Val Thr Val Gln Glu Leu Asp Tyr Lys 15 20
Ile Arg Lys Tyr Leu Val Asp Asn Lys Lys Leu Tyr 25 30 35
[0374] (9) INFORMATION FOR SEQ ID NO: 8: [0375] (i) SEQUENCE
CHARACTERISTICS: [0376] (A) LENGTH: 38 [0377] (B) TYPE: AMINO ACID
[0378] (C) STRANDEDNESS: UNKNOWN [0379] (D) TOPOLOGY: UNKNOWN
[0380] (ii) MOLECULE TYPE: PEPTIDE [0381] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 8: Cys Met Tyr Gly Gly Val Thr Glu His Glu
Gly Asn 5 10 Lys Lys Asn Val Thr Val Gln Glu Leu Asp Tyr Lys 15 20
Ile Arg Lys Tyr Leu Val Asp Asn Lys Lys Leu Tyr 25 30 35 Gly
Cys
[0382] (10) INFORMATION FOR SEQ ID NO: 9: [0383] (i) SEQUENCE
CHARACTERISTICS: [0384] (A) LENGTH: 12 [0385] (B) TYPE: AMINO ACID
[0386] (C) STRANDEDNESS: UNKNOWN [0387] (D) TOPOLOGY: UNKNOWN
[0388] (ii) MOLECULE TYPE: PEPTIDE [0389] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 9: Cys Met Tyr Gly Gly Val Thr Leu His Asp
Asn Asn 10
[0390] (11) INFORMATION FOR SEQ ID NO: 10: [0391] (i) SEQUENCE
CHARACTERISTICS: [0392] (A) LENGTH: 12 [0393] (B) TYPE: AMINO ACID
[0394] (C) STRANDEDNESS: UNKNOWN [0395] (D) TOPOLOGY: UNKNOWN
[0396] (ii) MOLECULE TYPE: PEPTIDE [0397] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 10: Cys Met Tyr Gly Gly Val Thr Glu His Asn
Gly Asn 5 10
[0398] (12) INFORMATION FOR SEQ ID NO: 11: [0399] (i) SEQUENCE
CHARACTERISTICS: [0400] (A) LENGTH: 12 [0401] (B) TYPE: AMINO ACID
[0402] (C) STRANDEDNESS: UNKNOWN [0403] (D) TOPOLOGY: UNKNOWN
[0404] (ii) MOLECULE TYPE: PEPTIDE [0405] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 11: Cys Met Tyr Gly Gly Ile Thr Lys His Glu
Gly Asn 5 10
[0406] (13) INFORMATION FOR SEQ ID NO: 12: [0407] (i) SEQUENCE
CHARACTERISTICS: [0408] (A) LENGTH: 12 [0409] (B) TYPE: AMINO ACID
[0410] (C) STRANDEDNESS: UNKNOWN [0411] (D) TOPOLOGY: UNKNOWN
[0412] (ii) MOLECULE TYPE: PEPTIDE [0413] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 12: Cys Thr Tyr Gly Gly Val Thr Pro His Glu
Gly Asn 10
[0414] (14) INFORMATION FOR SEQ ID NO: 13: [0415] (i) SEQUENCE
CHARACTERISTICS: [0416] (A) LENGTH: 12 [0417] (B) TYPE: AMINO ACID
[0418] (C) STRANDEDNESS: UNKNOWN [0419] (D) TOPOLOGY: UNKNOWN
[0420] (ii) MOLECULE TYPE: PEPTIDE [0421] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 13: Cys Met Tyr Gly Gly Val Thr Leu His Asp
Asn Asn 5 10
[0422] (15) INFORMATION FOR SEQ ID NO: 14: [0423] (i) SEQUENCE
CHARACTERISTICS: [0424] (A) LENGTH: 11 [0425] (B) TYPE: AMINO ACID
[0426] (C) STRANDEDNESS: UNKNOWN [0427] (D) TOPOLOGY: UNKNOWN
[0428] (ii) MOLECULE TYPE: PEPTIDE [0429] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 14: Cys Leu Tyr Gly Gly Ile Thr Leu Asn Ser
Glu 5 10
[0430] (16) INFORMATION FOR SEQ ID NO: 15: [0431] (i) SEQUENCE
CHARACTERISTICS: [0432] (A) LENGTH: 12 [0433] (B) TYPE: AMINO ACID
[0434] (C) STRANDEDNESS: UNKNOWN [0435] (D) TOPOLOGY: UNKNOWN
[0436] (ii) MOLECULE TYPE: PEPTIDE [0437] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 15: Cys Ile Tyr Gly Gly Val Thr Asn His Glu
Gly Asn 5 10
[0438] (17) INFORMATION FOR SEQ ID NO: 16: [0439] (i) SEQUENCE
CHARACTERISTICS: [0440] (A) LENGTH: 12 [0441] (B) TYPE: AMINO ACID
[0442] (C) STRANDEDNESS: UNKNOWN [0443] (D) TOPOLOGY: UNKNOWN
[0444] (ii) MOLECULE TYPE: PEPTIDE. [0445] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 16: Tyr Ile Tyr Gly Gly Ile Thr Pro Ala Gln
Asn Asn 5 10
[0446] (18) INFORMATION FOR SEQ ID NO: 17: [0447] (i) SEQUENCE
CHARACTERISTICS: [0448] (A) LENGTH: 12 [0449] (B) TYPE: AMINO ACID
[0450] (C) STRANDEDNESS: UNKNOWN [0451] (D) TOPOLOGY: UNKNOWN
[0452] (ii) MOLECULE TYPE: PEPTIDE [0453] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 17: Cys Met Tyr Gly Gly Val Thr Glu His His
Arg Asn 5 10
[0454] (19) INFORMATION FOR SEQ ID NO: 18: [0455] (i) SEQUENCE
CHARACTERISTICS: [0456] (A) LENGTH: 24 [0457] (B) TYPE: AMINO ACID
[0458] (C) STRANDEDNESS: UNKNOWN [0459] (D) TOPOLOGY: UNKNOWN
[0460] (ii) MOLECULE TYPE: PEPTIDE [0461] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 18: Lys Lys Asn Val Thr Val Gln Glu Leu Asp
Leu Gln 5 10 Ala Arg Arg Tyr Leu Gln Glu Lys Tyr Asn Leu Tyr 15
20
[0462] (20) INFORMATION FOR SEQ ID NO: 19: [0463] (i) SEQUENCE
CHARACTERISTICS: [0464] (A) LENGTH: 24 [0465] (B) TYPE: AMINO ACID
[0466] (C) STRANDEDNESS: UNKNOWN [0467] (D) TOPOLOGY: UNKNOWN
[0468] (ii) MOLECULE TYPE: PEPTIDE [0469] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 19: Lys Lys Lys Val Thr Ala Gln Glu Leu Asp
Tyr Leu 5 10 Thr Arg His Tyr Leu Val Lys Asn Lys Lys Leu Tyr 15
20
[0470] (21) INFORMATION FOR SEQ ID NO: 20: [0471] (i) SEQUENCE
CHARACTERISTICS: [0472] (A) LENGTH: 24 [0473] (B) TYPE: AMINO ACID
[0474] (C) STRANDEDNESS: UNKNOWN [0475] (D) TOPOLOGY: UNKNOWN
[0476] (ii) MOLECULE TYPE: PEPTIDE [0477] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 20: Lys Lys Ser Val Thr Ala Gln Glu Leu Asp
Ile Lys Ala Arg Asn Phe Leu Ile Asn Lys Lys Asn Leu Tyr 15 20
[0478] (22) INFORMATION FOR SEQ ID NO: 21: [0479] (i) SEQUENCE
CHARACTERISTICS: [0480] (A) LENGTH: 24 [0481] (B) TYPE: AMINO ACID
[0482] (C) STRANDEDNESS: UNKNOWN [0483] (D) TOPOLOGY: UNKNOWN
[0484] (ii) MOLECULE TYPE: PEPTIDE [0485] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 21: Lys Lys Asn Val Thr Val Gln Glu Leu Asp
Ala Gln 5 10 Ala Arg Arg Tyr Leu Gln Lys Asp Leu Lys Leu Tyr 15
20
[0486] (23) INFORMATION FOR SEQ ID NO: 22: [0487] (i) SEQUENCE
CHARACTERISTICS: [0488] (A) LENGTH: [0489] (B) TYPE: AMINO ACID
[0490] (C) STRANDEDNESS: UNKNOWN [0491] (D) TOPOLOGY: UNKNOWN
[0492] (ii) MOLECULE TYPE: PEPTIDE [0493] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 22: Lys Lys Glu Val Thr Val Gln Glu Leu Asp
Leu Gln 5 10 Ala Arg His Tyr Leu His Gly Lys Phe Gly Leu Tyr 15
20
[0494] (24) INFORMATION FOR SEQ ID NO: 23: [0495] (i) SEQUENCE
CHARACTERISTICS: [0496] (A) LENGTH: 24 [0497] (B) TYPE: AMINO ACID
[0498] (C) STRANDEDNESS: UNKNOWN [0499] (D) TOPOLOGY: UNKNOWN
[0500] (ii) MOLECULE TYPE: PEPTIDE [0501] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 23: Lys Lys Asn Val Thr Leu Gln Glu Leu Asp
Ile Lys 5 10 Ile Arg Lys Ile Leu Ser Asp Lys Tyr Lys Ile Tyr 15
20
[0502] (25) INFORMATION FOR SEQ ID NO: 24: [0503] (i) SEQUENCE
CHARACTERISTICS: [0504] (A) LENGTH: 24 [0505] (B) TYPE: AMINO ACID
[0506] (C) STRANDEDNESS: UNKNOWN [0507] (D) TOPOLOGY: UNKNOWN
[0508] (ii) MOLECULE TYPE: PEPTIDE [0509] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 24: Lys Lys Met Val Thr Ala Gln Glu Leu Asp
Tyr Lys 5 10 Val Arg Lys Tyr Leu Thr Asp Asn Lys Gln Leu Tyr 15
20
[0510] (26) INFORMATION FOR SEQ ID NO: 25: [0511] (i) SEQUENCE
CHARACTERISTICS: [0512] (A) LENGTH: 24 [0513] (B) TYPE: AMINO ACID
[0514] (C) STRANDEDNESS: UNKNOWN [0515] (D) TOPOLOGY: UNKNOWN
[0516] (ii) MOLECULE TYPE: PEPTIDE [0517] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 25: Lys Asp Ile Val Thr Phe Gln Glu Ile Asp
Phe Lys 5 10Ile Arg Lys Leu Tyr Met Asp Asn-Tyr Lys Ile Tyr 15
20
[0518] (27) INFORMATION FOR SEQ ID NO: 26: [0519] (i) SEQUENCE
CHARACTERISTICS: [0520] (A) LENGTH: 24 [0521] (B) TYPE: AMINO ACID
[0522] (C) STRANDEDNESS: UNKNOWN [0523] (D) TOPOLOGY: UNKNOWN
[0524] (ii) MOLECULE TYPE: PEPTIDE [0525] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 26: Lys Lys Gln Val Thr Val Gln Glu Leu Asp
Cys Lys 5 10 Thr Arg Lys Ile Leu Val Ser Arg Lys Asn Leu Tyr 15
20
[0526] (28) INFORMATION FOR SEQ ID NO: 27: [0527] (i) SEQUENCE
CHARACTERISTICS: [0528] (A) LENGTH: 24 [0529] (B) TYPE: AMINO ACID
[0530] (C) STRANDEDNESS: UNKNOWN [0531] (D) TOPOLOGY: UNKNOWN
[0532] (ii) MOLECULE TYPE: PEPTIDE [0533] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 27: Lys Lys Gln Leu Ala Ile Ser Thr Leu Asp
Phe Glu 5 10 Ile Arg His Gln Leu Thr Gln Ile His Gly Leu Tyr 15
20
[0534] (29) INFORMATION FOR SEQ ID NO: 28: [0535] (i) SEQUENCE
CHARACTERISTICS: [0536] (A) LENGTH: 12 [0537] (B) TYPE: AMINO ACID
[0538] (C) STRANDEDNESS: UNKNOWN [0539] (D) TOPOLOGY: UNKNOWN
[0540] (ii) MOLECULE TYPE: PEPTIDE [0541] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 28: Xaa Xaa Tyr Gly Gly Xaa Thr Xaa Xaa Xaa
Xaa Asn 10
[0542] (30) INFORMATION FOR SEQ ID NO: 29: [0543] (i) SEQUENCE
CHARACTERISTICS: [0544] (A) LENGTH: 24 [0545] (B) TYPE: AMINO ACID
[0546] (C) STRANDEDNESS: UNKNOWN [0547] (D) TOPOLOGY: UNKNOWN
[0548] (ii) MOLECULE TYPE: PEPTIDE [0549] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 29: Lys Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Asp
Xaa Xaa 5 10 Xaa Arg Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Tyr 15
20
[0550] (31) INFORMATION FOR SEQ ID NO: 30: [0551] (i) SEQUENCE
CHARACTERISTICS: [0552] (A) LENGTH: 12 [0553] (B) TYPE: AMINO ACID
[0554] (C) STRANDEDNESS: UNKNOWN [0555] (D) TOPOLOGY: UNKNOWN
[0556] (ii) MOLECULE TYPE: PEPTIDE [0557] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 30: Cys Met Tyr Gly Gly Xaa Thr Xaa His Xaa
Gly Asn 5 10
[0558] (32) INFORMATION FOR SEQ ID NO: 31: [0559] (i) SEQUENCE
CHARACTERISTICS: [0560] (A) LENGTH: 24 [0561] (B) TYPE: AMINO ACID
[0562] (C) STRANDEDNESS: UNKNOWN [0563] (D) TOPOLOGY: UNKNOWN
[0564] (ii) MOLECULE TYPE: PEPTIDE [0565] (xi) SEQUENCE
DESCRIPTION: SEQ ID NO: 31: Lys Lys Xaa Val Thr Xaa Gln Glu Leu Asp
Xaa Xaa 5 10 Xaa Arg Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Leu Tyr 20
Sequence CWU 1
1
80110PRTArtificial SequenceUNSURE(4)XAA may be L, I or V 1Tyr Gly
Gly Xaa Thr Xaa Xaa Xaa Xaa Asn 1 5 10224PRTArtificial
SequenceDescription of Artificial SequenceConsensus sequence
derived from staphylococcal and streptococcal toxins 2Lys Xaa Xaa
Xaa Xaa Xaa Xaa Xaa Xaa Asp Xaa Xaa Xaa Arg Xaa Xaa 1 5 10 15Leu
Xaa Xaa Xaa Xaa Xaa Xaa Tyr 20312PRTArtificial SequenceDescription
of Artificial SequenceConsensus sequence derived from
staphylococcal and streptococcal toxins 3Cys Met Tyr Gly Gly Val
Thr Glu His Glu Gly Asn 1 5 10424PRTArtificial SequenceDescription
of Artificial SequenceConsensus sequence derived from
staphylococcal and streptococcal toxins 4Lys Lys Asn Val Thr Val
Gln Glu Leu Asp Tyr Lys Ile Arg Lys Tyr 1 5 10 15Leu Val Asp Asn
Lys Lys Leu Tyr 20514PRTArtificial SequenceDescription of
Artificial SequenceConsensus sequence derived from staphylococcal
and streptococcal toxins 5Cys Met Tyr Gly Gly Val Thr Glu His Glu
Gly Asn Gly Cys 1 5 10628PRTArtificial SequenceDescription of
Artificial SequenceConsensus sequence derived from staphylococcal
and streptococcal toxins 6Cys Gly Lys Lys Asn Val Thr Val Gln Glu
Leu Asp Tyr Lys Ile Arg 1 5 10 15Lys Tyr Leu Val Asp Asn Lys Lys
Leu Tyr Gly Cys 20 25736PRTArtificial SequenceDescription of
Artificial SequenceConsensus sequence derived from staphylococcal
and streptococcal toxins 7Cys Met Tyr Gly Gly Val Thr Glu His Glu
Gly Asn Lys Lys Asn Val 1 5 10 15Thr Val Gln Glu Leu Asp Tyr Lys
Ile Arg Lys Tyr Leu Val Asp Asn 20 25 30Lys Lys Leu Tyr
35838PRTArtificial SequenceDescription of Artificial
SequenceConsensus sequence derived from staphylococcal and
streptococcal toxins 8Cys Met Tyr Gly Gly Val Thr Glu His Glu Gly
Asn Lys Lys Asn Val 1 5 10 15Thr Val Gln Glu Leu Asp Tyr Lys Ile
Arg Lys Tyr Leu Val Asp Asn 20 25 30Lys Lys Leu Tyr Gly Cys
35912PRTStaphylococcus 9Cys Met Tyr Gly Gly Val Thr Leu His Asp Asn
Asn 1 5 101012PRTStaphylococcus 10Cys Met Tyr Gly Gly Val Thr Glu
His Asn Gly Asn 1 5 101112PRTStaphylococcus 11Cys Met Tyr Gly Gly
Ile Thr Lys His Glu Gly Asn 1 5 101212PRTStaphylococcus 12Cys Thr
Tyr Gly Gly Val Thr Pro His Glu Gly Asn 1 5 101312PRTStaphylococcus
13Cys Met Tyr Gly Gly Val Thr Leu His Asp Asn Asn 1 5
101411PRTStaphylococcus 14Cys Leu Tyr Gly Gly Ile Thr Leu Asn Ser
Glu 1 5 101512PRTStreptococcus 15Cys Ile Tyr Gly Gly Val Thr Asn
His Glu Gly Asn 1 5 101612PRTStreptococcus 16Tyr Ile Tyr Gly Gly
Ile Thr Pro Ala Gln Asn Asn 1 5 101712PRTStreptococcus 17Cys Met
Tyr Gly Gly Val Thr Glu His His Arg Asn 1 5 101824PRTStaphylococcus
18Lys Lys Asn Val Thr Val Gln Glu Leu Asp Leu Gln Ala Arg Arg Tyr 1
5 10 15Leu Gln Glu Lys Tyr Asn Leu Tyr 201924PRTStaphylococcus
19Lys Lys Lys Val Thr Ala Gln Glu Leu Asp Tyr Leu Thr Arg His Tyr 1
5 10 15Leu Val Lys Asn Lys Lys Leu Tyr 202024PRTStaphylococcus
20Lys Lys Ser Val Thr Ala Gln Glu Leu Asp Ile Lys Ala Arg Asn Phe 1
5 10 15Leu Ile Asn Lys Lys Asn Leu Tyr 202124PRTStaphylococcus
21Lys Lys Asn Val Thr Val Gln Glu Leu Asp Ala Gln Ala Arg Arg Tyr 1
5 10 15Leu Gln Lys Asp Leu Lys Leu Tyr 202224PRTStaphylococcus
22Lys Lys Glu Val Thr Val Gln Glu Leu Asp Leu Gln Ala Arg His Tyr 1
5 10 15Leu His Gly Lys Phe Gly Leu Tyr 202324PRTStaphylococcus
23Lys Lys Asn Val Thr Leu Gln Glu Leu Asp Ile Lys Ile Arg Lys Ile 1
5 10 15Leu Ser Asp Lys Tyr Lys Ile Tyr 202424PRTStreptococcus 24Lys
Lys Met Val Thr Ala Gln Glu Leu Asp Tyr Lys Val Arg Lys Tyr 1 5 10
15Leu Thr Asp Asn Lys Gln Leu Tyr 202524PRTStreptococcus 25Lys Asp
Ile Val Thr Phe Gln Glu Ile Asp Phe Lys Ile Arg Lys Leu 1 5 10
15Tyr Met Asp Asn Tyr Lys Ile Tyr 202624PRTStreptococcus 26Lys Lys
Gln Val Thr Val Gln Glu Leu Asp Cys Lys Thr Arg Lys Ile 1 5 10
15Leu Val Ser Arg Lys Asn Leu Tyr 202724PRTStaphylococcus 27Lys Lys
Gln Leu Ala Ile Ser Thr Leu Asp Phe Glu Ile Arg His Gln 1 5 10
15Leu Thr Gln Ile His Gly Leu Tyr 202812PRTArtificial
SequenceDescription of Artificial SequenceConsensus sequence
derived from staphylococcal and streptococcal toxins 28Xaa Xaa Tyr
Gly Gly Xaa Thr Xaa Xaa Xaa Xaa Asn 1 5 102924PRTArtificial
SequenceDescription of Artificial SequenceConsensus sequence
derived from staphylococcal and streptococcal toxins 29Lys Xaa Xaa
Xaa Xaa Xaa Xaa Xaa Xaa Asp Xaa Xaa Xaa Arg Xaa Xaa 1 5 10 15Xaa
Xaa Xaa Xaa Xaa Xaa Xaa Tyr 203012PRTArtificial SequenceDescription
of Artificial SequenceConsensus sequence derived from
staphylococcal and streptococcal toxins 30Cys Met Tyr Gly Gly Xaa
Thr Xaa His Xaa Gly Asn 1 5 103124PRTArtificial
SequenceUNSURE(11)XAA may be L, Y, I, A, F or C; preferably Y 31Lys
Lys Xaa Val Thr Xaa Gln Glu Leu Asp Xaa Xaa Xaa Arg Xaa Xaa 1 5 10
15Xaa Xaa Xaa Xaa Xaa Xaa Leu Tyr 203212PRTArtificial
SequenceDescription of Artificial Sequence Variants of
staphylococcal and streptococcal toxins 32Cys Met Tyr Gly Gly Val
Thr Leu His Asp Gly Asn 1 5 103312PRTArtificial SequenceDescription
of Artificial Sequence Variants of staphylococcal and streptococcal
toxins 33Cys Met Tyr Gly Gly Val Thr Leu His Asn Gly Asn 1 5
103412PRTArtificial SequenceDescription of Artificial Sequence
Variants of staphylococcal and streptococcal toxins 34Cys Met Tyr
Gly Gly Val Thr Leu His Glu Gly Asn 1 5 103512PRTArtificial
SequenceDescription of Artificial Sequence Variants of
staphylococcal and streptococcal toxins 35Cys Met Tyr Gly Gly Val
Thr Leu His Gln Gly Asn 1 5 103612PRTArtificial SequenceDescription
of Artificial Sequence Variants of staphylococcal and streptococcal
toxins 36Cys Met Tyr Gly Gly Val Thr Leu His His Gly Asn 1 5
103712PRTArtificial SequenceDescription of Artificial Sequence
Variants of staphylococcal and streptococcal toxins 37Cys Met Tyr
Gly Gly Val Thr Glu His Asp Gly Asn 1 5 103812PRTArtificial
SequenceDescription of Artificial Sequence SEB 38Cys Met Tyr Gly
Gly Val Thr Glu His Asn Gly Asn 1 5 103912PRTArtificial
SequenceDescription of Artificial Sequence Variants of
staphylococcal and streptococcal toxins 39Cys Met Tyr Gly Gly Val
Thr Glu His Gln Gly Asn 1 5 104012PRTArtificial SequenceDescription
of Artificial Sequence Variants of staphylococcal and streptococcal
toxins 40Cys Met Tyr Gly Gly Val Thr Glu His His Gly Asn 1 5
104112PRTArtificial SequenceDescription of Artificial Sequence
Variants of staphylococcal and streptococcal toxins 41Cys Met Tyr
Gly Gly Val Thr Lys His Asp Gly Asn 1 5 104212PRTArtificial
SequenceDescription of Artificial Sequence Variants of
staphylococcal and streptococcal toxins 42Cys Met Tyr Gly Gly Val
Thr Lys His Asn Gly Asn 1 5 104312PRTArtificial SequenceDescription
of Artificial Sequence Variants of staphylococcal and streptococcal
toxins 43Cys Met Tyr Gly Gly Val Thr Lys His Glu Gly Asn 1 5
104412PRTArtificial SequenceDescription of Artificial Sequence
Variants of staphylococcal and streptococcal toxins 44Cys Met Tyr
Gly Gly Val Thr Lys His Gln Gly Asn 1 5 104512PRTArtificial
SequenceDescription of Artificial Sequence Variants of
staphylococcal and streptococcal toxins 45Cys Met Tyr Gly Gly Val
Thr Lys His His Gly Asn 1 5 104612PRTArtificial SequenceDescription
of Artificial Sequence Variants of staphylococcal and streptococcal
toxins 46Cys Met Tyr Gly Gly Val Thr Pro His Asp Gly Asn 1 5
104712PRTArtificial SequenceDescription of Artificial Sequence
Variants of staphylococcal and streptococcal toxins 47Cys Met Tyr
Gly Gly Val Thr Pro His Asn Gly Asn 1 5 104812PRTArtificial
SequenceDescription of Artificial Sequence Variants of
staphylococcal and streptococcal toxins 48Cys Met Tyr Gly Gly Val
Thr Pro His Glu Gly Asn 1 5 104912PRTArtificial SequenceDescription
of Artificial Sequence Variants of staphylococcal and streptococcal
toxins 49Cys Met Tyr Gly Gly Val Thr Pro His Gln Gly Asn 1 5
105012PRTArtificial SequenceDescription of Artificial Sequence
Variants of staphylococcal and streptococcal toxins 50Cys Met Tyr
Gly Gly Val Thr Pro His His Gly Asn 1 5 105112PRTArtificial
SequenceDescription of Artificial Sequence Variants of
staphylococcal and streptococcal toxins 51Cys Met Tyr Gly Gly Val
Thr Asn His Asp Gly Asn 1 5 105212PRTArtificial SequenceDescription
of Artificial Sequence Variants of staphylococcal and streptococcal
toxins 52Cys Met Tyr Gly Gly Val Thr Asn His Asn Gly Asn 1 5
105312PRTArtificial SequenceDescription of Artificial Sequence
Variants of staphylococcal and streptococcal toxins 53Cys Met Tyr
Gly Gly Val Thr Asn His Glu Gly Asn 1 5 105412PRTArtificial
SequenceDescription of Artificial Sequence Variants of
staphylococcal and streptococcal toxins 54Cys Met Tyr Gly Gly Val
Thr Asn His Gln Gly Asn 1 5 105512PRTArtificial SequenceDescription
of Artificial Sequence Variants of staphylococcal and streptococcal
toxins 55Cys Met Tyr Gly Gly Val Thr Asn His His Gly Asn 1 5
105612PRTArtificial SequenceDescription of Artificial Sequence
Variants of staphylococcal and streptococcal toxins 56Cys Met Tyr
Gly Gly Ile Thr Leu His Asp Gly Asn 1 5 105712PRTArtificial
SequenceDescription of Artificial Sequence Variants of
staphylococcal and streptococcal toxins 57Cys Met Tyr Gly Gly Ile
Thr Leu His Asn Gly Asn 1 5 105812PRTArtificial SequenceDescription
of Artificial Sequence Variants of staphylococcal and streptococcal
toxins 58Cys Met Tyr Gly Gly Ile Thr Leu His Glu Gly Asn 1 5
105912PRTArtificial SequenceDescription of Artificial Sequence
Variants of staphylococcal and streptococcal toxins 59Cys Met Tyr
Gly Gly Ile Thr Leu His Gln Gly Asn 1 5 106012PRTArtificial
SequenceDescription of Artificial Sequence Variants of
staphylococcal and streptococcal toxins 60Cys Met Tyr Gly Gly Ile
Thr Leu His His Gly Asn 1 5 106112PRTArtificial SequenceDescription
of Artificial Sequence Variants of staphylococcal and streptococcal
toxins 61Cys Met Tyr Gly Gly Ile Thr Glu His Asp Gly Asn 1 5
106212PRTArtificial SequenceDescription of Artificial Sequence
Variants of staphylococcal and streptococcal toxins 62Cys Met Tyr
Gly Gly Ile Thr Glu His Asn Gly Asn 1 5 106312PRTArtificial
SequenceDescription of Artificial Sequence Variants of
staphylococcal and streptococcal toxins 63Cys Met Tyr Gly Gly Ile
Thr Glu His Glu Gly Asn 1 5 106412PRTArtificial SequenceDescription
of Artificial Sequence Variants of staphylococcal and streptococcal
toxins 64Cys Met Tyr Gly Gly Ile Thr Glu His Gln Gly Asn 1 5
106512PRTArtificial SequenceDescription of Artificial Sequence
Variants of staphylococcal and streptococcal toxins 65Cys Met Tyr
Gly Gly Ile Thr Glu His His Gly Asn 1 5 106612PRTArtificial
SequenceDescription of Artificial Sequence Variants of
staphylococcal and streptococcal toxins 66Cys Met Tyr Gly Gly Ile
Thr Lys His Asp Gly Asn 1 5 106712PRTArtificial SequenceDescription
of Artificial Sequence Variants of staphylococcal and streptococcal
toxins 67Cys Met Tyr Gly Gly Ile Thr Lys His Asn Gly Asn 1 5
106812PRTArtificial SequenceDescription of Artificial Sequence SEC
68Cys Met Tyr Gly Gly Ile Thr Lys His Glu Gly Asn 1 5
106912PRTArtificial SequenceDescription of Artificial Sequence
Variants of staphylococcal and streptococcal toxins 69Cys Met Tyr
Gly Gly Ile Thr Lys His Gly Gly Asn 1 5 107012PRTArtificial
SequenceDescription of Artificial Sequence Variants of
staphylococcal and streptococcal toxins 70Cys Met Tyr Gly Gly Ile
Thr Lys His His Gly Asn 1 5 107112PRTArtificial SequenceDescription
of Artificial Sequence Variants of staphylococcal and streptococcal
toxins 71Cys Met Tyr Gly Gly Ile Thr Pro His Asp Gly Asn 1 5
107212PRTArtificial SequenceDescription of Artificial Sequence
Variants of staphylococcal and streptococcal toxins 72Cys Met Tyr
Gly Gly Ile Thr Pro His Asn Gly Asn 1 5 107312PRTArtificial
SequenceDescription of Artificial Sequence Variants of
staphylococcal and streptococcal toxins 73Cys Met Tyr Gly Gly Ile
Thr Pro His Glu Gly Asn 1 5 107412PRTArtificial SequenceDescription
of Artificial Sequence Variants of staphylococcal and streptococcal
toxins 74Cys Met Tyr Gly Gly Ile Thr Pro His Gln Gly Asn 1 5
107512PRTArtificial SequenceDescription of Artificial Sequence
Variants of staphylococcal and streptococcal toxins 75Cys Met Tyr
Gly Gly Ile Thr Pro His His Gly Asn 1 5 107612PRTArtificial
SequenceDescription of Artificial Sequence Variants of
staphylococcal and streptococcal toxins 76Cys Met Tyr Gly Gly Ile
Thr Asn His Asp Gly Asn 1 5 107712PRTArtificial SequenceDescription
of Artificial Sequence Variants of staphylococcal and streptococcal
toxins 77Cys Met Tyr Gly Gly Ile Thr Asn His Asn Gly Asn 1 5
107812PRTArtificial SequenceDescription of Artificial Sequence
Variants of staphylococcal and streptococcal toxins 78Cys Met Tyr
Gly Gly Ile Thr Asn His Glu Gly Asn 1 5 107912PRTArtificial
SequenceDescription of Artificial Sequence Variants of
staphylococcal and streptococcal toxins 79Cys Met Tyr Gly Gly Ile
Thr Asn His Gln Gly Asn 1 5 108012PRTArtificial SequenceDescription
of Artificial Sequence Variants of staphylococcal and streptococcal
toxins 80Cys Met Tyr Gly Gly Ile Thr Asn His His Gly Asn 1 5 10
* * * * *