U.S. patent application number 10/553703 was filed with the patent office on 2008-11-06 for hla-a2 tumor associated antigen peptides and compositions.
Invention is credited to Robert W. Chesnut, John D. Fikes, Glenn Ishioka, Alessandro Sette.
Application Number | 20080274129 10/553703 |
Document ID | / |
Family ID | 33310811 |
Filed Date | 2008-11-06 |
United States Patent
Application |
20080274129 |
Kind Code |
A1 |
Fikes; John D. ; et
al. |
November 6, 2008 |
Hla-A2 Tumor Associated Antigen Peptides and Compositions
Abstract
A peptide or composition comprising at least one HLA-A2 epitope
or analog from CEA, HER2/neu, MAGE2, MAGE3, or p53.
Inventors: |
Fikes; John D.; (San Diego,
CA) ; Ishioka; Glenn; (San Diego, CA) ; Sette;
Alessandro; (La Jolla, CA) ; Chesnut; Robert W.;
(Cardiff-by-the-Sea, CA) |
Correspondence
Address: |
STERNE, KESSLER, GOLDSTEIN & FOX P.L.L.C.
1100 NEW YORK AVENUE, N.W.
WASHINGTON
DC
20005
US
|
Family ID: |
33310811 |
Appl. No.: |
10/553703 |
Filed: |
April 16, 2004 |
PCT Filed: |
April 16, 2004 |
PCT NO: |
PCT/US04/11895 |
371 Date: |
September 19, 2006 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
60463724 |
Apr 18, 2003 |
|
|
|
Current U.S.
Class: |
424/185.1 ;
424/450 |
Current CPC
Class: |
A61K 39/0011 20130101;
A61K 39/39 20130101; A61K 2039/57 20130101; A61K 2039/572 20130101;
A61P 35/04 20180101; C07K 14/47 20130101; C07K 7/06 20130101; A61P
35/00 20180101; A61K 2039/70 20130101; A61K 2039/55566 20130101;
A61K 2039/55511 20130101 |
Class at
Publication: |
424/185.1 ;
424/450 |
International
Class: |
A61K 39/00 20060101
A61K039/00; A61K 9/127 20060101 A61K009/127; C07K 14/82 20060101
C07K014/82 |
Claims
1-14. (canceled)
15. A composition comprising at least three peptides, wherein each
of said three peptides is less than 15 amino acid residues in
length and comprises a cytotoxic T-cell lymphocyte (CTL) epitope
and/or analog selected from the group consisting of: TABLE-US-00023
RLLQETELV, (SEQ ID NO:2) YLQLVFGIEV, (SEQ ID NO:3) LLTFWNPPV, (SEQ
ID NO:4) SMPPPGTRV, (SEQ ID NO:5) KLBPVQLWV, (SEQ ID NO:6)
KVFGSLAFV, (SEQ ID NO:7) YLSGADLNL, (SEQ ID NO:8) IMIGHLVGV, (SEQ
ID NO:9) and KVAEIVHFL. (SEQ ID NO:10)
16. A composition according to claim 15, further comprising a
fourth peptide, wherein said fourth peptide is less than 15 amino
acid residues in length and comprises a cytotoxic T-cell lymphocyte
(CTL) epitope and/or analog selected from the group consisting of:
TABLE-US-00024 RLLQETELV, (SEQ ID NO:2) YLQLVFGIEV, (SEQ ID NO:3)
LLTFWNPPV, (SEQ ID NO:4) SMPPPGTRV, (SEQ ID NO:5) KLBPVQLWV, (SEQ
ID NO:6) KVFGSLAFV, (SEQ ID NO:7) YLSGADLNL, (SEQ ID NO:8)
IMIGHLVGV, (SEQ ID NO:9) and KVAEIVHFL. (SEQ ID NO:10)
17. A composition according to claim 16, further comprising a fifth
peptide, wherein said fifth peptide is less than 15 amino acid
residues in length and comprises a cytotoxic T-cell lymphocyte
(CTL) epitope and/or analog selected from the group consisting of:
TABLE-US-00025 RLLQETELV, (SEQ ID NO:2) YLQLVFGIEV, (SEQ ID NO:3)
LLTFWNPPV, (SEQ ID NO:4) SMPPPGTRV, (SEQ ID NO:5) KLBPVQLWV, (SEQ
ID NO:6) KVFGSLAFV, (SEQ ID NO:7) YLSGADLNL, (SEQ ID NO:8)
IMIGHLVGV, (SEQ ID NO:9) and KVAEIVHFL. (SEQ ID NO:10)
18. A composition according to claim 17, further comprising a sixth
peptide, wherein said sixth peptide is less than 15 amino acid
residues in length and comprises a cytotoxic T-cell lymphocyte
(CTL) epitope and/or analog selected from the group consisting of:
TABLE-US-00026 RLLQETELV, (SEQ ID NO:2) YLQLVFGIEV, (SEQ ID NO:3)
LLTFWNPPV, (SEQ ID NO:4) SMPPPGTRV, (SEQ ID NO:5) KLBPVQLWV, (SEQ
ID NO:6) KVFGSLAFV, (SEQ ID NO:7) YLSGADLNL, (SEQ ID NO:8)
IMIGHLVGV, (SEQ ID NO:9) and KVAEIVHFL. (SEQ ID NO:10)
19. A composition according to claim 18, further comprising a
seventh peptide, wherein said seventh peptide is less than 15 amino
acid residues in length and comprises a cytotoxic T-cell lymphocyte
(CTL) epitope and/or analog selected from the group consisting of:
TABLE-US-00027 RLLQETELV, (SEQ ID NO:2) YLQLVFGIEV, (SEQ ID NO:3)
LLTFWNPPV, (SEQ ID NO:4) SMPPPGTRV, (SEQ ID NO:5) KLBPVQLWV, (SEQ
ID NO:6) KVFGSLAFV, (SEQ ID NO:7) YLSGADLNL, (SEQ ID NO:8)
IMIGHLVGV, (SEQ ID NO:9) and KVAEIVHFL. (SEQ ID NO:10)
20. A composition according to claim 19, further comprising a
eighth peptide, wherein said eighth peptide is less than 15 amino
acid residues in length and comprises a cytotoxic T-cell lymphocyte
(CTL) epitope and/or analog selected from the group consisting of:
TABLE-US-00028 RLLQETELV, (SEQ ID NO:2) YLQLVFGIEV, (SEQ ID NO:3)
LLTFWNPPV, (SEQ ID NO:4) SMPPPGTRV, (SEQ ID NO:5) KLBPVQLWV, (SEQ
ID NO:6) KVFGSLAFV, (SEQ ID NO:7) YLSGADLNL, (SEQ ID NO:8)
IMIGHLVGV, (SEQ ID NO:9) and KVAEIVHFL. (SEQ ID NO:10)
21. A composition according to claim 20, further comprising a ninth
peptide, wherein said ninth peptide is less than 15 amino acid
residues in length and comprises a cytotoxic T lymphocyte (CTL)
epitope and/or analog selected from the group consisting of:
TABLE-US-00029 RLLQETELV, (SEQ ID NO:2) YLQLVFGIEV, (SEQ ID NO:3)
LLTFWNPPV, (SEQ ID NO:4) SMPPPGTRV, (SEQ ID NO:5) KLBPVQLWV, (SEQ
ID NO:6) KVFGSLAFV, (SEQ ID NO:7) YLSGADLNL, (SEQ ID NO:8)
IMIGHLVGV, (SEQ ID NO:9) and KVAEIVHFL. (SEQ ID NO:10)
22. A composition according to claim 15, further comprising an
additional peptide, wherein said additional peptide is less than 25
amino acid residues in length and comprises an helper T lymphocyte
(HTL) epitope.
23. A composition according to claim 22, wherein said additional
peptide is a PanDR binding peptide.
24. A composition according to claim 23, wherein said Pan DR
binding peptide comprises the amino acid sequence aKXVAAWTLKAAa
(SEQ ID NO:1).
25. A composition according to claim 15, further comprising a
liposome.
26. A composition according to claim 15, further comprising a
lipid.
27. A composition according to claim 15, further comprising an
antigen presenting cell.
28. A composition according to claim 27, wherein said antigen
presenting cell is a dendritic cell.
29. A composition according to claim 15, further comprising a
pharmaceutical excipient.
30. A composition according to claim 29, wherein said
pharmaceutical excipient is an adjuvant.
31. A composition according to claim 30, wherein said adjuvant is a
mineral oil adjuvant.
32. An isolated nucleic acid encoding at least three peptides,
wherein each of said three peptides is less than 15 amino acid
residues in length and comprises a cytotoxic T-cell lymphocyte
(CTL) epitope and/or analog selected from the group consisting of:
TABLE-US-00030 RLLQETELV, (SEQ ID NO:2) YLQLVFGIEV, (SEQ ID NO:3)
LLTFWNPPV, (SEQ ID NO:4) SMPPPGTRV, (SEQ ID NO:5) KLBPVQLWV, (SEQ
ID NO:6) KVFGSLAFV, (SEQ ID NO:7) YLSGADLNL, (SEQ ID NO:8)
IMIGHLVGV, (SEQ ID NO:9) and KVAEIVHFL. (SEQ ID NO:10)
33. A method for the treatment or prevention of cancer, said method
comprising administering the composition of claim 15 to a patient
in need thereof.
34. A method according to claim 33, wherein said treatment delays
the recurrence of cancer following surgery, radiation therapy or
chemotherapy.
35. A method according to claim 33, wherein said treatment prevents
the metastasis of a primary tumor.
36. A method according to claim 33, wherein said cancer is selected
from the group consisting of breast cancer, colon cancer, lung
cancer, non-small cell lung cancer, ovarian cancer, gastric cancer,
melanoma and a cancer of the head and/or neck.
37. A method for the treatment or prevention of cancer, said method
comprising administering the nucleic acid of claim 32 to a patient
in need thereof.
38. A method according to claim 37, wherein said treatment delays
the recurrence of cancer following surgery, chemotherapy or
radiation.
39. A method according to claim 37, wherein said treatment prevents
the metastasis of a primary tumor.
40. A method according to claim 37, wherein said cancer is selected
from the group consisting of breast cancer, colon cancer, lung
cancer, non-small cell lung cancer, ovarian cancer, gastric cancer,
melanoma and a cancer of the head and/or neck.
Description
BACKGROUND OF THE INVENTION
[0001] 1. Field of the Invention
[0002] This invention relates to the field of biology. In a
particular embodiment, it relates to peptides, polynucleotides, and
compositions useful to monitor or elicit an immune response to
selected tumor-associated antigens.
[0003] 2. Related Art
[0004] The field of immunotherapy is yielding new approaches for
the treatment of cancer, including the development of improved
cancer vaccines (Krul, K. G., Decision Resources, 10.1-10.25
(1998)). While vaccines provide a mechanism of directing immune
responses towards the tumor cells, there are a number of mechanisms
by which tumor cells circumvent immunological processes (Pardoll,
D. M., Nature Medicine (Vaccine Supplement), 4:525-531 (1998)).
Recent advances indicate that the efficacy of peptide vaccines may
be increased when combined with approaches which enhance the
stimulation of immune responses, such as the use of Interleukin-2
or autologous dendritic cells (DC) (Abbas et al., eds., Cellular
and Molecular Immunology, 3.sup.rd Edition, W. B. Saunders Company,
pub. (1997)).
[0005] In a Phase I study, Murphy, et al., demonstrated that Human
Leukocyte Antigen (HLA)-A2-binding peptides corresponding to
sequences present in prostate specific antigen (PSA) stimulated
specific cytotoxic T-cell lymphocyte (CTL) responses in patients
with prostate cancer (Murphy et al., The Prostate 29:371-380
(1996)). Rosenberg, et al., evaluated the safety and mechanism of
action of a synthetic HLA-A2 binding peptide derived from the
melanoma associated antigen, gp100, as a cancer vaccine to treat
patients with metastatic melanoma (Rosenberg et al., Nature Med.,
4:321-327 (1998)). Based on immunological assays, 91% of patients
were successfully immunized with the synthetic peptide. In
addition, 42% (13/31) of patients who received the peptide vaccine
in combination with IL-2 treatment, demonstrated objective cancer
responses. In addition, Nestle, et al., reported the vaccination of
16 melanoma patients with peptide- or tumor lysate-pulsed DC
(Nestle et al., Nature Med 4:328-332 (1998)). Peptide-pulsed DC
induced immune responses in 11/12 patients immunized with a vaccine
comprised of 1-2 peptides. Objective responses were evident in 5/16
(3 peptide-pulsed, 2 tumor-lysate pulsed) patients evaluated in
this study. These Phase I safety studies provided evidence that
HLA-A2 binding peptides of known tumor-associated antigens
demonstrate the expected mechanism of action. These vaccines were
generally safe and well tolerated. Vaccine molecules related to at
least four cancer antigens, CEA, HER2/neu, MAGE2, and, MAGE3 have
been disclosed. (Kawashima et al., Human Immunology, 59:1-14
(1998))
[0006] Preclinical studies have shown that vaccine-pulsed DC
mediate anti-tumor effects through the stimulation of
antigen-specific CTL (Mandelboim et al., Nature Med., 1: 1179-1183
(1995); Celluzzi et al., J Exp Med 183:283-287 (1996); Zitvogel et
al., J Exp Med 183:87-97 (1996); Mayordomo et al., Nature Med
1:1297-1302 (1995)). CTL directly lyse tumor cells and also secrete
an array of cytokines such as interferon gamma (IFN.gamma.), tumor
necrosis factor (TNF) and granulocyte-macrophage colony stimulating
factor (GM-CSF), that further amplify the immune reactivity against
the tumor cells. CTL recognize tumor associated antigens (TAA) in
the form of a complex composed of 8-11 amino acid residue peptide
epitopes, bound to Major Histocompatibility Complex (MHC) molecules
(Schwartz, B. D., The human major histocompatibility complex HLA in
basic & clinical immunology Stites et al., eds., Lange Medical
Publication: Los Altos, pp. 52-64, 4.sup.th ed.). Peptide epitopes
are generated through intracellular processing of proteins. The
processed peptides bind to newly synthesized MHC molecules and the
epitope-MHC complexes are expressed on the cell surface. These
epitope-MHC complexes are recognized by the T cell receptor of the
CTL. This recognition event is required for the activation of CTL
as well as induction of the effector functions such as lysis of the
target tumor cell.
[0007] MHC molecules are highly polymorphic proteins that regulate
T cell responses (Schwartz, B. D., The human major
histocompatibility complex HLA in basic & clinical immunology
Stites et al., eds., Lange Medical Publication: Los Altos, pp.
52-64, 4.sup.th ed.). The species-specific MHC homologues that
display CTL epitopes in humans are termed human leukocyte antigen
("HLA"). HLA class I molecules can be divided into several families
or "supertypes" based upon their ability to bind similar
repertoires of peptides. Vaccines which bind to multiple HLA
supertypes, such as for example A2, A3, and B7, will afford broad,
non-ethnically biased population coverage. As seen in Table 1,
population coverage is approximately 84-90% for various
ethnicities, with an average coverage of the sample ethnicities at
approximately 87%.
[0008] One of the main factors contributing to the dynamic
interplay between host and disease is the immune response mounted
against the pathogen, infected cell, or malignant cell. In many
conditions such immune responses control the disease. Several
animal model systems and prospective studies of natural infection
in humans suggest that immune responses against a pathogen can
control the pathogen, prevent progression to severe disease and/or
eliminate the pathogen. A common theme is the requirement for a
multispecific T cell response, and that narrowly focused responses
appear to be less effective.
[0009] In the cancer setting there are several findings that
indicate that immune responses can impact neoplastic growth:
[0010] First, the demonstration in many different animal models,
that anti-tumor T cells, restricted by MHC class I, can prevent or
treat tumors.
[0011] Second, encouraging results have come from immunotherapy
trials.
[0012] Third, observations made in the course of natural disease
correlated the type and composition of T cell infiltrate within
tumors with positive clinical outcomes (Coulie P G, et al.
Antitumor immunity at work in a melanoma patient In Advances in
Cancer Research, 213-242, 1999).
[0013] Moreover, tumors commonly have the ability to mutate,
thereby changing their immunological recognition. For example, the
presence of monospecific CTL was also correlated with control of
tumor growth, until antigen loss emerged (Riker A, et al., Immune
selection after antigen-specific immunotherapy of melanoma Surgery,
August: 126(2):112-20, 1999; Marchand M, et al., Tumor regressions
were observed in patients with metastatic melanoma treated with an
antigenic peptide derived from the MAGE-3 gene and presented by
HLA-A1 Int. J. Cancer 80(2):219-30, Jan. 18, 1999). Similarly, loss
of beta 2 microglobulin was detected in 5/13 lines established from
melanoma patients after receiving immunotherapy at the National
Cancer Institute (Restifo N P, et al., Loss of functional
Beta2--microglobulin in metastatic melanomas from five patients
receiving immunotherapy Journal of the National Cancer Institute,
Vol. 88 (2), 100-108, January 1996). It has long been recognized
that HLA class I is frequently altered in various tumor types. This
deservation has led to a hypothesis that this phenomenon might
reflect immune pressure exerted on the tumor by means of class I
restricted CTL. The extent and degree of alteration in HLA class I
expression appears to be reflective of past immune pressures, and
may also have prognostic value (van Duinen S G, et al, Level of HLA
antigens in locoregional metastases and clinical course of the
disease in patients with melanoma Cancer Research 48, 1019-1025,
February 1988; Moller P, et al., Influence of major
histocompatibility complex class I and II antigens on survival in
colorectal carcinoma Cancer Research 51, 729-736, January 1991).
Taken together, these observations provide a rationale for
immunotherapy of cancer and infectious disease, and suggest
effective strategies that are needed to counteract the complex
series of pathological changes associated with disease.
[0014] The frequency of alterations in class I expression is the
subject of numerous studies (Algarra I, et al., The HLA crossroad
in tumor immunology Human Immunology 61, 65-73, 2000). Rees and
Mian estimate allelic loss to occur overall in 3-20% of tumors, and
allelic deletion to occur in 15-50% of tumors. It should be noted
that each cell carries two separate sets of class I genes, each
gene carrying one HLA-A and one HLA-B locus. Thus, fully
heterozygous individuals carry two different HLA-A molecules and
two different HLA-B molecules. Accordingly, the actual frequency of
losses for any specific allele could be as little as one quarter of
the overall frequency. They also note that, in general, a gradient
of expression exists between normal cells, primary tumors and
metastatic tumors. In a study from Natali and coworkers (Natali P
G, et al., Selective changes in expression of HLA class I
polymorphic determinants in human solid tumors PNAS USA
86:6719-6723, September 1989), solid tumors were investigated for
total HLA expression, using the W6/32 antibody, and for
allele-specific expression of the A2 antigen, as evaluated by use
of the BB7.2 antibody. Tumor samples were derived from primary or
metastatic tumors, for 13 different tumor types, and scored as
"negative" if less than 20%, "reduced" if in the 30-80% range, and
"normal" above 80%. All tumors, both primary and metastatic, were
HLA positive with W6/32. In terms of A2 expression, a reduction was
noted in 16.1% of the cases, and A2 was scored as undetectable in
39.4% of the cases. Garrido and coworkers (Garrido F, et al.,
Natural history of HLA expression during tumour development Immunol
Today 14(10):491-99, 1993) emphasize that HLA changes appear to
occur at a particular step in the progression from benign to most
aggressive. Jiminez et al (Jiminez P, et al., Microsatellite
instability analysis in tumors with different mechanisms for total
loss of HLA expression. Cancer Immunol Immunother 48:684-90, 2000)
have analyzed 118 different tumors (68 colorectal, 34 laryngeal and
16 melanomas). The frequencies reported for total loss of HLA
expression were 11% for colon, 18% for melanoma and 13% for larynx.
Thus, HLA class I expression is altered in a large fraction of the
tumor types, possibly as a reflection of immune pressure, or simply
a reflection of the accumulation of pathological changes and
alterations in diseased cells.
[0015] A majority of tumors express HLA class I, with a general
tendency for the more severe alterations to be found in later stage
and less differentiated tumors. This pattern is encouraging in the
context of immunotherapy, especially considering that: 1) the
relatively low sensitivity of immunohistochemical techniques might
underestimate HLA expression in tumors; 2) class I expression can
be induced in tumor cells as a result of local inflammation and
lymphokine release; and, 3) class I negative cells are sensitive to
lysis by NK cells.
[0016] Currently there are a number of unmet needs in the area of
cancer treatment. This is evidenced by the side effects associated
with existing therapies employed for cancer treatment and the fact
that less than 50% of patients are cured by current therapies.
Therefore, an opportunity exists for a product with the ability to
either increase response rates, duration of response, overall
survival, disease free survival and/or quality of life.
SUMMARY OF THE INVENTION
[0017] In some embodiments, the invention is directed to an
isolated peptide comprising or consisting of one or more HLA-A2
epitopes and/or HLA-A2 analogs. The peptide may comprise multiple
epitopes and/or analogs, and may comprise additional amino acid
residues, including but not limited to, other CTL epitopes,
universal HTL epitopes, HTL epitopes, linkers, spacers, carriers,
etc.
[0018] In further embodiments, the invention is directed to
polynucleotides encoding such peptides.
[0019] In further embodiments, the invention is directed to a
composition comprising two, three, four, five, six, seven, eight,
nine, ten, eleven or twelve peptide epitopes and/or analogs. One or
more of the peptides and/or analogs in these embodiments may also
further comprise additional amino acid residues including, but not
limited to, other CTL epitopes, HTL epitopes, universal HTL
epitopes, linkers, spacers, carriers, etc.
[0020] In further embodiments, the invention is directed to a
composition comprising one or more of the above peptides and/or
polynucleotides and one or more additional components. Additional
components include diluents, excipients, CTL epitopes, HTL
epitopes, carriers, liposomes, HLA heavy chains,
.beta.2-microglobulin, strepavidin, antigen-presenting cells,
adjuvants, etc.
[0021] In further embodiments, the invention is directed to
prophylactic, therapeutic, diagnostic, and prognostic methods using
the peptides, polynucleotides, and compositions of the
invention.
BRIEF DESCRIPTION OF THE DRAWINGS/FIGURES
[0022] FIG. 1 depicts that splenic DC from ProGP-treated mice
induce CTL responses in vivo. In FIG. 1, Splenic DC from ProGP
treated HLA-A2.1 transgenic mice (33 .mu.g/mouse, QD, SC for 7
days) were pulsed in vitro with HBV Pol 455 peptide (10.sup.6 cell
per ml peptide at 10 .mu.g/ml) in Opti-MEM I medium (Gibco Life
Sciences) containing 3 .mu.g/ml .beta.2-microglobulin (Scripps
Laboratories). After peptide pulsing for 3 hr at room temperature,
DC were washed twice and 10.sup.6 cells were injected IV into
groups of three transgenic mice. Epitope-pulsed GM-CSF/IL-4
expanded DC and "mock-pulsed" ProGP derived DC were also tested for
comparison. Seven days after receiving the primary immunization
with DC, animals were boosted with the same DC populations. At
fourteen days after the primary immunization, spleen cells from
immunized animals were restimulated twice in vitro in the presence
of the Pol 455 peptide. CTL activity following restimulations was
measured using a standard .sup.51Cr release assay in which the
lysis of .sup.51Cr-labeled HLA-A2.1-transfected Jurkat target cells
was measured in the presence (circle symbols) or absence of peptide
(square symbols). The data points shown in Panels A-C represent a
composite of lytic activity from a triplicate set of cultures.
Panel A, splenic DC from ProGP (SD-9427) treated animals pulsed
with the HBV Pol 455 peptide. Panel B, GM-CSF/IL-4 expanded DC
pulsed with HBV Pol 455 peptide. Panel C, mock-pulsed DC from ProGP
treated animals. Studies were performed at Epimmune Inc., San
Diego, Calif.
[0023] FIG. 2 presents a schematic of a dendritic cell pulsing and
testing procedure.
[0024] FIG. 3A shows a flow chart of the preparation of Drug
Product.
[0025] FIG. 3B shows multi-epitope CTL induction in
HLA-A2.1/K.sup.b transgenic mice immunized with the EP-2101
vaccine. Mice were immunized with 50 .mu.g of EP-2101 (10 mg/ml
emulsion dose) or co-immunized with 50 .mu.g of each CTL epitope
individually with an equal dose of PADRE.RTM. epitope in
Montanide.RTM. ISA 51 adjuvant (latter responses designated as
"Individual"). Eleven to 14 days later, splenocytes from primed
animals were stimulated with each CTL peptide in vitro and six days
later CTL activity from triplicate cultures were measured with an
in situ IFN-.gamma. ELISA. As a control, splenocytes from naive
mice or mice injected with a Montanide.RTM. ISA 51 emulsion
prepared without peptide were also stimulated with peptide in vitro
and CTL activity was measured under identical conditions (responses
designated as "Naive control"). Data shown for each epitope is the
geometric mean CTL response from 6-10 independent experiments. CTL
responses are expressed in secretory units (SU) with 1 SU defined
as the release of 100 pg/well of IFN-.gamma. by 10.sup.6 effector
cells.
DETAILED DESCRIPTION OF THE INVENTION
[0026] This invention provides peptides that can be used to monitor
an immune response to a tumor associated antigen or to create a
cancer vaccine that stimulates the cellular arm of the immune
system, especially when one or more peptides are combined. In
particular embodiments, compositions mediate immune responses
against tumors in individuals who bear at least one allele of
HLA-A2 and/or HLA-A2 supertype. Such compositions will generally be
referred to as A2 compositions (or combinations thereof).
[0027] An A2 composition may, for example, act as a vaccine to
stimulate the immune system to recognize and kill tumor cells,
leading to increased quality of life, and/or disease-free or
overall survival rates for patients treated for cancer. In a
preferred embodiment, a composition of the invention such as a
vaccine will be administered to HLA-A2 or HLA-A2 supertype positive
individuals who have a cancer that expresses at least one of the
TAAs from which the epitopes or analogs were selected (e.g., CEA,
p53, HER2/neu, MAGE2/3), examples of such cancers being breast,
colon, lung, ovarian and gastric cancers and for MAGE 2/3, some
melanomas. Thereby, an A2 composition, e.g., vaccine, improves the
standard of care for patients being treated for breast, colon,
lung, ovarian or gastric cancers, or melanoma.
[0028] A2 compositions, e.g., vaccines, of the invention comprise
peptides bearing A2 motifs or A2 supermotifs (A2 epitopes and/or A2
analogs), as described herein, and/or nucleic acids encoding such
peptides. Such compositions may also comprise a PADRE.RTM.
epitope.
[0029] The peptides and corresponding nucleic acids and
compositions of the present invention are useful for stimulating an
immune response to TAAs by stimulating the production of CTL and
optionally HTL responses, e.g. therapeutic prophylaxis, and are
also useful for monitoring an immune response, e.g., diagnosis and
prognosis. The peptides, which contain A2 epitopes derived directly
or indirectly (i.e. by analoging) from native TAA protein amino
acid sequences, are able to bind to HLA molecules and stimulate an
immune response to TAAs. The complete sequence of the TAAs proteins
analyzed described as SEQ ID NOs:11-15 herein can be obtained from
GenBank. See Table 2.
[0030] The epitopes of the invention have been identified in a
number of ways, as will be discussed below. Also discussed in
greater detail is an embodiment of the invention in which analogs
have been derived wherein the binding activity for HLA molecules or
T cell receptor molecules was modulated by modifying specific amino
acid residues to create analogs which exhibit altered (e.g.
improved) immunogenicity.
DEFINITIONS
[0031] The invention can be better understood with reference to the
following definitions:
[0032] Throughout this disclosure, "binding data" results are often
expressed in terms of "IC.sub.50's." IC.sub.50 is the concentration
of peptide in a binding assay at which 50% inhibition of binding of
a reference peptide is observed. Given the conditions in which the
assays are run (i.e., limiting HLA proteins and labeled peptide
concentrations), these values approximate K.sub.D values. Assays
for determining binding are described in detail, e.g., in PCT
publications WO 94/20127 and WO 94/03205, and other publications
such Sidney et al., Current Protocols in Immunology 18.3.1 (1998);
Sidney, et al., J. Immunol. 154:247 (1995); and Sette, et al., Mol.
Immunol. 31:813 (1994). It should be noted that IC.sub.50 values
can change, often dramatically, if the assay conditions are varied,
and depending on the particular reagents used (e.g., HLA
preparation, etc.). For example, excessive concentrations of HLA
molecules will increase the apparent measured IC.sub.50 of a given
ligand.
[0033] Alternatively, binding is expressed relative to a reference
peptide. Although as a particular assay becomes more, or less,
sensitive, the IC.sub.50's of the peptides tested may change
somewhat, the binding relative to the reference peptide will not
significantly change. For example, in an assay run under conditions
such that the IC.sub.50 of the reference peptide increases 10-fold,
the IC.sub.50 values of the test peptides will also shift
approximately 10-fold. Therefore, to avoid ambiguities, the
assessment of whether a peptide is a good (i.e. high),
intermediate, weak, or negative binder is generally based on its
IC.sub.50, relative to the IC.sub.50 of a standard peptide. The
Tables included in this application present binding data in a
preferred biologically relevant form of IC.sub.50 nM.
[0034] Binding may also be determined using other assay systems
including those using: live cells (e.g., Ceppellini et al., Nature
339:392 (1989); Christnick et al., Nature 352:67 (1991); Busch et
al., Int. Immunol. 2:443 (1990); Hill et al., J. Immunol. 147:189
(1991); del Guercio et al., J. Immunol. 154:685 (1995)), cell free
systems using detergent lysates (e.g., Cerundolo et al., J.
Immunol. 21:2069 (1991)), immobilized purified MHC (e.g., Hill et
al., J. Immunol. 152, 2890 (1994); Marshall et al., J. Immunol.
152:4946 (1994)), ELISA systems (e.g., Reay et al., EMBO J. 11:2829
(1992)), surface plasmon resonance (e.g., Khilko et al., J. Biol.
Chem. 268:15425 (1993)); high flux soluble phase assays (Hammer et
al., J. Exp. Med. 180:2353 (1994)), and measurement of class I MHC
stabilization or assembly (e.g., Ljunggren et al., Nature 346:476
(1990); Schumacher et al., Cell 62:563 (1990); Townsend et al.,
Cell 62:285 (1990); Parker et al., J. Immunol. 149:1896
(1992)).
[0035] As used herein, "high affinity" with respect to HLA class I
molecules is defined as binding with an IC.sub.50 or K.sub.D value,
of 50 .mu.M or less, "intermediate affinity" is binding with an
IC.sub.50 or K.sub.D value of between 50 and about 500 nM, "weak
affinity" is binding with an IC.sub.50 or K.sub.D value of between
about 500 and about 5000 nM. "High affinity" with respect to
binding to HLA class II molecules is defined as binding with an
IC.sub.50 or K.sub.D value of 100 nM or less; "intermediate
affinity" is binding with an IC.sub.50 or K.sub.D value of between
about 100 and about 1000 nM.
[0036] A "computer" or "computer system" generally includes: a
processor and related computer programs; at least one information
storage/retrieval apparatus such as a hard drive, a disk drive or a
tape drive; at least one input apparatus such as a keyboard, a
mouse, a touch screen, or a microphone; and display structure, such
as a screen or a printer. Additionally, the computer may include a
communication channel in communication with a network. Such a
computer may include more or less than what is listed above.
[0037] "Cross-reactive binding" indicates that a peptide is bound
by more than one HLA molecule; a synonym is degenerate binding.
[0038] The term "derived" when used to discuss an epitope is a
synonym for "prepared." A derived epitope can be isolated from a
natural source, or it can be synthesized in accordance with
standard protocols in the art. Synthetic epitopes can comprise
artificial amino acid residues "amino acid mimetics," such as D
isomers of natural occurring L amino acid residues or non-natural
amino acid residues such as cyclohexylalanine. A derived or
prepared epitope can be an analog of a native epitope.
[0039] A "diluent" includes sterile liquids, such as water and
oils, including those of petroleum, animal, vegetable or synthetic
origin, such as peanut oil, soybean oil, mineral oil, sesame oil
and the like. Water is a preferred diluent for pharmaceutical
compositions. Saline solutions and aqueous dextrose and glycerol
solutions can also be employed as diluents, particularly for
injectable solutions.
[0040] A "dominant epitope" is an epitope that induces an immune
response upon immunization with a whole native antigen (see, e.g.,
Sercarz, et al., Annu. Rev. Immunol. 11:729-766, 1993). Such a
response is cross-reactive in vitro with an isolated peptide
epitope.
[0041] An "epitope" is the collective features of a molecule, such
as primary, secondary and tertiary peptide structure, and charge,
that together form a site recognized by an immunoglobulin, T cell
receptor or HLA molecule. Alternatively, an epitope can be defined
as a set of amino acid residues which is involved in recognition by
a particular immunoglobulin, or in the context of T cells, those
residues necessary for recognition by T cell receptor proteins
and/or Major Histocompatibility Complex (MHC) receptors. Epitopes
are present in nature, and can be isolated, purified or otherwise
prepared or derived by humans. For example, epitopes can be
prepared by isolation from a natural source, or they can be
synthesized in accordance with standard protocols in the art.
Synthetic epitopes can comprise artificial amino acid residues,
"amino acid mimetics," such as D isomers of naturally-occurring L
amino acid residues or non-naturally-occurring amino acid residues
such as cyclohexylalanine. Throughout this disclosure, epitopes may
be referred to in some cases as peptides or peptide epitopes. The
epitopes and analogs of the invention are set forth in Table 3.
[0042] It is to be appreciated that proteins or peptides that
comprise an epitope or an analog of the invention as well as
additional amino acid(s) are still within the bounds of the
invention. In certain embodiments, the peptide comprises a fragment
of an antigen. A "fragment of an antigen" or "antigenic fragment"
or simply "fragment" is a portion of an antigen which has 100%
identity with a wild type antigen or naturally-occurring variant
thereof. The fragment may or may not comprise an epitope of the
invention. The fragment may be less than or equal to 600 amino acid
residues, less than or equal to 500 amino acid residues, less than
or equal to 400 amino acid residues, less than or equal to 250
amino acid residues, less than or equal to 100 amino acid residues,
less than or equal to 85 amino acid residues, less than or equal to
75 amino acid residues, less than or equal to 65 amino acid
residues, or less than or equal to 50 amino acid residues in
length. In certain embodiments, a fragment is e.g., less than 101
or less than 51 amino acid residues in length, in any increment
down to 5 amino acid residues in length. For example, the fragment
may be 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20,
21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37,
38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54,
55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71,
72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88,
89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100 amino acid
residues in length. In preferred embodiments, a peptide is 9, 10,
or 11 amino acid residues in length.
[0043] In certain embodiments, there is a limitation on the length
of a peptide of the invention. The embodiment that is
length-limited occurs when the protein or peptide comprising an
epitope of the invention comprises a region (i.e., a contiguous
series of amino acid residues) having 100% identity with a native
sequence. In order to avoid the definition of epitope from reading,
e.g., on whole natural molecules, there is a limitation on the
length of any region that has 100% identity with a native peptide
sequence. Thus, for a peptide comprising an epitope of the
invention and a region with 100% identity with a native peptide
sequence, the region with 100% identity to a native sequence
generally has a length of: less than or equal to 600 amino acid
residues, often less than or equal to 500 amino acid residues,
often less than or equal to 400 amino acid residues, often less
than or equal to 250 amino acid residues, often less than or equal
to 100 amino acid residues, often less than or equal to 85 amino
acid residues, often less than or equal to 75 amino acid residues,
often less than or equal to 65 amino acid residues, and often less
than or equal to 50 amino acid residues. In certain embodiments, an
"epitope" of the invention is comprised by a peptide having a
region with less than 51 amino acid residues that has 100% identity
to a native peptide sequence, in any increment down to 5 amino acid
residues; for example 50, 49, 48, 47, 46, 45, 44, 43, 42, 41, 40,
39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23,
22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5,
4, 3, 2 or 1 amino acid residues.
[0044] Accordingly, peptide or protein sequences longer than 600
amino acid residues are within the scope of the invention, provided
that they do not comprise any contiguous sequence of more than 600
amino acid residues that have 100% identity with a native peptide
sequence. For any peptide that has five contiguous residues or less
that correspond to a native sequence, there is no limitation on the
maximal length of that peptide in order to fall within the scope of
the invention. It is presently preferred that a peptide of the
invention (e.g., a peptide comprising an epitope of the invention)
be less than 600 residues long in any increment down to eight amino
acid residues. In a preferred embodiment, peptides of the invention
are 9, 10 or 11 amino acid residues in length.
[0045] "Human Leukocyte Antigen" or "HLA" is a human class I or
class II Major Histocompatibility Complex (MHC) protein (see, e.g.,
Stites, et al., IMMUNOLOGY, 8.sup.TH ED., Lange Publishing, Los
Altos, Calif. (1994).
[0046] An "HLA supertype or HLA family", as used herein, describes
sets of HLA molecules grouped on the basis of shared
peptide-binding specificities. HLA class I molecules that share
somewhat similar binding affinity for peptides bearing certain
amino acid motifs are grouped into such HLA supertypes. The terms
HLA superfamily, HLA supertype family, HLA family, and HLA xx-like
molecules (where "xx" denotes a particular HLA type), are synonyms.
See, e.g., the HLA-A2 motif and super motifs are detailed in Tables
4A, 4B, 4C, and 4D.
[0047] As used herein, "high affinity" with respect to HLA class I
molecules is defined as binding with an IC.sub.50, or K.sub.D
value, of 50 nM or less; "intermediate affinity" is binding with an
IC.sub.50 or K.sub.D value of between about 50 and about 500 nM;
"weak affinity" is binding with an IC.sub.50 or K.sub.D value
between about 500 and about 5000 nM. "High affinity" with respect
to binding to HLA class II molecules is defined as binding with an
IC.sub.50 or K.sub.D value of 100 nM or less; "intermediate
affinity" is binding with an IC.sub.50 or K.sub.D value of between
about 100 and about 1000 nM. See "binding data."
[0048] An "IC.sub.50" is the concentration of peptide in a binding
assay at which 50% inhibition of binding of a reference peptide is
observed. Given the conditions in which the assays are run (i.e.,
limiting HLA proteins and labeled peptide concentrations), these
values approximate K.sub.D values. See "binding data."
[0049] The terms "identical" or percent "identity," in the context
of two or more peptide sequences or antigen fragments, refer to two
or more sequences or subsequences that are the same or have a
specified percentage of amino acid residues that are the same, when
compared and aligned for maximum correspondence over a comparison
window, as measured using a sequence comparison algorithm or by
manual alignment and visual inspection.
[0050] An "immunogenic" peptide or an "immunogenic" epitope or
"peptide epitope" is a peptide that comprises an allele-specific
motif or supermotif such that the peptide will bind an HLA molecule
and induce a CTL and/or HTL response. Thus, immunogenic peptides of
the invention are capable of binding to an appropriate HLA molecule
and thereafter inducing a cytotoxic T lymphocyte (CTL) response, or
a helper T lymphocyte (HTL) response, to the peptide.
[0051] The phrases "isolated" or "biologically pure" refer to
material which is substantially or essentially free from components
which normally accompany the material as it is found in its native
state. Thus, isolated peptides in accordance with the invention
preferably do not contain materials normally associated with the
peptides in their in situ environment. An "isolated" epitope refers
to an epitope that does not include the whole sequence of the
antigen from which the epitope was derived. Typically the
"isolated" epitope does not have attached thereto additional amino
acid residues that result in a sequence that has 100% identity over
the entire length of a native sequence. The native sequence can be
a sequence such as a tumor-associated antigen from which the
epitope is derived. Thus, the term "isolated" means that the
material is removed from its original environment (e.g., the
natural environment if it is naturally occurring). For example, a
naturally-occurring polynucleotide or peptide present in a living
animal is not isolated, but the same polynucleotide or peptide,
separated from some or all of the coexisting materials in the
natural system, is isolated. Such a polynucleotide could be part of
a vector, and/or such a polynucleotide or peptide could be part of
a composition, and still be "isolated" in that such vector or
composition is not part of its natural environment. Isolated RNA
molecules include in vivo or in vitro RNA transcripts of the DNA
molecules of the present invention, and further include such
molecules produced synthetically.
[0052] "Major Histocompatibility Complex" or "MHC" is a cluster of
genes that plays a role in control of the cellular interactions
responsible for physiologic immune responses. In humans, the MHC
complex is also known as the human leukocyte antigen (HLA) complex.
For a detailed description of the MHC and HLA complexes, see, Paul,
FUNDAMENTAL IMMUNOLOGY, 3.sup.RD ED., Raven Press, New York
(1993).
[0053] A "native" or a "wild type" sequence refers to a sequence
found in nature. Such a sequence may comprise a longer sequence in
nature.
[0054] A "negative binding residue" or "deleterious residue" is an
amino acid residue which, if present at certain positions
(typically not primary anchor positions) in a peptide epitope,
results in decreased binding affinity of the peptide for its
corresponding HLA molecule.
[0055] The terms "peptide" and "peptide epitope" are used
interchangeably with "oligopeptide" in the present specification to
designate a series of residues, typically L-amino acid residues,
connected one to the other, typically by peptide bonds between the
.alpha.-amino and carboxyl groups of adjacent amino acid
residues.
[0056] "Synthetic peptide" refers to a peptide that is obtained
from a non-natural source, e.g., is man-made. Such peptides may be
produced using such methods as chemical synthesis or recombinant
DNA technology. "Synthetic peptides" include "fusion proteins."
[0057] A "PanDR binding" peptide, a "PanDR binding epitope," or
"PADRE.RTM." peptide (Epimmune, San Diego, Calif.) is a member of a
family of molecules that binds more than one HLA class II DR
molecule. The pattern that defines the PADRE.RTM. family of
molecules can be referred to as an HLA Class II supermotif. A
PADRE.RTM. molecule binds to HLA-DR molecules and stimulates in
vitro and in vivo human helper T lymphocyte (HTL) responses. For a
further definition of the PADRE.RTM. family, see copending
application U.S. Ser. Nos. 09/709,774, filed Nov. 11, 2000; and
09/707,738, filed Nov. 6, 2000; PCT publication Nos WO 95/07707,
and WO 97/26784; U.S. Pat. Nos. 5,736,142 issued Apr. 7, 1998;
5,679,640, issued Oct. 21, 1997; and 6,413,935, issued Jul. 2,
2002.
[0058] "Pharmaceutically acceptable" refers to a generally
non-toxic, inert, and/or physiologically compatible composition or
component of a composition.
[0059] A "pharmaceutical excipient" or "excipient" comprises a
material such as an adjuvant, a carrier, pH-adjusting and buffering
agents, tonicity adjusting agents, wetting agents, preservatives,
and the like. A "pharmaceutical excipient" is an excipient which is
pharmaceutically acceptable.
[0060] The term "motif" refers to a pattern of residues in an amino
acid sequence of defined length, preferably a peptide of less than
about 15 amino acid residues in length, or less than about 13 amino
acid residues in length, usually from about 8 to about 13 amino
acid residues (e.g., 8, 9, 10, 11, 12, or 13) for a class I HLA
motif and from about 6 to about 25 amino acid residues (e.g., 6, 7,
8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24,
or 25) for a class II HLA motif, which is recognized by a
particular HLA molecule. Motifs are typically different for each
HLA protein encoded by a given human HLA allele. These motifs often
differ in their pattern of the primary and secondary anchor
residues. In preferred embodiments, an MHC class I motif identifies
a peptide of 9, 10, 0r 11 amino acid residues in length.
[0061] A "supermotif" is a peptide binding specificity shared by
HLA molecules encoded by two or more HLA alleles. Preferably, a
supermotif-bearing peptide is recognized with high or intermediate
affinity (as defined herein) by two or more HLA antigens.
[0062] A "primary anchor residue" is an amino acid at a specific
position along a peptide sequence which is understood to provide a
primary contact point between the immunogenic peptide and the HLA
molecule. One, two or three, primary anchor residues within a
peptide of defined length minimally defines a "motif" for an
immunogenic peptide. These residues are understood to fit in close
contact with peptide binding grooves of an HLA molecule, with their
side chains buried in specific pockets of the binding grooves
themselves. In one embodiment of an HLA class I motif, the primary
anchor residues are located at position 2 (from the amino terminal
position) and at the carboxyl terminal position of a peptide
epitope in accordance with the invention. The primary anchor
positions for the A2 motif and supermotif of HLA Class I are set
forth in Tables 4A, 4B, 4C, and 4D. For example, analog peptides
can be created by altering the presence or absence of particular
residues in these anchor positions. Such analogs are used to
modulate the binding affinity of an epitope comprising a particular
motif or supermotif.
[0063] A "secondary anchor residue" is an amino acid at a position
other than a primary anchor position in a peptide which may
influence peptide binding. A secondary anchor residue occurs at a
significantly higher frequency among HLA-bound peptides than would
be expected by random distribution of amino acid residues at a
given position. A secondary anchor residue can be identified as a
residue which is present at a higher frequency among high or
intermediate affinity binding peptides, or a residue otherwise
associated with high or intermediate affinity binding. The
secondary anchor residues are said to occur at "secondary anchor
positions." For example, analog peptides can be created by altering
the presence or absence of particular residues in these secondary
anchor positions. Such analogs are used to finely modulate the
binding affinity of an epitope comprising a particular motif or
supermotif. The terminology "fixed peptide" is generally used to
refer to an analog peptide that has changes in primary anchor
position; not secondary. A "cryptic epitope" elicits a response by
immunization with an isolated peptide, but the response is not
cross-reactive in vitro when intact whole protein, which comprises
the epitope, is used as an antigen.
[0064] "Promiscuous recognition" by a TCR is where a distinct
peptide is recognized by various T cell clones in the context of
various HLA molecules. Promiscuous binding by an HLA molecule is
synonymous with cross-reactive binding.
[0065] A "protective immune response" or "therapeutic immune
response" refers to a CTL and/or an HTL response to an antigen
derived from an pathogenic antigen (e.g., an antigen from an
infectious agent or a tumor antigen), which in some way prevents or
at least partially arrests disease symptoms, side effects or
progression. The immune response may also include an antibody
response which has been facilitated by the stimulation of helper T
cells.
[0066] The term "residue" refers to an amino acid residue or amino
acid mimetic residue incorporated into a peptide or protein by an
amide bond or amide bond mimetic.
[0067] A "subdominant epitope" is an epitope which evokes little or
no response upon immunization with a whole antigen or a fragment of
the whole antigen comprising a subdominant epitope and a dominant
epitope, which comprise the epitope, but for which a response can
be obtained by immunization with an isolated peptide, and this
response (unlike the case of cryptic epitopes) is detected when
whole antigen or a fragment of the whole antigen comprising a
subdominant epitope and a dominant epitope is used to recall the
response in vitro or in vivo.
[0068] As used herein, a "vaccine" is a composition used for
vaccination, e.g. for prophylaxis or therapy, that comprises one or
more peptides of the invention. There are numerous embodiments of
vaccines in accordance with the invention, such as by a cocktail of
one or more peptides; one or more peptides of the invention
comprised by a polyepitopic peptide; or nucleic acids that encode
such peptides or polypeptides, e.g., a minigene that encodes a
polyepitopic peptide. The "one or more peptides" can include any
whole unit integer from 1-150, e.g., at least 1, 2, 3, 4, 5, 6, 7,
8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24,
25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41,
42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58,
59, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125,
130, 135, 140, 145, or 150 or more peptides of the invention. The
peptides or polypeptides can optionally be modified, such as by
lipidation, addition of targeting or other sequences. HLA class
I-binding peptides of the invention can be linked or to otherwise
be combined with HLA class II-binding peptides, e.g. a PADRE.RTM.
universal HTL-binding peptide, to facilitate activation of both
cytotoxic T lymphocytes and helper T lymphocytes. Vaccines can
comprise peptide pulsed antigen presenting cells, e.g., dendritic
cells.
[0069] The nomenclature used to describe peptides or proteins
follows the conventional practice wherein the amino group is
presented to the left (the amino- or N-terminus) and the carboxyl
group to the right (the carboxy- or C-terminus) of each amino acid
residue. When amino acid residue positions are referred to in a
peptide epitope they are numbered in an amino to carboxyl direction
with position one being the residue located at the amino terminal
end of the epitope, or the peptide or protein of which it may be a
part.
[0070] In the formulae representing selected specific embodiments
of the present invention, the amino- and carboxyl-terminal groups,
although not specifically shown, are in the form they would assume
at physiologic pH values, unless otherwise specified. In the amino
acid structure formulae, each residue is generally represented by
standard three letter or single letter designations. The L-form of
an amino acid residue is represented by a capital single letter or
a capital first letter of a three-letter symbol, and the D-form for
those amino acid residues having D-forms is represented by a lower
case single letter or a lower case three letter symbol. However,
when three letter symbols or full names are used without capitals,
they may refer to L amino acid residues. Glycine has no asymmetric
carbon atom and is simply referred to as "Gly" or "G". The amino
acid sequences of peptides set forth herein are generally
designated using the standard single letter symbol. (A, Alanine; C,
Cysteine; D, Aspartic Acid; E, Glutamic Acid; F, Phenylalanine; G,
Glycine; H, Histidine; I, Isoleucine; K, Lysine; L, Leucine; M,
Methionine; N, Asparagine; P, Proline; Q, Glutamine; R, Arginine;
S, Serine; T, Threonine; V, Valine; W, Tryptophan; and Y,
Tyrosine.) In addition to these symbols, "B" in the single letter
abbreviations used herein designates .alpha.-amino butyric acid. In
some embodiments, .alpha.-amino butyric acid may be interchanged
with cysteine.
[0071] Acronyms used herein are as follows: [0072] APC: Antigen
presenting cell [0073] CD3: Pan T cell marker [0074] CD4: Helper T
lymphocyte marker [0075] CD8: Cytotoxic T lymphocyte marker [0076]
CEA: Carcinoembryonic antigen (see, e.g., SEQ ID NO: 363) [0077]
CTL: Cytotoxic T lymphocyte [0078] DC: Dendritic cells. DC function
as potent antigen presenting cells by stimulating cytokine release
from CTL lines that are specific for a model peptide derived from
hepatitis B virus. In vivo experiments using DC pulsed ex vivo with
an HBV peptide epitope have stimulated CTL immune responses in vivo
following delivery to naive mice. [0079] DLT: Dose-limiting
toxicity, an adverse event related to therapy. [0080] DMSO:
Dimethylsulfoxide [0081] ELISA: Enzyme-linked immunosorbant assay
[0082] E:T: Effector:Target ratio [0083] G-CSF: Granulocyte
colony-stimulating factor [0084] GM-CSF: Granulocyte-macrophage
(monocyte)-colony stimulating factor [0085] HBV: Hepatitis B virus
[0086] HER2/neu: A tumor associated antigen; c-erbB-2 is a synonym
(see, e.g. SEQ ID NO: 364) [0087] HLA: Human leukocyte antigen
[0088] HLA-DR: Human leukocyte antigen class II [0089] HPLC: High
Performance Liquid Chromatography [0090] HTC: Helper T Cell [0091]
HTL: Helper T Lymphocyte. A synonym for HTC. [0092] ID: Identity
[0093] IFN.gamma.: Interferon gamma [0094] IL-4: Interleukin-4
[0095] IV: Intravenous [0096] LU.sub.30%: Cytotoxic activity for
10.sup.6 effector cells required to achieve 30% lysis of a target
cell population, at a 100:1 (E:T) ratio. [0097] MAb: Monoclonal
antibody [0098] MAGE: Melanoma antigen (see, e.g., SEQ ID NO: 365
and 366 for MAGE2 and MAGE3, respectively) [0099] MLR: Mixed
lymphocyte reaction [0100] MNC: Mononuclear cells [0101] PB:
Peripheral blood [0102] PBMC: Peripheral blood mononuclear cell
[0103] ProGP.TM.: Progenipoietin.TM. product (Searle, St. Louis,
Mo.), a chimeric flt3/G-CSF receptor agonist. [0104] SC:
Subcutaneous [0105] S.E.M.: Standard error of the mean [0106] QD:
Once a day dosing [0107] TAA: Tumor Associated Antigen [0108] TNF:
Tumor necrosis factor [0109] WBC: White blood cells
[0110] The following describes the peptides, corresponding nucleic
acid molecules, compositions, and methods of the invention in more
detail.
A2 Peptides and Polynucleotides of Tumor Associated Antigens
[0111] A2 Epitopes and Analogs. In some embodiments, the invention
is directed to an isolated peptide comprising or consisting of an
epitope and/or analog. In some embodiments, the invention is
directed to an isolated polynucleotide encoding such a peptide.
[0112] The isolated epitopes and analogs of the invention are all
class I binding peptides, i.e., CTL peptides. In particular, the
epitopes and analogs of the invention comprise an A2 motif or
supermotif. Epitopes and analogs of the invention are those set
forth in Table 3 (SEQ ID NOs:1-10). A2 epitopes and analogs of the
invention may be referred to herein as "epitopes" and "analogs" or
referred to by Table or referred to by SEQ ID NO. Other epitopes
and analogs are referred to herein as CTL epitopes or CTL peptides
and HTL epitopes or HTL peptides.
[0113] Peptides and Polynucleotides. In some embodiments, the
invention is directed to an isolated peptide comprising or
consisting of an epitope and/or analog, wherein the epitope or
analog consists of a sequence selected from those in Table 3 (SEQ
ID NOs:1-10).
[0114] Preferably, the peptide comprises or consists of an epitope
or analog consisting of a sequence in Table 3.
[0115] Peptides of the invention may be fusion proteins of
epitope(s) and/or analog(s) to CTL epitope(s), and/or HTL
epitope(s), and/or linker(s), and/or spacer(s), and/or carrier(s),
and/or additional amino acid residue(s), and/or may comprise or
consist of homopolymers of an epitope or analog or heteropolymers
of epitopes and/or analogs, as is described in detail below.
[0116] Peptides which comprise an epitope and/or analog of the
invention may comprise or consist of a fragment of an antigen
("fragment" or "antigenic fragment"), wherein the fragment
comprises an epitope and/or analog. The fragment may be a portion
of CEA, HER2/neu MAGE2, MAGE3, and/or p53 (SEQ ID Nos:11, 12, 13,
14, and 15, respectively). The epitope of the invention may be
within the fragment or may be linked directly or indirectly, or
otherwise connected to the fragment.
[0117] The fragment may comprise or consist of a region of a native
antigen that contains a high concentration of class I and/or class
II epitopes, preferably it contains the greatest number of epitopes
per amino acid length. Such epitopes can be present in a
frame-shifted manner, e.g., a 10 amino acid long peptide could
contain two 9 amino acid residue long epitopes and one 10 amino
acid residue long epitope.
[0118] The fragment may be less than or equal to 600 amino acid
residues, less than or equal to 500 amino acid residues, less than
or equal to 400 amino acid residues, less than or equal to 250
amino acid residues, less than or equal to 100 amino acid residues,
less than or equal to 85 amino acid residues, less than or equal to
75 amino acid residues, less than or equal to 65 amino acid
residues, or less than or equal to 50 amino acid residues in
length. In certain embodiments, a fragment is less than 101 amino
acid residues in length, in any increment down to 5 amino acid
residues in length. For example, the fragment may be 5, 6, 7, 8, 9,
10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26,
27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43,
44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60,
61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77,
78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94,
95, 96, 97, 98, 99, or 100 amino acid residues in length. In
preferred embodiments, fragments are 9, 10, or 11 amino acid
residues in length.
[0119] Fragments of the full length CEA antigen may be fragments
from about residue 1-20, 21-40, 41-60, 61-80, 81-100, 101-120,
121-140, 141-160, 161-180, 181-200, 201-220, 221-240, 241-260,
261-280, 281-300, 301-320, 321-340, 341-360, 361-380, 381-400,
401-420, 421-440, 441-460, 461-480, 481-500, 501-520, 521-540,
541-560, 561-580, 581-600, 601-620, 621-640, 641-660, 661-680 or
681 to the C-terminus of the antigen.
[0120] Fragments of the full length HER2/neu antigen may be
fragments from about residue 1-20, 21-40, 41-60, 61-80, 81-100,
101-120, 121-140, 141-160, 161-180, 181-200, 201-220, 221-240,
241-260, 261-280, 281-300, 301-320, 321-340, 341-360, 361-380,
381-400, 401-420, 421-440, 441-460, 461-480, 481-500, 501-520,
521-540, 541-560, 561-580, 581-600, 601-620, 621-640, 641-660,
661-680, 681-700, 701-720, 721-740, 741-760, 761-780, 781-800,
801-820, 821-840, 841-860, 861-880, 881-900, 901-920, 921-940,
941-960, 961-980, 981-1000, 1001-1020, 1021-1040, 1041-1060,
1061-1080, 1081-1100, 1101-1120, 1121-1140, 1141-1160, 1161-1180,
1181-1200, 1201-1220, 1221-1240, or 1241 to the C-terminus of the
antigen.
[0121] Fragments of the full length MAGE-2 antigen may be fragments
from about residue 1-20, 21-40, 41-60, 61-80, 81-100, 101-120,
121-140, 141-160, 161-180, 181-200, 201-220, 221-240, 241-260,
261-280, 281-300 or 301 to the C-terminus of the antigen.
[0122] Fragments of the full length MAGE-3 antigen may be fragments
from about residue 1-20, 21-40, 41-60, 61-80, 81-100, 101-120,
121-140, 141-160, 161-180, 181-200, 201-220, 221-240, 241-260,
261-280, 281-300 or 301 to the C-terminus of the antigen.
[0123] Fragments of the full length p53 antigen may be fragments
from about residue 1-20, 21-40, 41-60, 61-80, 81-100, 101-120,
121-140, 141-160, 161-180, 181-200, 201-220, 221-240, 241-260,
261-280, 281-300, 301-320, 321-340, 341-360, 361-380 or 381 to the
C-terminus of the antigen.
[0124] Peptides which comprise an epitope and/or analog of the
invention may be a fusion protein comprising one or more amino acid
residues in addition to the epitope, analog, or fragment. Fusion
proteins include homopolymers and heteropolymers, as described
below.
[0125] In some embodiments, the peptide comprises or consists of
multiple epitopes and/or analogs, e.g., 2, 3, 4, 5, 6, 7, 8, 9 or
10 epitopes and/or analogs of the invention. In some embodiments,
the peptide comprises at least 1, at least 2, at least 3, at least
4, at least 5, at least 6, at least 7, at least 8, at least 9 or at
least 10 epitopes and/or analogs of the invention.
[0126] The peptide may also exclude any one or several epitopes
and/or analogs selected from those in Table 3 (SEQ ID NOs:1-10).
Epitopes/analogs which may preferably be excluded from peptides of
the invention are SEQ ID NOs:1-10.
[0127] The peptide may also be a homopolymer of one epitope or
analog or the peptide may be a heteropolymer which contains at
least two different epitopes and/or analogs. Polymers have the
advantage of increased probability for immunological reaction and,
where different epitopes/analogs are used to make up the polymer,
the ability to induce antibodies and/or T cells that react with
different antigenic determinants of the antigen(s) targeted for an
immune response.
[0128] A homopolymer may comprise 2, 3, 4, 5, 6, 7, 8, 9, 10, 11,
12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28,
29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 45, 50, 55, 60, 65,
70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135,
140, 145, or 150 copies of the same epitope or analog.
[0129] A heteropolymer may comprise one or more copies of an
individual epitope or analog and one or more copies of one or more
different epitopes and/or analogs of the invention. The epitopes
and/or analogs that form a heteropolymer may all be from the same
antigen, e.g., may be from CEA, p53, MAGE2/3, HER2/neu or other
antigens herein or known in the art, or may be from different
antigens, preferably TAAs. Combinations of epitopes and/or analogs
that may form a heteropolymer include those combinations described
above. Heteropolymers may contain multiple copies of one or more
epitopes and/or analogs.
[0130] Thus, peptides of the invention such as heteropolymers may
comprise a first epitope and/or analog and at least 1, 2, 3, 4, 5,
6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23,
24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40,
41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 other (different)
epitopes and/or analogs.
[0131] Peptides of the invention may also comprise additional amino
acid residues.
[0132] In some embodiments, the peptides may also comprise a number
of CTL and/or HTL epitopes, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10,
11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27,
28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44,
45, 46, 47, 48, 49, or 50 CTL and/or HTL epitopes.
[0133] The CTL and/or HTL epitope and the epitope/analog of the
invention may be from the same TAA or from different TAAs. Thus,
for example, if the epitope and/or analog is from CEA, the CTL
peptide and/or HTL peptide may also be from CEA. Alternatively, the
CTL peptide and/or HTL peptide may be from another antigen,
preferably a TAA antigen such as p53, MAGE2/3 or HER2/neu. As
another example, if the epitope and/or analog is from p53, the CTL
peptide and/or HTL peptide may be from p53 or, alternatively, may
be from MAGE2/3, HER2/neu, or CEA.
[0134] The CTL peptide and/or HTL peptide may be from
tumor-associated antigens such as but not limited to, melanoma
antigens MAGE-1, MAGE-2, MAGE-3, MAGE-11, MAGE-A10, as well as
BAGE, GAGE, RAGE, MAGE-C1, LAGE-1, CAG-3, DAM, MUC1, MUC2, MUC18,
NY-ESO-1, MUM-1, CDK4, BRCA2, NY-LU-1, NY-LU-7, NY-LU-12, CASP8,
RAS, KIAA-2-5, SCCs, p53, p73, CEA, HER2/neu, Melan-A, gp100,
tyrosinase, TRP2, gp75/TRP1, kallikrein, prostate-specific membrane
antigen (PSM), prostatic acid phosphatase (PAP), prostate-specific
antigen (PSA), PT1-1, .beta.-catenin, PRAME, Telomerase, FAK,
cyclin D1 protein, NOEY2, EGF-R, SART-1, CAPB, HPVE7, p15, Folate
receptor CDC27, PAGE-1, and PAGE-4 (See, e.g., Table 16).
[0135] Non-limiting examples of CTL peptides and HTL peptides are
disclosed in WO 01/42270, published 14 Jun. 2001; WO 01/41788,
published 14 Jun. 2001; WO 01/42270, published 14 Jun. 2001; WO
01/45728, published 28 Jun. 2001; and WO 01/41787, published 14
Jun. 2001.
[0136] The HTL peptide may comprise a synthetic peptide such as a
Pan-DR-binding epitope (e.g., a PADRE.RTM. peptide, Epimmune Inc.,
San Diego, Calif., described, for example, in U.S. Pat. No.
5,736,142), for example, having the formula aKXVAAZTLKAAa, where
"X" is either cyclohexylalanine, phenylalanine, or tyrosine; "Z" is
either tryptophan, tyrosine, histidine or asparagine; and "a" is
either D-alanine or L-alanine (SEQ ID NO: 746). Certain pan-DR
binding epitopes comprise all "L" natural amino acid residues;
these molecules can be provided as peptides or in the form of
nucleic acids that encode the peptide. See also, U.S. Pat. Nos.
5,679,640 and 6,413,935.
[0137] The peptide may comprise additional amino acid residues.
Such additional amino acid residues may be Ala, Arg, Asn, Asp, Cys,
Gln, Gly, Glu, His, Ile, Leu, Lys, Met, Phe, Pro, Ser, Thr, Tyr,
Trp, Val, amino acid mimetics, and other unnatural amino acid
residues such as those described below. Additional amino acid
residues may provide for ease of linking peptides one to another,
for linking epitopes and/or analogs to one another, for linking
epitopes and/or analogs to CTL and/or HTL epitopes, for coupling to
a carrier support or larger peptide, for modifying the physical or
chemical properties of the peptide or oligopeptide, or the like.
Amino acid residues such as Ala, Arg, Asn, Asp, Cys, Gln, Gly, Glu,
His, Ile, Leu, Lys, Met, Phe, Pro, Ser, Thr, Tyr, Trp, or Val, or
the like, can be introduced at the C- and/or N-terminus of the
peptide and/or can be introduced internally.
[0138] The peptide may comprise an amino acid spacer, which may be
joined to the epitopes, analogs, CTL epitopes, HTL epitopes,
carriers, etc. within a peptide or may be joined to the peptide at
the N- and/or C-terminus. Thus, spacers may be at the N-terminus or
C-terminus of peptide, or may be internal such that they link or
join epitopes, analogs, CTL epitopes, HTL epitopes, carriers,
additional amino acid residues, and/or antigenic fragments one to
the other.
[0139] The spacer is typically comprised of one or more relatively
small, neutral molecules, such as amino acid residues or amino acid
mimetics, which are substantially uncharged under physiological
conditions. The spacers are typically selected from, e.g., Ala,
Gly, or other neutral spacers of nonpolar amino acid residues or
neutral polar amino acid residues. It will be understood that the
optionally present spacer may be composed of the same residues or
may be composed of one or more different residues and thus may be a
homo- or hetero-oligomer of spacer residues. Thus, the spacer may
contain more than one Ala residue (poly-alanine) or more than one
Gly residue (poly-glycine), or may contain both Ala and Gly
residues, e.g., Gly, Gly-Gly-, Ser,Ser-Ser-, Gly-Ser-, Ser-Gly-,
etc. When present, the spacer will usually be at least one or two
residues, more usually three to six residues and sometimes 10 or
more residues, e.g., 3, 4, 5, 6, 7, 8, 9, or 10, or even more
residues. (Livingston, B. D. et al. Vaccine 19:4652-4660
(2000)).
[0140] Peptides may comprise carriers such as those well known in
the art, e.g., thyroglobulin, albumins such as human serum albumin,
tetanus toxoid, polyamino acid residues such as poly L-lysine, poly
L-glutamic acid, influenza virus proteins, hepatitis B virus core
protein, and the like.
[0141] In addition, the peptide may be modified by
terminal-NH.sub.2 acylation, e.g., by alkanoyl (C.sub.1-C.sub.20)
or thioglycolyl acetylation, terminal-carboxyl amidation, e.g.,
ammonia, methylamine, etc. In some instances these modifications
may provide sites for linking to a support or other molecule.
[0142] The peptides in accordance with the invention can contain
modifications such as but not limited to glycosylation, side chain
oxidation, biotinylation, phosphorylation, addition of a surface
active material, e.g. a lipid, or can be chemically modified, e.g.,
acetylation, etc. Moreover, bonds in the peptide can be other than
peptide bonds, e.g., covalent bonds, ester or ether bonds,
disulfide bonds, hydrogen bonds, ionic bonds, etc.
[0143] Peptides of the present invention may contain substitutions
to modify a physical property (e.g., stability or solubility) of
the resulting peptide. For example, peptides may be modified by the
substitution of a cysteine (C) with .alpha.-amino butyric acid
("B"). Due to its chemical nature, cysteine has the propensity to
form disulfide bridges and sufficiently alter the peptide
structurally so as to reduce binding capacity. Substituting
.alpha.-amino butyric acid for C not only alleviates this problem,
but actually improves binding and crossbinding capability in
certain instances. Substitution of cysteine with .alpha.-amino
butyric acid may occur at any residue of a peptide, e.g., at either
anchor or non-anchor positions of an epitope or analog within a
peptide, or at other positions of a peptide.
[0144] The peptides can comprise amino acid mimetics or unnatural
amino acid residues, e.g. D- or L-naphylalanine; D- or
L-phenylglycine; D- or L-2-thieneylalanine; D- or L-1, -2, 3-, or
4-pyreneylalanine; D- or L-3 thieneylalanine; D- or
L-(2-pyridinyl)-alanine; D- or L-(3-pyridinyl)-alanine; D- or
L-(2-pyrazinyl)-alanine; D- or L-(4-isopropyl)-phenylglycine;
D-(trifluoromethyl)-phenylglycine;
D-(trifluoro-methyl)-phenylalanine; D-.rho.-fluorophenylalanine; D-
or L-.rho.-biphenyl-phenylalanine; D- or
L-.rho.-methoxybiphenylphenylalanine; D- or
L-2-indole(allyl)alanines; and, D- or L-alkylalanines, where the
alkyl group can be a substituted or unsubstituted methyl, ethyl,
propyl, hexyl, butyl, pentyl, isopropyl, iso-butyl, sec-isotyl,
iso-pentyl, or a non-acidic amino acid residues. Aromatic rings of
a non-natural amino acid include, e.g., thiazolyl, thiophenyl,
pyrazolyl, benzimidazolyl, naphthyl, furanyl, pyrrolyl, and pyridyl
aromatic rings. Modified peptides that have various amino acid
mimetics or unnatural amino acid residues are particularly useful,
as they tend to manifest increased stability in vivo. Such peptides
may also possess improved shelf-life or manufacturing
properties.
[0145] Peptide stability can be assayed in a number of ways. For
instance, peptidases and various biological media, such as human
plasma and serum, have been used to test stability. See, e.g.,
Verhoef, et al., Eur. J. Drug Metab. Pharmacokinetics 11:291
(1986). Half-life of the peptides of the present invention is
conveniently determined using a 25% human serum (v/v) assay. The
protocol is generally as follows: Pooled human serum (Type AB,
non-heat inactivated) is dilapidated by centrifugation before use.
The serum is then diluted to 25% with RPMI-1640 or another suitable
tissue culture medium. At predetermined time intervals, a small
amount of reaction solution is removed and added to either 6%
aqueous trichloroacetic acid (TCA) or ethanol. The cloudy reaction
sample is cooled (4.degree. C.) for 15 minutes and then spun to
pellet the precipitated serum proteins. The presence of the
peptides is then determined by reversed-phase HPLC using
stability-specific chromatography conditions.
[0146] The peptides in accordance with the invention can be a
variety of lengths, and either in their neutral (uncharged) forms
or in forms which are salts. The peptides in accordance with the
invention can contain modifications such as glycosylation, side
chain oxidation, or phosphorylation, generally subject to the
condition that modifications do not destroy the biological activity
of the peptides.
[0147] The peptides of the invention may be lyophylized, or may be
in crystal form.
[0148] It is generally preferable that the epitope be as small as
possible while still maintaining substantially all of the
immunologic activity of the native protein. When possible, it may
be desirable to optimize HLA class I binding epitopes of the
invention to a length of about 8 to about 13 amino acid residues,
for example, 8, 9, 10, 11, 12 or 13, preferably 9 or 10. It is to
be appreciated that one or more epitopes in this size range can be
comprised by a longer peptide (see the Definition Section for the
term "epitope" for further discussion of peptide length). HLA class
II binding epitopes are preferably optimized to a length of about 6
to about 30 amino acid residues in length, e.g., 6, 7, 8, 9, 10,
11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27,
28, 29 or 30, preferably to between about 13 and about 20 residues,
e.g., 13, 14, 15, 16, 17, 18, 19 or 20. Preferably, the epitopes
are commensurate in size with endogenously processed
pathogen-derived peptides or tumor cell peptides that are bound to
the relevant HLA molecules. The identification and preparation of
peptides of various lengths can be carried out using the techniques
described herein.
[0149] Peptides in accordance with the invention can be prepared
synthetically, by recombinant DNA technology or chemical synthesis,
or can be isolated from natural sources such as native tumors or
pathogenic organisms. Epitopes may be synthesized individually or
joined directly or indirectly in a peptide. Although the peptide
will preferably be substantially free of other naturally occurring
host cell proteins and fragments thereof, in some embodiments the
peptides may be synthetically conjugated to be joined to native
fragments or particles.
[0150] The peptides of the invention can be prepared in a wide
variety of ways. For relatively short sizes, the peptides can be
synthesized in solution or on a solid support in accordance with
conventional techniques. Various automatic synthesizers are
commercially available and can be used in accordance with known
protocols. (See, for example, Stewart & Young, SOLID PHASE
PEPTIDE SYNTHESIS, 2D. ED., Pierce Chemical Co., 1984). Further,
individual peptides can be joined using chemical ligation to
produce larger peptides that are still within the bounds of the
invention.
[0151] Alternatively, recombinant DNA technology can be employed
wherein a nucleotide sequence which encodes a peptide inserted into
an expression vector, transformed or transfected into an
appropriate host cell and cultivated under conditions suitable for
expression. These procedures are generally known in the art, as
described generally in Sambrook et al., MOLECULAR CLONING, A
LABORATORY MANUAL, Cold Spring Harbor Press, Cold Spring Harbor,
N.Y. (1989). Thus, recombinant peptides, which comprise or consist
of one or more epitopes of the invention, can be used to present
the appropriate T cell epitope.
[0152] Polynucleotides encoding each of the peptides above are also
part of the invention. As appreciated by one of ordinary skill in
the art, various nucleic acids will encode the same peptide due to
the redundancy of the genetic code. Each of these nucleic acids
falls within the scope of the present invention. This embodiment of
the invention comprises DNA and RNA, and in certain embodiments a
combination of DNA and RNA. It is to be appreciated that any
polynucleotide that encodes a peptide in accordance with the
invention falls within the scope of this invention.
[0153] The polynucleotides encoding peptides contemplated herein
can be synthesized by chemical techniques, for example, the
phosphotriester method of Matteucci, et al., J. Am. Chem. Soc.
103:3185 (1981). Polynucleotides encoding peptides comprising or
consisting of an analog can be made simply by substituting the
appropriate and desired nucleic acid base(s) for those that encode
the native epitope.
[0154] The polynucleotide, e.g. minigene (see below), may be
produced by assembling oligonucleotides that encode the plus and
minus strands of the polynucleotide, e.g. minigene. Overlapping
oligonucleotides (15-100 bases long) may be synthesized,
phosphorylated, purified and annealed under appropriate conditions
using well known techniques. The ends of the oligonucleotides can
be joined, for example, using T4 DNA ligase. A polynucleotide, e.g.
minigene, encoding the peptide of the invention, can be cloned into
a desired vector such as an expression vector. The coding sequence
can then be provided with appropriate linkers and ligated into
expression vectors commonly available in the art, and the vectors
used to transform suitable hosts to produce the desired peptide
such as a fusion protein.
[0155] A large number of such vectors and suitable host systems are
known to those of skill in the art, and are commercially available.
The following vectors are provided by way of example. Bacterial:
pQE70, pQE60, pQE-9 (Qiagen), pBS, pD10, phagescript, psiX174,
pBluescript SK, pbsks, pNH8A, pNH16a, pNH18A, pNH46A (Stratagene);
ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5 (Pharmacia); pCR
(Invitrogen). Eukaryotic: pWLNEO, pSV2CAT, pOG44, pXT1, pSG
(Stratagene) pSVK3, pBPV, pMSG, pSVL (Pharmacia); p75.6 (Valentis);
pCEP (Invitrogen); pCEI (Epimmune). However, any other plasmid or
vector can be used as long as it is replicable and viable in the
host.
[0156] As representative examples of appropriate hosts, there can
be mentioned: bacterial cells, such as E. coli, Bacillus subtilis,
Salmonella typhimurium and various species within the genera
Pseudomonas, Streptomyces, and Staphylococcus; fungal cells, such
as yeast; insect cells such as Drosophila and Sf9; animal cells
such as COS-7 lines of monkey kidney fibroblasts, described by
Gluzman, Cell 23:175 (1981), and other cell lines capable of
expressing a compatible vector, for example, the C127, 3T3, CHO,
HeLa and BHK cell lines or Bowes melanoma; plant cells, etc. The
selection of an appropriate host is deemed to be within the scope
of those skilled in the art from the teachings herein.
[0157] Thus, the present invention is also directed to vectors,
preferably expression vectors useful for the production of the
peptides of the present invention, and to host cells comprising
such vectors.
[0158] Host cells are genetically engineered (transduced or
transformed or transfected) with the vectors of this invention
which can be, for example, a cloning vector or an expression
vector. The vector can be, for example, in the form of a plasmid, a
viral particle, a phage, etc. The engineered host cells can be
cultured in conventional nutrient media modified as appropriate for
activating promoters, selecting transformants or amplifying the
polynucleotides. The culture conditions, such as temperature, pH
and the like, are those previously used with the host cell selected
for expression, and will be apparent to the ordinarily skilled
artisan.
[0159] For expression of the peptides, the coding sequence will be
provided with operably linked start and stop codons, promoter and
terminator regions and usually a replication system to provide an
expression vector for expression in the desired cellular host. For
example, promoter sequences compatible with bacterial hosts are
provided in plasmids containing convenient restriction sites for
insertion of the desired coding sequence. The resulting expression
vectors are transformed into suitable bacterial hosts.
[0160] Generally, recombinant expression vectors will include
origins of replication and selectable markers permitting
transformation of the host cell, e.g., the ampicillin resistance
gene of E. coli and S. cerevisiae TRP1 gene, and a promoter derived
from a highly-expressed gene to direct transcription of a
downstream structural sequence. Such promoters can be derived from
operons encoding glycolytic enzymes such as 3-phosphoglycerate
kinase (PGK), .A-inverted.-factor, acid phosphatase, or heat shock
proteins, among others. The heterologous structural sequence is
assembled in appropriate phase with translation initiation and
termination sequences, and preferably, a leader sequence capable of
directing secretion of translated protein into the periplasmic
space or extracellular medium. Optionally, the heterologous
sequence can encode a fusion protein including an N-terminal
identification peptide imparting desired characteristics, e.g.,
stabilization or simplified purification of expressed recombinant
product.
[0161] Yeast, insect or mammalian cell hosts may also be used,
employing suitable vectors and control sequences. Examples of
mammalian expression systems include the COS-7 lines of monkey
kidney fibroblasts, described by Gluzman, Cell 23:175 (1981), and
other cell lines capable of expressing a compatible vector, for
example, the C127, 3T3, CHO, HeLa and BHK cell lines. Mammalian
expression vectors will comprise an origin of replication, a
suitable promoter and enhancer, and also any necessary ribosome
binding sites, polyadenylation site, splice donor and acceptor
sites, transcriptional termination sequences, and 5' flanking
nontranscribed sequences. Such promoters may also be derived from
viral sources, such as, e.g., human cytomegalovirus (CMV-IE
promoter) or herpes simplex virus type-1 (HSV TK promoter). Nucleic
acid sequences derived from the SV40 splice, and polyadenylation
sites can be used to provide the required nontranscribed genetic
elements.
[0162] Polynucleotides encoding peptides of the invention may also
comprise a ubiquitination signal sequence, and/or a targeting
sequence such as an endoplasmic reticulum (ER) signal sequence to
facilitate movement of the resulting peptide into the endoplasmic
reticulum.
[0163] Polynucleotides of the invention, e.g., minigenes, may be
expressed in human cells. A human codon usage table can be used to
guide the codon choice for each amino acid. Such polynucleotides
preferably comprise spacer amino acid residues between epitopes
and/or analogs, such as those described above, or may comprise
naturally-occurring flanking sequences adjacent to the epitopes
and/or analogs (and/or CTL and HTL epitopes).
[0164] The peptides of the invention can also be expressed by viral
or bacterial vectors. Examples of expression vectors include
attenuated viral hosts, such as vaccinia or fowlpox. As an example
of this approach, vaccinia virus is used as a vector to express
nucleotide sequences that encode the peptides of the invention.
Vaccinia vectors and methods useful in immunization protocols are
described in, e.g., U.S. Pat. No. 4,722,848. Another vector is BCG
(Bacille Calmette Guerin). BCG vectors are described by Stover et
al., Nature 351:456-460 (1991). A wide variety of other vectors
useful for therapeutic administration or immunization of the
polypeptides of the invention, e.g. adeno and adeno-associated
virus vectors, retroviral vectors, Salmonella typhi vectors,
detoxified anthrax toxin vectors, and the like, will be apparent to
those skilled in the art from the description herein. A preferred
vector is Modified Vaccinia Ankara (VA) (e.g. Bavarian Noridic
(MVA-BN)).
[0165] Standard regulatory sequences well known to those of skill
in the art are preferably included in the vector to ensure
expression in the human target cells. Several vector elements are
desirable: a promoter with a downstream cloning site for
polynucleotide, e.g., minigene insertion; a polyadenylation signal
for efficient transcription termination; an E. coli origin of
replication; and an E. coli selectable marker (e.g. ampicillin or
kanamycin resistance). Numerous promoters can be used for this
purpose, e.g., the human cytomegalovirus (hCMV) promoter. See,
e.g., U.S. Pat. Nos. 5,580,859 and 5,589,466 for other suitable
promoter sequences. A preferred promoter is the CMV-IE
promoter.
[0166] Polynucleotides, e.g. minigenes, may comprise one or more
synthetic or naturally-occurring introns in the transcribed region.
The inclusion of mRNA stabilization sequences and sequences for
replication in mammalian cells may also be considered for
increasing polynucleotide, e.g. minigene, expression.
[0167] In addition, the polynucleotide, e.g. minigene, may comprise
immunostimulatory sequences (ISSs or CpGs). These sequences may be
included in the vector, outside the polynucleotide (e.g. minigene)
coding sequence to enhance immunogenicity.
[0168] In some embodiments, a bi-cistronic expression vector which
allows production of both the polynucleotide- (e.g. minigene-)
encoded peptides of the invention and a second protein (e.g., one
that modulates immunogenicity) can be used. Examples of proteins or
polypeptides that, if co-expressed with peptides of the invention,
can enhance an immune response include cytokines (e.g., IL-2,
IL-12, GM-CSF), cytokine-inducing molecules (e.g., LeIF),
costimulatory molecules, or pan-DR binding proteins (PADRE.RTM.
molecules, Epimmune, San Diego, Calif.). Helper T cell (HTL)
epitopes such as PADRE.RTM. molecules can be joined to
intracellular targeting signals and expressed separately from
expressed peptides of the invention. Specifically decreasing the
immune response by co-expression of immunosuppressive molecules
(e.g. TGF-.beta.) may be beneficial in certain diseases.
[0169] Once an expression vector is selected, the polynucleotide,
e.g. minigene, is cloned into the polylinker region downstream of
the promoter. This plasmid is transformed into an appropriate
bacterial strain, and DNA is prepared using standard techniques.
The orientation and DNA sequence of the polynucleotide, e.g.
minigene, as well as all other elements included in the vector, are
confirmed using restriction mapping, DNA sequence analysis, and/or
PCR analysis. Bacterial cells harboring the correct plasmid can be
stored as cell banks.
[0170] Therapeutic/prophylactic quantities of DNA can be produced
for example, by fermentation in E. coli, followed by purification.
Aliquots from the working cell bank are used to inoculate growth
medium, and are grown to saturation in shaker flasks or a
bioreactor according to well known techniques. Plasmid DNA is
purified using standard bioseparation technologies such as solid
phase anion-exchange resins available, e.g., from QIAGEN, Inc.
(Valencia, Calif.). If required, supercoiled DNA can be isolated
from the open circular and linear forms using gel electrophoresis
dr other methods.
[0171] Purified polynucleotides, e.g. minigenes, can be prepared
for injection using a variety of formulations. The simplest of
these is reconstitution of lyophilized polynucleotide, e.g. DNA, in
sterile phosphate-buffer saline (PBS). This approach, known as
"naked DNA," is currently being used by others for intramuscular
(IM) administration in clinical trials. To maximize the
immunotherapeutic effects of polynucleotide vaccines, alternative
methods of formulating purified plasmid DNA may be used. A variety
of such methods have been described, and new techniques may become
available. Cationic lipids, glycolipids, and fusogenic liposomes
can also be used in the formulation (see, e.g., WO 93/24640;
Mannino & Gould-Fogerite, BioTechniques 6(7): 682 (1988); U.S.
Pat. No. 5,279,833; WO 91/06309; and Felgner, et al., Proc. Nat'l
Acad. Sci. USA 84:7413 (1987). In addition, peptides and compounds
referred to collectively as protective, interactive, non-condensing
compounds (PINC) can also be complexed to purified plasmid DNA to
influence variables such as stability, intramuscular dispersion, or
trafficking to specific organs or cell types.
[0172] Known methods in the art can be used to enhance delivery and
uptake of a polynucleotide in vivo. For example, the polynucleotide
can be complexed to polyvinylpyrrolidone (PVP), to prolong the
localized bioavailability of the polynucleotide, thereby enhancing
uptake of the polynucleotide by the organism (see e.g., U.S. Pat.
No. 6,040,295; EP 0 465 529; WO 98/17814). This approach is thought
to be more effective than inoculation with merely "naked" DNA. PVP
is a polyamide that is known to form complexes with a wide variety
of substances, and is chemically and physiologically inert.
[0173] Target cell sensitization can be used as a functional assay
of the expression and HLA class I presentation of polynucleotide-
(e.g. minigene-) encoded peptides. For example, the polynucleotide,
e.g. plasmid DNA, is introduced into a mammalian cell line that is
a suitable target for standard CTL chromium release assays. The
transfection method used will be dependent on the final
formulation. For example, electroporation can be used for "naked"
DNA, whereas cationic lipids or PVP-formulated DNA allow direct in
vitro transfection. A plasmid expressing green fluorescent protein
(GFP) can be co-transfected to allow enrichment of transfected
cells using fluorescence activated cell sorting (FACS). The
transfected cells are then chromium-51 (.sup.51Cr) labeled and used
as targets for epitope-specific CTLs. Cytolysis of the target
cells, detected by .sup.51Cr release, indicates both production and
HLA presentation of, polynucleotide-, e.g. minigene-, encoded
epitopes and/or analogs of the invention, or peptides comprising
them. Expression of HTL epitopes may be evaluated in an analogous
manner using assays to assess HTL activity.
[0174] In vivo immunogenicity is a second approach for functional
testing of polynucleotides, e.g. minigenes. Transgenic mice
expressing appropriate human HLA proteins are immunized with the
polynucleotide, e.g. DNA, product. The dose and route of
administration are formulation dependent (e.g., IM for
polynucleotide (e.g., naked DNA or PVP-formulated DNA) in PBS,
intraperitoneal (IP) for lipid-complexed polynucleotide (e.g.,
DNA)). Eleven to twenty-one days after immunization, splenocytes
are harvested and restimulated for one week in the presence of
polynucleotides encoding each peptide being tested. Thereafter, for
peptides comprising or consisting of epitopes and/or analogs,
standard assays are conducted to determine if there is cytolysis of
peptide-loaded, .sup.51Cr-labeled target cells. Once again, lysis
of target cells that were exposed to epitopes and/or analogs
corresponding to those encoded by the polynucleotide, e.g.
minigene, demonstrates polynucleotide, e.g., DNA, vaccine function
and induction of CTLs. Immunogenicity of HTL epitopes is evaluated
in transgenic mice in an analogous manner.
[0175] Alternatively, the nucleic acids can be administered using
ballistic delivery as described, for instance, in U.S. Pat. No.
5,204,253. Using this technique, particles comprised solely of a
polynucleotide such as DNA are administered. In a further
alternative embodiment for ballistic delivery, polynucleotides such
as DNA can be adhered to particles, such as gold particles.
[0176] The use of polynucleotides such as multi-epitope minigenes
is described herein and in, e.g. co-pending application U.S. Ser.
No. 09/311,784; Ishioka et al., J. Immunol. 162:3915-3925, 1999;
An, L. and Whitton, J. L., J. Virol. 71:2292, 1997; Thomson, S. A.
et al., J. Immunol 157:822, 1996; Whitton, J. L. et al., J. Virol.
67:348, 1993; Hanke, R. et al., Vaccine 16:426, 1998. For example,
a polynucleotide such as a multi-epitope DNA plasmid can be
engineered which encodes an epitope derived from multiple regions
of a TAA (e.g., p53, HER2/neu, MAGE-2/3, or CEA), a pan-DR binding
peptide such as the PADRE.RTM. universal helper T cell epitope, and
an endoplasmic reticulum-translocating signal sequence. As
described in the sections above, a peptide/polynucleotide may also
comprise/encode epitopes that are derived from other TAAs.
[0177] Thus, the invention includes peptides as described herein,
polynucleotides encoding each of said peptides, as well as
compositions comprising the peptides and polynucleotides, and
includes methods for producing and methods of using the peptides,
polynucleotides, and compositions, as further described below.
[0178] Compositions. In other embodiments, the invention is
directed to a composition comprising one or more peptides and/or a
polynucleotide of the invention and optionally another
component(s).
[0179] In some embodiments, the composition comprises or consists
of multiple peptides, e.g., 2, 3, 4, 5, 6, 7, 8, 9 or 10 peptides
of the invention. In some embodiments, the composition comprises at
least 2, at least 3, at least 4, at least 5, at least 6, at least
7, at least 8, at least 9 or at least 10 peptides of the
invention.
[0180] Compositions of the invention may comprise polynucleotides
encoding the above peptides and/or combinations of peptides.
[0181] The composition can comprise at least 2, at least 3, at
least 4, at least 5, at least 6, at least 7, at least 8, at least 9
or at least 10 peptides and/or polynucleotides selected from those
described above or below. At least one of the one or more peptides
can be a heteropolymer or a homopolymer. Additionally, the
composition can comprise a CTL and/or HTL epitope, which can be
derived from a tumor-associated antigen. The additional epitope can
also be a PanDR binding molecule, (e.g., a PADRE.RTM. universal
helper T cell epitope).
[0182] Optional components include excipients, diluents, proteins
such as peptides comprising a CTL epitope, and/or an HTL epitope
such as a pan-DR binding peptide (e.g., a PADRE.RTM. universal
helper T cell epitope), and/or a carrier, polynucleotides encoding
such proteins, lipids, or liposomes, as well as other components
described herein. There are numerous embodiments of compositions in
accordance with the invention, such as a cocktail of one or more
peptides and/or polynucleotides; one or more peptides and/or
analogs and one or more CTL and/or HTL epitopes; and/or nucleic
acids that encode such peptides, e.g., minigenes.
[0183] Compositions may comprise one or more peptides (and/or
polynucleotides such as minigenes) of the invention, along with one
or more other components as described above and herein. "One or
more" refers to any whole unit integer from 1-150, e.g., at least
2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20,
21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37,
38, 39, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105,
110, 115, 120, 125, 130, 135, 140, 145, or 150 peptides,
polynucleotides, or other components.
[0184] Compositions of the invention may be, for example,
polynucleotides or, polypeptides of the invention combined with or
completed to cationic lipid formulations; lipopeptides (e.g.,
Vitiello, A. et al., J. Clin. Invest. 95:341, 1995), encapsulated
e.g., in poly(DL-lactide-co-glycolide) ("PLG") microspheres (see,
e.g., Eldridge, et al., Molec. Immunol. 28:287-294, 1991: Alonso et
al., Vaccine 12:299-306, 1994; Jones et al., Vaccine 13:675-681,
1995); peptide compositions contained in immune stimulating
complexes (ISCOMS) (see, e.g., Takahashi et al., Nature
344:873-875, 1990; Hu et al., Clin Exp Immunol. 113:235-243, 1998);
multiple antigen peptide systems (MAPs) (see e.g., Tam, J. P.,
Proc. Natl. Acad. Sci. U.S.A. 85:5409-5413, 1988; Tam, J. P., J.
Immunol. Methods 196:17-32, 1996); viral, bacterial, or, fungal
delivery vectors (Perkus, M. E. et al., In: Concepts in vaccine
development, Kaufmann, S. H. E., ed., p. 379, 1996; Chakrabarti, S.
et al., Nature 320:535, 1986; Hu, S. L. et al., Nature 320:537,
1986; Kieny, M.-P. et al., AIDS Bio/Technology 4:790, 1986; Top, F.
H. et al., J. Infect. Dis. 124:148, 1971; Chanda, P. K. et al.,
Virology 175:535, 1990); particles of viral or synthetic origin
(e.g., Kofler, N. et al., J. Immunol. Methods. 192:25, 1996;
Eldridge, J. H. et al., Sem. Hematol. 30:16, 1993; Falo, L. D., Jr.
et al., Nature Med. 7:649, 1995); adjuvants (e.g., incomplete
Freund's adjuvant) (Warren, H. S., Vogel, F. R., and Chedid, L. A.
Annu. Rev. Immunol. 4:369, 1986; Gupta, R. K. et al., Vaccine
11:293, 1993); liposomes (Reddy, R. et al., J. Immunol. 148:1585,
1992; Rock, K. L., Immunol. Today 17:131, 1996); or,
particle-absorbed cDNA or other polynucleotides of the invention
(Ulmer, J. B. et al., Science 259:1745, 1993; Robinson, H. L.,
Hunt, L. A., and Webster, R. G., Vaccine 11:957, 1993; Shiver, J.
W. et al., In: Concepts in vaccine development, Kaufmann, S. H. E.,
ed., p. 423, 1996; Cease, K. B., and Berzofsky, J. A., Annu. Rev.
Immunol. 12:923, 1994 and Eldridge, J. H. et al., Sem. Hematol.
30:16, 1993), etc. Toxin-targeted delivery technologies, also known
as receptor mediated targeting, such as those of Avant
Immunotherapeutics, Inc. (Needham, Mass.) or attached to a stress
protein, e.g., HSP 96 (Stressgen Biotechnologies Corp., Victoria,
BC, Canada) can also be used.
[0185] Compositions of the invention comprise
polynucleotide-mediated modalities. DNA or RNA encoding one or more
of the peptides of the invention can be administered to a patient.
This approach is described, for instance, in Wolff et. al., Science
247:1465 (1990) as well as U.S. Pat. Nos. 5,580,859; 5,589,466;
5,804,566; 5,739,118; 5,736,524; 5,679,647; and, WO 98/04720.
Examples of DNA-based delivery technologies include "naked DNA"
(see, e.g., U.S. Pat. No. 5,693,622), facilitated DNA ((i.e.,
non-"naked DNA") facilitated e.g. by combination with bupivicaine,
polymers (e.g., PVP, PINC, etc.), peptide-mediated) delivery,
cationic lipid complexes, and particle-mediated ("gene gun") or
pressure-mediated delivery (see, e.g., U.S. Pat. No. 5,922,687).
Accordingly, peptides of the invention can be expressed by viral or
bacterial vectors. Examples of expression vectors include
attenuated viral hosts, such as Modified Vaccinia Ankara (MVA)
(e.g., Bavarian Noridic), vaccinia or fowlpox. For example,
vaccinia virus is used as a vector to express nucleotide sequences
that encode the peptides of the invention. Upon introduction into
an acutely or chronically infected host or into a non-infected
host, the recombinant vaccinia virus expresses the immunogenic
peptide, and thereby elicits an immune response. Vaccinia vectors
and methods useful in immunization protocols are described in,
e.g., U.S. Pat. No. 4,722,848. Another vector is BCG (Bacille
Calmette Guerin). BCG vectors are described in Stover et al.,
Nature 351:456-460 (1991). A wide variety of other vectors useful
for therapeutic administration or immunization of the peptides of
the invention, e.g. adeno and adeno-associated virus vectors, alpha
virus vectors, retroviral vectors, Salmonella typhi vectors,
detoxified anthrax toxin vectors, and the like, are apparent to
those skilled in the art from the description herein.
[0186] In certain embodiments, components that induce T cell
responses are combined with components that induce antibody
responses to the target antigen of interest. A preferred embodiment
of such a composition comprises class I and class II epitopes in
accordance with the invention. Alternatively, a composition
comprises a class I and/or class II epitope in accordance with the
invention, along with a PADRE.RTM. molecule (Epimmune, San Diego,
Calif.).
[0187] Compositions of the invention can comprise antigen
presenting cells, such as dendritic cells. Antigen presenting
cells, e.g., dendritic cells, may be transfected, e.g., with a
polynucleotide such as a minigene construct in accordance with the
invention, in order to elicit immune responses. The peptide can be
bound to an HLA molecule on the antigen-resenting cell, whereby
when an HLA-restricted cytotoxic T lymphocyte (CTL) is present, a
receptor of the CTL binds to a complex of the HLA molecule and the
peptide.
[0188] The compositions of the invention may also comprise
antiviral drugs such as interferon-.alpha., or immune adjuvants
such as IL-12, GM-CSF, etc.
[0189] Compositions may comprise an HLA heavy chain,
2-microglobulin, streptavidin, and/or biotin. The streptavidin may
be fluorescently labeled. Compositions may comprise tetramers (see
e.g., U.S. Pat. No. 5,635,363; Science 274:94-96 (1996)). A
tetramer composition comprising an HLA heavy chain,
.beta..sub.2-microglobulin, streptavidin, and biotin. The
streptavidin may be fluorescently labeled. Compositions may also
comprise dimers. A dimer composition comprises as MHC molecule and
an Ig molecule (see e.g., Proc. Natl. Acad. Sci., USA, 95:7568-73
(1998)).
[0190] In some embodiments it may be desirable to include in the
compositions of the invention at least one component which primes
cytotoxic T lymphocytes. Lipids have been identified as agents
capable of priming CTL in vivo against viral antigens. For example,
palmitic acid residues can be attached to the .epsilon.- and
.alpha.-amino groups of a lysine residue and then linked, e.g., via
one or more linking residues such as Gly, Gly-Gly-, Ser, Ser-Ser,
or the like, to an immunogenic peptide. The lipidated peptide can
then be administered either directly in a micelle or particle,
incorporated into a liposome, or emulsified in an adjuvant, e.g.,
incomplete Freund's adjuvant. A preferred composition comprises
palmitic acid attached to .epsilon.- and .alpha.-amino groups of
Lys, which is attached via linkage, e.g., Ser-Ser, to the amino
terminus of the peptide.
[0191] As another example of lipid priming of CTL responses, E.
coli lipoproteins, such as
tripalmitoyl-S-glycerylcysteinlyseryl-serine P.sub.3CSS) can be
used to prime virus specific CTL when covalently attached to an
appropriate peptide (see, e.g., Deres, et al., Nature 342:561,
1989). Peptides of the invention can be coupled to P.sub.3CSS, for
example, and the lipopeptide administered to an individual to
specifically prime a CTL response to the target antigen. Moreover,
because the induction of neutralizing antibodies can also be primed
with P.sub.3CSS-conjugated epitopes, two such compositions can be
combined to more effectively elicit both humoral and cell-mediated
responses.
[0192] Another preferred embodiment is a composition comprising one
or more peptides of the invention emulsified in IFA.
[0193] A highly preferred embodiment of the invention comprises
peptides comprising SEQ ID NOs:1-10 of the invention emulsified in
IFA.
[0194] Compositions of the invention may also comprise CTL and/or
HTL peptides. Such CTL and HTL peptides can be modified by the
addition of amino acid residues to the termini of a peptide to
provide for ease of linking peptides one to another, for coupling
to a carrier support or larger peptide, for modifying the physical
or chemical properties of the peptide or oligopeptide, or the like.
Amino acid residues such as tyrosine, cysteine, lysine, glutamic or
aspartic acid, or naturally or unnaturally occurring amino acid
residues, can be introduced at the carboxyl- or amino-terminus of
the peptide or oligopeptide, particularly class I peptides.
However, it is to be noted that modification at the carboxyl
terminus of a CTL epitope may, in some cases, alter binding
characteristics of the peptide. In addition, the peptide or
oligopeptide sequences can differ from the natural sequence by
being modified by terminal-NH.sub.2 acylation, e.g., by alkanoyl
(C.sub.1-C.sub.20) or thioglycolyl acetylation, terminal-carboxyl
amidation, e.g., ammonia, methylamine, etc. In some instances these
modifications may provide sites for linking to a support or other
molecule. CTL and HTL epitopes may comprise additional amino acid
residues, such as those described above including spacers.
[0195] A further embodiment of a composition in accordance with the
invention is an antigen presenting cell that comprises one or more
peptides in accordance with the invention. The antigen presenting
cell can be a "professional" antigen presenting cell, such as a
dendritic cell. The antigen presenting cell can comprise the
peptide of the invention by any means known or to be determined in
the art. Such means include pulsing of dendritic cells with one or
more individual peptides, by nucleic acid administration such as
ballistic nucleic acid delivery or by other techniques in the art
for administration of nucleic acids, including vector-based, e.g.
viral vector, delivery of nucleic acids.
[0196] Compositions may comprise carriers. Carriers that can be
used with compositions of the invention are well known in the art,
and include, e.g., thyroglobulin, albumins such as human serum
albumin, tetanus toxoid, polyamino acid residues such as poly
L-lysine, poly L-glutamic acid, influenza virus proteins, hepatitis
B virus core protein, and the like.
[0197] The compositions (e.g. pharmaceutical compositions) can
contain a physiologically tolerable diluent such as water, or a
saline solution, preferably phosphate buffered saline.
Additionally, as disclosed herein, CTL responses can be primed by
conjugating peptides of the invention to lipids, such as
tripalmitoyl-S-glyceryl-cysteinyl-seryl-serine (P.sub.3CSS).
[0198] Compositions of the invention may be pharmaceutically
acceptable compositions. Pharmaceutical compositions preferably
contain an immunologically effective amount of one or more peptides
and/or polynucleotides of the invention, and optionally one or more
other components which are pharmaceutically acceptable. A preferred
composition comprises one or more peptides of the invention and
IFA. A more preferred composition of the invention comprises one or
more peptides of the invention, one or more peptides, and IFA.
[0199] Upon immunization with a peptide and/or polynucleotide
and/or composition in accordance with the invention, via injection
(e.g. SC, ID, IM), aerosol, oral, transdermal, transmucosal,
intrapleural, intrathecal, or other suitable routes, the immune
system of the host responds to the vaccine by an immune response
comprising the production of antibodies, CTLs and/or HTLs specific
for the desired antigen(s). Consequently, the host becomes at least
partially immune to subsequent exposure to the TAA(s), or at least
partially resistant to further development of TAA-bearing cells and
thereby derives a prophylactic or therapeutic benefit.
[0200] Furthermore, the peptides, primers, and epitopes of the
invention can be used in any desired immunization or administration
regimen; e.g., as part of periodic vaccinations such as annual
vaccinations as in the veterinary arts or as in periodic
vaccinations as in the human medical arts, or as in a prime-boost
regime wherein an inventive vector or recombinant is administered
either before or after the administration of the same or of a
different epitope of interest or recombinant or vector expressing
such as a same or different epitope of interest (including an
inventive recombinant or vector expressing such as a same or
different epitope of interest), see, e.g., U.S. Pat. Nos.
5,997,878; 6,130,066; 6,180,398; 6,267,965; and 6,348,450. An
useful viral vector of the present invention is Modified Vaccinia
Ankara (MVA) (e.g., Bavarian Noridic (MVA-BN)).
[0201] Recent studies have indicated that a prime-boost protocol,
whereby immunization with a poxvirus recombinant expressing a
foreign gene product is followed by a boost using a purified
subunit preparation form of that gene product, elicits an enhanced
immune response relative to the response elicited with either
product alone. Human volunteers immunized with a vaccinia
recombinant expressing the HIV-1 envelope glycoprotein and boosted
with purified HIV-1 envelope glycoprotein subunit preparation
exhibit higher HIV-1 neutralizing antibody titers than individuals
immunized with just the vaccinia recombinant or purified envelope
glycoprotein alone (Graham et al., J. Infect. Dis., 167:533-537
(1993); Cooney et al., Proc. Natl. Acad. Sci. USA, 90:1882-1886
(1993)). Humans immunized with two injections of an ALVAC-HIV-1 env
recombinant (vCP125) failed to develop HIV specific antibodies.
Boosting with purified rgp160 from a vaccinia virus recombinant
resulted in detectable HIV-1 neutralizing antibodies. Furthermore,
specific lymphocyte T cell proliferation to rgp160 was clearly
increased by the boost with rgp160. Envelope specific cytotoxic
lymphocyte activity was also detected with this vaccination regimen
(Pialoux et al., AIDS Res. and Hum. Retroviruses, 11:272-381
(1995)). Macaques immunized with a vaccinia recombinant expressing
the simian immunodeficiency virus (SIV) envelope glycoprotein and
boosted with SIV envelope glycoprotein from a baculovirus
recombinant are protected against SIV challenge (Hu et al., AID
Res. and Hum. Retroviruses, 3:615-620 (1991); Hu et al., Science
255:456-459 (1992)). In the same fashion, purified HCMVgB protein
can be used in prime-boost protocols with NYVAC or ALVAC-gB
recombinants.
[0202] In certain embodiments, the polynucleotides are complexed in
a liposome preparation. Liposomal preparations for use in the
instant invention include cationic (positively charged), anionic
(negatively charged) and neutral preparations. However, cationic
liposomes are particularly preferred because a tight charge complex
can be formed between the cationic liposome and the polyanionic
nucleic acid. Cationic liposomes have been shown to mediate
intracellular delivery of plasmid DNA (Felgner et al., Proc. Natl.
Acad. Sci. USA 84:74137416 (1987), which is herein incorporated by
reference); mRNA (Malone et al., Proc. Natl. Acad. Sci. USA
86:60776081 (1989), which is herein incorporated by reference); and
purified transcription factors (Debs et al., J. Biol. Chem.
265:1018910192 (1990), which is herein incorporated by reference),
in functional form.
[0203] Cationic liposomes are readily available. For example,
N-[12,3-dioleyloxy)-propyl]-N,N,N-triethylammonium (DOTMA)
liposomes are particularly useful and are available under the
trademark Lipofectin.RTM., from Invitrogen, Carlsbad, Calif. (See,
also, Felgner et al., Proc. Natl. Acad. Sci. USA 84:74137416
(1987)). Other commercially available liposomes include
transfectace (DDAB/DOPE) and DOTAP/DOPE (Boehringer).
[0204] Other cationic liposomes can be prepared from readily
available materials using techniques well known in the art. See,
e.g. PCT Publication No. WO 90/11092 for a description of the
synthesis of DOTAP (1,2-bis(oleoyloxy)-3-(trimethylammonio)propane)
liposomes. Preparation of DOTMA liposomes is explained in the
literature, see, e.g., P. Felgner et al., Proc. Natl. Acad. Sci.
USA 84:74137417. Similar methods can be used to prepare liposomes
from other cationic lipid materials.
[0205] Similarly, anionic and neutral liposomes are readily
available, such as from Avanti Polar Lipids (Birmingham, Ala.), or
can be easily prepared using readily available materials. Such
materials include phosphatidyl, choline, cholesterol, phosphatidyl
ethanolamine, dioleoylphosphatidyl choline (DOPC),
dioleoylphosphatidyl glycerol (DOPG), dioleoylphosphatidyl
ethanolamine (DOPE), among others. These materials can also be
mixed with the DOTMA and DOTAP starting materials in appropriate
ratios. Methods for making liposomes using these materials are well
known in the art.
[0206] For example, commercially available dioleoylphosphatidyl
choline (DOPC), dioleoylphosphatidyl glycerol (DOPG), and
dioleoylphosphatidyl ethanolamine (DOPE) can be used in various
combinations to make conventional liposomes, with or without the
addition of cholesterol. Thus, for example, DOPG/DOPC vesicles can
be prepared by drying 50 mg each of DOPG and DOPC under a stream of
nitrogen gas into a sonication vial. The sample is placed under a
vacuum pump overnight and is hydrated the following day with
deionized water. The sample is then sonicated for 2 hours in a
capped vial, using a Heat Systems model 350 sonicator equipped with
an inverted cup (bath type) probe at the maximum setting while the
bath is circulated at 15.degree. C. Alternatively, negatively
charged vesicles can be prepared without sonication to produce
multilamellar vesicles or by extrusion through nucleopore membranes
to produce unilamellar vesicles of discrete size. Other methods are
known and available to those of skill in the art.
[0207] The liposomes can comprise multilamellar vesicles (MLVs),
small unilamellar vesicles (SUVs), or large unilamellar vesicles
(LUVs), with SUVs being preferred. The various liposome nucleic
acid complexes are prepared using methods well known in the art.
See, e.g., Straubinger et al., Methods of Immunology 101:512527
(1983). For example, MLVs containing nucleic acid can be prepared
by depositing a thin film of phospholipid on the walls of a glass
tube and subsequently hydrating with a solution of the material to
be encapsulated. SUVs are prepared by extended sonication of MLVs
to produce a homogeneous population of unilamellar liposomes. The
material to be entrapped is added to a suspension of preformed MLVs
and then sonicated. When using liposomes containing cationic
lipids, the dried lipid film is resuspended in an appropriate
solution such as sterile water or an isotonic buffer solution such
as 10 mM Tris/NaCl, sonicated, and then the preformed liposomes are
mixed directly with the DNA. The liposome and DNA form a very
stable complex due to binding of the positively charged liposomes
to the cationic DNA. SUVs find use with small nucleic acid
fragments. LUVs are prepared by a number of methods, well known in
the art. Commonly used methods include Ca.sup.2+-EDTA chelation
(Papahadjopoulos et al., Biochim. Biophys. Acta 394:483 (1975);
Wilson et al., Cell 17:77 (1979)); ether injection (Deamer, D. and
Bangham, A., Biochim. Biophys. Acta 443:629 (1976); Ostro et al.,
Biochem. Biophys. Res. Commun. 76:836 (1977); Fraley et al., Proc.
Natl. Acad. Sci. USA 76:3348 (1979)); detergent dialysis (Enoch, H.
and Strittmatter, P., Proc. Natl. Acad. Sci. USA 76:145 (1979));
and reversephase evaporation (REV) (Fraley et al., J. Biol. Chem.
255:10431 (1980); Szoka, F. and Papahadjopoulos, D., Proc Natl.
Acad. Sci. USA 75:145 (1978); SchaeferRidder et al., Science
215:166 (1982)).
[0208] Generally, the ratio of DNA to liposomes will be from about
10:1 to about 1:10. Preferably, the ration will be from about 5:1
to about 1:5. More preferably, the ration will be about 3:1 to
about 1:3. Still more preferably, the ratio will be about 1:1.
[0209] U.S. Pat. No. 5,676,954 reports on the injection of genetic
material, complexed with cationic liposome carriers, into mice.
U.S. Pat. Nos. 4,897,355, 4,946,787, 5,049,386, 5,459,127,
5,589,466, 5,693,622, 5,580,859, 5,703,055, and international
publication no. WO 94/9469 provide cationic lipids for use in
transfecting DNA into cells and mammals. U.S. Pat. Nos. 5,589,466,
5,693,622, 5,580,859, 5,703,055, and international publication no.
WO 94/9469 provide methods for delivering DNA-cationic lipid
complexes to mammals.
[0210] Binding Affinity of Epitopes and Analogs for HLA
Molecules
[0211] As indicated herein, the large degree of HLA polymorphism is
an important factor to be taken into account with the epitope-based
approach to developing therapeutics and diagnostics. To address
this factor, epitope selection encompassing identification of
peptides capable of binding at high or intermediate affinity to
multiple HLA molecules is preferably utilized, most preferably
these epitopes bind at high or intermediate affinity to two or more
allele-specific HLA molecules. However, in some embodiments, it is
preferred that all epitopes in a given composition bind to the
alleles of a single HLA supertype or a single HLA molecule.
[0212] Epitopes and analogs of the invention preferably include
those that have an IC.sub.50 or binding affinity value for a class
I HLA molecule(s) of 500 nM or better (i.e., the value is
.ltoreq.500 nM). In certain embodiments of the invention, peptides
of interest have an IC.sub.50 or binding affinity value for a class
I HLA molecule(s) of 200 nM or better. In certain embodiments of
the invention, peptides of interest, have an IC.sub.50 or binding
affinity value for a class I HLA molecule(s) of 100 nM or better.
If HTL epitopes are included, they preferably are HTL epitopes that
have an IC.sub.50 or binding affinity value for class II HLA
molecules of 1000 nM or better, (i.e., the value is .ltoreq.1,000
nM). For example, peptide binding is assessed by testing the
capacity of a candidate peptide to bind to a purified HLA molecule
in vitro. Peptides exhibiting high or intermediate affinity are
then considered for further analysis. Selected peptides are
generally tested on other members of the supertype family. In
preferred embodiments, peptides that exhibit cross-reactive binding
are then used in cellular screening analyses or vaccines.
[0213] The relationship between binding affinity for HLA class I
molecules and immunogenicity of discrete peptide epitopes on bound
antigens was determined for the first time by inventors at
Epimmune. As disclosed in greater detail herein, higher HLA binding
affinity is correlated with greater immunogenicity.
[0214] Greater immunogenicity can be manifested in several
different ways. Immunogenicity corresponds to whether an immune
response is elicited at all, and to the vigor of any particular
response, as well as to the extent of a population in which a
response is elicited. For example, a peptide might elicit an immune
response in a diverse array of the population, yet in no instance
produce a vigorous response. In accordance with these principles,
close to 90% of high binding peptides have been found to elicit a
response and thus be "immunogenic," as contrasted with about 50% of
the peptides that bind with intermediate affinity. (See, e.g.
Schaeffer et al. Proc. Natl. Acad. Sci., USA (1988)) High
affinity-binding class I peptides generally have an affinity of
less than or equal to 100 nM. Moreover, not only did peptides with
higher binding affinity have an enhanced probability of generating
an immune response, the generated response tended to be more
vigorous than the response seen with weaker binding peptides. As a
result, less peptide is required to elicit a similar biological
effect if a high affinity binding peptide is used rather than a
lower affinity one. Thus, in some preferred embodiments of the
invention, high affinity binding epitopes are used.
[0215] The correlation between binding affinity and immunogenicity
was analyzed by the present inventors by two different experimental
approaches (see, e.g., Sette, et al., J. Immunol. 153:5586-5592
(1994)). In the first approach, the immunogenicity of potential
epitopes ranging in HLA binding affinity over a 10,000-fold range
was analyzed in HLA-A*0201 transgenic mice. In the second approach,
the antigenicity of approximately 100 different hepatitis B virus
(HBV)-derived potential epitopes, all carrying A*0201 binding
motifs, was assessed by using PBL from acute hepatitis patients.
Pursuant to these approaches, it was determined that an affinity
threshold value of approximately 500 nM (preferably 50 nM or less)
determines the capacity of a peptide epitope to elicit a CTL
response. These data are true for class I binding affinity
measurements for naturally processed peptides and for synthesized T
cell epitopes. These data also indicate the important role of
determinant selection in the shaping of T cell responses (see,
e.g., Schaeffer et al. Proc. Natl. Acad. Sci. USA 86:4649-4653
(1989)).
[0216] An affinity threshold associated with immunogenicity in the
context of HLA class II (i.e., HLA DR) molecules has also been
delineated (see, e.g. Southwood et al. J. Immunology 160:3363-3373
(1998), and U.S. Pat. No. 6,413,527, issued Jul. 2, 2002). In order
to define a biologically significant threshold of HLA class II
binding affinity, a database of the binding affinities of 32
DR-restricted epitopes for their restricting element (i.e., the HLA
molecule that binds the epitope) was compiled. In approximately
half of the cases (15 of 32 epitopes), DR restriction was
associated with high binding affinities, i.e. binding affinity
values of 100 nM or less. In the other half of the cases (16 of
32), DR restriction was associated with intermediate affinity
(binding affinity values in the 100-1000 nM range). In only one of
32 cases was DR restriction associated with an IC.sub.50 of 1000 nM
or greater. Thus, 1000 nM is defined as an affinity threshold
associated with immunogenicity in the context of DR molecules.
[0217] Epitope Binding Motifs and Supermotifs
[0218] Through the study of single amino acid substituted antigen
analogs and the sequencing of endogenously bound, naturally
processed peptides, critical residues required for allele-specific
binding to HLA molecules have been identified. The presence of
these residues in a peptide correlates with both the probability of
binding and with binding affinity for HLA molecules.
[0219] The identification of motifs and/or supermotifs that
correlate with high and intermediate affinity binding is important
when identifying immunogenic peptide epitopes for the inclusion in
a vaccine. Kast et al. (J. Immunol. 152:3904-3912 (1994)) have
shown that motif-bearing peptides account for 90% of the epitopes
that bind to allele-specific HLA class I molecules. In the Kast
study, all possible 9 amino acid long peptides, each overlapping by
eight amino acid residues, which cover the entire sequence of the
E6 and E7 proteins of human papillomavirus type 16 were generated,
which produced 240 peptides. All 240 peptides were evaluated for
binding to five allele-specific HLA molecules that are expressed at
high frequency among different ethnic groups. This unbiased set of
peptides allowed an evaluation of the predictive values of HLA
class I motifs. From the set of 240 peptides, 22 peptides were
identified that bound to an allele-specific HLA molecule with high
or intermediate affinity. Of these 22 peptides, 20 (i.e. 91%) were
motif-bearing. Thus, this study demonstrated the value of motifs
for identification of peptide epitopes to be included in a
vaccine.
[0220] Accordingly, the use of motif-based identification
techniques identifies approximately 90% of all potential epitopes
in a target protein sequence. Without the disclosed motif analysis,
the ability to practically identify immunogenic peptide(s) for use
in diagnostics or therapeutics is seriously impaired.
[0221] Peptides, pharmaceutical compositions and vaccines of the
present invention may also comprise epitopes that bind to MHC class
II DR molecules. A greater degree of heterogeneity in both size and
binding frame position of the motif, relative to the N- and
C-termini of the peptide, exists for class II peptide ligands. This
increased heterogeneity of HLA class II peptide ligands is due to
the structure of the binding groove of the HLA class II molecule
which, unlike its class I counterpart, is less physically
constricted at both ends. Crystallographic analysis of HLA class II
DRB*0101-peptide complexes to identify the residues associated with
major binding energy identified those residues complexed with
complementary pockets on the DRBI*0101 molecules. An important
anchor residue engages the deepest hydrophobic pocket (see, e.g.,
Madden, D. R. Ann. Rev. Immunol. 13:587 (1995)) and is referred to
as position 1 (P1). P1 may represent the N-terminal residue of a
class II binding peptide epitope, but more typically is flanked
towards the N-terminus by one or more residues. Other studies have
also pointed to an important role for the peptide residue in the
sixth position towards the C-terminus, relative to P1, for binding
to various DR molecules. See, e.g., U.S. Pat. No. 5,736,142, and
co-pending applications entitled Alteration Of Immune Responses
Using Pan DR Binding Peptides, U.S. Ser. No. 09/709,774, filed Nov.
8, 2000 and 09/707,738, filed Nov. 6, 2000.
[0222] HLA-A2 Supermotif
[0223] Primary anchor specificities for allele-specific HLA-A2.1
molecules (see, e.g., Falk et al., Nature 351:290-296 (1991); Hunt
et al., Science 255:1261-1263 (1992); Parker et al., J. Immunol.
149:3580-3587 (1992); Ruppert et al., Cell 74:929-937 (1993)) and
cross-reactive binding among HLA-A2 and -A28 molecules have been
described. (See, e.g., Fruci et al., Human Immunol. 38:187-192
(1993); Tanigaki et al., Human Immunol. 39:155-162 (1994); del
Guercio et al., J. Immunol. 154:685-693 (1995); Kast et al., J.
Immunol. 152:3904-3912 (1994) for reviews of relevant data.) These
primary anchor residues define the HLA-A2 supermotif; which when
present in peptide ligands corresponds to the ability to bind
several different HLA-A2 and -A28 molecules. The HLA-A2 supermotif
comprises peptide ligands with L, I, V, M, A, T, or Q as a primary
anchor residue at position 2 and L, I, V, M, A, or T as a primary
anchor residue at the C-terminal position of the epitope.
[0224] The corresponding family of HLA molecules (i.e., the HLA-A2
supertype that binds these peptides) is comprised of at least:
A*0201, A*0202, A*0203, A*0204, A*0205, A*0206, A*0207, A*0209,
A*0214, A*6802, and A*6901. Other allele-specific HLA molecules
predicted to be members of the A2 superfamily are shown in Tables
4D and 6. As explained in detail below, binding to each of the
individual allele-specific HLA molecules can be modulated by
substitutions at the primary anchor and/or secondary anchor
positions, preferably choosing respective residues specified for
the supermotif.
[0225] HLA-A*0201 Motif
[0226] An HLA-A2*0201 motif was determined to be characterized by
the presence in peptide ligands of L or M as a primary anchor
residue in position 2, and L or V as a primary anchor residue at
the C-terminal position of a 9-residue peptide (see, e.g., Falk et
al., Nature 351:290-296 (1991)) and was further found to comprise
an I at position 2 and I or A at the C-terminal position of a nine
amino acid peptide (see, e.g., Hunt et al., Science 255:1261-1263,
Mar. 6, 1992; Parker et al., J. Immunol. 149:3580-3587 (1992)) and
position 10 of a decamer peptide. The A*0201 allele-specific motif
has also been defined by the present inventors to additionally
comprise V, A, T, or Q as a primary anchor residue at position 2,
and M or T as a primary anchor residue at the C-terminal position
of the epitope (see, e.g., Kast et al., J. Immunol. 152:3904-3912,
1994).
[0227] Thus, the HLA-A*0201 motif comprises peptide ligands with L,
I, V, M, A, T, or Q as primary anchor residues at position 2 and L,
I, V, M, A, or T as a primary anchor residue at the C-terminal
position of the epitope. For this motif-supermotif relationship the
preferred and less preferred/tolerated residues that characterize
the primary anchor positions of the HLA-A*0201 motif are identical
to the residues describing the A2 supermotif. (For reviews of
relevant data, see, e.g., del Guercio et al., J. Immunol.
154:685-693, 1995; Ruppert et al., Cell 74:929-937, 1993; Sidney et
al., Immunol. Today 17:261-266, 1996; Sette and Sidney, Curr. Opin.
in Immunol. 10:478-482, 1998). Secondary anchor residues that
characterize the A*0201 motif have additionally been defined (see,
e.g., Ruppert et al., Cell 74:929-937, 1993). These secondary
anchors are shown in Tables 4A, 4B, and 4C. Peptide binding to
HLA-A*0201 molecules can be modulated by substitutions at primary
and/or secondary anchor positions, preferably choosing respective
residues specified for the motif.
[0228] Motifs Indicative of Class II HTL Inducing Peptide
Epitopes
[0229] The primary and secondary anchor residues of the HLA class
II peptide epitope supermotifs and motifs are summarized in U.S.
Pat. Nos. 5,736,142, 5,679,640 and 6,413,935; co-pending
applications entitled Alteration Of Immune Responses Using Pan DR
Binding Peptides, U.S. Ser. No. 09/709,774, filed Nov. 8, 2000 and
09/707,738, filed Nov. 6, 2000; and PCT publication Nos. WO
95/07707 and WO 97/26784.
[0230] Immune Response-Stimulating Peptide Analogs
[0231] In general, CTL and HTL responses are not directed against
all possible epitopes. Rather, they are restricted to a few
"immunodominant" determinants (Zinkernagel, et al., Adv. Immunol.
27:5159, 1979; Bennink, et al., J. Exp. Med. 168:19351939, 1988;
Rawle, et al., J. Immunol. 146:3977-3984, 1991). It has been
recognized that immunodominance (Benacerraf, et al., Science
175:273-279, 1972) could be explained by either the ability of a
given epitope to selectively bind a particular HLA protein
(determinant selection theory) (Vitiello, et al., J. Immunol.
131:1635, 1983); Rosenthal, et al., Nature 267:156-158, 1977), or
to be selectively recognized by the existing TCR (T cell receptor)
specificities (repertoire theory) (Klein, J., IMMUNOLOGY, THE
SCIENCE OF SELFNONSELF DISCRMINATION, John Wiley & Sons, New
York, pp. 270-310, 1982). It has been demonstrated that additional
factors, mostly linked to processing events, can also play a key
role in dictating, beyond strict immunogenicity, which of the many
potential determinants will be presented as immunodominant
(Sercarz, et al., Annu. Rev. Immunol. 11:729-766, 1993).
[0232] The concept of dominance and subdominance is relevant to
immunotherapy of both infectious diseases and malignancies. For
example, in the course of chronic viral disease, recruitment of
subdominant epitopes can be important for successful clearance of
the infection, especially if dominant CTL or HTL specificities have
been inactivated by functional tolerance, suppression, mutation of
viruses and other mechanisms (Franco, et al., Curr. Opin. Immunol.
7:524-531, 1995). In the case of cancer and tumor antigens, CTLs
recognizing at least some of the highest binding affinity peptides
might be functionally inactivated. Lower binding affinity peptides
are preferentially recognized at these times, and may therefore be
preferred in therapeutic or prophylactic anti-cancer vaccines.
[0233] In particular, it has been noted that a significant number
of epitopes derived from known non-viral tumor associated antigens
(TAA) bind HLA class I with intermediate affinity (IC.sub.50 in the
50-500 nM range) rather than at high affinity (IC.sub.50 of less
than 50 nM).
[0234] For example, it has been found that 8 of 15 known TAA
peptides recognized by tumor infiltrating lymphocytes (TIL) or CTL
bound in the 50-500 nM range. (These data are in contrast with
estimates that 90% of known viral antigens were bound by HLA class
I molecules with IC.sub.50 of 50 nM or less, while only
approximately 10% bound in the 50-500 nM range (Sette, et al., J.
Immunol., 153:558-592, 1994). In the cancer setting this phenomenon
is probably due to elimination or functional inhibition of the CTL
recognizing several of the highest binding peptides, presumably
because of T cell tolerization events.
[0235] Without intending to be bound by theory, it is believed that
because T cells to dominant epitopes may have been clonally
deleted, and selecting subdominant epitopes may allow existing T
cells to be recruited, which will then lead to a therapeutic or
prophylactic response. However, the binding of HLA molecules to
subdominant epitopes is often less vigorous than to dominant
ones.
[0236] Accordingly, there is a need to be able to modulate the
binding affinity of particular immunogenic epitopes for one or more
HLA molecules, to thereby modulate the immune response elicited by
the peptide, for example to prepare analog peptides which elicit a
more vigorous response. This ability to modulate both binding
affinity and the resulting immune response in accordance with the
present invention greatly enhances the usefulness of peptide
epitope-based vaccines and therapeutic agents.
[0237] Although peptides with suitable cross-reactivity among all
alleles of a superfamily are identified by the screening procedures
described above, cross-reactivity is not always as complete as
possible, and in certain cases procedures to increase
cross-reactivity of peptides can be useful; moreover, such
procedures can also be used to modify other properties of the
peptides such as binding affinity or peptide stability. Having
established the general rules that govern cross-reactivity of
peptides for HLA alleles within a given motif or supermotif,
modification (i.e., analoging) of the structure of peptides of
particular interest in order to achieve broader (or otherwise
modified) HLA binding capacity can be performed. More specifically,
peptides that exhibit the broadest cross-reactivity patterns, can
be produced in accordance with the teachings herein. The present
concepts related to analog generation are set forth in greater
detail in co-pending U.S. Ser. No. 09/226,775 filed 6 Jan.
1999.
[0238] In brief, the analoging strategy utilizes the motifs or
supermotifs that correlate with binding to certain HLA molecules.
Analog peptides can be created by substituting amino acid residues
at primary anchor, secondary anchor, or at primary and secondary
anchor positions. Generally, analogs are made for peptides that
already bear a motif or supermotif. As noted herein, preferred
primary and secondary anchor residues of supermotifs and motifs for
HLA-A2 class I binding peptides are shown in Tables 4A, 4B, and 4C.
For 4 number of the motifs or supermotifs in accordance with the
invention, residues are defined which are deleterious to binding to
allele-specific HLA molecules or members of HLA supertypes that
bind the respective motif or supermotif (Table 4C). Accordingly,
removal of such residues that are detrimental to binding can be
performed in accordance with the present invention.
[0239] Thus, one strategy to improve the cross-reactivity of
peptides within a given supermotif is simply to delete one or more
of the deleterious residues present within a peptide and substitute
a small "neutral" residue such as Ala (that may not influence T
cell recognition of the peptide). An enhanced likelihood of
cross-reactivity is expected if, together with elimination of
detrimental residues within a peptide, "preferred" residues
associated with high affinity binding to an allele-specific HLA
molecule or to multiple HLA molecules within a superfamily are
inserted.
[0240] To ensure that an analog peptide, when used as a vaccine,
actually elicits a CTL response to the native epitope in vivo (or,
in the case of class II epitopes, elicits helper T cells that
cross-react with the wild type peptides), the analog peptide may be
used to induce T cells in vitro from individuals of the appropriate
HLA allele. Thereafter, the immunized cells' capacity to lyse wild
type peptide sensitized target cells is evaluated. Alternatively,
evaluation of the cells' activity can be evaluated by monitoring
IFN release. Each of these cell monitoring strategies evaluate the
recognition of the APC by the CTL. It will be desirable to use as
antigen presenting cells, cells that have been either infected, or
transfected with the appropriate genes, or, (generally only for
class II epitopes, due to the different peptide processing pathway
for HLA class II), cells that have been pulsed with whole protein
antigens, to establish whether endogenously produced antigen is
also recognized by the T cells induced by the analog peptide. It is
to be noted that peptide/protein-pulsed dendritic cells can be used
to present whole protein antigens for both HLA class I and class
II.
[0241] Another embodiment of the invention is to create analogs of
weak binding peptides, to thereby ensure adequate numbers of
cellular binders. Class I binding peptides exhibiting binding
affinities of 500-5000 nM, and carrying an acceptable but
suboptimal primary anchor residue at one or both positions can be
"fixed" by substituting preferred anchor residues in accordance
with the respective supertype. The analog peptides can then be
tested for binding and/or cross-binding capacity.
[0242] Another embodiment of the invention is to create analogs of
peptides that are already cross-reactive binders and are vaccine
candidates, but which bind weakly to one or more alleles of a
supertype. If the cross-reactive binder carries a suboptimal
residue (less preferred or deleterious) at a primary or secondary
anchor position, the peptide can be analoged by substituting out a
deleterious residue and replacing it with a preferred or less
preferred one, or by substituting out a less preferred reside and
replacing it with a preferred one. The analog peptide can then be
tested for cross-binding capacity.
[0243] Another embodiment for generating effective peptide analogs
involves the substitution of residues that have an adverse impact
on peptide stability or solubility in, e.g., a liquid environment.
This substitution may occur at any position of the peptide epitope.
For example, a cysteine (C) can be substituted in favor of
.alpha.-amino butyric acid. Due to its chemical nature, cysteine
has the propensity to form disulfide bridges and sufficiently alter
the peptide structurally so as to reduce binding capacity.
Substituting .alpha.-amino butyric acid for C not only alleviates
this problem, but actually improves binding and crossbinding
capability in certain instances (see, e.g., the review by) Sette et
al., In: Persistent Viral Infections, Eds. R. Ahmed and I. Chen,
John Wiley & Sons, England, 1999). Substitution of cysteine
with .alpha.-amino butyric acid may occur at any residue of a
peptide epitope, i.e. at either anchor or non-anchor positions.
[0244] Moreover, it has been shown that in sets of A*0201
motif-bearing peptides containing at least one preferred secondary
anchor residue while avoiding the presence of any deleterious
secondary anchor residues, 69% of the peptides will bind A*0201
with an IC.sub.50 less than 500 nM (Ruppert, J. et al. Cell 74:929,
1993). The determination of what was a preferred or deleterious
residue in Ruppert can be used to generate algorithms. Such
algorithms are flexible in that cut-off scores may be adjusted to
select sets of peptides with greater or lower predicted binding
properties, as desired.
[0245] In accordance with the procedures described herein, tumor
associated antigen peptide epitopes and analogs thereof that were
found to bind HLA-A2 allele-specific molecules and to bind members
of the HLA-A2 supertype have been identified.
[0246] Furthermore, additional amino acid residues can be added to
the termini of a peptide to provide for ease of linking peptides
one to another, for coupling to a carrier support or larger
peptide, for modifying the physical or chemical properties of the
peptide or oligopeptide, or the like. Amino acid residues such as
tyrosine, cysteine, lysine, glutamic or aspartic acid, or any
naturally occurring or any non-naturally occurring amino acid
residues, can be introduced at the C- and/or N-terminus of the
peptide or oligopeptide, particularly class I peptides. It is to be
noted that modification at the carboxyl terminus of a CTL epitope
may, in some cases, alter binding characteristics of the peptide.
In addition, the peptide or oligopeptide sequences can differ from
the natural sequence by being modified by terminal-NH.sub.2
acylation, e.g., by alkanoyl (C.sub.1-C.sub.20) or thioglycolyl
acetylation, terminal-carboxyl amidation, e.g., ammonia,
methylamine, etc. In some instances these modifications may provide
sites for linking to a support or other molecule.
[0247] Assays to Detect T-Cell Responses
[0248] Once HLA binding peptides are identified, they can be tested
for the ability to elicit a T-cell response. The preparation and
evaluation of motif-bearing peptides are described, e.g., in PCT
publications WO 94/20127 and WO 94/03205. Briefly, peptides
comprising epitopes from a particular antigen are synthesized and
tested for their ability to bind to relevant HLA proteins. These
assays may involve evaluation of peptide binding to purified HLA
class I molecules in relation to the binding of a radioiodinated
reference peptide. Alternatively, cells expressing empty class I
molecules (i.e. cell surface HLA molecules that lack any bound
peptide) may be evaluated for peptide binding by immunofluorescent
staining and flow microfluorimetry. Other assays that may be used
to evaluate peptide binding include peptide-dependent class I
assembly assays and/or the inhibition of CTL recognition by peptide
competition. Those peptides that bind to an HLA class I molecule,
typically with an affinity of 500 nM or less, are further evaluated
for their ability to serve as targets for CTLs derived from
infected or immunized individuals, as well as for their capacity to
induce primary in vitro or in vivo CTL responses that can give rise
to CTL populations capable of reacting with selected target cells
associated with pathology.
[0249] Analogous assays are used for evaluation of HLA class II
binding peptides. HLA class II motif-bearing peptides that are
shown to bind, typically at an affinity of 1000 nM or less, are
further evaluated for the ability to stimulate HTL responses.
[0250] Conventional assays utilized to detect T cell responses
include proliferation assays, lymphokine secretion assays, direct
cytotoxicity assays, and limiting dilution assays. For example,
antigen-presenting cells that have been incubated with a peptide
can be assayed for the ability to induce CTL responses in responder
cell populations. Antigen-presenting cells can be normal cells such
as peripheral blood mononuclear cells or dendritic cells.
Alternatively, mutant, non-human mammalian cell lines that have
been transfected with a human class I MHC gene, and that are
deficient in their ability to load class I molecules with
internally processed peptides, are used to evaluate the capacity of
the peptide to induce in vitro primary CTL responses. Peripheral
blood mononuclear cells (PBMCs) can be used as the source of CTL
precursors. Antigen presenting cells are incubated with peptide,
after which the peptide-loaded antigen-presenting cells are then
incubated with the responder cell population under optimized
culture conditions. Positive CTL activation can be determined by
assaying the culture for the presence of CTLs that lyse
radio-labeled target cells, either specific peptide-pulsed targets
or target cells that express endogenously processed antigen from
which the specific peptide was derived. Alternatively, the presence
of epitope-specific CTLs can be determined by IFN.gamma. in situ
ELISA.
[0251] In an embodiment of the invention, directed to diagnostics,
a method has been devised which allows direct quantification of
antigen-specific T cells by staining with fluorescein-labelled HLA
tetrameric complexes (Altman, J. D. et al., Proc. Natl. Acad. Sci.
USA 90:10330, 1993; Altman, J. D. et al., Science 274:94, 1996).
Other options include staining for intracellular lymphokines, and
interferon release assays or ELISPOT assays. Tetramer staining,
intracellular lymphokine staining and ELISPOT assays all appear to
be at least 10-fold more sensitive than more conventional assays
(Lalvani, A. et al., J. Exp. Med. 186:859, 1997; Dunbar, P. R. et
al., Curr. Biol. 8:413, 1998; Murali-Krishna, K. et al., Immunity
8:177, 1998). Additionally, DimerX technology can be used as a
means of quantitation (see, e.g., Science 274:94-99 (1996) and
Proc. Natl. Acad. Sci. 95:7568-73 (1998)).
[0252] HTL activation may also be assessed using techniques known
to those in the art, such as T cell proliferation or lymphokine
secretion (see, e.g. Alexander et al., Immunity 1:751-761,
1994).
[0253] Alternatively, immunization of HLA transgenic mice can be
used to determine immunogenicity of peptide epitopes. Several
transgenic mouse strains, e.g., mice with human A2.1, A11 (which
can additionally be used to analyze HLA-A3 epitopes), and B7
alleles have been characterized. Other transgenic mice strains
(e.g., transgenic mice for HLA-A1 and A24) are being developed.
Moreover, HLA-DR1 and HLA-DR3 mouse models have been developed. In
accordance with principles in the art, additional transgenic mouse
models with other HLA alleles are generated as necessary.
[0254] Such mice can be immunized with peptides emulsified in
Incomplete Freund's Adjuvant; thereafter any resulting T cells can
be tested for their capacity to recognize target cells that have
been peptide-pulsed or transfected with genes encoding the peptide
of interest. CTL responses can be analyzed using cytotoxicity
assays described above. Similarly, HTL responses can be analyzed
using, e.g. T cell proliferation or lymphokine secretion
assays.
[0255] Minigenes
[0256] A number of different approaches are available which allow
simultaneous delivery of multiple epitopes. Nucleic acids encoding
multiple epitopes are a useful embodiment of the invention;
discrete peptide epitopes or polyepitopic peptides can be encoded.
The epitopes to be included in a minigene are preferably selected
according to the guidelines set forth in the previous section.
Examples of amino acid sequences that can be included in a minigene
include: HLA class I epitopes, HLA class II epitopes, a
ubiquitination signal sequence, and/or a targeting sequence such as
an endoplasmic reticulum (ER) signal sequence to facilitate
movement of the resulting peptide into the endoplasmic
reticulum.
[0257] The use of multi-epitope minigenes is also described in,
e.g., co-pending applications U.S. Ser. No. 09/311,784, 09/894,018,
60/419,973, 60/415,463; Ishioka et al., J. Immunol. 162:3915-3925,
1999; An, L. and Whitton, J. L., J. Virol. 71:2292, 1997; Thomson,
S. A. et al., J. Immunol. 157:822, 1996; Whitton, J. L. et al., J.
Virol. 67:348, 1993; Hanke, R. et al., Vaccine 16:426, 1998. For
example, a multi-epitope DNA plasmid encoding nine dominant
HLA-A*0201- and A11-restricted CTL epitopes derived from the
polymerase, envelope, and core proteins of HBV and human
immunodeficiency virus (HIV), a PADRE.RTM. universal helper T cell
(HTL) epitope, and an endoplasmic reticulum-translocating signal
sequence has been engineered. Immunization of HLA transgenic mice
with this plasmid construct resulted in strong CTL induction
responses against the nine CTL epitopes tested. This CTL response
was similar to that observed with a lipopeptide of known
immunogenicity in humans, and significantly greater than
immunization using peptides in oil-based adjuvants. Moreover, the
immunogenicity of DNA-encoded epitopes in vitro was also correlated
with the in vitro responses of specific CTL lines against target
cells transfected with the DNA plasmid. These data show that the
minigene served: 1.) to generate a CTL response and 2.) to generate
CTLs that recognized cells expressing the encoded epitopes. A
similar approach can be used to develop minigenes encoding TAA
epitopes.
[0258] For example, to create a DNA sequence encoding the selected
epitopes (minigene) for expression in human cells, the amino acid
sequences of the epitopes may be reverse translated. A human codon
usage table can be used to guide the codon choice for each amino
acid. These epitope-encoding DNA sequences may be directly
adjoined, so that when translated, a continuous peptide sequence is
created. However, to optimize expression and/or immunogenicity,
additional elements can be incorporated into the minigene design
such as spacer amino acid residues between epitopes. HLA
presentation of CTL and HTL epitopes may be improved by including
synthetic (e.g. poly-alanine) or naturally-occurring flanking
sequences adjacent to the CTL or HTL epitopes; these larger
peptides comprising the epitope(s) are within the scope of the
invention. In one embodiment, spacer amino acid residues between
one or more CTL and/or HTL epitopes are designed so as to minimize
junctional epitopes that may result from the juxtaposition of 2 CTL
and/or HTL epitopes.
[0259] The minigene sequence may be converted to DNA by assembling
oligonucleotides that encode the plus and minus strands of the
minigene. Overlapping oligonucleotides (30-100 bases long) may be
synthesized, phosphorylated, purified and annealed under
appropriate conditions using well known techniques. The ends of the
oligonucleotides can be joined, for example, using T4 DNA ligase.
This synthetic minigene, encoding the epitope peptide, can then be
cloned into a desired expression vector.
[0260] Standard regulatory sequences well known to those of skill
in the art are preferably included in the vector to ensure
expression in the target cells. Several vector elements are
desirable: a promoter with a downstream cloning site for minigene
insertion; a polyadenylation signal for efficient transcription
termination; an E. coli origin of replication; and an E. coli
selectable marker (e.g. ampicillin or kanamycin resistance).
Numerous promoters can be used for this purpose, e.g. the human
cytomegalovirus (hCMV) CMV-IE promoter. See, e.g., U.S. Pat. Nos.
5,580,859 and 5,589,466 for other suitable promoter sequences.
[0261] Optimized peptide expression and immunogenicity can be
achieved by certain modifications to a minigene construct. For
example, in some cases introns facilitate efficient gene
expression, thus one or more synthetic or naturally-occurring
introns can be incorporated into the transcribed region of the
minigene. The inclusion of mRNA stabilization sequences and
sequences for replication in mammalian cells may also be considered
for increasing minigene expression.
[0262] Once an expression vector is selected, the minigene is
cloned into the polylinker region downstream of the promoter. This
plasmid is transformed into an appropriate bacterial strain, and
DNA is prepared using standard techniques. The orientation and DNA
sequence of the minigene, as well as all other elements included in
the vector, are confirmed using restriction mapping, PCR and/or DNA
sequence analysis. Bacterial cells harboring the correct plasmid
can be stored as cell banks.
[0263] In addition, immunostimulatory sequences (ISSs or CpGs)
appear to play a role in the immunogenicity of DNA vaccines. These
sequences may be included in the vector, outside the minigene
coding sequence to enhance immunogenicity.
[0264] In some embodiments, a bi-cistronic expression vector which
allows production of both the minigene-encoded epitopes and a
second protein (e.g., one that modulates immunogenicity) can be
used. Examples of proteins or polypeptides that, if co-expressed
with epitopes, can enhance an immune response include cytokines
(e.g., IL-2, IL-12, GM-CSF), cytokine-inducing molecules (e.g.,
LeIF), costimulatory molecules, or pan-DR binding proteins
(PADRE.RTM., Epimmune, San Diego, Calif.). Helper T cell (HTL)
epitopes such as PADRE.RTM. molecules can be joined to
intracellular targeting signals and expressed separately from
expressed CTL epitopes. This can be done in order to direct HTL
epitopes to a cell compartment different than that of the CTL
epitopes, one that provides for more efficient entry of HTL
epitopes into the HLA class II pathway, thereby improving HTL
induction. In contrast to HTL or CTL induction, specifically
decreasing the immune response by co-expression of
immunosuppressive molecules (e.g. TGF-.beta.) may be beneficial in
certain diseases.
[0265] Therapeutic quantities of plasmid DNA can be produced for
example, by fermentation in E. coli, followed by purification.
Aliquots from the working cell bank are used to inoculate growth
medium, and are grown to saturation in shaker flasks or a
bioreactor according to well known techniques. Plasmid DNA is
purified using standard bioseparation technologies such as solid
phase anion-exchange resins available, e.g., from QIAGEN, Inc.
(Valencia, Calif.). If required, supercoiled DNA can be isolated
from the open circular and linear forms using gel electrophoresis
or other methods.
[0266] Purified plasmid DNA can be prepared for injection using a
variety of formulations. The simplest of these is reconstitution of
lyophilized DNA in sterile phosphate-buffer saline (PBS). This
approach, known as "naked DNA," is currently being used for
intramuscular (IM) administration in clinical trials. To maximize
the immunotherapeutic effects of minigene vaccines, alternative
methods of formulating purified plasmid DNA may be used. A variety
of such methods have been described, and new techniques may become
available. Cationic lipids, glycolipids, and fusogenic liposomes
can also be used in the formulation (see, e.g., WO 93/24640;
Mannino & Gould-Fogerite, BioTechniques 6(7): 682 (1988); U.S.
Pat. No. 5,279,833; WO 91/06309; and Felgner, et al., Proc. Nat'l
Acad. Sci. USA 84:7413 (1987). In addition, peptides and compounds
referred to collectively as protective, interactive, non-condensing
compounds (PINC) can also be complexed to purified plasmid DNA to
influence variables such as stability, intramuscular dispersion, or
trafficking to specific organs or cell types.
[0267] Known methods in the art can be used to enhance delivery and
uptake of a polynucleotide in vivo. For example, the polynucleotide
can be complexed to polyvinylpyrrolidone (PVP), to prolong the
localized bioavailability of the polynucleotide, thereby enhancing
uptake of the polynucleotide by the organism (see e.g., U.S. Pat.
No. 6,040,295; EP 0 465 529; WO 98/17814). PVP is a polyamide that
is known to form complexes with a wide variety of substances, and
is chemically and physiologically inert.
[0268] Target cell sensitization can be used as a functional assay
of the expression and HLA class I presentation of minigene-encoded
epitopes. For example, the plasmid DNA is introduced into a
mammalian cell line that is a suitable target for standard CTL
chromium release assays. The transfection method used will be
dependent on the final formulation, electroporation can be used for
"naked" DNA, whereas cationic lipids or DNA:PVP compositions allow
direct in vitro transfection. A plasmid expressing green
fluorescent protein (GFP) can be co-transfected to allow enrichment
of transfected cells using fluorescence activated cell sorting
(FACS). The transfected cells are then chromium-51 (.sup.51Cr)
labeled and used as targets for epitope-specific CTLs. Cytolysis of
the target cells, detected by .sup.51Cr release, indicates both the
production and HLA presentation of, minigene-encoded CTL epitopes.
Expression of HTL epitopes may be evaluated in an analogous manner
using assays to assess HTL activity.
[0269] In vivo immunogenicity is a second approach for functional
testing of minigene DNA formulations. Transgenic mice expressing
appropriate human HLA proteins are immunized with the DNA product.
The dose and route of administration are formulation dependent
(e.g., IM for DNA in PBS, intraperitoneal (IP) for lipid-complexed
DNA). Eleven to twenty-one days after immunization, splenocytes are
harvested and restimulated for one week in the presence of peptides
encoding each epitope being tested. Thereafter, for CTLs, standard
assays are conducted to determine if there is cytolysis of
peptide-loaded, .sup.51Cr-labeled target cells. Once again, lysis
of target cells that were exposed to epitopes corresponding to
those in the minigene, demonstrates DNA vaccine function and
induction of CTLs. Immunogenicity of HTL epitopes is evaluated in
transgenic mice in an analogous manner.
[0270] Alternatively, the nucleic acids can be administered using
ballistic delivery as described, for instance, in U.S. Pat. No.
5,204,253. Using this technique, particles comprised solely of DNA
are administered. In a further alternative embodiment for ballistic
delivery, DNA can be adhered to particles, such as gold
particles.
[0271] Vaccine Compositions
[0272] Vaccines that contain an immunologically effective amount of
one or more peptides or polynucleotides of the invention are a
further embodiment of the invention. The peptides can be delivered
by various means or formulations, all collectively referred to as
"vaccine" compositions. Such vaccine compositions, and/or modes of
administration, can include, for example, naked DNA, DNA formulated
with PVP, DNA in cationic lipid formulations; lipopeptides (e.g.,
Vitiello, A. et al., J. Clin. Invest. 95:341, 1995), DNA or
peptides, encapsulated e.g., in poly(DL-lactide-co-glycolide)
("PLG") microspheres (see, e.g., Eldridge, et al., Molec. Immunol.
28:287-294, 1991: Alonso et al., Vaccine 12:299-306, 1994; Jones et
al., Vaccine 13:675-681, 1995); peptide compositions contained in
immune stimulating complexes (ISCOMS) (see, e.g., Takahashi et al.,
Nature 344:873-875, 1990; Hu et al., Clin Exp Immunol. 113:235-243,
1998); multiple antigen peptide systems (MAPs) (see e.g., Tam, J.
P., Proc. Natl. Acad. Sci. U.S.A. 85:5409-5413, 1988; Tam, J. P.,
J. Immunol. Methods 196:17-32, 1996); viral, bacterial, or, fungal
delivery vectors (Perkus, M. E. et al., In: Concepts in vaccine
development, Kaufmann, S. H. E., ed., p. 379, 1996; Chakrabarti, S.
et al., Nature 320:535, 1986; Hu, S. L. et al., Nature 320:537,
1986; Kieny, M.-P. et al., AIDS Bio/Technology 4:790, 1986; Top, F.
H. et al., J. Infect. Dis. 124:148, 1971; Chanda, P. K. et al.,
Virology 175:535, 1990); particles of viral or synthetic origin
(e.g. Kofler, N. et al., J. Immunol. Methods. 192:25, 1996;
Eldridge, J. H. et al., Sem. Hematol. 30:16, 1993; Falo, L. D., Jr.
et al., Nature Med. 7:649, 1995); adjuvants (e.g., incomplete
freund's adjuvant) (Warren, H. S., Vogel, F. R., and Chedid, L. A.
Annu. Rev. Immunol. 4:369, 1986; Gupta, R. K. et al., Vaccine
11:293, 1993); liposomes (Reddy, R. et al., J. Immunol. 148:1585,
1992; Rock, K. L., Immunol. Today 17:131, 1996); or,
particle-absorbed DNA (Ulmer, J. B. et al., Science 259:1745, 1993;
Robinson, H. L., Hunt, L. A., and Webster, R. G., Vaccine 11:957,
1993; Shiver, J. W. et al., In: Concepts in vaccine development,
Kaufmann, S. H. E., ed., p. 423, 1996; Cease, K. B., and Berzofsky,
J. A., Annu. Rev. Immunol. 12:923, 1994 and Eldridge, J. H. et al.,
Sem. Hematol. 30:16, 1993), etc. Toxin-targeted delivery
technologies, also known as receptor mediated targeting, such as
those of Avant Immunotherapeutics, Inc. (Needham, Mass.) or
attached to a stress protein, e.g. HSP 96 (Stressgen
Biotechnologies Corp., Victoria, BC, Canada) can also be used.
[0273] Vaccines of the invention comprise nucleic acid mediated
modalities. DNA or RNA encoding one or more of the peptides of the
invention can be administered to a patient. This approach is
described, for instance, in Wolff et. al., Science 247:1465 (1990)
as well as U.S. Pat. Nos. 5,580,859; 5,589,466; 5,804,566;
5,739,118; 5,736,524; 5,679,647; and, WO 98/04720. Examples of
DNA-based delivery technologies include "naked DNA", facilitated
((i.e., non-"naked DNA") e.g., facilitated by combination with
bupivicaine, polymers (e.g., PVP), peptide-mediated) delivery,
cationic lipid complexes, and particle-mediated ("gene gun") or
pressure-mediated delivery (see, e.g., U.S. Pat. No. 5,922,687).
Accordingly, peptide vaccines of the invention can be expressed by
viral or bacterial vectors. Examples of expression vectors include
attenuated viral hosts, such as vaccinia or fowlpox. For example,
vaccinia virus is used as a vector to express nucleotide sequences
that encode the peptides of the invention (e.g., MVA). Upon
introduction into an acutely or chronically infected host or into a
non-infected host, the recombinant vaccinia virus expresses the
immunogenic peptide, and thereby elicits an immune response.
Vaccinia vectors and methods useful in immunization protocols are
described in, e.g., U.S. Pat. No. 4,722,848. Another vector is BCG
(Bacille Calmette Guerin). BCG vectors are described in Stover et
al., Nature 351:456-460 (1991). A wide variety of other vectors
useful for therapeutic administration or immunization of the
peptides of the invention, e.g. adeno and adeno-associated virus
vectors, alpha virus vectors, retroviral vectors, Salmonella typhi
vectors, detoxified anthrax toxin vectors, and the like, are
apparent to those skilled in the art from the description
herein.
[0274] Furthermore, vaccines in accordance with the invention can
comprise one or more peptides of the invention. Accordingly, a
peptide can be present in a vaccine individually; alternatively,
the peptide can exist as a homopolymer comprising multiple copies
of the same peptide, or as a heteropolymer of various peptides.
Polymers have the advantage of increased probability for
immunological reaction and, where different peptide epitopes are
used to make up the polymer, the ability to induce antibodies
and/or T cells that react with different antigenic determinants of
the antigen targeted for an immune response. The composition may be
a naturally occurring region of an antigen or can be prepared,
e.g., recombinantly or by chemical synthesis.
[0275] Carriers that can be used with vaccines of the invention are
well known in the art, and include, e.g., thyroglobulin, albumins
such as human serum albumin, tetanus toxoid, polyamino acid
residues such as poly L-lysine, poly L-glutamic acid, influenza
virus proteins, hepatitis B virus core protein, and the like. The
vaccines can contain a physiologically tolerable diluent such as
water, or a saline solution, preferably phosphate buffered saline.
Generally, the vaccines also include an adjuvant. Adjuvants such as
incomplete Freund's adjuvant, aluminum phosphate, aluminum
hydroxide, or alum are examples of materials well known in the art.
Additionally, as disclosed herein, CTL responses can be primed by
conjugating peptides of the invention to lipids, such as
tripalmitoyl-S-glyceryl-cysteinyl-seryl-serine (P.sub.3CSS).
[0276] Upon immunization with a peptide composition in accordance
with the invention, via injection (e.g., SC, ID, M), aerosol, oral,
transdermal, transmucosal, intrapleural, intrathecal, or other
suitable routes, the immune system of the host responds to the
vaccine by producing antibodies, CTLs and/or HTLs specific for the
desired antigen. Consequently, the host becomes at least partially
immune to subsequent exposure to the TAA, or at least partially
resistant to further development of TAA-bearing cells and thereby
derives a prophylactic or therapeutic benefit.
[0277] In certain embodiments, components that induce T cell
responses are combined with components that induce antibody
responses to the target antigen of interest. A preferred embodiment
of such a composition comprises class I and class II epitopes in
accordance with the invention. Alternatively, a composition
comprises a class I and/or class II epitope in accordance with the
invention, along with a PADRE.RTM. molecule (Epimmune, San Diego,
Calif.).
[0278] Vaccines of the invention can comprise antigen presenting
cells, such as dendritic cells, as a vehicle to present peptides of
the invention. For example, dendritic cells are transfected, e.g.,
with a minigene construct in accordance with the invention, in
order to elicit immune responses. Minigenes are discussed in
greater detail in a following section. Vaccine compositions can be
created in vitro, following dendritic cell mobilization and
harvesting, whereby loading of dendritic cells occurs in vitro.
[0279] The vaccine compositions of the invention may also be used
in combination with antiviral drugs such as interferon-.alpha., or
immune adjuvants such as IL-12, GM-CSF, etc.
[0280] Preferably, the following principles are utilized when
selecting epitope(s) and/or analogs for inclusion in a vaccine,
either peptide-based or nucleic acid-based formulations. Exemplary
epitopes and analogs that may be utilized in a vaccine to treat or
prevent TAA-associated disease are set out in Table 3. Each of the
following principles can be balanced in order to make the
selection. When multiple epitopes are to be used in a vaccine, the
epitopes may be, but need not be, contiguous in sequence in the
native antigen from which the epitopes are derived. Such multiple
epitopes can refer to the order of epitopes within a peptide, or to
the selection of epitopes that come from the same region, for use
in either individual peptides or in a multi-epitopic peptide.
[0281] 1.) Epitopes and/or analogs are selected which, upon
administration, mimic immune responses that have been observed to
be correlated with prevention or clearance of TAA-expressing
tumors. For HLA Class I, this generally includes 3-4 epitopes
and/or analogs from at least one TAA.
[0282] 2.) Epitopes and/or analogs are selected that have the
requisite binding affinity established to be correlated with
immunogenicity: for HLA Class I an IC.sub.50 of 500 nM or less, or
for Class II an IC.sub.50 of 1000 nM or less. For HLA Class I it is
presently preferred to select a peptide having an IC.sub.50 of 200
nM or less, as this is believed to better correlate not only to
induction of an immune response, but to in vitro tumor cell killing
as well. For HLA A1 and A24, it is especially preferred to select a
peptide having an IC.sub.50 of 100 nM or less.
[0283] 3.) Supermotif bearing-epitopes and/or analogs, or a
sufficient array of allele-specific motif-bearing epitopes and/or
analogs, are selected to give broad population coverage. In
general, it is preferable to have at least 80% population coverage.
A Monte Carlo analysis, a statistical evaluation known in the art,
can be employed to assess the breadth of population coverage.
[0284] 4.) For cancer-related antigens, it can be preferable to
select analogs instead of or in addition to epitopes, because the
patient may have developed tolerance to the native epitope.
[0285] 5.) Of particular relevance are "nested epitopes." Nested
epitopes occur where at least two epitopes overlap in a given
peptide sequence. For example, a nested epitope can be a fragment
of an antigen from a region that contains multiple epitopes that
are overleaping, or one epitope that is completely encompassed by
another, e.g., A2 peptides MAGE3.159 and MAGE3.160 are nested. A
peptide comprising "transcendent nested epitopes" is a peptide that
has both HLA class I and HLA class II epitopes in it. When
providing nested epitopes, it is preferable to provide a sequence
that has the greatest number of epitopes per provided sequence.
Preferably, one avoids providing a peptide that is any longer than
the amino terminus of the amino terminal epitope and the carboxyl
terminus of the carboxyl terminal epitope in the peptide. When
providing a sequence comprising nested epitopes, it is important to
evaluate the sequence in order to insure that it does not have
pathological or other deleterious biological properties; this is
particularly relevant for vaccines directed to infectious
organisms.
[0286] 6.) If a protein with multiple epitopes or a polynucleotide
(e.g., minigene) is created, an objective is to generate the
smallest peptide that encompasses the epitopes of interest. This
principle is similar, if not the same as that employed when
selecting a peptide comprising nested epitopes. However, with an
artificial peptide comprising multiple epitopes, the size
minimization objective is balanced against the need to integrate
any spacer sequences between epitopes in the polyepitopic protein.
Spacer amino acid residues can be introduced to avoid junctional
epitopes (an epitope recognized by the immune system, not present
in the target antigen, and only created by the man-made
juxtaposition of epitopes), or to facilitate cleavage between
epitopes and thereby enhance epitope presentation. Junctional
epitopes are generally to be avoided because the recipient may
generate an immune response to that non-native epitope. Of
particular concern is a junctional epitope that is a "dominant
epitope." A dominant epitope may lead to such a zealous response
that immune responses to other epitopes are diminished or
suppressed.
[0287] The principles are the same, except junctional epitopes
applies to the sequences surrounding the epitope. One must also
take care with other sequences in construct to avoid immune
response.
[0288] T Cell Priming Materials
[0289] In some embodiments it may be desirable to include in the
pharmaceutical compositions of the invention at least one component
which primes cytotoxic T lymphocytes. Lipids have been identified
as agents capable of facilitating the priming in vitro-CTL response
against viral antigens. For example, palmitic acid residues can be
attached to the .epsilon.- and .alpha.-amino groups of a lysine
residue and then linked to an immunogenic peptide. One or more
linking moieties can be used such as Gly, Gly-Gly-, Ser, Ser-Ser,
or the like. The lipidated peptide can then be administered
directly in a micelle or particle, incorporated into a liposome, or
emulsified in an adjuvant, e.g., incomplete Freund's adjuvant. A
preferred immunogenic composition comprises palmitic acid attached
to .epsilon.- and .alpha.-amino groups of Lys via a linking moiety,
e.g., Ser-Ser, added to the amino terminus of an immunogenic
peptide.
[0290] In another embodiment of lipid-facilitated priming of CTL
responses, E. coli lipoproteins, such as
tripalmitoyl-5-glyceryl-cysteinyl-seryl-serine (P.sub.3CSS) can be
used to prime CTL when covalently attached to an appropriate
peptide. (See, e.g., Deres, et al., Nature 342:561, 1989). Thus,
peptides of the invention can be coupled to P.sub.3CSS, and the
lipopeptide administered to an individual to specifically prime a
CTL response to the target antigen. Moreover, because the induction
of neutralizing antibodies can also be primed with
P.sub.3CSS-conjugated epitopes, two such compositions can be
combined to elicit both humoral and cell-mediated responses.
Dendritic Cells Pulsed with CTL and/or HTL Peptides
[0291] An embodiment of a vaccine composition in accordance with
the invention comprises ex vivo administration of a cocktail of
epitope-bearing peptides to PBMC, or isolated DC therefrom, from
the patient's blood. A pharmaceutical to facilitate harvesting of
DC can be used, such as Progenipoietin.TM. (Monsanto, St. Louis,
Mo.) or GM-CSF/IL-4. After pulsing the DC with peptides and prior
to reinfusion into patients, the DC are washed to remove unbound
peptides. In this embodiment, a vaccine comprises peptide-pulsed
DCs which present the pulsed peptide epitopes in HLA molecules on
their surfaces.
[0292] The DC can be pulsed ex vivo with a cocktail of peptides,
some of which stimulate CTL responses to one or more antigens of
interest, e.g., tumor associated antigens (TAA) such as HER2/neu,
p53, MAGE 2, MAGE3, and/or carcinoembryonic antigen (CEA).
Collectively, these TAA are associated with breast, colon and lung
cancers. Optionally, a helper T cell (HTL) peptide such as
PADRE.RTM., can be included to facilitate the CTL response. Thus, a
vaccine in accordance with the invention comprising epitopes from
HER2/neu, p53, MAGE 2, MAGE3, and carcinoembryonic antigen (CEA) is
used to treat minimal or residual disease in patients with
malignancies such as breast, colon, lung or ovarian cancer; any
malignancies that bear any of these TAAs can also be treated with
the vaccine. A TAA vaccine can be used following debulking
procedures such as surgery, radiation therapy or chemotherapy,
whereupon the vaccine provides the benefit of increasing disease
free survival and overall survival in the recipients.
[0293] Thus, in preferred embodiments, a vaccine of the invention
is a product that treats a majority of patients across a number of
different tumor types. A vaccine comprising a plurality of
epitopes, preferably supermotif-bearing epitopes, offers such an
advantage.
[0294] Diagnostic and Prognostic Uses
[0295] In one embodiment of the invention, HLA class I and class II
binding peptides can be used as reagents to evaluate an immune
response. Preferably, the following principles are utilized when
selecting an epitope(s) and/or analog(s) for diagnostic, prognostic
and similar uses. Potential principles include having the binding
affinities described earlier, and/or matching the
HLA-motif/supermotif of a peptide with the HLA-type of a
patient.
[0296] The evaluated immune response can be induced by any
immunogen. For example, the immunogen may result in the production
of antigen-specific CTLs or HTLs that recognize the peptide
epitope(s) employed as the reagent. Thus, a peptide of the
invention may or may not be used as the immunogen. Assay systems
that can be used for such analyses include tetramer-based protocols
(e.g., DimerX technology (see, e.g., Science 274:94-99 (1996) and
Proc. Natl. Acad. Sci. 95:7568-73 (1998)), staining for
intracellular lymphokines, interferon release assays, or ELISPOT
assays.
[0297] For example, following exposure to a putative immunogen, a
peptide of the invention can be used in a tetramer staining assay
to assess peripheral blood mononuclear cells for the presence of
any antigen-specific CTLs. The HLA-tetrameric complex is used to
directly visualize antigen-specific CTLs and thereby determine the
frequency of such antigen-specific CTLs in a sample of peripheral
blood mononuclear cells (see, e.g., Ogg et al., Science
279:2103-2106, 1998; and Altman et al., Science 174:94-96,
1996).
[0298] A tetramer reagent comprising a peptide of the invention is
generated as follows: A peptide that binds to an HLA molecule is
refolded in the presence of the corresponding HLA heavy chain and
.beta..sub.2-microglobulin to generate a trimolecular complex. The
complex is biotinylated at the carboxyl terminal end of the HLA
heavy chain, at a site that was previously engineered into the
protein. Tetramer formation is then induced by adding streptavidin.
When fluorescently labeled streptavidin is used, the tetrameric
complex is used to stain antigen-specific cells. The labeled cells
are then readily identified, e.g., by flow cytometry. Such
procedures are used for diagnostic or prognostic purposes; the
cells identified by the procedure can be used for therapeutic
purposes.
[0299] Peptides of the invention are also used as reagents to
evaluate immune recall responses. (see, e.g., Bertoni et al., J.
Clin. Invest. 100:503-513, 1997 and Penna et al., J. Exp. Med.
174:1565-1570, 1991.) For example, a PBMC sample from an individual
expressing a disease-associated antigen (e.g. a tumor-associated
antigen such as CEA, p53, MAGE2/3, HER2neu, or an organism
associated with neoplasia such as HPV or HSV) can be analyzed for
the presence of antigen-specific CTLs or HTLs using specific
peptides. A blood sample containing mononuclear cells may be
evaluated by cultivating the PBMCs and stimulating the cells with a
peptide of the invention. After an appropriate cultivation period,
the expanded cell population may be analyzed, for example, for CTL
or for HTL activity.
[0300] Thus, the peptides can be used to evaluate the efficacy of a
vaccine. PBMCs obtained from a patient vaccinated with an immunogen
may be analyzed by methods such as those described herein. The
patient is HLA typed, and peptide epitopes that are bound by the
HLA molecule(s) present in that patient are selected for analysis.
The immunogenicity of the vaccine is indicated by the presence of
CTLs and/or HTLs directed to epitopes present in the vaccine.
[0301] The peptides of the invention may also be used to make
antibodies, using techniques well known in the art (see, e.g.
CURRENT PROTOCOLS IN IMMUNOLOGY, Wiley/Greene, NY; and Antibodies A
Laboratory Manual Harlow, Harlow and Lane, Cold Spring Harbor
Laboratory Press, 1989). Such antibodies are useful as reagents to
determine the presence of disease-associated antigens. Antibodies
in this category include those that recognize a peptide when bound
by an HLA molecule, i.e., antibodies that bind to a peptide-MHC
complex.
[0302] Administration for Therapeutic or Prophylactic Purposes
[0303] The peptides and polynucleotides of the present invention,
including compositions thereof, are useful for administration to
mammals, particularly humans, to treat and/or prevent disease. In
one embodiment, peptides, polynucleotides, or vaccine compositions
(peptide or nucleic acid) of the invention are administered to a
patient who has a malignancy associated with expression of one or
more TAAs, or to an individual susceptible to, or otherwise at risk
for developing TAA-related disease. Upon administration an immune
response is elicited against the TAAs, thereby enhancing the
patient's own immune response capabilities. In therapeutic
applications, peptide and/or nucleic acid compositions are
administered to a patient in an amount sufficient to elicit an
effective immune response to the TAA-expressing cells and to
thereby cure, arrest or slow symptoms and/or complications. An
amount adequate to accomplish this is defined as "therapeutically
effective dose." Amounts effective for this use will depend on,
e.g., the particular composition administered, the manner of
administration, the stage and severity of the disease being
treated, the weight and general state of health of the patient, and
the judgment of the prescribing physician.
[0304] In certain embodiments, a method of treating cancer is
provided. In some cases, the treatment of cancer may include the
treatment of solid tumors or the treatment of metastasis.
Metastasis is the form of cancer wherein the transformed or
malignant cells are traveling and spreading the cancer from one
site to another. The cancer can be of the colon, non-small cell
lung cancer ("NSCLC"), the breast, the ovary, the kidney, the
rectum, head and neck (including but not limited to the nasal and
oral cavities), the prostate, the pancreas, small cell lung cancer,
the uterus, the bladder, the thyroid, the skin (including, but not
limited to, malignant melanoma, basal cell carcinoma, squamous cell
carcinoma, Karposi's sarcoma, moles dysplastic nevi, lipoma,
angioma, dermatofibroma, keloids, psoriasis, and metastatic
melanoma), breast, brain, cervical carcinomas, testicular
carcinomas, etc. More particularly, cancers may include, but are
not limited to the following organs or systems: cardiac, lung,
gastrointestinal, genitourinary tract, liver, bone, nervous system,
gynecological, hematologic, skin, and adrenal glands. More
particularly, the methods herein can be used for treating gliomas
(Schwannoma, glioblastoma, astrocytoma), neuroblastoma,
pheochromocytoma, paraganlioma, meningioma, adrenalcortical
carcinoma, kidney cancer, vascular cancer of various types,
osteoblastic osteocarcinoma, prostate cancer, ovarian cancer,
uterine leiomyomas, salivary gland cancer, choroid plexus
carcinoma, mammary cancer, pancreatic cancer, colon cancer, and
megakaryoblastic leukemia.
[0305] In preferred embodiments, the cancer to be treated by the
present invention is colorectal cancer, non-small cell lung cancer
("NSCLC"), breast cancer, ovarian cancer, renal cancer, prostate
cancer, cervical cancer, head and/or neck cancer, endometrial
cancer, pancreatic cancer, and/or esophageal cancer.
[0306] In preferred embodiments, the cancer to be treated by the
present invention is colorectal cancer, non-small cell lung cancer
("NSCLC"), breast cancer, and/or ovarian cancer. In certain other
preferred embodiments, the cancer is a cancer of the head and/or
neck. The term "cancerous cell" as provided herein, includes a cell
afflicted by any one of the cancerous conditions provided herein,
or any cancer.
[0307] In certain embodiments, the present invention may also be
used to treat diseases associated with increased cell survival, or
the inhibition of apoptosis, including cancers (such as follicular
lymphomas, carcinomas with p53 mutations, and hormone-dependent
tumors, including, but not limited to colon cancer, cardiac tumors,
pancreatic cancer, melanoma, retinoblastoma, glioblastoma, lung
cancer, intestinal cancer, testicular cancer, stomach cancer,
neuroblastoma, myxoma, myoma, lymphoma, endothelioma,
osteoblastoma, osteoclastoma, osteosarcoma, chondrosarcoma,
adenoma, breast cancer, prostate cancer, Kaposi's sarcoma and
ovarian cancer); autoimmune disorders (such as, multiple sclerosis,
Sjogren's syndrome, Hashimoto's thyroiditis, biliary cirrhosis,
Behcet's disease, Crohn's disease, polymyositis, systemic lupus
erythematosus and immune-related glomerulonephritis and rheumatoid
arthritis) and viral infections (such as herpes viruses, pox
viruses and adenoviruses), inflammation, graft v. host disease,
acute graft rejection, and chronic graft rejection.
[0308] In certain embodiments, the invention is used to treat
additional diseases or conditions associated with increased cell
survival including, but not limited to, progression, and/or
metastases of malignancies and related disorders such as leukemia
(including acute leukemias (e.g., acute lymphocytic leukemia, acute
myelocytic leukemia (including myeloblastic, promyelocytic,
myelomonocytic, monocytic, and erythroleukemia)) and chronic
leukemias (e.g., chronic myelocytic (granulocytic) leukemia and
chronic lymphocytic leukemia)), polycythemia vera, lymphomas (e.g.,
Hodgkin's disease and non-Hodgkin's disease), multiple myeloma,
Waldenstrom's macroglobulinemia, heavy chain disease, and solid
tumors including, but not limited to, sarcomas and carcinomas such
as fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma,
osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma,
lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma,
mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma,
colon carcinoma, pancreatic cancer, breast cancer, ovarian cancer,
prostate cancer, squamous cell carcinoma, basal cell carcinoma,
adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma,
papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma,
medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma,
hepatoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal
carcinoma, Wilm's tumor, cervical cancer, testicular tumor, lung
carcinoma, small cell lung carcinoma, bladder carcinoma, epithelial
carcinoma, glioma, astrocytoma, medulloblastoma, craniopharyngioma,
ependymoma, pinealoma, hemangioblastoma, acoustic neuroma,
oligodendroglioma, menangioma, melanoma, neuroblastoma, and
retinoblastoma.
[0309] The vaccine compositions of the invention can be used purely
as prophylactic agents. Generally the dosage for an initial
prophylactic immunization generally occurs in a unit dosage range
where the lower value is about 1, 5, 50, 500, or 1000 .mu.g of
peptide and the higher value is about 10,000; 20,000; 30,000; or
50,000 .mu.g of peptide. Dosage values for a human typically range
from about 500 .mu.g to about 50,000 .mu.g of peptide per 70
kilogram patient. This is followed by boosting dosages of between
about 1.0 .mu.g to about 50,000 .mu.g of peptide, administered at
defined intervals from about four weeks to six months after the
initial administration of vaccine. The immunogenicity of the
vaccine may be assessed by measuring the specific activity of CTL
and HTL obtained from a sample of the patient's blood.
[0310] As noted above, peptides comprising CTL and/or HTL epitopes
of the invention induce immune responses when presented by HLA
molecules and contacted with a CTL or HTL specific for an epitope
comprised by the peptide. The manner in which the peptide is
contacted with the CTL or HTL is not critical to the invention. For
instance, the peptide can be contacted with the CTL or HTL either
in vitro or in vivo. If the contacting occurs in vivo, peptide can
be administered directly, or in other forms/vehicles, e.g., DNA
vectors encoding one or more peptides, viral vectors encoding the
peptide(s), liposomes, antigen presenting cells such as dendritic
cells, and the like.
[0311] Accordingly, for pharmaceutical compositions of the
invention in the form of peptides or polypeptides, the peptides or
polypeptides can be administered directly. Alternatively, the
peptide/polypeptides can be administered indirectly presented on
APCs, or as DNA encoding them. Furthermore, the peptides or DNA
encoding them can be administered individually or as fusions of one
or more peptide sequences.
[0312] For therapeutic use, administration should generally begin
at the first diagnosis of TAA-related disease. This is followed by
boosting doses at least until symptoms are substantially abated and
for a period thereafter. In chronic disease states, loading doses
followed by boosting doses may be required.
[0313] The dosage for an initial therapeutic immunization generally
occurs in a unit dosage range where the lower value is about 1, 5,
50, 500, or 1,000 .mu.g of peptide and the higher value is about
10,000; 20,000; 30,000; or 50,000 .mu.g of peptide. Dosage values
for a human typically range from about 500 .mu.g to about 50,000
.mu.g of peptide per 70 kilogram patient. Boosting dosages of
between about 1.0 .mu.g to about 50,000 .mu.g of peptide,
administered pursuant to a boosting regimen over weeks to months,
can be administered depending upon the patient's response and
condition. Patient response can be determined by measuring the
specific activity of CTL and HTL obtained from the patient's
blood.
[0314] In certain embodiments, peptides and compositions of the
present invention are used in serious disease states. In such
cases, as a result of the minimal amounts of extraneous substances
and the relative nontoxic nature of the peptides, it is possible
and may be desirable to administer substantial excesses of these
peptide compositions relative to these stated dosage amounts.
[0315] For treatment of chronic disease, a representative dose is
in the range disclosed above, namely where the lower value is about
1, 5, 50, 500, or 1,000 .mu.g of peptide and the higher value is
about 10,000; 20,000; 30,000; or 50,000 .mu.g of peptide,
preferably from about 500 .mu.g to about 50,000 .mu.g of peptide
per 70 kilogram patient. Initial doses followed by boosting doses
at established intervals, e.g., from four weeks to six months, may
be required, possibly for a prolonged period of time to effectively
immunize an individual. In the case of chronic disease,
administration should continue until at least clinical symptoms or
laboratory tests indicate that the disease has been eliminated or
substantially abated, and for a follow-up period thereafter. The
dosages, routes of administration, and dose schedules are adjusted
in accordance with methodologies known in the art.
[0316] The pharmaceutical compositions for therapeutic treatment
are intended for parenteral, topical, oral, intrathecal, or local
administration. Preferably, the pharmaceutical compositions are
administered parentally, e.g. intravenously, subcutaneously,
intradermally, or intramuscularly.
[0317] Thus, in a preferred embodiment the invention provides
compositions for parenteral administration which comprise a
solution of the immunogenic peptides dissolved or suspended in an
acceptable carrier, preferably an aqueous carrier. A variety of
aqueous carriers may be used, e.g., water, buffered water, 0.8%
saline, 0.3% glycine, hyaluronic acid and the like. These
compositions may be sterilized by conventional, well known
sterilization techniques, or may be sterile filtered. The resulting
aqueous solutions may be packaged for use as is, or lyophilized,
the lyophilized preparation being combined with a sterile solution
prior to administration. The compositions may contain
pharmaceutically acceptable auxiliary substances or pharmaceutical
excipients as may be required to approximate physiological
conditions, such as pH-adjusting and buffering agents, tonicity
adjusting agents, wetting agents, preservatives, and the like, for
example, sodium acetate, sodium lactate, sodium chloride, potassium
chloride, calcium chloride, sorbitan monolaurate, triethanolamine
oleate, etc.
[0318] The concentration of peptides of the invention in the
pharmaceutical formulations can vary widely, i.e., from less than
about 0.1%, usually at or at least about 2% to as much as 20% to
50% or more by weight, and will be selected primarily by fluid
volumes, viscosities, etc., in accordance with the particular mode
of administration selected.
[0319] A human unit dose form of the peptide composition is
typically included in a pharmaceutical composition that also
comprises a human unit dose of an acceptable carrier, preferably an
aqueous carrier, and is administered in a volume of fluid that is
known by those of skill in the art to be used for administration of
such compositions to humans (see, e.g., Remington's Pharmaceutical
Sciences, 17.sup.th Edition, A. Gennaro, Editor, Mack Publishing
Co., Easton, Pa., 1985).
[0320] The peptides of the invention can also be administered via
liposomes, which serve to target the peptides to a particular
tissue, such as lymphoid tissue, or to target selectively to
infected cells, as well as to increase the half-life of the peptide
composition. Liposomes include emulsions, foams, micelles,
insoluble monolayers, liquid crystals, phospholipid dispersions,
lamellar layers and the like. In these preparations, the peptide to
be delivered is incorporated as part of a liposome, alone or in
conjunction with a molecule which binds to a receptor prevalent
among lymphoid cells (such as monoclonal antibodies which bind to
the CD45 antigen) or with other therapeutic or immunogenic
compositions. Thus, liposomes either filled or decorated with a
desired peptide of the invention can be directed to the site of
lymphoid cells, where the liposomes then deliver the peptide
compositions. Liposomes for use in accordance with the invention
are formed from standard vesicle-forming lipids, which generally
include neutral and negatively charged phospholipids and a sterol,
such as cholesterol. The selection of lipids is generally guided by
consideration of, e.g., liposome size, acid liability and stability
of the liposomes in the blood stream. A variety of methods are
available for preparing liposomes, as described in, e.g., Szoka, et
al., Ann. Rev. Biophys. Bioeng. 9:467 (1980), and U.S. Pat. Nos.
4,235,871, 4,501,728, 4,837,028, and 5,019,369.
[0321] For targeting compositions of the invention to cells of the
immune system, a ligand can be incorporated into the liposome,
e.g., antibodies or fragments thereof specific for cell surface
determinants of the desired immune system cells. A liposome
suspension containing a peptide may be administered intravenously,
locally, topically, etc. in a dose which varies according to, inter
alia, the manner of administration, the peptide being delivered,
and the stage of the disease being treated.
[0322] For solid compositions, conventional nontoxic solid carriers
may be used which include, for example, pharmaceutical grades of
mannitol, lactose, starch, magnesium stearate, sodium saccharin,
talcum, cellulose, glucose, sucrose, magnesium carbonate, and the
like. For oral administration, a pharmaceutically acceptable
nontoxic composition is formed by incorporating any of the normally
employed excipients, such as those carriers previously listed, and
generally 10-95% of active ingredient, that is, one or more
peptides of the invention, often at a concentration of 25%-75%.
[0323] For aerosol administration, the immunogenic peptides are
preferably supplied in finely divided form, along with a surfactant
and propellant. Typical percentages of peptides are 0.01%-20% by
weight, often 1%-10%. The surfactant must, of course, be
pharmaceutically acceptable, and preferably soluble in the
propellant. Representative of such agents are the esters or partial
esters of fatty acids containing from 6 to 22 carbon atoms, such as
caproic, octanoic, lauric, palmitic, stearic, linoleic, linolenic,
olesteric and oleic acids with an aliphatic polyhydric alcohol or
its cyclic anhydride. Mixed esters, such as mixed or natural
glycerides may be employed. The surfactant may constitute 0.1%-20%
by weight of the composition, preferably 0.25-5%. The balance of
the composition is ordinarily propellant, although an atomizer may
be used in which no propellant is necessary and other percentages
are adjusted accordingly. A carrier can also be included, e.g.
lecithin for intranasal delivery.
[0324] Antigenic peptides of the invention have been used to elicit
a CTL and/or HTL response ex vivo, as well. The resulting CTLs or
HTLs can be used to treat chronic infections, or tumors in patients
that do not respond to other conventional forms of therapy, or who
do not respond to a therapeutic peptide or nucleic acid vaccine in
accordance with the invention. Ex vivo CTL or HTL responses to a
particular antigen (infectious or tumor-associated) are induced by
incubating in tissue culture the patient's, or genetically
compatible, CTL or HTL precursor cells together with a source of
antigen-presenting cells (APC), such as dendritic cells, and the
appropriate immunogenic peptide. After an appropriate incubation
time (typically about 7-28 days), in which the precursor cells are
activated and expanded into effector cells, the cells are infused
back into the patient, where they will destroy (CTL) or facilitate
destruction (HTL) of their specific target cell (an infected cell
or a tumor cell).
[0325] Kits
[0326] The peptide and nucleic acid compositions of this invention
can be provided in kit form together with instructions for vaccine
administration. Typically the kit would include desired
composition(s) of the invention in a container, preferably in unit
dosage form and instructions for administration. For example, a kit
would include an APC, such as a dendritic cell, previously exposed
to and now presenting peptides of the invention in a container,
preferably in unit dosage form together with instructions for
administration. An alternative kit would include a minigene
construct with desired nucleic acids of the invention in a
container, preferably in unit dosage form together with
instructions for administration. Lymphokines such as IL-2 or IL-12
may also be included in the kit. Other kit components that may also
be desirable include, for example, a sterile syringe, booster
dosages, and other desired excipients.
[0327] The invention will be described in greater detail by way of
specific examples. The following examples are offered for
illustrative purposes, and are not intended to limit the invention
in any manner. Those of skill in the art will readily recognize a
variety of non-critical parameters that can be changed or modified
to yield alternative embodiments in accordance with the
invention.
EXAMPLES
Example 1
Selection of Tumor Associated Antigens
[0328] Because the A2 supertype is broadly expressed in the
population (39-49%), peptides which bind to this family of
molecules provide a reasonable basis for peptide-based vaccines.
While the A2 vaccine targets patients that express HLA-A2
molecules, the approach can be readily extended to include
peptide(s) that bind to additional alleles or supertype groups
thereof (see, e.g. U.S. Provisional Application No. 60/432,017,
filed 10 Dec. 2002; which is herein incorporated by reference in
its entirety).
[0329] Whole proteins often induce an immune response limited to
specific epitopes that may be ineffective in mediating effective
anti-tumor immune responses (Disis et al., J. Immunology
156:3151-3158 (1996); Manca et al., J. Immunology 146:1964-1971
(1991)). An epitope-based vaccine circumvents this limitation
through the identification of peptide epitopes embedded in TAAs.
Exemplary TAAs are set forth in Table 3.
[0330] Peptides were evaluated based upon MHC binding motifs, on
the capacity to bind MHC molecules, and the ability to activate
tumor-reactive CTL in vitro using lymphocyte cultures from normal
individuals. This approach has several advantages. First, it does
not require the isolation of patient-derived cells such as CTL or
tumor cells. Secondly, the identification of epitopes that
stimulate CTL in normal individuals permits the identification of a
broad range of epitopes, including subdominant as well as dominant
epitopes.
[0331] Four tumor-associated antigens, CEA, p53, MAGE 2/3 and
HER2/neu, are expressed in various tumor types Kawashima et al.,
Human Immunology 59:1-14 (1998); Tomlinson, et al., Advanced Drug
Delivery Reviews, Vol. 32(3) (6 Jul. 1998)). In a preferred
embodiment, a vaccine comprises epitopes (as one or more peptides
or as nucleic acids encoding them) from among these four, or any
other, TAAs. Accordingly, this vaccine induces CTL responses
against several major cancer types.
[0332] Carcinoembryonic antigen is a 180 kD mw cell surface and
secreted glycoprotein overexpressed on most human adenocarcinomas.
These include colon, rectal, pancreatic and gastric (Muraro, 1985)
as well as 50% of breast (Steward, 1974) and 70% of non-small cell
lung carcinomas (Vincent, 1978). This antigen is also expressed on
normal epithelium and in some fetal tissue (Thompson, 1991).
[0333] The HER2/neu antigen (185 kDa) is a transmembrane
glycoprotein with tyrosine kinase activity whose structure is
similar to the epidermal growth factor receptor (Coussens, 1985;
Bargmann, 1986; Yamamoto, 1986). Amplification of the HER2/neu gene
and/or overexpression of the associated protein have been reported
in many human adenocarcinomas of the breast (Slamon, 1987 and 1989;
Borg, 1990), ovary (Slamon, 1989), uterus (Berchuck, 1991; Lukes,
1994), prostate (Kuhn, 1993; Sadasivan, 1993), stomach (Yonemura,
1991; Kameda, 1990; Houldsworth, 1990), esophagus (Houldsworth,
1990), pancreas (Yamanaka, 1993), kidney (Weidner, 1990) and lung
(Kern, 1990; Rachwal, 1995).
[0334] The MAGE, melanoma antigen genes, are a family of related
proteins that were first described in 1991. Van der Bruggen and
co-workers were able to identify the MAGE gene after isolating CTLs
from a patient who demonstrated spontaneous tumor regression. These
CTLs recognized melanoma cell lines as well as tumor lines from
other patients all expressing the same HLA-A1 restricted gene (van
der Bruggen, 1991; De Plaen, 1994). The MAGE genes are expressed in
metastatic melanomas (Brasseur, 1995), non-small lung (Weynants,
1994), gastric (Inoue, 1995), hepatocellular (Chen, 1999), renal
(Yamanaka, 1998) colorectal (Mori, 1996), and esophageal (Quillien,
1997) carcinomas as wells as tumors of the head and neck (Lee,
1996), ovaries (Gillespie, 1998; Yamada, 1995), bladder (Chaux,
1998) and bone (Sudo, 1997). They are also expressed on normal
tissue, specifically placenta and male germ cells (De Plaen, 1994).
However, these normal cells do not express MHC Class I molecules
and therefore do not present MAGE peptides on their surface.
[0335] In this study and previous work to identify A2 superfamily
epitopes (Kawashima, 1998), MAGE-2 and MAGE-3 were considered a
single TAA, based on the expression patterns and predicted primary
amino acid sequences of the two genes. These two members of the
MAGE family appear to be coordinately regulated (Zakut, 1993),
resulting in a distribution in cancers that appears to be very
similar, if not identical. Therefore, immune responses directed at
either antigen should provide coverage for treatment of the cancers
expected to express these TAA. The MAGE-2 and MAGE-3 proteins are
84% identical at the primary amino acid level. As a result, some
epitopes are identical in the two antigens, while others are unique
to one or the other. It should be noted that two subtypes of
MAGE-2, designated "a" and b", have been reported (Zakut, 1993).
The gene referred to herein as MAGE-2 corresponds to the MAGE-2a
subtype (C. Dahlberg personal communication, NB 1056, p. 16; Van
der Bruggen, 1991; Zakut, 1993).
[0336] The fourth TAA selected for use in the vaccine is p53. In
normal cells the p53 gene induces a cell cycle arrest which allows
DNA to be checked for irregularities and maintains DNA integrity
(Kuerbitz, 1992). Mutations in the gene abolish its suppressor
function and allow escape of transformed cells from the restriction
of controlled growth. At the same time, these mutations lead to
overexpression of both wildtype and mutated p53 (Levine, 1991)
making it more likely that epitopes within the protein may be
recognized by the immune system. The most common mutations are at
positions 175, 248, 273 and 282 and have been observed in colon
(Rodrigues, 1990), lung (Fujino, 1995), prostate (Eastham, 1995),
bladder (Vet, 1995) and bone cancers (Abudu, 1999; Hung, 1997).
[0337] Table 5 below delineates the tumor antigen expression in
breast, colon and lung. By targeting four TAA, the likelihood of
the mutation of tumor cells (tumor escape) into cells which do not
express any of the tumor antigens is decreased. Preferably, the
inclusion of two or more epitopes from each TAA serves to increase
the likelihood that individuals of different ethnicity will respond
to the vaccine and provides broadened population coverage.
[0338] This rational approach to vaccine compositions can be
focused on a particular HLA allele, or extended to various HLA
molecules or supertypes to further extend population coverage.
[0339] Table 6 shows the incidence, 5-year survival rates, and the
estimated number of deaths per year for these tumors in the U.S.
for each type of cancer in Table 5. In terms of estimated new
cases, estimated deaths and 5 year survival rates each of these
tumor types has a large unmet need. Globally, the incidence of
these tumors is significantly greater.
Example 2
A PADRE.RTM. Molecule as a Helper Epitope for Enhancement of CTL
Induction
[0340] There is increasing evidence that HTL activity is critical
for the induction of long lasting CTL responses (Livingston et al.
J. Immunol. 162:3088-3095 (1999); Walter et al., New Engl. J. Med.
333:1038-1044 (1995); Hu et al., J. Exp. Med. 177:1681-1690
(1993)). Therefore, one or more peptides that bind to HLA class II
molecules and stimulate HTLs can be used in accordance with the
invention. Accordingly, a preferred embodiment of a vaccine
includes a molecule from the PADRE.RTM. family of universal T
helper cell epitopes (HTL) that target most DR molecules in a
manner designed to stimulate helper T cells. For instance, a
pan-DR-binding epitope peptide having the formula: aKXVAAZTLKAAa,
where "X" is either cyclohexylalanine, phenylalanine, or tyrosine;
"Z" is either tryptophan, tyrosine, histidine or asparagine; and
"a" is either D-alanine or L-alanine (SEQ ID NO:29), has been found
to bind to most HLA-DR alleles, and to stimulate the response of T
helper lymphocytes from most individuals, regardless of their HLA
type.
[0341] A particularly preferred PADRE.RTM. molecule is a synthetic
peptide, aKXVAAWTLKAAa (a=D-alanine, X=cyclohexylalanine),
containing non-natural amino acid residues, specifically engineered
to maximize both HLA-DR binding capacity and induction of T cell
immune responses.
[0342] Alternative preferred PADRE.RTM. molecules are the peptides,
aKFVAAWTLKAAa, aKYVAAWTLKAAa, aKFVAAYTLKAAa, aKXVAAYTLKAAa,
aKYVAAYTLKAAa, aKFVAAHTLKAAa, aKXVAAHTLKAAa, aKYVAAHTLKAAa,
aKFVAANTLKAAa, aKXVAANTLKAAa, aKYVAANTLKAAa, AKXVAAWTLKAAA (SEQ ID
NO:30), AKFVAAWTLKAAA (SEQ ID NO:31), AKYVAAWTLKAAA (SEQ ID NO:32),
AKFVAAYTLKAAA (SEQ ID NO:33), AKXVAAYTLKAAA (SEQ ID NO:34),
AKYVAAYTLKAAA (SEQ ID NO:35), AKFVAAHTLKAAA (SEQ ID NO:36),
AKXVAAHTLKAAA (SEQ ID NO:37), AKYVAAHTLKAAA (SEQ ID NO:38),
AKFVAANTLKAAA (SEQ ID NO:39), AKXVAANTLKAAA (SEQ ID NO:40),
AKYVAANTLKAAA (SEQ ID NO:41) (a=D-alanine,
X=cyclohexylalanine).
[0343] In a presently preferred embodiment, the PADRE.RTM. peptide
is amidated. For example, a particularly preferred amidated
embodiment of a PADRE.RTM. molecule is conventionally written
aKXVAAWTLKAAa-NH.sub.2.
[0344] Competitive inhibition assays with purified HLA-DR molecules
demonstrated that the PADRE.RTM. molecule aKXVAAWTLKAAa-NH.sub.2
binds with high or intermediate affinity (IC.sub.50.ltoreq.1,000
nM) to 15 out of 16 of the most prevalent HLA-DR molecules
((Kawashima et al., Human Immunology 59:1-14 (1998); Alexander et
al., Immunity 1:751-761 (1994)). A comparison of the DR binding
capacity of PADRE.RTM. and tetanus toxoid (TT) peptide 830-843, a
"universal" epitope has been published (Panina-Bordignon et al.,
Eur. J. Immunology 19:2237-2242 (1989)). The TT 830-843 peptide
bound to only seven of 16 DR molecules tested, while PADRE.RTM.
bound 15 of 16. At least 1 of the 15 DR molecules that bind
PADRE.RTM. is predicted to be present in >95% of all humans.
Therefore, this PADRE.RTM. molecule is anticipated to induce an HTL
response in virtually all patients, despite the extensive
polymorphism of HLA-DR molecules in the human population.
[0345] Early data from a phase I/II investigator-sponsored trial,
conducted at the University of Leiden (C. J. M. Melief), support
the principle that the PADRE.RTM. molecule aKXVAAWTLKAAa, possibly
the amidated aKXVAAWTLKAAa-NH.sub.2, is highly immunogenic in
humans (Ressing et al., J. Immunother. 23(2):255-66 (2000)). In
this trial, a PADRE.RTM. molecule was co-emulsified with various
human papilloma virus (HPV) derived CTL epitopes and was injected
into patients with recurrent or residual cervical carcinoma.
However, because of the late stage of carcinoma with the study
patients, it was expected that these patients were
immunocompromised. The patients' immunocompromised status was
demonstrated by their low frequency of influenza virus-specific
CTL, reduced levels of CD3 expression, and low incidence of
proliferative recall responses after in vitro stimulation with
conventional antigens. Thus, no efficacy was anticipated in the
University of Leiden trial, rather the goal of that trial was
essentially to evaluate safety. Safety was, in fact,
demonstrated.
[0346] Thus, the PADRE.RTM. peptide component(s) of the vaccine
bind with broad specificity to multiple allelic forms of HLA-DR
molecules. Moreover, PADRE.RTM. peptide component(s) bind with high
affinity (IC.sub.50.ltoreq.1000 nM), i.e., at a level of affinity
correlated with being immunogenic for HLA Class II restricted T
cells. The in vivo administration of PADRE.RTM. peptide(s)
stimulates the proliferation of HTL in normal humans as well as
patient populations.
[0347] One or more PADRE.RTM. peptide(s) may be included in a
composition, e.g., a vaccine, comprising one or more peptides,
either as an individual peptide(s), fused to one or more CTL
peptides (epitope and/or analog), or both.
Example 3
Functional Competence of ProGP-Derived DC
[0348] One embodiment of a vaccine in accordance with the invention
comprises epitope-bearing peptides of the invention delivered via
dendritic cells (DC). Accordingly, DC were evaluated in both in
vitro and in vivo immune function assays. These assays include the
stimulation of CTL hybridomas and CTL cell lines, and the in vivo
activation of CTL.
[0349] DC Purification
[0350] ProGP-mobilized DC were purified from peripheral blood (PB)
and spleens of ProGP-treated C57B1/6 mice to evaluate their ability
to present antigen and to elicit cellular immune responses.
Briefly, DC were purified from total WBC and spleen using a
positive selection strategy employing magnetic beads coated with a
CD11c specific antibody (Miltenyi Biotec, Auburn Calif.). For
comparison, ex vivo expanded DC were generated by culturing bone
marrow cells from untreated C57B1/6 mice with the standard cocktail
of GM-CSF and IL-4 (R&D Systems, Minneapolis, Minn.) for a
period of 7-8 days (Mayordomo et al., Nature Med. 1:1297-1302
(1995)). Recent studies have revealed that this ex vivo expanded DC
population contains effective antigen presenting cells, with the
capacity to stimulate anti-tumor immune responses (Celluzzi et al.,
J. Exp. Med. 83:283-287 (1996)).
[0351] The purities of ProGP-derived DC (100 .mu.g/day, 10 days,
SC) and GM-CSF/IL-4 ex vivo expanded DC were determined by flow
cytometry. DC populations were defined as cells expressing both
CD11c and MHC Class II molecules. Following purification of DC from
magnetic CD11c microbeads, the percentage of double positive
PB-derived DC, isolated from ProGP-treated mice, was enriched from
approximately 4% to a range from 48-57% (average
yield=4.5.times.10.sup.6 DC/animal). The percentage of purified
splenic DC isolated from ProGP treated mice was enriched from a
range of 12-17% to a range of 67-77%. The purity of GM-CSF/IL-4 ex
vivo expanded DC ranged from 31-41% (Wong et al., J. Immunother.,
21:32040 (1998)).
In Vitro Stimulation of CTL Hybridomas and CTL Cell Lines:
Presentation of Specific CTL Epitopes
[0352] The ability of ProGP generated DC to stimulate a CTL cell
line was demonstrated in vitro using a viral-derived epitope and a
corresponding epitope responsive CTL cell line. Transgenic mice
expressing human HLA-A2.1 were treated with ProGP. Splenic DC
isolated from these mice were pulsed with a peptide epitope derived
from hepatitis B virus (HBV Pol 455) and then incubated with a CTL
cell line that responds to the HBV Pol 455 epitope/HLA-A2.1 complex
by producing IFN.gamma.. The capacity of ProGP-derived splenic DC
to present the HBV Pol 455 epitope was greater than that of two
positive control populations: GM-CSF and IL-4 expanded DC cultures,
or purified splenic B cells (FIG. 3B). The left shift in the
response curve for ProGP-derived spleen cells versus the other
antigen presenting cells reveal that these ProGP-derived cells
require less epitope to stimulate maximal IFN.gamma. release by the
responder cell line.
Example 4
Peptide-Pulsed ProGP-Derived DC Promote In Vivo CTL Responses
[0353] The ability of ex vivo peptide-pulsed DC to stimulate CTL
responses in vivo was also evaluated using the HLA-A2.1 transgenic
mouse model. DC derived from ProGP-treated animals or control DC
derived from bone marrow cells after expansion with GM-CSF and IL-4
were pulsed ex vivo with the HBV Pol 455 CTL epitope, washed and
injected (IV) into such mice. At seven days post immunization,
spleens were removed and splenocytes containing DC and CTL were
restimulated twice in vitro in the presence of the HBV Pol 455
peptide. The CTL activity of three independent cultures of
restimulated spleen cell cultures was assessed by measuring the
ability of the CTL to lyse .sup.51Cr-labeled target cells pulsed
with or without peptide. Vigorous CTL responses were generated in
animals immunized with the epitope-pulsed ProGP derived DC as well
as epitope-pulsed GM-CSF/IL-4 DC (FIG. 4). In contrast, animals
that were immunized with mock-pulsed ProGP-generated DC (no
peptide) exhibited no evidence of CTL induction. These data confirm
that DC derived from ProGP treated mice can be pulsed ex vivo with
epitope and used to induce specific CTL responses in vivo. Thus,
these data support the principle that ProGP-derived DC promote CTL
responses in a model that manifests human MHC Class I
molecules.
[0354] In vivo pharmacology studies in mice have demonstrated no
apparent toxicity of reinfusion of pulsed autologous DC into
animals.
Example 5
Dendritic Cell Isolation, Pulsing, Testing and Administration
[0355] A presently preferred procedure for vaccination is set forth
herein. In brief, patients are treated with ProGP to expand and
mobilize DC into the circulation. On the day of peak DC
mobilization, determined in accordance with procedures known in the
art, patients undergo leukapheresis (approximately 15 L process,
possibly repeated once if required to collect sufficient
mononuclear cells). The mononuclear cell product is admixed with
peptides of the invention by injection through micropore filters
(this admixing protocol is not needed if sterile peptides are
used). After incubation and washing to remove residual unbound
peptides, the cell product vaccine embodiment is resuspended in
cryopreservative solution (final 10% DMSO) and, for those protocols
involving multiple vaccination boosts, divided into aliquots. The
pulsed mononuclear cell product(s) are frozen and stored according
to accepted procedures for hematopoietic stem cells.
[0356] Vaccination is performed by injection or intravenous
infusion of thawed cell product after the hematologic effects of
ProGP in the patient have dissipated (i.e., the hemogram has
returned to baseline). FIG. 5 provides a flow chart of ex vivo
pulsing of DC with peptides, washing of DC, DC testing, and
cryopreservation. A more detailed description of the process is
provided in the following Examples.
Example 6
[0357] Administration of ProGP and Collection of Mononuclear Cells
by Leukapheresis
[0358] Patients are treated with ProGP daily by subcutaneous
injection (dose and schedule determined in accordance with standard
medical procedures). On the evening before leukapheresis, patients
are assessed by an apheresis physician or nurse/technologist for
adequacy of intravenous access for large-bore apheresis catheters.
If peripheral venous access is deemed inadequate to maintain rapid
blood flow for apheresis, then central venous catheters (inguinal,
subclavian or internal jugular sites) can be inserted by
appropriate medical/surgical personnel. On the day of predicted
peak DC mobilization, leukapheresis (approximately 3 blood volumes
or 15 L) is performed, for example, on a Cobe Spectra or Fenwal
CS3000 (flow rate .gtoreq.35 mL/min) to obtain mononuclear cells.
The number of DC in the leukapheresis product is estimated by flow
cytometric counting of mononuclear cells possessing the
immunophenotypes lin-/HLA-DR+/CD11c+ and lin-/HLA-DR+/CD123+ in a 1
mL sample aseptically withdrawn from the apheresis product. The
numbers of granulocytes and lymphocytes in the leukapheresis
product are counted by automated cytometry (CBC/differential).
CBC/differential is performed immediately after the leukapheresis
procedure and every other day for ten days to monitor resolution of
the hematologic effects of the hematopoietin treatment and
apheresis.
Example 7
A Procedure for Dendritic Cell Pulsing
[0359] Plasma is removed from the leukapheresis product by
centrifugation and expression of supernatant. The cells from the
centrifugation pellet are resuspended in OptiMEM medium with 1%
Human Serum Albumin (HSA) at a cell density of 10.sup.7. DC/ml in
up to 100 ml.
[0360] The peptide(s) of the invention, preferably as individual
sterile A2 peptide formulations, are administered directly into the
DC culture bag through an injection port, using aseptic technique.
After mixing, e.g., by repeated squeezing and inversion, the cell
suspension is incubated for four hours at ambient temperature.
Cryopreservative solution is prepared by dissolving 50 mL
pharmaceutical grade dimethylsulfoxide (DMSO) in 200 mL
Plasmalyte.RTM.. After the pulsing period, the cell suspension is
washed by centrifugation and resuspension in an equal volume of
phosphate buffered saline solution. The washing procedure is
repeated a defined number of times, e.g., until studies validate
that peptides have been removed. Samples of one milliliter each are
removed for viability testing and microbiological testing. The
cells are then prepared for freezing by centrifugation and
resuspension in an equal volume of cryopreservative solution (final
10% DMSO). The cell suspension in cryopreservative is then divided
into six equal aliquots, transferred to 50 ml freezing bags
(Fenwal) and frozen at controlled rate of 1.degree. C./min for
storage in liquid nitrogen until needed for vaccination
procedure.
[0361] Assay to Evaluate the Pulsing Procedure
[0362] Antigen presenting cells, long-term stimulated T cells
corresponding to peptides of the invention, or T cell hybridomas,
are used to determine the optimal procedure for incubating the
peptide reagents of a vaccine with human cells. Pulsing studies are
done using one or more of the following cell sources: purified DC
from ProGP treated LA-A2.1 transgenic mice; human tumor cell lines
that express HLA-A2; peripheral blood mononuclear cells from normal
human volunteers; peripheral blood mononuclear cells from ProGP
treated patients; and/or DC obtained from normal human HLA-A2
volunteers following the ex vivo culture of their peripheral blood
mononuclear cells with GM-CSF and IL-4.
[0363] Evaluated conditions include, e.g.: [0364] Cellular
isolation procedure and cell number [0365] Concentration of vaccine
peptides [0366] Washing conditions to remove ancillary reagents
[0367] Post-pulsing manipulations (resuspension, freezing)
[0368] Accordingly, these studies demonstrate the ability of the
procedure to produce functional HLA-A2/peptide complexes on the
surface of the human cells. The validation of the pulsing procedure
is established using HLA-A2.1-specific T cell lines after which the
Phase I clinical trial occurs.
Example 8
Validation of Peptide Removal from The DC Product
[0369] Following pulsing with the peptide reagents, DC from the
patient are washed several times to remove excess peptides prior to
infusing the cells back into the patient. In this embodiment of a
vaccine of the invention, the washing procedure removes unbound
peptides. Accordingly, there is no, or negligible, systemic
exposure of the patient to the peptides. Alternative vaccines of
the invention involve direct administration of peptides of the
invention to a patient, administration of a multiepitopic
polypeptide comprising one or more peptides of the invention,
administration of the peptides in a form of nucleic acids which
encode them, e.g. by use of minigene constructs, or by viral
vectors.
[0370] Assay for Vaccine Peptides in the Dendritic Cell Wash
Buffer
[0371] After the DC are incubated with the peptides, the cells are
washed with multiple volumes of wash buffer. An aliquot of the last
wash is placed onto a nonpolar solid-phase extraction cartridge and
washed to reduce the salt content of the sample. Any peptides
contained in the buffer will be eluted from the extraction
cartridge and evaporated to dryness. The sample is then
reconstituted in High Performance Liquid Chromatography (HPLC)
mobile phase, injected onto a polymer based reverse-phase HPLC
column, and eluted using reverse-phase gradient elution
chromatography. Residual peptides are detected using a mass
spectrometer set-up to monitor the protonated molecular ions of
each peptide as they elute from the HPLC column. The peptides are
quantified by comparing the area response ratio of analyte and
internal standard to that obtained for standards in a calibration
curve.
Example 9
Validation of Trifluoroacetic Acid Removal from the DC Product
[0372] In a particular embodiment, peptide reagents may be
formulated using 0.1% trifluoroacetic acid (TFA). The washing
procedure developed to remove residual peptide also removes
residual TFA.
Example 10
Dendritic Cell Release Testing
Identity
[0373] The number of DC in the leukapheresis product is estimated
by flow cytometric counting of mononuclear cells possessing the
immunophenotypes lin.sup.-/HLA-DR.sup.+/CD11c.sup.+ and
lin.sup.-/HLA-DR.sup.+/CD123.sup.+ in a 1 ml sample aseptically
withdrawn from the apheresis product. Lin.sup.- cells excludes
monocytes, T-lymphocytes, B-lymphocytes, and granulocytes, by using
a cocktail of antibodies to lineage markers CD3, CD14, DC16, CD19,
CD20, CD56.
Cell Viability
[0374] Viability of mononuclear cells is assessed after pulsing and
washing, prior to suspension in cryopreservative, by trypan blue
dye exclusion. In general, if the cell product contains more than
50% trypan blue-positive cells, the product is not administered to
a patient.
Microbiological Testing
[0375] The cell suspension in cryopreservative is examined for
microbial contamination by gram stain and routine clinical
bacterial and fungal culture/sensitivity. If tests are positive for
bacterial or fungal contamination, implicit evidence of significant
contamination, the product is not infused. If, e.g. a gram stain is
negative, the product may be infused for the first vaccination
while awaiting results of culture/sensitivity. Antibiotic therapy
based on culture results is instituted at the discretion of the
treating physician if the patient shows appropriate signs of
infection that could be clinically attributable to the infused
contaminant.
Example 11
Patient Vaccination
[0376] In a preferred embodiment, an aliquot of frozen pulsed
dendritic cell product is removed from a liquid nitrogen freezer
and kept frozen in an insulated vessel containing liquid nitrogen
during transport to the infusion site. The product is thawed by
immersion with gentle agitation in a water bath at 37.degree. C.
Immediately on thawing, the cell suspension is infused through
intravenous line by gravity or by syringe pump. Alternatively, the
vaccine is administered by injection, e.g., subcutaneously,
intradermally, or intramuscularly. The patient's vital signs are
monitored before infusion/injection and at 5 minute intervals
during an infusion, then at 15 minute intervals for 1 hour after
infusion/injection.
[0377] Infusion protocols in accordance with knowledge in the art
are carried out for alternative vaccine embodiments of the
invention, such as direct peptide infusion or nucleic acid
administration.
Example 12
Identification of A2 Supermotif/Motif-Bearing Peptides
[0378] Nine CTL epitopes derived from well-characterized tumor
antigens (MAGE-2/3, HER-2/neu, p53, and CEA) were selected for the
current vaccine using a 3-step process: 1) computer motif analysis
of the primary protein sequence to identify motif-containing
peptides that will thus have a high likelihood of binding HLA-A2
supertype molecules; 2) direct measurement of MHC binding affinity
of the motif-containing peptides to A2 supertype alleles; and 3)
immunogenicity testing of high-affinity MHC-binding peptides for
CTL induction. In addition to identifying native-sequence epitopes,
modified epitope analogs were designed to provide enhanced
immunogenicity. Analogs were generated by substituting key amino
acid residues that enhance either MHC binding affinity or T Cell
Receptor (TCR) interaction.
[0379] The final vaccine product, EP-2101, is a pool of the nine
tumor-associated CTL epitopes (natural and analog sequences) and a
PADRE.RTM. universal epitope, administered to cancer patients as an
emulsion in Montanide.RTM. ISA 51 adjuvant. The vaccine is similar
to synthetic peptide vaccines (containing one or more peptides)
that have been tested by other investigators in cancer patients
where CTL induction, positive clinical responses, and vaccine
safety have been described (Cormier, J. N., et al., Cancer J Sci.
Am. 3:37-44 (1997); Salgaller, M. L., et al., Cancer Res.
56:4749-4757 (1996); Wang, F., et al., Clin. Cancer Res.
5:2756-2765 (1999); Muderspach, L., et al., Clin. Cancer Res.
6:3406-3416 (2000); Ressing, M. E., et al., J Immunother.
23:255-266 (2000)). All of the EP-2101 epitopes are immunogenic,
using peripheral blood mononuclear cells (PBMC) from HLA-A2.1
positive subjects and an in vitro primary induction assay, in
inducing CTLs that respond to the peptide and to tumor cell lines
that express the TAA and present the wild-type epitope (Keogh, E.,
et al., J Immunol. 167:787-796 (2001); Kawashima, I., et al., Hum.
Immunol. 59:1-14 (1998)). The epitopes were also shown to be
immunogenic when tested in an HLA-A2.1/K.sup.b transgenic mouse
model used to determine the immunogenicity of HLA-A2.1-restricted
human epitopes (Wentworth, P. A., et al., Eur. J Immunol. 26:97-101
(1996); Vitiello, A., et al., J Exp. Med. 173:1007-1015 (1991);
Lustgarten, J., et al., Hum. Immunol. 52:109-118 (1997)).
Native Epitope Sequences
[0380] A computer-based motif and algorithm search was performed on
the primary amino acid sequences of CEA, MAGE-213, HER-2/neu, and
p53 to predict peptides most likely to bind the MHC molecules of
the five alleles of the HLA-A2 supertype family (Tables 4D and 6)
(Sette, A. and J. Sidney, Immunogenetics 50:201-212 (1999)). Motif
and algorithm-positive peptides were then synthesized and tested
for binding to purified HLA-A2.1, the molecule most frequently
expressed in humans as well as other MHC molecules of the HLA-A2
supertype family.
[0381] In the final step of the epitope screening process, peptides
with high cross-reactive MHC binding to the HLA-A2 supertype family
receptors were tested for immunogenicity. The assay is an in vitro
primary CTL induction system where CD8.sup.+ PBMC from normal
subjects are stimulated in vitro, initially with peptide-loaded
dendritic cells (DCs) (adherent PBMC expanded in GM-CSF and IL-4),
followed by two weekly cycles of restimulation with peptide (Keogh,
E., et al., J Immunol. 167:787-796 (2001); Kawashima, I., et al.,
Hum. Immunol. 59:1-14 (1998)). Following expansion of naive
precursor cells, CTL activity is determined in the presence of
HLA-A2.1 positive target cells and wild-type peptide, using
cytotoxicity (.sup.51Cr-release assay) or interferon-gamma
(IFN-.gamma.) production (ELISA) as the read-out. Immunogenic
peptides that induced CTL were further tested for responses against
the naturally processed epitope expressed on tumor cell lines.
Epitopes that induced tumor-reactive CTL were considered as vaccine
candidates.
Fixed Anchor Analogs
[0382] To break tolerance and improve CTL induction against weakly
immunogenic epitopes, tumor-associated peptides with low MHC
binding activity were modified to enhance their binding by
substituting suboptimal MHC-interacting anchor residues with
optimal, motif-associated residues Kawashima, I., et al., Hum.
Immunol. 59:1-14 (1998); Parkhurst, M. R., et al., J Immunol.
157:2539-2548 (1996)). This strategy of "fixing" anchor residues
has been described for a number of tumor and infectious disease
epitopes and these analogs have demonstrated enhanced in vivo
immunogenicity compared to the wild-type epitope (Kawashima, I., et
al., Hum. Immunol. 59:1-14 (1998); Vierboom, M. P., et al., J
Immunother. 21:399-408 (1998)), a finding that is correlated with
increased MHC binding (Parkhurst, M. R., et al., J Immunol.
157:2539-2548 (1996)). The disease relevance of fixed-anchor
analogs has been demonstrated by their capacity to induce not only
stronger CTL responses, but also CTL that cross-react against the
native wild-type epitope expressed on tumor cells (Kawashima, I.,
et al., Hum. Immunol. 59:1-14 (1998); Vierboom, M. P., et al., J
Immunother. 21:399-408 (1998); Sarobe, P., et al., J Clin. Invest
102:1239-1248 (1998)). More importantly, significant tumor
regression has been observed in melanoma patients immunized with a
fixed-anchor epitope in conjunction with IL-2 therapy (Rosenberg,
S. A., et al., Nat. Med. 4:321-327 (1998)).
Heteroclitic Analogs
[0383] A second strategy was also used to generate analogs with
improved potency for CTL induction. Amino acid substitutions that
affect TCR contact residue(s) were introduced into known CTL
epitopes, since these analogs have been shown to induce stronger
responses than the wild-type epitope (Zaremba, S., et al., Cancer
Res. 57:4570-4577 (1997); Zugel, U., R. et al., J Immunol.
161:1705-1709 (1998); Rivoltini, L., P., et al., Cancer Res.
59:301-306 (1999); Slansky, J. E., et al., Immunity. 13:529-538
(2000)). The T cell response stimulated by heteroclitic analogs
compared to the wild-type epitope is manifested both as an increase
in the response magnitude as well as an enhancement in TCR avidity
(Zugel, U., R. et al., J Immunol. 161:1705-1709 (1998); Rivoltini,
L., P., et al., Cancer Res. 59:301-306 (1999); Slansky, J. E., et
al., Immunity. 13:529-538 (2000); Tangri, S., et al., J Exp. Med.
194:833-846 (2001)), with the latter thought to be a potential
mechanism for heteroclicity (Slansky, J. E., et al., Immunity.
13:529-538 (2000)).
[0384] Heteroclitic analogs are potentially important in cancer
vaccines not only for their ability to induce strong T cell
responses, but also for their ability to break T cell tolerance.
These properties have been demonstrated in animal as well as human
trials (Zugel, U., R. et al., J Immunol. 161:1705-1709 (1998);
Slansky, J. E., et al., Immunity. 13:529-538 (2000); Fong, L., et
al., Proc. Natl. Acad. Sci. U.S.A. 98:8809-8814 (2001)). In humans,
significant anti-tumor responses were recently reported in a trial
examining treatment of colon cancer and NSCLC patients with DCs
loaded with a heteroclitic analog of a CEA epitope, referred to as
CAP1-6D (designated herein as CEA.605D6, peptide 1350.01), that was
initially described by Zaremba et al. (Zaremba, S., et al., Cancer
Res. 57:4570-4577 (1997)). In this clinical study (Fong, L., et
al., Proc. Natl. Acad. Sci. U.S.A. 98:8809-8814 (2001)), five
clinical responders were observed out of 12 patients who received
the DC vaccine, and a correlation was observed between clinical
response and an increase in the percentage of analog-specific
CD8.sup.+ T cells following vaccination as detected by tetramer
staining. During our preclinical studies, heteroclitic analogs were
identified which led to the generation of six new analogs modified
from three known tumor epitopes, MAGE-3.112, MAGE-2.157, and
CEA.691 (Tangri, S., et al., J Exp. Med. 194:833-846 (2001)). All
of these analogs induce strong primary human CTL responses in vitro
that cross-react against the native epitope expressed by tumor
cells (Tangri, S., et al., J Exp. Med. 194:833-846 (2001)).
[0385] Using the epitope selection process described above, nine
epitopes were selected for the vaccine product. These epitopes,
shown in Tables 3 and 7, were chosen on the basis of demonstrating
1) broad tumor antigen coverage with a mix of CTL native sequence
epitopes, fixed-anchor analogs and heteroclitic analogs; 2) high
cross-reactive binding affinity for HLA-A2 supertype alleles; 3)
immunogenicity in the in vitro human primary CTL induction assay,
particularly in generating CTL that respond to wild-type,
epitope-expressing tumor cells; and, 4) wherever available,
published reports in the literature showing primary or
post-vaccination CTL responses in normal subjects or cancer
patients.
[0386] Pursuant to our clinical objective of inducing a broad
multi-epitope, multi-antigen response in cancer patients, two
epitopes are represented from each of three TAAs (HER-2/neu, p53,
and MAGE-2/3) and three epitopes from CEA, a more widely expressed
TAA on lung- and colon-associated tumors. The extent of
cross-reactive binding against multiple HLA-A2 supertype alleles
should enable the vaccine to cover a broad and non-ethnically
biased population among individuals expressing HLA-A2 supertype
alleles.
[0387] Four of the epitopes selected are fixed-anchor analogs that
were modified for improved MHC binding. One fixed-anchor analog was
derived from the well-characterized HER-2/neu.369 epitope, which
has been shown to induce strong recall and post-vaccination CTL
responses in cancer patients (Zaks, T. Z. and Rosenberg, S. A.,
Cancer Res. 58:4902-4908 (1998); Knutson, K. L., et al., J Clin.
Invest 107:477-484 (2001)). By increasing supertype binding through
substitution of both MHC anchor residues, the V2V9 analog of
HER-2/neu.369 is expected to demonstrate even broader
immunogenicity in HLA-A2 supertype individuals. The remaining
fixed-anchor analogs (CEA.24V9, p53.139L2B3, and p53.149M2) were
designed from epitopes identified in the selection process and they
have not been tested previously in the clinic. The p53.139L2B3
analog contains an additional .alpha.-aminoisobutyric acid
substitution at position 3 (a non-anchor position) to circumvent
potential stability issues with the cysteine residue found in the
wild-type epitope. As with the epitopes derived from wild-type
sequences, all of the fixed-anchor analogs induce CTL, that
cross-react with the wild-type epitope presented by tumor cell
lines (Table 7) (Keogh, E., et al., J Immunol. 167:787-796
(2001)).
[0388] Another class of analogs represented in the current vaccine
are those with heteroclitic activity resulting from substitution of
TCR contact residues (Zaremba, S., et al., Cancer Res. 57:4570-4577
(1997); Zugel, U., R. et al., J Immunol. 161:1705-1709 (1998);
Rivoltini, L., P., et al., Cancer Res. 59:301-306 (1999); Slansly,
J. E., et al., Immunity. 13:529-538 (2000)). Of the three
heteroclitic analogs included, two analogs (MAGE-3.112I5 and
CEA.691H5) induce strong CTL activity which exceeds that of the
wild-type peptide (Tangri, S., et al., J Exp. Med. 194:833-846
(2001)). The third heteroclitic analog, CEA.605D6 (CAP1-6D)
(Zaremba, S., et al., Cancer Res. 57:4570-4577 (1997)), is included
in the current vaccine to provide additional epitope breadth and
anti-tumor CTL induction, particularly in light of recent clinical
data reporting significant CTL and clinical responses in colon and
lung cancer patients vaccinated with DC loaded with this
heteroclitic CEA analog (Fong, L., et al., Proc. Natl. Acad. Sci.
U.S.A. 98:8809-8814 (2001)).
[0389] The immunogenicity of the vaccine epitopes has been
corroborated, particularly in human systems, by additional reports.
For example, the HER-2/neu.369 and p53.149 epitopes (wild-type
versions of analogs used in EP-2101), and HER-2/neu.689 have
induced specific CTL responses using PBMC obtained from healthy
donors through primary in vitro induction (zum Buschenfelde, C. M.,
et al., J Immunol. 165:4133-4140 (2000); Chikamatsu, K., et al.,
Clin. Cancer Res. 5:1281-1288 (1999)) as well as recall responses
using PBMC from cancer patients (Knutson, K. L., et al., J Clin.
Invest 107:477-484 (2001); Rongcun, Y., et al., J Immunol.
163:1037-1044 (1999)). In addition, the p53.139L2, p53.149M2,
HER-2/neu.369, and MAGE-2.157 epitopes were shown by others to
induce peptide and tumor cell-reactive CTL in vivo in HLA-A2.1
transgenic mice (Lustgarten, J., et al., Hum. Immunol. 52:109-118
(1997); Visseren, M. J., et al., Int J Cancer 73:125-130 (1997);
Petersen, T. R., et al., Scand. J Immunol. 53:357-364 (2001);
Theobald, M., et al., Proc. Natl. Acad. Sci. U.S.A. 92:11993-11997
(1995)).
[0390] The final epitope included in the vaccine is a universal
PADRE.RTM. epitope (Alexander, J., et al., Immunity. 1:751-761
(1994)). The PADRE.RTM. epitope was designed to bind in a
cross-reactive manner to the majority of the DR supertype alleles
(Alexander, J., et al., Immunity. 1:751-761 (1994)) such that
>90% of the general population is predicted to respond against
this epitope. In the current vaccine, the PADRE.RTM. epitope is
included to enhance CTL induction by the pool of CTL epitopes. A
number of published studies have demonstrated the ability of HTL
responses to augment and support the maintenance of CTL responses
in vivo (Knutson, K. L., et al., J Clin. Invest 107:477-484 (2001);
Kalams, S. A. and Walker, B. D., J Exp. Med. 188:2199-2204 (1998);
Weber, J. S. and Mule, J. J., J Clin. Invest 107:553-554 (2001);
Toes, R. E., et al., J Exp. Med. 189:753-756 (1999)). Indeed, the
PADRE.RTM. epitope (Muderspach, L., et al., Clin. Cancer Res.
6:3406-3416 (2000); Ressing, M. E., et al., J Immunother.
23:255-266 (2000); Weber, J. S., et al., J Immunother. 22:431-440
(1999)), as well as other HTL-inducing antigens and epitopes
(Vitiello, A., et al., J Clin. Invest 95:341-349 (1995); Dhodapkar,
M. V., et al., J Clin. Invest 104:173-180 (1999)), have been an
integral component of several clinical trial vaccines.
[0391] In summary, nine CTL epitopes representing a combination of
fixed anchor native sequences and heteroclitic analogs, and one
PADRE.RTM. universal HTL epitope, have been selected for inclusion
of EP-2101. This set of epitopes constitutes a unique combination
of vaccine constituents intended to provide broad antigen and
population coverage among HLA-A2 individuals. The CTL epitopes
selected for the current vaccine are capable of inducing CTL from
naive precursors in PBMC from normal subjects and in cancer
patients. This observation strongly suggests the absence of
complete tolerance against these tumor-associated epitopes and
supports their utility for inducing beneficial CTL responses in
cancer patients.
Example 13
Immunogenicity of the Vaccine Epitopes and Vaccine Product
[0392] As described above, during the epitope screening process to
identify vaccine candidates, individual epitopes from TAA were
tested for their capacity to induce CTL in vitro from human PBMC
obtained from HLA-A2.1 individuals. All of the epitopes selected
for the current vaccine were shown to generate CTL in vitro and the
CTL generated were capable of recognizing wild-type epitope
expressed on tumor cell lines (Keogh, E., et al., J Immunol.
167:787-796 (2001); Kawashima, I., et al., Hum. Immunol. 59:1-14
(1998); Zaremba, S., et al., Cancer Res. 57:4570-4577 (1997)).
These observations support the potential immunogenicity of the
vaccine epitopes when administered to humans and provide further
evidence for the existence of precursor CTL that can be primed with
tumor-associated epitopes in cancer patients. The results are
further supported by data generated from other laboratories
demonstrating recall or post-vaccination CTL responses against most
of the nine vaccine epitopes (including the wild-type versions of
analogs in the current vaccine) (Lustgarten, J., et al., Hum.
Immunol. 52:109-118 (1997); Knutson, K. L., et al., J Clin. Invest
107:477-484 (2001); zum Buschenfelde, C. M., et al., J Immunol.
165:4133-4140 (2000); Chikamatsu, K., et al., Clin. Cancer Res.
5:1281-1288 (1999); Rongcun, Y., et al., J Immunol. 163:1037-1044
(1999); Visseren, M. I., et al., Int J Cancer 73:125-130 (1997);
Petersen, T. R., et al., Scand. J Immunol. 53:357-364 (2001);
Theobald, M., et al., Proc. Natl. Acad. Sci. U.S.A. 92:11993-11997
(1995)).
[0393] The immunogenicity of EP-2101 was also analyzed using
HLA-A2.1/K.sup.b transgenic mice which express the human HLA-A2.1
molecule (see also Examples 15-17). These mice have been used to
assess the immunogenicity of HLA-A2.1-restricted epitopes following
in vivo immunization (Wentworth, P. A., et al., Eur. J Immunol.
26:97-101 (1996); Vitiello, A., et al., J Exp. Med. 173:1007-1015
(1991)) and while useful for in vivo evaluation, they have several
limitations. Our studies, using a variety of CTL epitopes, indicate
that HLA transgenic mice will respond to approximately 80% of the
HLA-A2.1-restricted epitopes to which humans respond Wentworth, P.
A., et al., Eur. J Immunol. 26:97-101 (1996); Wentworth, P. A., et
al., Int Immunol. 8:651-659 (1996)). Also, the magnitude of the
response detected for a given epitope can vary widely from
experiment-to-experiment, especially for responses that are lower
in magnitude. Finally, the relative magnitude of the response
detected in HLA transgenic mice will not necessarily indicate the
relative magnitude that will be induced in humans.
[0394] For the in vivo immunogenicity studies in HLA-A2.1/K.sup.b
transgenic mice, EP-2101 (prepared by an emulsification protocol
(see Example 17) similar to that proposed for drug manufacture) was
injected into mice and CTL responses against all of the epitopes in
the vaccine were measured and compared to CTL responses induced by
co-immunizing mice with each CTL epitope alone plus the PADRE.RTM.
epitope, in Montanide.RTM. ISA 51 adjuvant. CTL responses were
determined by measuring IFN-.gamma. production by CTLs using an in
situ ELISA (McKinney, D. M., et al., J Immunol. Methods 237:105-117
(2000)), following in vitro stimulation of splenocytes from
immunized animals with peptide. As shown in FIG. 6, based on data
gathered thus far from 6-10 independent experiments, the EP-2101
vaccine appears to demonstrate immunogenicity for a majority of CTL
epitopes. For half of the CTL epitopes in EP-2101, strong CTL
responses were observed that exceeded 50 secretory units (SU) of
IFN-.gamma. production (CEA.24V9, CEA.691H5, HER-2/neu.369V2V9,
MAGE-2.157, and MAGE-3.112I5). The remaining epitopes demonstrated
moderate to weak CTL responses (<10-50 SI), and these responses
were generally associated with larger experimental variations as
indicated by the larger standard deviation bars. As discussed
above, these variations reflect the limitations of the transgenic
mouse assay. However, despite the inherent variability of the
assay, the multi-epitope CTL responses induced by the pool of CTL
epitopes in EP-2101 appeared comparable to CTL responses induced in
mice by each CTL epitope alone, when co-immunized with the
PADRE.RTM. epitope in Montanide.RTM. ISA 51 adjuvant. Thus,
overall, these experiments indicate that EP-2101 is immunogenic in
HLA A2.1/K.sup.b transgenic mice. Additional experiments also
indicate that EP-2101 can induce HTL responses against the
PADRE.RTM. epitope in HLA-A2.1/K.sup.b transgenic mice, which are
restricted by the mouse H-2 I-A.sup.b allele (Alexander, J., et
al., Immunity. 1:751-761 (1994)).
Example 14
Immunopharmacology Study in HLA-A2.1/K.sup.b Mice
[0395] EP-2101 is an immunotherapeutic vaccine designed to induce
CTL responses against nine peptide epitopes derived from four TAAs
which are widely expressed on colon and lung cancer cells (CEA,
p53, HER-2/neu, and MAGE-2/3). Because TAAs represent self-proteins
which are over-expressed in tumor cells, induction of a therapeutic
response by EP-2101 may require the breaking of CTL tolerance
against self-epitopes and induction of a limited but effective CTL
response, one that specifically eliminates tumor cells without
eliciting severe immunopathology against any normal tissue that may
express low levels of the same TAAs. Pre-clinical characterization
of EP-2101 indicated that the vaccine is indeed immunogenic since a
broad CTL response of significant magnitude was induced in
HLA-A2.1/K.sup.b transgenic mice against several wild-type and
analog TAA epitopes in the vaccine (see Example 13).
[0396] The immunogenicity of the EP-2101 vaccine against multiple
epitopes and multiple self tumor proteins raised the possibility
that immunopathological responses directed against normal tissue
expressing low levels of TAAs may be induced in cancer patients
after vaccination, although studies in murine models (Mizobata, S.,
K., et al., Cancer Immunol. Immunother. 49:285-295 (2000); Morgan,
D. J., et al., J. Immunol. 160:643-651 (1998)) and previous
clinical trials (Cormier, J. N., et al., Cancer J Sci. Am. 3:37-44
(1997); Salgaller, M. L., et al., Cancer Res. 56:4749-4757 (1996);
Wang, F., et al., Clin. Cancer Res. 5:2756-2765 (1999); Muderspach,
L., et al., Clin. Cancer Res. 6:3406-3416 (2000); Weber, J. S., et
al., J Immunother. 22:431-440 (1999); Lee, P., et al., J. Clin.
Oncol. 19:3836-3847 (2001)) have reported the absence of autoimmune
toxicities associated with induction of an anti-TAA CTL response.
To address this important concern, a pre-clinical
immunopharmacology study was undertaken in HLA-A2.1/K.sup.b
transgenic mice to determine whether autoimmune pathological
responses occur following in vivo immunization with EP-2101.
Although not a validated animal model for toxicological testing,
this transgenic mouse system offered the opportunity to assess this
important safety issue in a pre-clinical setting since the
HLA-A2.1/K.sup.b transgene allowed for induction of murine CTL
responses against the human CTL epitopes in the vaccine (Wentworth,
P. A., et al., Eur. J Immunol. 26:97-101 (1996); Vitiello, A., et
al., J Exp. Med. 173:1007-1015 (1991)).
[0397] In this 18 week study, HLA-A2.1/K.sup.b transgenic mice
received a total of six treatments with EP-2101 or a placebo
emulsion control at three week intervals. Mice were injected at the
tail base with EP-2101 at a 150-fold excess dose on a mg/kg basis
compared to the dose planned for cancer patients in the clinical
trial. Histopathology was performed on injected animals at three
time points; at week two following a single treatment, at week 9
after three treatments, and at week 18 after six treatments, on
tissue from seven major organs (heart, lung, kidney, stomach,
intestine, brain and liver) from each animal, as well as on skin
isolated from the injection site. In addition to histopathology,
animals were monitored at regular intervals for adverse events and
body weight. Concurrent to histopathology analysis at the 3 time
points and adverse event monitoring, the CTL responses in the
spleen of vaccinated and placebo-treated mice were also measured to
correlate any immunopathology with presence of CTL responses
against epitopes in the vaccine.
[0398] Results from this immunopharmacology study indicated that
treatment with EP-2101 or an emulsion control did not result in
autoimmune immunopathology in major organs of HLA-A2.1/K.sup.b
transgenic mice at all of the time points examined, even though
strong CTL responses were detected in animals. Histology sections
of seven major organs from animals treated with EP-2101 or emulsion
control appeared normal at all of the time points studied. The only
pathology observed in this study attributable to treatment was the
appearance of granulomatous inflammation and granuloma formation at
the injection site skin, which appeared in both the vaccine and the
emulsion control treatment groups. This observation is a common
side-effect of treatment with the Montanide.RTM. ISA 51 adjuvant
used in this study (Wang, F., et al., Clin. Cancer Res. 5:2756-2765
(1999); Lee, P., et al., J Clin. Oncol. 19:3836-3847 (2001);
Leenaars, M., et al., Vet Immunol Immunopathol. 61:291-304 (1998);
Yamanaka, M., et al., J. Vet. Med. Sci. 54:685-692 (1992)).
[0399] Adverse event monitoring of treated mice throughout the 18
week study indicated an overall absence of symptomologies
associated with illness or toxicity, in both the vaccine and
emulsion control-treated groups (e.g. lethargy, diarrhea, cachexia,
paralysis, abnormal posture). The only observation of note was the
appearance of a palpable lump at the tail base of all animals,
consistent with granuloma formation, which appeared transiently
over a 21/2 week period between the 4th and 5th treatment periods,
in both the vaccine and emulsion control-treated groups. This
transitory adverse event was not associated with necrosis or
bleeding at the injection site skin, and such injuries were not
observed in any animal throughout the duration of the entire study.
Finally, the absence of serious adverse events and immunopathology
in test animals was confirmed by their body weight measurements
which appeared normal and increased steadily over the course of the
study.
[0400] In summary, the absence of autoimmune inflammatory pathology
in the HLA-A2.1/K.sup.b mouse model system observed in this current
study is reminiscent of the absence of similar pathologies reported
in previous human clinical trials where peptide vaccines formulated
in Montanide.RTM. ISA 51 adjuvant were administered to cancer
patients (Cormier, J. N., et al., Cancer J Sci. Am. 3:37-44 (1997);
Salgaller, M. L., et al., Cancer Res. 56:4749-4757 (1996); Wang,
F., et al., Clin. Cancer Res. 5:2756-2765 (1999); Muderspach, L.,
et al., Clin. Cancer Res. 6:3406-3416 (2000); Weber, J. S., et al.,
J Immunother. 22:431-440 (1999); Lee, P., et al., J Clin. Oncol.
19:3836-3847 (2001)). For the EP-2101 vaccine, the absence of
autoimmune immunopathology in HLA-A2.1/K.sup.b transgenic mice in
the face of a broadly specific CTL response directed at multiple
epitopes of self tumor antigens supports the general safety of
administering this vaccine to colon and lung cancer patients in the
proposed clinical trials.
Example 15
Clinical Trial
[0401] EP-2101 is a therapeutic, peptide vaccine for use as an
adjuvant therapy in patients with cancer. The vaccine is designed
for administration to patients for the induction of cytotoxic T
lymphocytes (CTL) directed against carcinoembryonic antigen (CEA),
p53, human epidermal receptor-2/neurological (HER-2/neu) and
melanoma antigen 2 and 3 (MAGE-2/3), tumor associated antigens
(TAAs) that are frequently over-expressed in colon and non-small
cell lung cancer (NSCLC). The clinical objective for inducing CTL
responses against these four well-characterized TAAs is to delay or
prevent the recurrence of cancer following surgery, chemotherapy or
radiation.
[0402] Cancer of the lung continues to be a major health problem
with a very high mortality rate. Approximately 170,000 new lung
cancer cases were predicted in the United States in 2001 and an
estimated 160,000 patients expected to die from the disease. About
80% of lung cancers are NSCLC, and a majority of these patients
present with later stage disease. The "standard of care" for NSCLC
remains surgery, radiation therapy, or chemotherapy. In addition,
some patients receive adjunctive therapy after surgery in the form
of chemotherapy following the removal of detectable tumor, although
clinical studies are only now ongoing to assess the benefit of such
treatment. Despite these treatments, the 2 year survival rate is
30% for stage IIIa, 45% for IIb, 60% for IIa and Ib and 80% for Ia.
Mountain, C. Lung Cancer; A Handbook For Staging, Imaging and Lymph
Node Classification (1999). Therefore, effective adjuvant therapies
are critically needed.
[0403] The continued improvement in detection of colon cancers has
enhanced the ability to treat patients early in the course of
disease. According to the American Cancer Society, the five-year
survival rate for local disease is 91% while the survival rate for
disseminated disease is only 7% (American Cancer Society, Cancer
Facts and Figures 2001). Projected deaths in the United States from
colon cancer are approximately 50,000 in 2001. The "standard of
care" for stage III colon cancer is surgery followed by
chemotherapy utilizing 5-fluorouracil and leucovorin. Recently
there has been increased use of irinotecan with 5-fluorouricil and
leucovorin in the adjuvant setting. Despite these available
regimens, additional safe and effective adjuvant treatments are
needed.
[0404] EP-2101 is composed of ten synthetic peptides, each composed
of 9-13 amino acid residues, formulated as a stable water-in-oil
emulsion in Montanide.RTM. ISA 51 adjuvant. Nine of the peptides
represent CTL epitopes. Each CTL epitope is restricted by HLA-A2.1
and at least one other member of the HLA-A2 superfamily of MHC
class I molecules, providing coverage of approximately 45% of the
general population. The CTL epitopes included represent a
combination of wild-type, fixed-anchor analog and heteroclitic
analog epitopes. The tenth synthetic peptide is a pan-DR epitope
(PADRE.RTM.), a rationally-designed helper T lymphocyte (HTL)
epitope included to augment the magnitude and duration of CTL
responses.
[0405] The concept of inducing a CTL response to delay or prevent
the recurrence of cancer is supported by significant animal model
data, studies correlating tumor infiltration with a favorable
clinical outcome and reports of tumor regression following
spontaneous or vaccine-induced anti-tumor T cell responses (Yu, Z.
and Restifo, N. P., J. Clin. Invest 110:289-294 (2002)). Peptide
epitopes have been utilized for the induction of CTL responses in
cancer patients in numerous clinical studies with some encouraging
results (Rosenberg, S. A., et al., Nat. Med. 4:321-327 (1998);
Fong, L., et al., Proc. Natl. Acad. Sci. U.S.A. 98:8809-8814
(2001)). To improve the clinical outcome in the proposed studies,
the EP-2101 peptide vaccine was designed to incorporate the
insights and promising concepts learned from previous studies.
Specifically, EP-2101 incorporates: [0406] 1. defined,
optimal-length CTL epitopes derived from multiple,
well-characterized TAAs; [0407] 2. epitopes with high HLA binding
affinity and demonstrated ability to induce CTL that recognize
tumor cell lines; [0408] 3. epitopes that are a mixture of
wild-type sequences and two types of analogs, fixed-anchor and
heteroclitic, that were shown to induce responses in humans that
correlated with clinical responses; [0409] 4. a
rationally-designed, non-self, helper T cell PADRE.RTM. epitope,
that has been shown to induce helper responses in humans; [0410] 5.
Montanide.RTM. ISA 51, a mineral oil adjuvant similar to Incomplete
Freund's Adjuvant that is a well-characterized adjuvant for human
use that has exhibited acceptable safety and potency in numerous
clinical studies (Weber, J. S., et al., J Immunother. 22:431-440
(1999); Lee, P., et al., J Clin. Oncol. 19:3836-3847 (2001);
Cormier, J. N., et al., Cancer J Sci. Am. 3:37-44 (1997); Wang, F.,
et al., Clin. Cancer Res. 5:2756-2765 (1999); Muderspach, L., et
al., Clin. Cancer Res. 6:3406-3416 (2000); Ressing, M. E., et al.,
J Immunother. 23:255-266 (2000); Yamshchikov, G. V., et al., Int J
Cancer 92:703-711 (2001); Rosenberg, S. A., et al., J Immunol.
163:1690-1695 (1999)).
[0411] The unique combination of wild-type and analog epitopes
derived from well-studied TAAs and delivered in an adjuvant that
has produced encouraging clinical data should provide an
opportunity to improve on the results obtained to date using
peptide-based cancer vaccines.
Rationale for Dose Selection
[0412] EP-2101 is an immunotherapeutic vaccine consisting of nine
peptide epitopes derived from four TAAs which stimulate CTL
responses and the PADRE.RTM. universal helper T cell epitope. The
10 peptides are formulated in an emulsion with Montanide.RTM. ISA
51 adjuvant which will be administered to NSCLC and colon cancer
patients to assess safety and immunogenicity of the vaccine.
Guidance as to the appropriate vaccine dosage for treating patients
was provided by reports of previous clinical trials where CTL and
clinical responses as well as vaccine safety were reported
following administration of a peptide/Montanide.RTM. ISA 51 vaccine
(Weber, J. S., et al., J Immunother. 22:431-440 (1999); Lee, P., et
al., J Clin. Oncol. 19:3836-3847 (2001); Cormier, J. N., et al.,
Cancer J Sci. Am. 3:37-44 (1997); Wang, F., et al., Clin. Cancer
Res. 5:2756-2765 (1999); Muderspach, L., et al., Clin. Cancer Res.
6:3406-3416 (2000); Ressing, M. E., et al., J Immunother.
23:255-266 (2000); Yamshchikov, G. V., et al., Int J Cancer
92:703-711 (2001); Rosenberg, S. A., et al., J Immunol.
163:1690-1695 (1999)).
[0413] Several peptide vaccines formulated in Montanide.RTM. ISA 51
have been tested in cancer patients and these vaccines have
generally been deemed safe and well-tolerated with no severe
dose-related systemic toxicities being reported (Weber, J. S., et
al., J Immunother. 22:431-440 (1999); Cormier, J. N., et al.,
Cancer J Sci. Am. 3:37-44 (1997); Wang, F., et al., Clin. Cancer
Res. 5:2756-2765 (1999); Muderspach, L., et al., Clin. Cancer Res.
6:3406-3416 (2000); Ressing, M. E., et al., J Immunother.
23:255-266 (2000)). The dose of peptide administered to patients in
these trials has been as high as 10 mg of total peptide per
treatment, with most being in the range of 1-2 mg total peptide,
and the treatment schedule was similar to that being proposed for
the EP-2101 clinical trial (i.e. 4-6 subcutaneous injections at 3-4
week intervals). The most common toxicities reported were local
injection site reactions (pain, tenderness, and granuloma
formation) that were almost always scored grade 1 or 2 in severity
(Wang, F., et al., Clin. Cancer Res. 5:2756-2765 (1999);
Muderspach, L., et al., Clin. Cancer Res. 6:3406-3416 (2000);
Ressing, M. E., et al., J Immunother. 23:255-266 (2000)). Other
transient grade 1/2 toxicities that were occasionally observed
included nausea, headaches, fever, and fatigue. Studies testing
vaccines with more than a single peptide formulated in
Montanide.RTM. ISA 51 adjuvant include the clinical trials reported
by Yamshchikov et al. (Yamshchikov, G. V., et al., Int J Cancer
92:703-711 (2001)) and Ressing et al. (Ressing, M. E., et al., J
Immunother. 23:255-266 (2000)). In each study, melanoma or cervical
carcinoma patients were treated with a mixture of three or five
peptides, respectively, injected at doses up to 3 mg total peptide.
As observed in other studies, both vaccines showed only limited
grade 1/2 toxicities. Thus, collectively, data from these clinical
trials indicate that vaccines consisting of one or several peptide
epitopes formulated in Montanide.RTM. ISA 51 at total peptide doses
up to 10 mg are generally well-tolerated.
[0414] With respect to induction of CTLs and clinical responses by
peptide/Montanide.RTM. ISA 51 vaccines, clinical trials examining
escalating doses of peptide, ranging from 0.1 to 10 mg of peptide
per injection dose, have shown that CTL responses and clinical
responses are induced in this dose range, particularly at doses
approaching 1 mg per peptide Weber, J. S., et al., J Immunother.
22:431-440 (1999); Cormier, J. N., et al., Cancer J Sci. Am.
3:37-44 (1997); Wang, F., et al., Clin. Cancer Res. 5:2756-2765
(1999); Muderspach, L., et al., Clin. Cancer Res. 6:3406-3416
(2000)).sup.1-4. For example, in a noteworthy study described by
Rosenberg et al. 7; 8 (Rosenberg, S. A., et al., Nat. Med.
4:321-327 (1998); Rosenberg, S. A., et al., J Immunol.
163:1690-1695 (1999)), where significant post-vaccination clinical
responses were reported, a 1 mg dose of a single fixed-anchor
analog peptide, gp100.209 (210M), was delivered in Montanide.RTM.
ISA 51. In this trial, a 40% clinical response rate was observed in
melanoma patients following peptide vaccination in conjunction with
IL-2 therapy, compared to a historical response rate of 15% with
IL-2 therapy alone (Rosenberg, S. A., et al., Nat. Med. 4:321-327
(1998)). Similarly, in another trial where a HPV-16 E7 peptide
vaccine was tested in patients with high-grade cervical
intraepithelial neoplasia, CTL responses and clinical responses
were reported at doses of 0.3 mg and 1 mg (Muderspach, L., et al.,
Clin. Cancer Res. 6:3406-3416 (2000)). With regard to correlating
CTL induction with peptide dose, Wang et al. (Wang, F., et al.,
Clin. Cancer Res. 5:2756-2765 (1999)) observed that a high dose of
the Melan-A/MART-1.27 peptide in Montanide.RTM. ISA 51 adjuvant (2
mg peptide/dose) appeared to result in a greater magnitude of CTL
responses, as measured by interferon-gamma (IFN-.gamma.) release
using the enzyme-linked immunospot (ELISPOT) assay, when compared
to patients receiving a lower dose (0.1 mg/dose). Although the
number of patients in this trial was limited, this finding is
consistent with other studies in humans immunized with a lipidated
HBV CTL peptide construct (Vitiello, A., et al., J Clin. Invest
95:341-349 (1995)) or a tumor specific bcl-abl breakpoint peptide
delivered in QS-21 adjuvant (Pinilla-Ibarz, J., et al., Blood
95:1781-1787 (2000)).sup.10 where higher doses of peptide were
shown to be more consistent at inducing T cell responses than lower
doses.
[0415] A stable emulsion was generated at a 5 mg/ml total peptide
dose (0.5 mg/ml per peptide epitope). Thus, cancer patients in the
EP-2101 clinical trial will receive a dosage corresponding to 5 mg
of total peptide (0.5 mg per epitope) in an injection volume of 1
ml. Patients will receive six total subcutaneous injections at
three week intervals in an injection volume of 1 ml.
[0416] Potential risks of vaccine administration are known to the
clinician of ordinary skill in the art and include discomfort at
the site of injection, general symptoms associated with
administration of a vaccine (chills, fever, rash, aches and pain,
nausea, headache and fatigue), reproductive toxicity, anaphylactic
reaction, effects on pregnancy and fetal development, and
autoimmune reactions, including those of the retina.
Structural Formula
[0417] The amino acid sequence of each peptide is given in Tables 3
and 7.
Formulation of Dosage Form
[0418] EP-2101 is a sterile, preservative-free emulsion of 10
peptide epitopes at a concentration of 0.5 mg/ml each, formulated
in Montanide.RTM. ISA 51 adjuvant at a ratio of 1:1 (w:w) and
filled into rubber stoppered glass vials. The peptides are
synthesized using standard Boc or Fmoc chemistry for solid phase
peptide synthesis starting with the appropriate resin, and purified
by standard methods. The adjuvant is a mineral oil adjuvant,
similar to Incomplete Freund's Adjuvant, manufactured and supplied
by Seppic, Inc., Fairfield, N.J. EP-2101 is manufactured under
aseptic conditions. Peptides are dissolved in three different
solvents, sterile filtered, pooled and then emulsified in adjuvant
via homogenization under controlled conditions.
Route of Administration
[0419] EP-2101 is designed for subcutaneous injection. The vaccine
will be administered as a 1 ml injection every three weeks for a
total of six injections. The total peptide dose for each injection
will be 5.0 mg (0.5 mg of each peptide).
Manufacture of Drug Substance
[0420] Peptides are prepared using solid phase synthesis
methodology. Briefly, fluorenylmethoxycarbonyl (Fmoc) and/or
tert-butyloxycarbonyl (Boc) groups are used as the protecting
groups for the amino acid residues in the synthesis. The peptide is
built upon the appropriate resin.
[0421] Amino acid derivatives are added to the resin-based amino
acid using three equivalents each of DIC and HOBt as the coupling
reagents. The Fmoc or Boc protecting group is removed from the
terminal amino acid of the resin-based peptide using 20% piperidine
in DMF or 65% TFA in dichloromethane, respectively.
[0422] The remaining Fmoc-N- or Boc-N-protected amino acid residues
are added to the resin-based peptide in sequential coupling cycles
using DIC and HOBt as the coupling reagents and 20% piperidine in
DMF or 65% TFA in dichloromethane to remove Fmoc and Boc protecting
groups, respectively.
[0423] Some side-chain protecting groups are removed using
appropriate organic mixtures prior to peptide cleavage from the
resin. Both removal of additional protecting groups and cleavage
from the resin are achieved by treatment of the peptide-resin with
a mixture of hydrogen fluoride/methoxybenzene or TFA/water. The
peptide is extracted from the resin with acetic acid and, in some
cases, extraction with trifluoroacetic acid. The resin is washed
with ether. The peptide is isolated by lyophilization from the
HOAc/TFA solution.
[0424] The peptide is purified by preparative Reverse Phase High
Performance Liquid Chromatography (RP-HPLC) on a C18 derivatized
silica stationary phase. The column is eluted and the fractions
containing pure peptide are pooled and the peptide is isolated by
lyophilization. In some cases RP-HPLC is followed by ion exchange
purification/deslating using HOAc-buffered solvents. The resulting
fractions are isolated by lyophilization.
Solubility of Individual Peptides
[0425] Solubility studies have been performed on the peptides, with
solubility defined as a clear solution with no visible particulates
(Table 8). Only 6 out of 10 peptides (1013.08, 1243.08, 1295.03,
1323.06, 1350.01 and 1352.03) were soluble at physiological pH.
Therefore, the peptides were tested at 2-5 mg/ml in various aqueous
acidic solutions and aqueous basic solutions, in addition to
dimethylsulfoxide (DMSO).
Specifications and Analytical Methods for the Drug Substance
[0426] Table 9 describes the specifications for the Drug
Substance.
Components and Quantitative Composition
[0427] The components and quantitative composition of EP-2101 are
described in Table 10.
Component Specifications
[0428] The components used in the manufacture of the drug product
are listed in Table 11.
Method of Manufacture of the Bulk Drug Product and Drug Product
[0429] The bulk drug product is prepared as shown in FIG. 5. The
bulk drug product is formulated into three solutions (see Tables 8
and 12) based on the solubility of individual peptides in each of
the three solvents and the solubility of the peptides when pooled.
Briefly, to allow for aseptic processing, the 10 peptides are
dissolved into either an acidic solution (0.1875 M acetic acid), a
basic solution (0.1 M sodium hydroxide) or the organic solvent
DMSO. These three peptide-containing pools are sterilized by
filtration. Under aseptic conditions, these three peptide pools are
combined, buffered, pH adjusted and then homogenized with
Montanide.RTM. ISA 51 adjuvant under temperature-controlled
conditions to form the drug product. The drug product, a stable 1:1
(w:w) emulsion, is then filled into 2 ml glass vials and stored at
2-8.degree. C.
Drug Product Specifications and Analytical Methods
[0430] Tables 13 and 14 describe the specifications for EP-2101
bulk drug product and drug product, respectively.
Peptide Concentration (Each Peptide)
[0431] Concentration of all peptide components in the EP-2101 Drug
Product is assayed by RP-HPLC (conditions illustrated in Table 15).
A specified quantity of the emulsion is mixed with a solution of
0.1% TFA in DMSO to form a two-layered mixture. Attempts to produce
a clear, homogeneous solution for HPLC analysis by using solvents
other than DMSO were unsuccessful. Sampling of the aforementioned
two-phase mixture takes place by inserting a syringe or pipette
through the top mineral oil layer and into the bottom, DMSO layer.
The only sample taken for HPLC analysis is taken from the DMSO
layer, in which all peptides are soluble. HPLC chromatography
affords a distinct chromatographic peak for each peptide, which
upon integration and comparison to a calibration curve yields the
individual peptide concentration in the EP-2101 Drug Product. The
biphasic nature of the sample introduces variability in the
estimation of the full sample volume as well as the transfer of the
sample. Subsequently, because of the complexity of sample
preparation and handling, unusually large errors in determining the
peptide concentration (as high as 30%) were observed. The large
variability was not accompanied by major degradation product
formation or other unusual physical changes of the sample, and is
inferred to be a result of sample preparation and handling. For
this reason the specification of .+-.50% of the intended
concentration was set as a release and stability criterion.
Attempts to improve the sample handling and, simplify the biphasic
mineral oil-DMSO mixture are currently underway with a primary aim
of narrowing the release and stability specifications.
Potency
[0432] EP-2101 is composed of synthetic CTL and HTL peptide
epitopes. Peptide content and integrity can be determined
accurately by physical/chemical characterization using the
analytical methods described above (e.g. HPLC, viscosity, and
particle size analysis). In addition, a method for evaluating the
overall potency of the drug product has been developed.
[0433] Development of a relevant potency assay is challenging
because the EP-2101 vaccine is designed to specifically stimulate
HLA-A2.1-restricted CTL responses in humans and not other species.
One way to address this challenge is to measure the in vivo potency
of EP-2101 using mice that express the HLA-A2.1 molecule as a
transgene (i.e. HLA-A2.1/K.sup.b transgenic mice). The proposed
EP-2101 potency assay is similar to the preclinical assay used to
measure the immunogenicity of EP-2101 CTL epitopes in
LA-A2.1/K.sup.b transgenic mice (see Example 13). It should be
pointed out that the HLA-A2.1/K.sup.b transgenic mouse assay has
limitations in quantifying CTL responses, specifically: 1) only
about 80% of the HLA-A2.1-restricted epitopes that are immunogenic
in humans also induce CTL responses in transgenic mice (Wentworth,
P. A., et al., Eur. J. Immunol. 26:97-101 (1996)), therefore, CTL
responses against some epitopes cannot be quantified using this
system, and; 2) using a number of approaches, we have found that in
vivo CTL responses generated in HLA transgenic mice, whether
induced by vaccination or natural infection, are variable from
experiment-to-experiment due to individual animal differences and
to the in vitro manipulation of primed T cells required for this
assay method (e.g. see FIG. 7). Although the potency assay has
limitations common to in vivo bioassays, it provides a measurement
of overall potency of EP-2101. Accordingly, it serves as an
appropriate complement to the highly sensitive and quantitative
analytical assays described above.
[0434] In the EP-2101 potency assay, HLA-A2.1/K.sup.b transgenic
mice are injected with EP-2101 and 14 days later splenocytes from
immunized animals are stimulated in vitro with representative
EP-2101 CTL epitopes, CEA.691H5 (1352.02) and HER-2/neu.369V2V9
(1334.10), to expand in vivo-primed CTL. Following in vitro
expansion, in vivo-primed CTL responses (also referred to as
effector cells) will be quantitated by measuring, with an ELISA,
their capacity to produce IFN-.gamma. when stimulated again in
vitro with the CEA.691H5 or HER-2/neu.369V2V9 peptides. CTL
activity measured by ELISA is expressed as secretory units (SU),
which represent the number of effector cells needed to secrete 100
pg of IFN-.gamma. in response to peptide (McKinney, D. M., et al.,
J. Immunol. Methods 237:105-117 (2000)). Thus, the SU value is a
reflection of the level of CTL induced by EP-2101 in
HLA-A2.1/K.sup.b transgenic mice and is a measurement of vaccine
potency.
Example 16
Detailed Description of the Potency Assay
[0435] To assess the drug potency, an assay has been developed to
measure the ability of the vaccine to induce a CTL response in
transgenic mice that express a chimeric MHC class I molecule in
which the heavy chain is composed of the first and second domains
of the HLA-A2.1 molecule and the third domain, transmembrane
domain, and cytoplasmic domain of the mouse H-2K.sup.b molecule.
Previously, it was demonstrated that when HLA-A2.1/K.sup.b
transgenic mice are immunized with HLA-A2.1-restricted epitopes
known to be immunogenic in humans, approximately 80% of the
epitopes induce CTL responses (Wentworth, P. A., et al., Eur. J.
Immunol 26:97-101 (1996)). These data confirm the validity of using
these mice to quantitate CTL responses induced upon immunization
with a vaccine composed of HLA-A2.1-restricted epitopes.
[0436] The selection of two CTL epitopes for measuring EP-2101
potency and the establishment of a potency assay specification is
described below. Specific protocols are described in Example
17.
[0437] Briefly, analysis of the immunogenicity of EP-2101 in
several experiments indicated that the different epitopes in the
vaccine induced varying responses ranging from a mean of .about.10
SU to >100 SU and these responses were associated with high
intra- and interexperimental variability, particularly for weakly
immunogenic epitopes. Both of these factors made it unfeasible to
measure potency of the vaccine based on CTL responses against all
nine epitopes in the vaccine. Instead, an assay was developed using
the immunogenicity measurements of two representative, immunogenic
epitopes in EP-2101 as an indicator of overall vaccine potency.
[0438] Selection of the two epitopes was based on a retrospective
analysis of CTL immunogenicity data generated from experiments
where mice were injected with EP-2101 at varying emulsion doses.
CTL responses from 6-10 independent experiments in which mice were
immunized with a 10 mg/ml emulsion dose were evaluated and the two
top immunogenic epitopes in EP-2101 were CEA.691H5 (geometric mean
response, 164.times.//1.8 SU) and HER-2/neu.369V2V9 (geometric mean
response, 152.times.//2.4 SU), with a third epitope, MAGE-3.112I5
(geometric mean response, 92.times.//2.1 SU) serving as a potential
back-up epitope. In addition to the high response magnitude, the
overall variability associated with these responses was within
ranges normally observed for immunogenic epitopes tested in
HLA-A2.1/K.sup.b transgenic mice (SD between .times.//1.8-2.4).
Although this extensive database was generated with EP-2101 at a 10
mg/ml emulsion dose, further experiments indicate that the EP-2101
emulsions at a 2.5 mg/ml and 5 mg/ml total peptide dose induce a
comparable level of CTL response as the 10 mg/ml emulsion dose
against the highly immunogenic CEA.691H5, HER-2/neu.369V2V9, and
MAGE-3.112I5 epitopes.
[0439] Further support for epitope selection was provided by data
from responses measured in the ELISPOT assay which tests for CTL
effector cell activity without in vitro expansion by peptide
stimulation. Consistent CTL responses could be detected by the
ELISPOT assay against the HER-2/neu.369V2V9 and CEA.691H5 epitopes
and these results confirm the strong immunogenicity of the two
candidate potency assay epitopes compared to others in the vaccine
when tested with this assay.
[0440] In addition to responses measured in immunized mice, the
baseline CTL responses observed in naive mice or in mice injected
with a placebo Montanide.RTM. ISA 51 emulsion were also considered.
For the three top epitope candidates, CTL responses in negative
control mice in three independent experiments were low (<10 SU),
such that the difference in the magnitude between the baseline and
vaccine-induced CTL responses was sufficiently large to assure
detection of a drop in vaccine potency should it occur after
manufacture.
[0441] A final consideration in epitope selection for the potency
assay was variability of CTL induction associated with individual
mice. Since the protocol for the EP-2101 potency assay specifies
measurement of CTL responses in a pooled splenocyte population
derived from 6 immunized mice, a potential source of variability in
the assay could be the frequency of CTL induction in individual
animals. This consideration is not trivial since sporadic CTL
responses behaving in an all-or-none fashion have been observed in
individual mice injected with different types of highly immunogenic
vaccine constructs (e.g. lipopeptide, DNA) (unpublished results).
In light of this important parameter, a study was initiated to
determine the variability of CTL induction against the top three
potency epitope candidates in 15 individual HLA-A2.1/K.sup.b
transgenic mice immunized with the EP-2101 vaccine. CTL responses
against all three epitopes could be demonstrated in 100% of the
immunized animals. As expected, the hierarchy of CTL responses
against each of the three epitopes was similar to that measured
with a pool of splenocytes from primed mice and the degree of
variability of the responses between individual animals was within
an acceptable range for an in vivo assay. Thus, CEA.691H5 and
HER-2/neu.369V2V9 induced the most robust and reproducible CTL
response in all animals, followed by the MAGE-3.112I5 epitope
(geometric mean SU response in 15 mice against the CEA, HER-2/neu,
and MAGE-3 epitopes was 252.times.//1.4, 169.times.//1.7, and
48.times.//1.7, respectively and these responses were within the
range observed with pooled splenocytes from EP-2101-immunized
animals).
[0442] In summary, the CEA.691H5 and HER-2/neu.369V2V9 epitopes
were selected as the potency assay epitopes, and the MAGE-3.112I5
epitope was designated as a back-up based on 1) the strength of CTL
responses measured in EP-2101 immunized animals using the in situ
ELISA and ex vivo ELISPOT assays, 2) the equivalent magnitude of
CTL responses generated against the epitopes with EP-2101 vaccine
formulated at varying peptide emulsion doses, 3) the inter- and
intra-experiment variability of these CTL responses, 4) the
baseline responses in negative control animals, and 5) the
consistency of CTL induction in individual animals.
[0443] A potency assay specification was established to determine
the upper and lower limits of CTL responses against the two potency
epitopes induced by EP-2101. To establish the lower specification
limit, the data-base generated in naive or emulsion control
(placebo) mice over six experiments (18 data-points) was analyzed
and the SU values of all cultures from negative control mice were
compiled. The lower limit specification was established by first
calculating the geometric mean SU response and SD from all of the
negative control cultures and then calculating a 3 SD cutoff value.
This value for the CEA.691H5 epitope was calculated to be 22 SU
(geometric mean.times.3 SD=1.53.times.14.01; with rounding to the
next highest integer) and 8 SU for the HER-2/neu.369V2V9 epitope
(geometric mean.times.3 SD=0.49.times.14.58). For a given test
sample of EP-2101 to pass potency, the geometric mean SU value of
CTL activity from EP-2101-primed splenocytes for both epitopes must
equal or exceed its respective lower limit specification.
[0444] To establish the upper limit of the assay, SU values from 11
experiments (32 data-points) generated from EP-2101-injected mice
were compiled and the geometric mean SU value from the three
highest experiments for each epitope was calculated. For the
CEA.691H5 epitope, this calculation resulted in a value of 289.5 SU
based on the responses of individual cultures from three
experiments. For HER-2/neu.369V2V9, the geometric mean SU of the
three highest responding experiments was 330.9 SU. Since in vivo
biological responses in vaccine-immunized subjects tend to generate
significant differences at log intervals of dosage (Vitiello, A.,
et al., J. Clin. Invest. 95:341-349 (1995); Pinilla-Ibarz, J., et
al., Blood 95:1781-1787 (2000)), a log greater CTL response value
from the mean of the highest responses observed in
EP-2101-immunized animals was established as the upper limit
specification. Thus, the upper limit specification for the two
epitopes was determined by multiplying the geometric mean SU value
of the three highest experiments by 10 then rounding this value.
For CEA.691H5 this value was calculated to be 2,895 SU or 2,900 SU
and for the HER-2/neu epitope the same calculation yielded a value
of 3,309 SU or 3,300 SU. A given test sample of EP-2101 which
exceeds the upper limit specification of 2,900 SU and 3,300 SU for
the CEA.691H5 and HER-2/neu.369V2V9 epitopes respectively, fails
the potency assay due to concerns regarding super-optimal CTL
inducing activity and potential toxicity.
[0445] Each potency experiment will also include system suitability
controls which will determine the validity of the EP-2101 potency
measurements, obtained in the experiment. As a positive control,
mice will be co-immunized with each CTL epitope alone and the
PADRE.RTM. epitope in a Montanide.RTM. ISA 51 emulsion and CTL
responses in this group will be monitored using the same
specifications established for the EP-2101 vaccine product. As a
negative control, splenocytes from naive (non-vaccinated) mice will
be stimulated in vitro with each CTL epitope under identical
conditions as splenocytes harvested from EP-2101-immunized mice and
as a criteria for a valid potency assay, CTL responses in this
control group should not exceed the lower specification limit for
each epitope.
Example 17
Detailed Protocols
Mice
[0446] HLA-A2.1/K.sup.b transgenic mice were generated as described
previously (Vitiello A., et al., J. Exp. Med. 173:1007-15 (1991))
as an F1 generation of a cross between an HLA-A2.1/K.sup.b
transgenic strain generated on the C57/BL6 background and BALB/c
mice.
Cell Culture Medium
[0447] All cells were grown in RPMI-1640 medium with HEPES (Life
Technologies, Grand Island, N.Y.) supplemented with 10% FBS, 4 mM
L-glutamine, 5.times.10.sup.-5 M 2-ME, 0.5 mM sodium pyruvate,
1.times. non-essential amino acid residues, 100 .mu.g/ml
streptomycin and 100 U/ml penicillin (hereafter designated RPMI-10
medium).
Preparation of Montanide ISA 51 peptide emulsions
[0448] For emulsion preparations, the individual peptides in the
EP-2101 vaccine were solubilized from a lyophilized powder in the
appropriate aqueous or DMSO solution and at the appropriate
concentrations to yield 10, 5, or 2.5 mg/ml total peptide in the
final adjuvant emulsion. The different solutions, the respective
peptides formulated in them, and the method of formulation are
described below.
Solution 1 (Acidic Pool): Peptides CEA.694H5, p53.149M2,
MAGE3.112I5, and PADRE were solubilized in 0.1875M acetic acid. The
CEA.691H5 peptide was solubilized first by 2 minutes of vortexing
at high speed, followed by 5-10 minutes of sonication
(35-40.degree. C.). The other peptides were added one at a time and
solubilized by vortexing for 1-2 minutes. Solution 2 (Basic Pool):
Peptides CEA.24V9, CEA.605D6, HER2.689, MAGE2.157, and p53.139L2B3
were solubilized in 0.1M NaOH. Peptides were readily solubilized
with brief vortexing (1-2 minutes). Solution 3 (DMSO): Peptide
HER2.369V2V9 was solubilized in DMSO with vortexing (2 minutes) and
heating (35-40.degree. C.).
[0449] All Solutions were stored at 4.degree. C. until they were
combined to generate Pool 4 which contains a mixture of all 10
peptides.
Pool 4 (Combination of Solutions 1, 2, and 3): Solutions 1, 2 and 3
were combined in a 4:5:1 ratio (v:v, e.g. 0.8:1:0.2 ml
respectively), or in a 3.2:4:1 ratio (v:v, e.g. 0.8:1:0.25 ml
respectively), which resulted in precipitation of some peptides.
The combined pool was buffered with 0.2 ml of 62.5 mM sodium
phosphate (pH 7) and pH-adjusted to pH 7 with 0.5 M NaOH
(approximately 178 .mu.l per 2.5 ml of final pool 4 after buffering
and water addition), then brought to volume (2.5 ml) with
water-for-injection (WFI).
[0450] The final Pool 4 solution was then combined 1:1 v:v with
Montanide.RTM. ISA 51 (Seppic Inc.) and emulsified by
homogenization using a Silverson L4RT homogenizer fitted with a 3/8
inch mini-micro tubular probe. Typically, a 10 mg/ml research
emulsion was prepared in a total volume of 1.5.about.5 ml, with the
tube kept cool on ice during preparation. Initially, the probe was
carefully inserted into the oil layer near the water/oil interface
and the oil layer was mixed at a low speed before the probe was
transferred to the bottom of the tube and the speed adjusted to
8,000 rpm. Homogenization was performed for a total of 30 minutes
and an even emulsion was produced by repeatedly raising and
lowering the tube during this interval. The final EP-2101
emulsified product was kept at 4.degree. C., prior to injection of
animals.
[0451] Emulsions at a 2.5 mg/ml and 5 mg/ml total peptide dose were
prepared at a scale of approximately 25 ml, 500 ml, or 1 liter
using probes and mixing screens of appropriate diameter and pore
size.
[0452] Placebo emulsion (emulsion control) was prepared as
described above, except Solutions 1, 2, and 3 did not contain
peptides.
Immunization of Mice and In Vitro Expansion of In Vivo-Primed
CTLs
[0453] HLA-A2.1/K.sup.b transgenic mice were immunized with EP-2101
or placebo emulsion subcutaneously at the tail base in an injection
volume of 50-100 .mu.l/animal. Eleven to fourteen days after
immunization, animals from each experimental group were sacrificed
and a single cell suspension was prepared from a pool of mouse
spleens. Individual cultures of splenocytes (20-25.times.10.sup.6
cells per culture) were then stimulated in vitro in upright 25
cm.sup.2 flasks with individual CTL epitopes represented in EP-2101
(1 .mu.g/ml final peptide concentration in 10 ml of RPMI-10 medium;
duplicate or triplicate cultures established per epitope). As APCs,
1-1.25.times.10.sup.7 irradiated (4000 rad) LPS-activated blasts
were added to each culture. LPS blasts were prepared by stimulating
spleen cells from untreated HLA-A2.1/K.sup.b mice in vitro with
6.25 .mu.g/ml LPS (Sigma Chemical Co., St. Louis, Mo.) and 7
.mu.g/ml dextran sulfate (500,000 M.W., 17% sulfur, Pharmacia
Bioprocess Technology, Uppsala, Sweden) for 3 days at 37.degree.
C.
[0454] Splenocyte cultures stimulated with EP-2101 peptide were
incubated for 6 days at 37.degree. C. in 5% CO.sub.2 before each
culture was measured for CTL activity using the IFN-.gamma. in situ
ELISA, as described below.
Measurement of CTL Activity
[0455] Six days after initiation of culture, CTL activity from
individual cultures was measured by the IFN-.gamma. in situ ELISA
as previously described (McKinney, D. M, et al., J Immunol Methods
237:105 (2000)). Briefly, CTL effector cells (4.times.10.sup.5)
cells were added to 4 or 6 wells in a 96-well plate (flat-bottom,
precoated with a capture anti-IFN-.gamma. monoclonal antibody).
Cells were then serially diluted 4-fold in RPMI-10 medium until a
final concentration of 391 cells/well was achieved.
Jurkat-A2.1/K.sup.b tumor cells (10.sup.5/well) were then added to
each well. Half of the wells in each replicate (cells were plated
in replicates of 6 or 4 wells) received 10 .mu.g/ml of CTL peptide
and the remaining wells received medium. After overnight
incubation, wells were washed and developed to determine
IFN-.gamma. content by sequential treatment with a secondary
biotinylated anti-IFN-.gamma. monoclonal antibody, streptavidin
peroxidase, and finally substrate. The pg of IFN-.gamma. released
per well by CTLs in the presence or absence of peptide was
calculated by measuring absorbance with an automated ELISA reader
and extrapolating the IFN-.gamma. concentration from a standard
curve. The data is expressed in secretory units (SU) as calculated
by the method described by McKinney et al. (McKinney, D. M, et al.,
J Immunol Methods 237:105 (2000)). One secretory unit is defined as
the release of 100 pg/well of IFN-.gamma. by 10.sup.6 effector
cells.
Measurement of CTL and HTL Induction by the ELISPOT Assay
[0456] ELISPOT assays to measure CTL or HTL responses induced by
EP-2101 were performed according to previously published protocols
(Lewis J J, et al., Int J Cancer 87:391 (1998)). Briefly, flat
bottom 96-well nitrocellulose plates (IP, Millipore) were coated
with IFN-.gamma. mAb (10 .mu.g/ml, clone R4-6A2, PharMingen) and
incubated overnight at 4.degree. C. After washing with PBS, plates
were blocked with RPMI-10 medium for 1 h at 37.degree. C.
Four.times.10.sup.5 CD8.sup.+ cells or CD4.sup.+ cells (isolated
with Miltenyi isolation system from EP-2101-immunized splenocytes)
and 5.times.10.sup.4 Jurkat-A2.1/K.sup.b cells (for CD8.sup.+
cells) or 10.sup.5 .gamma.-irradiated naive spleen cells (for
CD4.sup.+ cells, treated with erythrocyte lysis buffer) were added
to each well. Wells also received 10 .mu.g/ml of CTL or HTL peptide
to test for induction of responses against EP-2101 epitopes or an
identical concentration of an irrelevant peptide. The irrelevant
peptide for the CD8 ELISPOT assay was the HCV core.132 peptide
(DLMGYIPLV (SEQ ID NO:______) and the HCV NS3.1253 peptide
(GYKVLVLNPSVAATL (SEQ ID NO:______) for the CD4 ELISPOT assay.
After incubation, the plates were washed thoroughly with PBS/0.05%
Tween 20 and biotinylated IFN-.gamma. mAb (2 .mu.g/ml, clone
XMG1.2, PharMingen) was added to each well and incubated for 2-4 h
at 37.degree. C. After washing 4 times with PBS/0.05% Tween 20,
Vectastain ABC peroxidase (Vectastain Elite kit; Vector
laboratories, Inc., Burlingame, Calif., USA) was added to the wells
and plates were incubated for 1 h at room temperature. The plates
were washed again 3 times with PBS/0.05% Tween 20 followed by 3
washes with PBS. One hundred .mu.l of AEC solution (Sigma Chemical
Co) was added to develop the spots. The reaction was stopped after
4-6 minutes under running tap water. The spots were counted by
computer-assisted image analysis (Zeiss KS ELISPOT Reader, Jena,
Germany). The net number of spots/10.sup.6 CD8.sup.+ cells or
CD4.sup.+ cells was calculated as (number of spots against relevant
peptide)-(number of spots with irrelevant control
peptide).times.2.5.
[0457] It is understood that the examples and embodiments described
herein are for illustrative purposes only and that various
modifications or changes in light thereof will be suggested to
persons skilled in the art and are to be included within the spirit
and purview of this application and scope of the appended claims.
All publications, patents, patent applications and sequence
listings cited herein are hereby incorporated by reference in their
entirety for all purposes.
TABLE-US-00001 TABLE 1 Sequence of Peptides in Drug Substance
Peptide Identification Sequence Epitope Type 965.10 aKXVAAWTLKAAa
PADRE .RTM. Universal Helper T Cell Epitope 1013.08 RLLQETELV
HER-2/neu.689 Wild-type 1090.01 YLQLVFGIEV MAGE2.157 Wild-type
1243.08 LLTFWNPPV CEA.24V9 Fixed-Anchor Analog 1295.03 SMPPPGTRV
p53.149M2 Fixed-Anchor Analog 1323.06 KLBPVQLWV p53.139L2B3
Fixed-Anchor Analog 1334.10 KVFGSLAFV HER-2/neu.369V2V9
Fixed-Anchor Analog 1350.01 YLSGADLNL CEA.605D6 Heteroclitic Analog
1352.02 IMIGHLVGV CEA.691H5 Heteroclitic Analog 1352.03 KVAEIVHFL
MAGE-3.112I5 Heteroclitic Analog a = d-alanine, B =
.alpha.-aminoisobutyric acid, X = cyclohexylalanine
TABLE-US-00002 TABLE 2 Overview of current cancer vaccine
approaches. APPROACH DESCRIPTION ISSUES STRENGTHS Whole Cell
Involve the administration of Often difficult to Likely to have
Vaccines whole cancer cells with obtain tumor cells novel TAA
adjuvants which serve to Patient variability potentiate the immune
response Single patient product Has relatively low concentration of
relevant TAA epitopes Cell Lysate Consist of lysed allogeneic Often
difficult to Likely to have Vaccines cancer cell membrane particles
obtain tumor cells novel TAA that are ingested by macrophages
Patient variability and presented as tumor antigens Single patient
product to effector cells Has relatively low concentration of
relevant TAA epitopes Idiotypic Contain proteins derived from Often
difficult to Specific TAA Vaccines individual patient tumors or
from obtain tumor cells specific tumor types Patient variability
Single patient product Has relatively low concentration of relevant
TAA epitopes Whole Limited disease Complex Antigen coverage
"natural" Vaccines Difficult to break immune tolerance responses
may be elicited Relatively easy single compound manufacture Viral
Consist of vaccinia virus Often difficult to oncolysate infected
cancer cell, lysed to obtain tumor cells vaccines form membrane
segments Not always possible expressing both vaccinia and to infect
cancer cells cancer cell antigens Patient specific treatment Has
relatively low concentration of relevant TAA epitopes Shed antigen
Similar to whole cell and lysate Difficult to purify Likely to have
vaccines vaccines but are partially antigens novel TAA purified
Patient specific treatment Has relatively low concentration of
relevant TAA epitopes Genetically A number of avenues are being
Very difficult to Cells contain modified explored including the
obtain tumor tissues novel TAA tumor cell transduction of cells
with GM- and grow to allow and adjuvants vaccines CSF stable
transduction Patient specific treatment Peptide Synthetic peptides
are produced Need to choose Single Vaccines that correspond to
tumor correct peptides to preparation associated antigens. Designed
to elicit an effective used for stimulate a cytotoxic T-Cell immune
response multiple response (CTL) Restriction to HLA patients and
subtype or HLA possibly supertypes multiple diseases Possible to
combine various antigens/ targets Reproducible antigen production
Able to break tolerance Able to elicit responses to subdominant
epitopes Can be directed to supertypes for broad population
coverage Carbohydrate Synthetically produced tumor May need CTL
Single vaccines associated carbohydrates, response as well as
preparation designed to stimulate an humoral response used for
antibody response against the Carbohydrate multiple carbohydrate
antigens antigens are HTL patients and dependent possibly multiple
diseases
TABLE-US-00003 TABLE 3 POSITION POSITION POSITION C Terminus
(Primary 2 (Primary Anchor) 3 (Primary Anchor) Anchor) SUPERMOTIFS
A1 T, I, L, V, M, S F, W, Y A2 L, I, V, M, A, T, Q I, V, M, A, T, L
A3 V, S, M, A, T, L, I R, K A24 Y, F, W, I, V, L, M, T F, I, Y, W,
L, M B7 P V, I, L, F, M, W, Y, A B27 R, H, K F, Y, L, W, M, I, V, A
B44 E, D F, W, L, I, M, V, A B58 A, T, S F, W, Y, L, I, V, M, A B62
Q, L, I, V, M, P F, W, Y, M, I, V, L, A MOTIFS A1 T, S, M Y A1 D,
E, A, S Y A2.1 L, M, V, Q, I, A, T V, L, I, M, A, T A3 L, M, V, I,
S, A, T, F, K, Y, R, H, F, A C, G, D A11 V, T, M, L, I, S, A, K, R,
Y, H G, N, C, D, F A24 Y, F, W, M F, L, I, W A*3101 M, V, T, A, L,
I, S R, K A*3301 M, V, A, L, F, I, S, T R, K A*6801 A, V, T, M, S,
L, I R, K B*0702 P L, M, F, W, Y, A, I, V B*3501 P L, M, F, W, Y,
I, V, A B51 P L, I, V, F, W, Y, A, M B*5301 P I, M, F, W, Y, A, L,
V B*5401 P A, T, I, V, L, M, F, W, Y SUPERMOTIFS A1 T, I, L, V, M,
S F, W, Y A2 V, Q, A, T I, V, L, M, A, T A3 V, S, M, A, T, L, I R,
K A24 Y, F, W, I, V, L, M, T F, I, Y, W, L, M B7 P V, I, L, F, M,
W, Y, A B27 R, H, K F, Y, L, W, M, I, V, A B58 A, T, S F, W, Y, L,
I, V, M, A B62 Q, L, I, V, M, P F, W, Y, M, I, V, L, A MOTIFS A1 T,
S, M Y A1 D, E, A, S Y A2.1 V, Q, A, T* V, L, I, M, A, T A3.2 L, M,
V, I, S, A, T, F, K, Y, R, H, F, A C, G, D A11 V, T, M, L, I, S, A,
K, R, H, Y G, N, C, D, F A24 Y, F, W F, L, I, W *If 2 is V, or Q,
the C-term is not L Bolded residues are preferred, italicized
residues are less preferred: A peptide is considered motif-bearing
if it has primary anchors at each primary anchor position for a
motif or supermotif as specified in the above table.
TABLE-US-00004 TABLE 4 ##STR00001## ##STR00002## ##STR00003##
##STR00004## ##STR00005## ##STR00006## ##STR00007## ##STR00008##
##STR00009## ##STR00010## SUPERMOTIFS A1 1.degree. Anchor 1.degree.
Anchor T, I, L, V, M, S F, W, Y A2 1.degree. Anchor 1.degree.
Anchor L, I, V, M, A, L, I, V, M, A, T T, Q A3 preferred --
1.degree. Anchor Y, F, W, (4/5) Y, F, W, Y, F, W, (4/5) P, (4/5)
1.degree. Anchor V, S, M, A, T, (3/5) R, K L, I deleterious D, E
(3/5); P, (5/5) D, E, (4/5) 1.degree. Anchor 1.degree. Anchor A24
Y, F, W, I, V, F, I, Y, W, L, M L, M, T B7 preferred F, W, Y (5/5)
1.degree. Anchor F, W, Y (4/5) F, W, Y, 1.degree. Anchor L, I, V,
M, (3/5) P (3/5) V, I, L, F, M, W, Y, A deleterious D, E (3/5); P
(5/5); D, E, (3/5) G, (4/5) Q, N, (4/5) D, E, (4/5) G (4/5); A
(3/5); Q, N, (3/5) 1.degree. Anchor 1.degree. Anchor B27 R, H, K F,
Y, L, W, M, V, A 1.degree. Anchor 1.degree. Anchor B44 E, D F, W,
Y, L, I, M, V, A 1.degree. Anchor 1.degree. Anchor B58 A, T, S F,
W, Y, L, I, V, M, A 1.degree. Anchor 1.degree. Anchor B62 Q, L, I,
V, M, F, W, Y, M, I, V, L, A P ##STR00011## ##STR00012##
##STR00013## ##STR00014## ##STR00015## ##STR00016## ##STR00017##
##STR00018## ##STR00019## ##STR00020## ##STR00021## MOTIFS A1
preferred G, F, Y, W, 1.degree. Anchor D, E, A, Y, F, W, P, D, E,
Q, N, Y, F, W, 1.degree. Anchor 9-mer S, T, M, Y deleterious D, E,
R, H, K, L, I, V A, G, A, M, P, A1 preferred G, R, H, K A, S, T, C,
L, I 1.degree. Anchor G, S, T, C, A, S, T, C, L, I, V, M, D, E,
1.degree. Anchor 9-mer V, M, D, E, A, S Y deleterious A R, H, K, D,
E, D, E, P, Q, N, R, H, K, P, G, G, P, P, Y, F, W, A1 peferred Y,
F, W, 1.degree. Anchor D, E, A, Q, N, A, Y, F, W, Q, N, P, A, S, T,
C, G, D, E, P, 1.degree. Anchor 10-mer S, T, M Y deleterious G, P,
R, H, K, G, L, I D, E, R, H, K, Q, N, A R, H, K, Y, F, R, H, K, A
V, M, W, A1 preferred Y, F, W, S, T, C, L, I, V 1.degree. Anchor A,
Y, F, W, P, G, G, Y, F, W, 1.degree. Anchor 10-mer M, D, E, A, S Y
deleterious R, H, K, R, H, K, D, E, P, G, P, R, H, K, Q, N, P, Y,
F, W, A2.1 preferred Y, F, W, 1.degree. Anchor Y, F, W, S, T, C, Y,
F, W, A, P 1.degree. Anchor 9-mer L, M, I, V, Q, V, L, I, M, A, T
A, T deleterious D, E, P, D, E, R, K, H R, K, H D, E, R, K, H A2.1
preferred A, Y, F, W, 1.degree. Anchor L, V, I, M, G, G, F, Y, W,
L, 1.degree. Anchor 10-mer L, M, I, V, Q, V, I, M, V, L, I, M, A, T
A, T deleterious D, E, P, D, E, R, K, H, A, P, R, K, H, D, E, R, K,
R, K, H, H, A3 preferred R, H, K, 1.degree. Anchor Y, F, W, P, R,
H, K, Y, A, Y, F, W, P, 1.degree. Anchor L, M, V, I, S, F, W, K, Y,
R, H, F, A A, T, F, C, G D deleterious D, E, P, D, E A11 preferred
A, A1.degree. Anchor Y, F, W, Y, F, W, A, Y, F, W, Y, F, W, P,
1.degree. Anchor V, T, L, M, I, K,, RY, H S, A, G, N, C, D, F
deleterious D, E, P, A G, A24 preferred Y, F, W, R, H, K, 1.degree.
Anchor S, T, C Y, F, W, Y, F, W, 1.degree. Anchor 9-mer Y, F, W, M
F, L, I, W deleterious D, E, G, D, E, G, Q, N, P, D, E, R, H, K, G,
A, Q, N, A24 preferred 1.degree. Anchor P, Y, F, W, P, P, 10-mer Y,
F, W, M F, L, I, W deleterious G, D, E Q, N R, H, K D, E A Q, N, D,
E, A, A3101 preferred R, H, K, 1.degree. Anchor Y, F, W, P, Y, F,
W, Y, F, W, A, P, 1.degree. Anchor M, V, T, A, L, R, K I, S
deleterious D, E, P, D, E, A, D, E, D, E, D, E, D, E, A3301
preferred 1.degree. Anchor Y, F, W A, Y, F, W 1.degree. Anchor M,
V, A, L, F, R, K I, S, T deleterious G, P D, E A6801 preferred Y,
F, W, S, T, C, 1.degree. Anchor Y, F, W, L, I, Y, F, W, P,
1.degree. Anchor A, V, T, M, S, V, M R, K L, I deleterious G, P, D,
E, G, R, H, K, A, B0702 preferred R, H, K, F, W, Y, 1.degree.
Anchor R, H, K, R, H, K, R, H, K, R, H, K, P, A, 1.degree. Anchor P
L, M, F, W, Y, A, I, V deleterious D, E, Q, N, P, D, E, P, D, E, D,
E, G, D, E, Q, N, D, E, B3501 preferred F, W, Y, L, I, V, M,
1.degree. Anchor F, W, Y, F, W, Y, 1.degree. Anchor P L, M, F, W,
Y, I, V, A deleterious A, G, P, G, G, B51 preferred L, I, V, M, F,
W, Y, 1.degree. Anchor F, W, Y, S, T, C, F, W, Y, G, F, W, Y,
1.degree. Anchor P L, I, V, F, W, Y, A, M deleterious A, G, P, D,
E, R, H, K, D, E, G, D, E, Q, N, G, D, E, S, T, C, B5301 preferred
L, I, V, M, F, W, Y, 1.degree. Anchor F, W, Y, S, T, C, F, W, Y, L,
I, V, M, F, F, W, Y, 1.degree. Anchor P W, Y, I, M, F, W, Y, A, L,
V deleterious A, G, P, Q, N, G, R, H, K, Q, N, D, E, B5401
preferred F, W, Y, 1.degree. Anchor F, W, Y, L, I, V L, I, V, M, A,
L, I, V, M, F, W, Y, A, P, 1.degree. Anchor P M, A, T, I, V, L, M,
F, W, Y deleterious G, P, Q, N, D, E, G, D, E, S, T, C, R, H, K, D,
E, D, E, Q, N, D, G, E, D, E, Italicized residues indicate less
preferred or "tolerated" residues. The information in Table II is
specific for 9-mers unless otherwise specified. Secondary anchor
specificities are designated for each position independently.
TABLE-US-00005 TABLE 5 Expression of Tumor Associated Antigen (TAA)
% of Tumors Expressing the TAA TAA Colon Cancer Breast Cancer Lung
Cancer CEA 95 50 70 P53 50 50 40-60 MAGE 2/3 20-30 20-30 35
HER2/neu 28-50 30-50 20-30 Total 99 86-91 91-95
TABLE-US-00006 TABLE 6 HLA- Allelle-specific HLA-supertype members
supertype Verified.sup.a Predicted.sup.b A1 A*0101, A*2501, A*2601,
A*2602, A*0102, A*2604, A*3601, A*4301, A*3201, A*2902 A*8001 A2
A*0201, A*0202, A*0203, A*0204, A*0208, A*0210, A*0211, A*0212,
A*0205, A*0206, A*0207, A*0209, A*0213 A*0214, A*6802, A*6901 A3
A*0301, A*1101, A*3101, A*3301, A*6801 A*0302, A*1102, A*2603,
A*3302, A*3303, A*3401, A*3402, A*6601, A*6602, A*7401 A24 A*2301,
A*2402, A*3001 A*2403, A*2404, A*3002, A*3003 B7 B*0702, B*0703,
B*0704, B*0705, B*1508, B*1511, B*4201, B*5901 B*3501, B*3502,
B*3503, B*3503, B*3504, B*3505, B*3506, B*3507, B*3508, B*5101,
B*5102, B*5103, B*5104, B*5105, B*5301, B*5401, B*5501, B*5502,
B*5601, B*5602, B*6701, B*7801 B27 B*1401, B*1402, B*1509, B*2702,
B*2703, B*2701, B*2707, B*2708, B*3802, B*2704, B*2705, B*2706,
B*3801, B*3901, B*3903, B*3904, B*3905, B*4801, B*3902, B*7301
B*4802, B*1510, B*1518, B*1503 B44 B*1801, B*1802, B*3701, B*4402,
B*4403, B*4101, B*4501, B*4701, B*4901, B*4404, B*4001, B*4002,
B*4006 B*5001 B58 B*5701, B*5702, B*5801, B*5802, B*1516, B*1517
B62 B*1501, B*1502, B*1513, B*5201 B*1301, B*1302, B*1504, B*1505,
B*1506, B*1507, B*1515, B*1520, B*1521, B*1512, B*1514, B*1510
.sup.aVerified alleles include alleles whose specificity has been
determined by pool sequencing analysis, peptide binding assays, or
by analysis of the sequences of CTL epitopes. .sup.bPredicted
alleles are alleles whose specificity is predicted on the basis of
B and F pocket structure to overlap with the supertype
specificity.
TABLE-US-00007 TABLE 7 Expression of Tumor Associated Antigen (TAA)
% of Tumors Expressing the TAA TAA Colon Cancer Breast Cancer Lung
Cancer CEA 95 50 70 P53 50 50 40-60 MAGE 2/3 20-30 20-30 35
HER2/neu 28-50 30-50 20-30 Total 99 86-91 91-95
TABLE-US-00008 TABLE 8 Incidence and survival rate of patients with
breast, colon, or lung cancer in the United States Estimated New
Cases Estimate 5-Year relative survival rates 1998 Deaths 1998
1974-76 1980-82 1986-1993 Breast 180,300 43,900 75% 77% 80% Colon
95,600 47,700 50% 56% 63% Lung 171,500 160,100 12% 14% 14% Source:
Cancer Statistics 1998. January/February 1998, Vol. 48, No. 1
TABLE-US-00009 TABLE 9 Population coverage by HLA class I supertype
epitopes. Minimal Allelic Frequency Representative HLA Supertype
Molecules* Caucasian Black Japanese Chinese Hispanic Average A2
2.1, 2.2, 2.3, 2.5, 45.8 39.0 42.4 45.9 43.0 43.2 2.6, 2.7, 68.02
A3 3, 11, 31, 33, 37.5 42.1 45.8 52.7 43.1 44.2 68.01 B7 7, 51, 53,
35, 54 43.2 55.1 57.1 43.0 49.3 49.5 Total Population Coverage 84.3
86.8 89.5 89.8 86.8 87.4
TABLE-US-00010 TABLE 10 Tumor Associated Antigens and Genes (TAA)
ANTIGEN REFERENCE MAGE 1 (Traversari C., Boon T, J. Ex. Med 176:
1453, 1992) MAGE 2 (De Smet C., Boon T, Immunogenetics, 39(2)121-9,
1994) MAGE 3 (Gaugler B., Boon T, J. Ex. Med 179: 921, 1994)
MAGE-11 (Jurk M., Winnacker L, Int. J. Cancer 75, 762-766, 1998)
MAGE-A10 (Huang L., Van Pel A, J. Immunology, 162: 6849-6854) BAGE
(Boel P., Bruggen V, Immunity 2: 167, 1995) GAGE (Eynde V., Boon T,
J. Exp. Med 182: 689, 1995) RAGE (Gaugler B., Eynde V,
Immunogenetics, 44: 325, 1996) MAGE-C1 (Lucas S., Boon T, Cancer
Research, 58, 743-752, 1998) LAGE-1 (Lethel B., Boon T, Int J
cancer, 10; 76(6) 903-908 CAG-3 (Wang R--Rosenberg S, J.
Immunology, 161: 3591-3596, 1998) DAM (Fleischhauer K., Traversari
C, Cancer Research, 58, 14, 2969, 1998) MUC1 (Karanikas V.,
McKenzie IF, J. clnical investigation, 100: 11, 1-10, 1997) MUC2
(Bohm C., Hanski, Int. J. Cancer 75, 688-693, 1998) MUC18 (Putz E.,
Pantel K, Cancer Res 59(1): 241-248, 1999) NY-ES0-1 (Chen Y., Old
LJ PNAS, 94, 1914-18, 1997) MUM-1 (Coulie P., Boon T, PNAS 92:
7976, 1995) CDK4 (Wolfel T., Beach D, Science 269: 1281, 1995)
BRCA2 (Wooster R---Stratton M, Nature, 378, 789-791, 1995) NY-LU-1
(Gure A., Chen, Cancer Research, 58, 1034-41, 1998) NY-LU-7 (Gure
A., Chen, Cancer Research, 58, 1034-41, 1998) NY-LU-12 (Gure A.,
Chen, Cancer Research, 58, 1034-41, 1998) CASP8 (Mandruzzato S.,
Bruggen P, J. Ex. Med 186, 5, 785-793, 1997) RAS (Sidransky D.,
Vogelstein B, Science, 256: 102) KIAA0205 (Gueguen M., Eynde, J.
Immunology, 160: 6188-94, 1998) SCCs (Molina R., Ballesta AM, Tumor
Biol, 17(2): 81-9, 1996) p53 (Hollstein M., Harris CC, Science,
253, 49-53, 1991) p73 (Kaghad M., Caput D, Cell; 90(4): 809-19,
1997) CEA (Muraro R., Schlom J, Cancer Research, 45: 5769-55780,
1985) Her 2/neu (Disis M., Cheever M, Cancer Res 54: 1071, 1994)
Melan-A (Coulie P., Boon T, J. Ex. Med, 180: 35, 1994) gp100
(Bakker A., Figdor, J. Ex. Med 179: 1005, 1994) Tyrosinase (Wolfel
T., Boon T, E. J. I 24: 759, 1994) TRP2 (Wang R., Rosenberg S. A,
J. Ex. Med 184: 2207, 1996) gp75/TRP1 (Wang R., Rosenberg S. A, J.
Ex. Med 183: 1131, 1996) PSM (Pinto J. T., Heston W. D. W., Clin
Cancer Res 2(9); 1445-1451, 1996) PSA (Correale P., Tsang K, J.
Natl cancer institute, 89: 293-300, 1997) PT1-1 (Sun Y., Fisher PB,
Cancer Research, 57(1): 18-23, 1997) B-catenin (Robbins P.,
Rosenberg SA, J. Ex. Med 183: 1185, 1996) PRAME (Neumann E.,
Seliger B, Cancer Research, 58, 4090-4095, 1998) Telomearse
(Kishimoto K., Okamoto E, J Surg Oncol, 69(3): 119-124, 1998) FAK
(Kornberg LJ, Head Neck, 20(8): 745-52, 1998) Tn antigen (Wang Bl,
J Submicrosc Cytol Path, 30(4): 503-509, 1998) cyclin D1 protein
(Linggui K., Yaowu Z, Cancer Lett 130(1-2), 93-101, 1998) NOEY2 (Yu
Y., Bat RC, PNAS, 96(1): 214-219, 1999) EGF-R (Biesterfeld S.---
Cancer Weekly, Feb. 15, 1999) SART-1 (Matsumoto H., Itoh K,
Japanese Journal of Cancer Research, 59, iss12, 1292-1295, 1998)
CAPB (Cancer Weekly, Mar. 29, 4-5, 1999) HPVE7 (Rosenberg S. A.
Immunity, 10, 282-287, 1999) p15 (Rosenberg S. A., Immunity, 10,
282-287, 1999) Folate receptor (Gruner B. A., Weitman S. D.,
Investigational New Drugs, Vol16, iss3, 205-219, 1998) CDC27 (Wang
R. F., Rosenberg SA, Science, vol 284, 1351-1354, 1999) PAGE-1
(Chen, J. Biol. Chem: 273: 17618-17625, 1998) PAGE-4 (Brinkmann:
PNAS, 95: 10757, 1998) Kallikrein 2 (Darson: Urology, 49: 857-862,
1997) PSCA (Reiter R., PNAS, 95: 1735-1740, 1998) DD3 (Bussemakers
M. J. G, European Urology, 35: 408-412, 1999) RBP-1 (Takahashi T.,
British Journal of Cancer, 81(2): 342-349, 1999) RU2 (Eybde V. D.,
J. Exp. Med, 190 (12): 1793-1799, 1999) Folate binding (Kim D.,
Anticancer Research, 19: 2907-2916, 1999) protein EGP-2
(Heidenreich R., Human Gene Therapy, 11: 9-19, 2000)
TABLE-US-00011 TABLE 11 Tumor-associated antigen (TAA) sequences
CEA SEQ ID NO: 11
MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKE
VLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREI
IYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSIS
SNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTL
TLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYR
SGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQ
AHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQ
NTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELS
VDHSDPVILNYLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWL
IDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAEL
PKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLS
NGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISP
PDSSYLSGANLNSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNG
TYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVAL I Her2/neu SEQ
ID NO: 12 MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLY
QGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLR
IVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILK
GGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCK
GSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHS
DCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHL
REVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVF
ETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRP
EDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVLQGL
PREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARC
PSGVKPDLSYMPIWKFPDEEGACQPCPINCTHSCVDLDDKGCPAEQRASP
LTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPL
TPSGAMPNQAQMRILKETELRKVKVLGSGAFGTVYKGIWIPDGENVKIPV
AIKVLRENTSPKANKEILDEAYVMAGVGSPYVSRLLGICLTSTVQLVTQL
MPYGCLLDHVRENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARN
VLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTDV
YMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPASPLD
STFYRSLLEDDDMGDLVDAEEYLVPQQGFFCPDPAPGAGGMVHHRHRSSS
TRSGGGDLTLGLEPSEEEAPRSPLAPSEGAGSDVFDGDLGMGAAKGLQSL
PTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPEYVNQPDVRPQPPS
PREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQG
GAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGL DVPV MAGE2 SEQ
ID NO: 13 MPLEQRSQHCKPEEGLEARGEALGLVGAQALPATEEQQTASSSSTLVEVT
LGEVPAADSPSPPHSPQGASSFSTTINYTLWRQSDEGSSNQEEEGPRMFP
DLESEFQAAISRKMVELVHFLLLKYRAREPVTKAEMLESVLRNCQDFFPV
IFSKASEYLQLVFGIEVVEVVPISHLYILVTCLGLSYDGLLGDNQVMPKT
GLLIIVLAIIAIEGDCAPEEKIWEELSMLEVFEGREDSVFAHPRKLLMQD
LVQENYLEYRQVPGSDPACYEFLWGPRALIETSYVKVLHHTLKIGGEPHI SYPPLHERALREGEE
MAGE3 SEQ ID NO: 14
MLPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVT
LGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFF
PDLESEFQAALSRKVAELVHFLLLKYRAREPVTKAEMLGSVVGNWQYFFP
VFSKASSSLQLVFGIELMEVDPIGHLYIFATCLGLSYDGLLGDNQIMPKA
GLLIIYLAIIAREGDCAPEEKIWEELSVLEVFEGREDSILGDPKKLLTQH
FVQENYLEYRQVPGSDPACYEFLWGPRALVETSYVKVLHHMVKISGGPHI SYPPLHEWVLREGEE
p53 SEQ ID NO: 15
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDI
EQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQ
KTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDST
PPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGN
LRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRP
ILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP
PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRLELNEALE
LKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD
TABLE-US-00012 TABLE 12 Hepatitis B Virus Core Protein (SEQ ID NO:
16) MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATW
VGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVS
FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP RRRRSQSRESQC
TABLE-US-00013 TABLE 13 HLA-A2 Supertype Family Alleles Prototype
Additional Allele Supertype Alleles HLA-A*0201 HLA-A*0202, A*0203,
A*0204, A*0205, A*0206, A*0207, A*6802, A*6901
TABLE-US-00014 TABLE 14 List of Vaccine Epitopes No. A2 CTL
Response Peptide Alleles Wild-type Tumor Reference for Wild-type
Epitope Sequence Number Crossbound.sup.1 Peptide Cell or Analog
Epitope Wild-type Epitopes HER-2/neu.689 RLLQETELV 1013.08 2 + +
Knutson KL, 2001; Rongcun Y, 1999 MAGE-2.157 YLQLVFGIEV 1090.01 4 +
+ Visseren MJ, 1997; Kawashima I, 1998 Fixed-anchor Analogs
CEA.24V9 LLTFWNPPV 1243.08 4 + + Kawashima I,, 1998
HER-2/neu.369V2V9 KVFGSLAFV 1334.10 4 + + Keogh E, 2001 p53.139L2B3
KLBPVQLWV.sup.2 1323.06 4 + + Keogh E, 2001 p53.149M2 SMPPPGTRV
1295.03 4 + + Keogh E, 2001; Petersen TR, 2001 Heteroclitic Analogs
CEA.691H5 IMIGHLVGV 1352.02 5 + + Tangri S, 2001 MAGE-3.112I5
KVAEIVHFL 1352.03 5 + + Tangri S, 2001 CEA.605D6 YLSGADLNL 1350.01
3 + + Zaremba S, 1997 Universal Helper T Cell Epitope PADRE
aKXVAAWTLKAAa.sup.3 965.10 Alexander 3, 1994 .sup.1All peptides
bind to the prototype HLA-A2.1 molecule. .sup.2B indicates
.alpha.-aminoisobutyric acid. .sup.3X indicates cyclohexylalanine
and a indicates d-alanine.
TABLE-US-00015 TABLE 15 Peptide Solubility Acidic Basic Peptide
conditions (pH 2-4).sup.1 conditions (pH 9.6-13).sup.2 DMSO 965.10
+ -.sup.3 + 1013.08 +/-.sup.4 + + 1090.01 -.sup.5 + + 1243.08
+.sup.6 + + 1295.03 + +.sup.7 + 1323.06 +.sup.6 + + 1334.10 + - +
1350.01 +.sup.6 + + 1352.02 + - + 1352.03 + +.sup.7 + .sup.10.1%
TFA, 0.15-0.1875 M acetic acid, 25 mM pH 4 sodium acetate .sup.225
mM pH 9.6 arginine, 25 mM pH 9.6 sodium bicarbonate, 0.1 M NaOH
.sup.3Not tested in 0.1 M NaOH, assumed insoluble since not soluble
under other basic conditions .sup.4Not soluble in pH 4 acetate
buffer .sup.5Not tested in diluted acetic acid, assumed insoluble
under these conditions since insoluble under other acidic
conditions .sup.6Not tested in diluted acetic acid, assumed soluble
under these conditions since soluble in 0.1% TFA .sup.7Not tested
in 0.1 M NaOH, assumed soluble under these conditions since soluble
in other basic buffers
TABLE-US-00016 TABLE 16 Release Specifications of Bulk Drug
Substance Component Peptides Test Name Test Method Specification
Appearance Visual White to off-white powder Identity Mass
spectrometry Molecular Weight Tandem mass Sequence of peptide
spectrometry Amino acid analysis Amino acid composition Purity HPLC
.gtoreq.90% Acetate Content Ion chromatography Report result
Peptide content AAA or UV Report results Residual Organic USP 24
<467> Isopropanol .ltoreq.300 ppm Volatiles USP 24
<467> Methylene chloride .ltoreq.20 ppm USP 24 <467>
Acetonitrile .ltoreq.100 ppm Water Content USP 24 <921>
Report results Endotoxin USP 24 <85> .ltoreq.0.5 EU/mg
Bioburden USP 24 <61> Report results Total Fluorine
Combustion/ISE Report results Total Mass Balance Calculation
90-105% NPC + HOAc + H.sub.2O
TABLE-US-00017 TABLE 17 Components and Quantitative Composition of
EP-2101 Drug Product Component Name Concentration (g/L) Peptide
965.10 0.5 1013.08 0.5 1090.01 0.5 1243.08 0.5 1295.03 0.5 1323.06
0.5 1334.10 0.5 1350.01 0.5 1352.02 0.5 1352.03 0.5 Adjuvant
Montanide .RTM. ISA 51 459 Excipients Sodium acetate 2.83 Sodium
phosphate, dibasic 0.33 DMSO (USP) 50.5
TABLE-US-00018 TABLE 18 Components for Use in the Manufacture of
EP-2101 Drug Product Components for Manufacture of EP-2101 Drug
Product Peptides 1352.02 1295.03 1352.03 965.10 1243.08 1350.01
1013.08 1090.01 1323.06 1334.10 Chemicals/Solutions Acetic Acid
(USP) NaOH anhydrous (NF) DMSO (USP)
Na.sub.2HPO.sub.4.cndot.7H.sub.2O (USP) Sterile Water for Injection
(USP) Adjuvant Montanide .RTM. ISA 51
TABLE-US-00019 TABLE 19 Pool Assignments for EP-2101 Peptide
Epitopes Amino Solution Solution Solution Peptide Acid Sequence 1 2
3 965.10 AkXVAAWTLKAAa + PADRE .RTM. 1013.08 RLLQETELV + 1090.01
YLQLVFG1EV + 1243.08 LLTFWNPPV + 1295.03 SMPPPGTRV + 1323.06
KLBPVQLWV + 1334.10 KVFGSLAFV + 1350.01 YLSGADLNL + 1352.02
LMIGHLVGV + 1352.03 KVABIVHFL + + = solution assignment, a =
d-alanine, B = .alpha.-aminoisobutyric acid, X =
cyclohexylalanine
TABLE-US-00020 TABLE 20 Specifications of EP-2101 Bulk Drug Product
Test Name Test Method Specification Endotoxin USP 25 <85>
.ltoreq.10 EU/ml Sterility USP 25 <71> No growth after 14
days
TABLE-US-00021 TABLE 21 Specifications of EP-2101 Drug Product Test
Name Test Method Specification Appearance Visual White to pale
yellow emulsion Endotoxin USP 25 <85> .ltoreq.20 EU/ml
Sterility USP 25 <71> No growth after 14 days (conforms with
21 CFR 610.12) Viscosity Plate and cone Report value PH pH
electrode pH 7.0 .+-. 1.0 Particle size Laser light Report value
distribution diffraction Peptide concentration HPLC 0.50 .+-. 0.25
mg/ml of each peptide of emulsion Identity HPLC Conforms to
standard Extractable volume Syringe withdrawal .gtoreq.1.00 ml
Potency In vivo Peptide 1352.02: .gtoreq.22 SU immunogenicity and
.ltoreq.2900 SU Peptide 1334.10: .gtoreq.8 SU and .ltoreq.3300
SU
TABLE-US-00022 TABLE 22 HPLC Parameters for Determination of
Peptide Concentration HPLC Parameters Mobile Phase A: 0.1% TFA
Mobile Phase B: 0.1% TFA in 80% Acetonitrile in water, Column:
PLRP-S (300 A, 5 .mu.m, 4.6 .times. 250 mm), Polymer Laboratories
Flow-rate: 1.0 ml/min Wavelength: 214 nm Column temperature:
40.degree. C. Autosampler temperature: Ambient Solvent Gradient
Time (min) Flow (ml/min) % A % B Curve 0.00 1.0 95.0 5.0 N/A 5.00
1.0 80.0 20.0 Linear 40.00 1.0 60.0 40.0 Linear 54.00 1.0 5.0 95.0
Linear 60.00 1.0 5.0 95.0 Linear 65.00 1.0 95.0 5.0 Linear 77.00
1.0 95.0 5.0 Linear
Sequence CWU 1
1
43113PRTMus sp.MISC_FEATURE(1)..(1)Ala is D-alanine. 1Ala Lys Xaa
Val Ala Ala Trp Thr Leu Lys Ala Ala Ala1 5 1029PRTMus. sp 2Arg Leu
Leu Gln Glu Thr Glu Leu Val1 5310PRTMus sp. 3Tyr Leu Gln Leu Val
Phe Gly Ile Glu Val1 5 1049PRTMus sp. 4Leu Leu Thr Phe Trp Asn Pro
Pro Val1 559PRTMus sp. 5Ser Met Pro Pro Pro Gly Thr Arg Val1
569PRTMus sp.MISC_FEATURE(3)..(3)Xaa is alpha-aminoisobutyric acid.
6Lys Leu Xaa Pro Val Gln Leu Trp Val1 579PRTMus sp. 7Lys Val Phe
Gly Ser Leu Ala Phe Val1 589PRTMus sp. 8Tyr Leu Ser Gly Ala Asp Leu
Asn Leu1 599PRTMus sp. 9Ile Met Ile Gly His Leu Val Gly Val1
5109PRTMus sp. 10Lys Val Ala Glu Ile Val His Phe Leu1 511702PRTMus
sp. 11Met Glu Ser Pro Ser Ala Pro Pro His Arg Trp Cys Ile Pro Trp
Gln1 5 10 15Arg Leu Leu Leu Thr Ala Ser Leu Leu Thr Phe Trp Asn Pro
Pro Thr 20 25 30Thr Ala Lys Leu Thr Ile Glu Ser Thr Pro Phe Asn Val
Ala Glu Gly 35 40 45Lys Glu Val Leu Leu Leu Val His Asn Leu Pro Gln
His Leu Phe Gly 50 55 60Tyr Ser Trp Tyr Lys Gly Glu Arg Val Asp Gly
Asn Arg Gln Ile Ile65 70 75 80Gly Tyr Val Ile Gly Thr Gln Gln Ala
Thr Pro Gly Pro Ala Tyr Ser 85 90 95Gly Arg Glu Ile Ile Tyr Pro Asn
Ala Ser Leu Leu Ile Gln Asn Ile 100 105 110Ile Gln Asn Asp Thr Gly
Phe Tyr Thr Leu His Val Ile Lys Ser Asp 115 120 125Leu Val Asn Glu
Glu Ala Thr Gly Gln Phe Arg Val Tyr Pro Glu Leu 130 135 140Pro Lys
Pro Ser Ile Ser Ser Asn Asn Ser Lys Pro Val Glu Asp Lys145 150 155
160Asp Ala Val Ala Phe Thr Cys Glu Pro Glu Thr Gln Asp Ala Thr Tyr
165 170 175Leu Trp Trp Val Asn Asn Gln Ser Leu Pro Val Ser Pro Arg
Leu Gln 180 185 190Leu Ser Asn Gly Asn Arg Thr Leu Thr Leu Phe Asn
Val Thr Arg Asn 195 200 205Asp Thr Ala Ser Tyr Lys Cys Glu Thr Gln
Asn Pro Val Ser Ala Arg 210 215 220Arg Ser Asp Ser Val Ile Leu Asn
Val Leu Tyr Gly Pro Asp Ala Pro225 230 235 240Thr Ile Ser Pro Leu
Asn Thr Ser Tyr Arg Ser Gly Glu Asn Leu Asn 245 250 255Leu Ser Cys
His Ala Ala Ser Asn Pro Pro Ala Gln Tyr Ser Trp Phe 260 265 270Val
Asn Gly Thr Phe Gln Gln Ser Thr Gln Glu Leu Phe Ile Pro Asn 275 280
285Ile Thr Val Asn Asn Ser Gly Ser Tyr Thr Cys Gln Ala His Asn Ser
290 295 300Asp Thr Gly Leu Asn Arg Thr Thr Val Thr Thr Ile Thr Val
Tyr Ala305 310 315 320Glu Pro Pro Lys Pro Phe Ile Thr Ser Asn Asn
Ser Asn Pro Val Glu 325 330 335Asp Glu Asp Ala Val Ala Leu Thr Cys
Glu Pro Glu Ile Gln Asn Thr 340 345 350Thr Tyr Leu Trp Trp Val Asn
Asn Gln Ser Leu Pro Val Ser Pro Arg 355 360 365Leu Gln Leu Ser Asn
Asp Asn Arg Thr Leu Thr Leu Leu Ser Val Thr 370 375 380Arg Asn Asp
Val Gly Pro Tyr Glu Cys Gly Ile Gln Asn Glu Leu Ser385 390 395
400Val Asp His Ser Asp Pro Val Ile Leu Asn Val Leu Tyr Gly Pro Asp
405 410 415Asp Pro Thr Ile Ser Pro Ser Tyr Thr Tyr Tyr Arg Pro Gly
Val Asn 420 425 430Leu Ser Leu Ser Cys His Ala Ala Ser Asn Pro Pro
Ala Gln Tyr Ser 435 440 445Trp Leu Ile Asp Gly Asn Ile Gln Gln His
Thr Gln Glu Leu Phe Ile 450 455 460Ser Asn Ile Thr Glu Lys Asn Ser
Gly Leu Tyr Thr Cys Gln Ala Asn465 470 475 480Asn Ser Ala Ser Gly
His Ser Arg Thr Thr Val Lys Thr Ile Thr Val 485 490 495Ser Ala Glu
Leu Pro Lys Pro Ser Ile Ser Ser Asn Asn Ser Lys Pro 500 505 510Val
Glu Asp Lys Asp Ala Val Ala Phe Thr Cys Glu Pro Glu Ala Gln 515 520
525Asn Thr Thr Tyr Leu Trp Trp Val Asn Gly Gln Ser Leu Pro Val Ser
530 535 540Pro Arg Leu Gln Leu Ser Asn Gly Asn Arg Thr Leu Thr Leu
Phe Asn545 550 555 560Val Thr Arg Asn Asp Ala Arg Ala Tyr Val Cys
Gly Ile Gln Asn Ser 565 570 575Val Ser Ala Asn Arg Ser Asp Pro Val
Thr Leu Asp Val Leu Tyr Gly 580 585 590Pro Asp Thr Pro Ile Ile Ser
Pro Pro Asp Ser Ser Tyr Leu Ser Gly 595 600 605Ala Asn Leu Asn Leu
Ser Cys His Ser Ala Ser Asn Pro Ser Pro Gln 610 615 620Tyr Ser Trp
Arg Ile Asn Gly Ile Pro Gln Gln His Thr Gln Val Leu625 630 635
640Phe Ile Ala Lys Ile Thr Pro Asn Asn Asn Gly Thr Tyr Ala Cys Phe
645 650 655Val Ser Asn Leu Ala Thr Gly Arg Asn Asn Ser Ile Val Lys
Ser Ile 660 665 670Thr Val Ser Ala Ser Gly Thr Ser Pro Gly Leu Ser
Ala Gly Ala Thr 675 680 685Val Gly Ile Met Ile Gly Val Leu Val Gly
Val Ala Leu Ile 690 695 700121255PRTMus sp. 12Met Glu Leu Ala Ala
Leu Cys Arg Trp Gly Leu Leu Leu Ala Leu Leu1 5 10 15Pro Pro Gly Ala
Ala Ser Thr Gln Val Cys Thr Gly Thr Asp Met Lys 20 25 30Leu Arg Leu
Pro Ala Ser Pro Glu Thr His Leu Asp Met Leu Arg His 35 40 45Leu Tyr
Gln Gly Cys Gln Val Val Gln Gly Asn Leu Glu Leu Thr Tyr 50 55 60Leu
Pro Thr Asn Ala Ser Leu Ser Phe Leu Gln Asp Ile Gln Glu Val65 70 75
80Gln Gly Tyr Val Leu Ile Ala His Asn Gln Val Arg Gln Val Pro Leu
85 90 95Gln Arg Leu Arg Ile Val Arg Gly Thr Gln Leu Phe Glu Asp Asn
Tyr 100 105 110Ala Leu Ala Val Leu Asp Asn Gly Asp Pro Leu Asn Asn
Thr Thr Pro 115 120 125Val Thr Gly Ala Ser Pro Gly Gly Leu Arg Glu
Leu Gln Leu Arg Ser 130 135 140Leu Thr Glu Ile Leu Lys Gly Gly Val
Leu Ile Gln Arg Asn Pro Gln145 150 155 160Leu Cys Tyr Gln Asp Thr
Ile Leu Trp Lys Asp Ile Phe His Lys Asn 165 170 175Asn Gln Leu Ala
Leu Thr Leu Ile Asp Thr Asn Arg Ser Arg Ala Cys 180 185 190His Pro
Cys Ser Pro Met Cys Lys Gly Ser Arg Cys Trp Gly Glu Ser 195 200
205Ser Glu Asp Cys Gln Ser Leu Thr Arg Thr Val Cys Ala Gly Gly Cys
210 215 220Ala Arg Cys Lys Gly Pro Leu Pro Thr Asp Cys Cys His Glu
Gln Cys225 230 235 240Ala Ala Gly Cys Thr Gly Pro Lys His Ser Asp
Cys Leu Ala Cys Leu 245 250 255His Phe Asn His Ser Gly Ile Cys Glu
Leu His Cys Pro Ala Leu Val 260 265 270Thr Tyr Asn Thr Asp Thr Phe
Glu Ser Met Pro Asn Pro Glu Gly Arg 275 280 285Tyr Thr Phe Gly Ala
Ser Cys Val Thr Ala Cys Pro Tyr Asn Tyr Leu 290 295 300Ser Thr Asp
Val Gly Ser Cys Thr Leu Val Cys Pro Leu His Asn Gln305 310 315
320Glu Val Thr Ala Glu Asp Gly Thr Gln Arg Cys Glu Lys Cys Ser Lys
325 330 335Pro Cys Ala Arg Val Cys Tyr Gly Leu Gly Met Glu His Leu
Arg Glu 340 345 350Val Arg Ala Val Thr Ser Ala Asn Ile Gln Glu Phe
Ala Gly Cys Lys 355 360 365Lys Ile Phe Gly Ser Leu Ala Phe Leu Pro
Glu Ser Phe Asp Gly Asp 370 375 380Pro Ala Ser Asn Thr Ala Pro Leu
Gln Pro Glu Gln Leu Gln Val Phe385 390 395 400Glu Thr Leu Glu Glu
Ile Thr Gly Tyr Leu Tyr Ile Ser Ala Trp Pro 405 410 415Asp Ser Leu
Pro Asp Leu Ser Val Phe Gln Asn Leu Gln Val Ile Arg 420 425 430Gly
Arg Ile Leu His Asn Gly Ala Tyr Ser Leu Thr Leu Gln Gly Leu 435 440
445Gly Ile Ser Trp Leu Gly Leu Arg Ser Leu Arg Glu Leu Gly Ser Gly
450 455 460Leu Ala Leu Ile His His Asn Thr His Leu Cys Phe Val His
Thr Val465 470 475 480Pro Trp Asp Gln Leu Phe Arg Asn Pro His Gln
Ala Leu Leu His Thr 485 490 495Ala Asn Arg Pro Glu Asp Glu Cys Val
Gly Glu Gly Leu Ala Cys His 500 505 510Gln Leu Cys Ala Arg Gly His
Cys Trp Gly Pro Gly Pro Thr Gln Cys 515 520 525Val Asn Cys Ser Gln
Phe Leu Arg Gly Gln Glu Cys Val Glu Glu Cys 530 535 540Arg Val Leu
Gln Gly Leu Pro Arg Glu Tyr Val Asn Ala Arg His Cys545 550 555
560Leu Pro Cys His Pro Glu Cys Gln Pro Gln Asn Gly Ser Val Thr Cys
565 570 575Phe Gly Pro Glu Ala Asp Gln Cys Val Ala Cys Ala His Tyr
Lys Asp 580 585 590Pro Pro Phe Cys Val Ala Arg Cys Pro Ser Gly Val
Lys Pro Asp Leu 595 600 605Ser Tyr Met Pro Ile Trp Lys Phe Pro Asp
Glu Glu Gly Ala Cys Gln 610 615 620Pro Cys Pro Ile Asn Cys Thr His
Ser Cys Val Asp Leu Asp Asp Lys625 630 635 640Gly Cys Pro Ala Glu
Gln Arg Ala Ser Pro Leu Thr Ser Ile Ile Ser 645 650 655Ala Val Val
Gly Ile Leu Leu Val Val Val Leu Gly Val Val Phe Gly 660 665 670Ile
Leu Ile Lys Arg Arg Gln Gln Lys Ile Arg Lys Tyr Thr Met Arg 675 680
685Arg Leu Leu Gln Glu Thr Glu Leu Val Glu Pro Leu Thr Pro Ser Gly
690 695 700Ala Met Pro Asn Gln Ala Gln Met Arg Ile Leu Lys Glu Thr
Glu Leu705 710 715 720Arg Lys Val Lys Val Leu Gly Ser Gly Ala Phe
Gly Thr Val Tyr Lys 725 730 735Gly Ile Trp Ile Pro Asp Gly Glu Asn
Val Lys Ile Pro Val Ala Ile 740 745 750Lys Val Leu Arg Glu Asn Thr
Ser Pro Lys Ala Asn Lys Glu Ile Leu 755 760 765Asp Glu Ala Tyr Val
Met Ala Gly Val Gly Ser Pro Tyr Val Ser Arg 770 775 780Leu Leu Gly
Ile Cys Leu Thr Ser Thr Val Gln Leu Val Thr Gln Leu785 790 795
800Met Pro Tyr Gly Cys Leu Leu Asp His Val Arg Glu Asn Arg Gly Arg
805 810 815Leu Gly Ser Gln Asp Leu Leu Asn Trp Cys Met Gln Ile Ala
Lys Gly 820 825 830Met Ser Tyr Leu Glu Asp Val Arg Leu Val His Arg
Asp Leu Ala Ala 835 840 845Arg Asn Val Leu Val Lys Ser Pro Asn His
Val Lys Ile Thr Asp Phe 850 855 860Gly Leu Ala Arg Leu Leu Asp Ile
Asp Glu Thr Glu Tyr His Ala Asp865 870 875 880Gly Gly Lys Val Pro
Ile Lys Trp Met Ala Leu Glu Ser Ile Leu Arg 885 890 895Arg Arg Phe
Thr His Gln Ser Asp Val Trp Ser Tyr Gly Val Thr Val 900 905 910Trp
Glu Leu Met Thr Phe Gly Ala Lys Pro Tyr Asp Gly Ile Pro Ala 915 920
925Arg Glu Ile Pro Asp Leu Leu Glu Lys Gly Glu Arg Leu Pro Gln Pro
930 935 940Pro Ile Cys Thr Ile Asp Val Tyr Met Ile Met Val Lys Cys
Trp Met945 950 955 960Ile Asp Ser Glu Cys Arg Pro Arg Phe Arg Glu
Leu Val Ser Glu Phe 965 970 975Ser Arg Met Ala Arg Asp Pro Gln Arg
Phe Val Val Ile Gln Asn Glu 980 985 990Asp Leu Gly Pro Ala Ser Pro
Leu Asp Ser Thr Phe Tyr Arg Ser Leu 995 1000 1005Leu Glu Asp Asp
Asp Met Gly Asp Leu Val Asp Ala Glu Glu Tyr 1010 1015 1020Leu Val
Pro Gln Gln Gly Phe Phe Cys Pro Asp Pro Ala Pro Gly1025 1030
1035Ala Gly Gly Met Val His His Arg His Arg Ser Ser Ser Thr Arg
1040 1045 1050Ser Gly Gly Gly Asp Leu Thr Leu Gly Leu Glu Pro Ser
Glu Glu 1055 1060 1065Glu Ala Pro Arg Ser Pro Leu Ala Pro Ser Glu
Gly Ala Gly Ser 1070 1075 1080Asp Val Phe Asp Gly Asp Leu Gly Met
Gly Ala Ala Lys Gly Leu 1085 1090 1095Gln Ser Leu Pro Thr His Asp
Pro Ser Pro Leu Gln Arg Tyr Ser1100 1105 1110Glu Asp Pro Thr Val
Pro Leu Pro Ser Glu Thr Asp Gly Tyr Val 1115 1120 1125Ala Pro Leu
Thr Cys Ser Pro Gln Pro Glu Tyr Val Asn Gln Pro 1130 1135 1140Asp
Val Arg Pro Gln Pro Pro Ser Pro Arg Glu Gly Pro Leu Pro 1145 1150
1155Ala Ala Arg Pro Ala Gly Ala Thr Leu Glu Arg Pro Lys Thr Leu
1160 1165 1170Ser Pro Gly Lys Asn Gly Val Val Lys Asp Val Phe Ala
Phe Gly1175 1180 1185Gly Ala Val Glu Asn Pro Glu Tyr Leu Thr Pro
Gln Gly Gly Ala 1190 1195 1200Ala Pro Gln Pro His Pro Pro Pro Ala
Phe Ser Pro Ala Phe Asp 1205 1210 1215Asn Leu Tyr Tyr Trp Asp Gln
Asp Pro Pro Glu Arg Gly Ala Pro 1220 1225 1230Pro Ser Thr Phe Lys
Gly Thr Pro Thr Ala Glu Asn Pro Glu Tyr 1235 1240 1245Leu Gly Leu
Asp Val Pro Val1250 125513314PRTMus sp. 13Met Pro Leu Glu Gln Arg
Ser Gln His Cys Lys Pro Glu Glu Gly Leu1 5 10 15Glu Ala Arg Gly Glu
Ala Leu Gly Leu Val Gly Ala Gln Ala Pro Ala 20 25 30Thr Glu Glu Gln
Gln Thr Ala Ser Ser Ser Ser Thr Leu Val Glu Val 35 40 45Thr Leu Gly
Glu Val Pro Ala Ala Asp Ser Pro Ser Pro Pro His Ser 50 55 60Pro Gln
Gly Ala Ser Ser Phe Ser Thr Thr Ile Asn Tyr Thr Leu Trp65 70 75
80Arg Gln Ser Asp Glu Gly Ser Ser Asn Gln Glu Glu Glu Gly Pro Arg
85 90 95Met Phe Pro Asp Leu Glu Ser Glu Phe Gln Ala Ala Ile Ser Arg
Lys 100 105 110Met Val Glu Leu Val His Phe Leu Leu Leu Lys Tyr Arg
Ala Arg Glu 115 120 125Pro Val Thr Lys Ala Glu Met Leu Glu Ser Val
Leu Arg Asn Cys Gln 130 135 140Asp Phe Phe Pro Val Ile Phe Ser Lys
Ala Ser Glu Tyr Leu Gln Leu145 150 155 160Val Phe Gly Ile Glu Val
Val Glu Val Val Pro Ile Ser His Leu Tyr 165 170 175Ile Leu Val Thr
Cys Leu Gly Leu Ser Tyr Asp Gly Leu Leu Gly Asp 180 185 190Asn Gln
Val Met Pro Lys Thr Gly Leu Leu Ile Ile Val Leu Ala Ile 195 200
205Ile Ala Ile Glu Gly Asp Cys Ala Pro Glu Glu Lys Ile Trp Glu Glu
210 215 220Leu Ser Met Leu Glu Val Phe Glu Gly Arg Glu Asp Ser Val
Phe Ala225 230 235 240His Pro Arg Lys Leu Leu Met Gln Asp Leu Val
Gln Glu Asn Tyr Leu 245 250 255Glu Tyr Arg Gln Val Pro Gly Ser Asp
Pro Ala Cys Tyr Glu Phe Leu 260 265 270Trp Gly Pro Arg Ala Leu Ile
Glu Thr Ser Tyr Val Lys Val Leu His 275 280 285His Thr Leu Lys Ile
Gly Gly Glu Pro His Ile Ser Tyr Pro Pro Leu 290 295 300His Glu Arg
Ala Leu Arg Glu Gly Glu Glu305 31014314PRTMus sp. 14Met Pro Leu Glu
Gln Arg Ser Gln His Cys Lys Pro Glu Glu Gly Leu1 5 10 15Glu Ala Arg
Gly Glu Ala Leu Gly Leu Val Gly Ala Gln Ala Pro Ala 20 25 30Thr Glu
Glu Gln Glu Ala Ala Ser Ser Ser Ser Thr Leu Val Glu Val 35 40 45Thr
Leu Gly Glu Val Pro Ala Ala Glu Ser Pro Asp Pro Pro Gln Ser 50 55
60Pro Gln Gly Ala Ser Ser Leu Pro Thr Thr Met Asn Tyr Pro Leu
Trp65
70 75 80Ser Gln Ser Tyr Glu Asp Ser Ser Asn Gln Glu Glu Glu Gly Pro
Ser 85 90 95Thr Phe Pro Asp Leu Glu Ser Glu Phe Gln Ala Ala Leu Ser
Arg Lys 100 105 110Val Ala Glu Leu Val His Phe Leu Leu Leu Lys Tyr
Arg Ala Arg Glu 115 120 125Pro Val Thr Lys Ala Glu Met Leu Gly Ser
Val Val Gly Asn Trp Gln 130 135 140Tyr Phe Phe Pro Val Ile Phe Ser
Lys Ala Ser Ser Ser Leu Gln Leu145 150 155 160Val Phe Gly Ile Glu
Leu Met Glu Val Asp Pro Ile Gly His Leu Tyr 165 170 175Ile Phe Ala
Thr Cys Leu Gly Leu Ser Tyr Asp Gly Leu Leu Gly Asp 180 185 190Asn
Gln Ile Met Pro Lys Ala Gly Leu Leu Ile Ile Val Leu Ala Ile 195 200
205Ile Ala Arg Glu Gly Asp Cys Ala Pro Glu Glu Lys Ile Trp Glu Glu
210 215 220Leu Ser Val Leu Glu Val Phe Glu Gly Arg Glu Asp Ser Ile
Leu Gly225 230 235 240Asp Pro Lys Lys Leu Leu Thr Gln His Phe Val
Gln Glu Asn Tyr Leu 245 250 255Glu Tyr Arg Gln Val Pro Gly Ser Asp
Pro Ala Cys Tyr Glu Phe Leu 260 265 270Trp Gly Pro Arg Ala Leu Val
Glu Thr Ser Tyr Val Lys Val Leu His 275 280 285His Met Val Lys Ile
Ser Gly Gly Pro His Ile Ser Tyr Pro Pro Leu 290 295 300His Glu Trp
Val Leu Arg Glu Gly Glu Glu305 31015393PRTMus sp. 15Met Glu Glu Pro
Gln Ser Asp Pro Ser Val Glu Pro Pro Leu Ser Gln1 5 10 15Glu Thr Phe
Ser Asp Leu Trp Lys Leu Leu Pro Glu Asn Asn Val Leu 20 25 30Ser Pro
Leu Pro Ser Gln Ala Met Asp Asp Leu Met Leu Ser Pro Asp 35 40 45Asp
Ile Glu Gln Trp Phe Thr Glu Asp Pro Gly Pro Asp Glu Ala Pro 50 55
60Arg Met Pro Glu Ala Ala Pro Pro Val Ala Pro Ala Pro Ala Ala Pro65
70 75 80Thr Pro Ala Ala Pro Ala Pro Ala Pro Ser Trp Pro Leu Ser Ser
Ser 85 90 95Val Pro Ser Gln Lys Thr Tyr Gln Gly Ser Tyr Gly Phe Arg
Leu Gly 100 105 110Phe Leu His Ser Gly Thr Ala Lys Ser Val Thr Cys
Thr Tyr Ser Pro 115 120 125Ala Leu Asn Lys Met Phe Cys Gln Leu Ala
Lys Thr Cys Pro Val Gln 130 135 140Leu Trp Val Asp Ser Thr Pro Pro
Pro Gly Thr Arg Val Arg Ala Met145 150 155 160Ala Ile Tyr Lys Gln
Ser Gln His Met Thr Glu Val Val Arg Arg Cys 165 170 175Pro His His
Glu Arg Cys Ser Asp Ser Asp Gly Leu Ala Pro Pro Gln 180 185 190His
Leu Ile Arg Val Glu Gly Asn Leu Arg Val Glu Tyr Leu Asp Asp 195 200
205Arg Asn Thr Phe Arg His Ser Val Val Val Pro Tyr Glu Pro Pro Glu
210 215 220Val Gly Ser Asp Cys Thr Thr Ile His Tyr Asn Tyr Met Cys
Asn Ser225 230 235 240Ser Cys Met Gly Gly Met Asn Arg Arg Pro Ile
Leu Thr Ile Ile Thr 245 250 255Leu Glu Asp Ser Ser Gly Asn Leu Leu
Gly Arg Asn Ser Phe Glu Val 260 265 270Arg Val Cys Ala Cys Pro Gly
Arg Asp Arg Arg Thr Glu Glu Glu Asn 275 280 285Leu Arg Lys Lys Gly
Glu Pro His His Glu Leu Pro Pro Gly Ser Thr 290 295 300Lys Arg Ala
Leu Pro Asn Asn Thr Ser Ser Ser Pro Gln Pro Lys Lys305 310 315
320Lys Pro Leu Asp Gly Glu Tyr Phe Thr Leu Gln Ile Arg Gly Arg Glu
325 330 335Arg Phe Glu Met Phe Arg Glu Leu Asn Glu Ala Leu Glu Leu
Lys Asp 340 345 350Ala Gln Ala Gly Lys Glu Pro Gly Gly Ser Arg Ala
His Ser Ser His 355 360 365Leu Lys Ser Lys Lys Gly Gln Ser Thr Ser
Arg His Lys Lys Leu Met 370 375 380Phe Lys Thr Glu Gly Pro Asp Ser
Asp385 39016212PRTMus sp. 16Met Gln Leu Phe His Leu Cys Leu Ile Ile
Ser Cys Ser Cys Pro Thr1 5 10 15Val Gln Ala Ser Lys Leu Cys Leu Gly
Trp Leu Trp Gly Met Asp Ile 20 25 30Asp Pro Tyr Lys Glu Phe Gly Ala
Thr Val Glu Leu Leu Ser Phe Leu 35 40 45Pro Ser Asp Phe Phe Pro Ser
Val Arg Asp Leu Leu Asp Thr Ala Ser 50 55 60Ala Leu Tyr Arg Glu Ala
Leu Glu Ser Pro Glu His Cys Ser Pro His65 70 75 80His Thr Ala Leu
Arg Gln Ala Ile Leu Cys Trp Gly Glu Leu Met Thr 85 90 95Leu Ala Thr
Trp Val Gly Val Asn Leu Glu Asp Pro Ala Ser Arg Asp 100 105 110Leu
Val Val Ser Tyr Val Asn Thr Asn Met Gly Leu Lys Phe Arg Gln 115 120
125Leu Leu Trp Phe His Ile Ser Cys Leu Thr Phe Gly Arg Glu Thr Val
130 135 140Ile Glu Tyr Leu Val Ser Phe Gly Val Trp Ile Arg Thr Pro
Pro Ala145 150 155 160Tyr Arg Pro Pro Asn Ala Pro Ile Leu Ser Thr
Leu Pro Glu Thr Thr 165 170 175Val Val Arg Arg Arg Gly Arg Ser Pro
Arg Arg Arg Thr Pro Ser Pro 180 185 190Arg Arg Arg Arg Ser Gln Ser
Pro Arg Arg Arg Arg Ser Gln Ser Arg 195 200 205Glu Ser Gln Cys
210179PRTMus sp. 17Asp Leu Met Gly Tyr Ile Pro Leu Val1 51815PRTMus
sp. 18Gly Tyr Lys Val Leu Val Leu Asn Pro Ser Val Ala Ala Thr Leu1
5 10 151913PRTMus sp.MISC_FEATURE(1)..(1)Ala is D-alanine. 19Ala
Lys Phe Val Ala Ala Trp Thr Leu Lys Ala Ala Ala1 5 102013PRTMus
sp.MISC_FEATURE(1)..(1)Ala is D-alanine. 20Ala Lys Tyr Val Ala Ala
Trp Thr Leu Lys Ala Ala Ala1 5 102113PRTMus
sp.MISC_FEATURE(1)..(1)Ala is D-alanine. 21Ala Lys Phe Val Ala Ala
Tyr Thr Leu Lys Ala Ala Ala1 5 102213PRTMus
sp.MISC_FEATURE(1)..(1)Ala is D-alanine. 22Ala Lys Xaa Val Ala Ala
Tyr Thr Leu Lys Ala Ala Ala1 5 102313PRTMus
sp.MISC_FEATURE(1)..(1)Ala is D-alanine. 23Ala Lys Tyr Val Ala Ala
Tyr Thr Leu Lys Ala Ala Ala1 5 102413PRTMus
sp.MISC_FEATURE(1)..(1)Ala is D-alanine. 24Ala Lys Phe Val Ala Ala
His Thr Leu Lys Ala Ala Ala1 5 102513PRTMus
sp.MISC_FEATURE(1)..(1)Ala is D-alanine. 25Ala Lys Xaa Val Ala Ala
His Thr Leu Lys Ala Ala Ala1 5 102613PRTMus
sp.MISC_FEATURE(1)..(1)Ala is D-alanine. 26Ala Lys Tyr Val Ala Ala
His Thr Leu Lys Ala Ala Ala1 5 102713PRTMus
sp.MISC_FEATURE(1)..(1)Ala is D-alanine. 27Ala Lys Phe Val Ala Ala
Asn Thr Leu Lys Ala Ala Ala1 5 102813PRTMus
sp.MISC_FEATURE(1)..(1)Ala is D-alanine. 28Ala Lys Xaa Val Ala Ala
Asn Thr Leu Lys Ala Ala Ala1 5 102913PRTMus
sp.MISC_FEATURE(1)..(1)Ala is D-alanine. 29Ala Lys Tyr Val Ala Ala
Asn Thr Leu Lys Ala Ala Ala1 5 103013PRTMus
sp.MISC_FEATURE(3)..(3)Xaa is cyclohexylalanine. 30Ala Lys Xaa Val
Ala Ala Trp Thr Leu Lys Ala Ala Ala1 5 103113PRTMus sp. 31Ala Lys
Phe Val Ala Ala Trp Thr Leu Lys Ala Ala Ala1 5 103213PRTalternative
PADRE peptide 32Ala Lys Tyr Val Ala Ala Trp Thr Leu Lys Ala Ala
Ala1 5 103313PRTMus sp. 33Ala Lys Phe Val Ala Ala Tyr Thr Leu Lys
Ala Ala Ala1 5 103413PRTMus sp.MISC_FEATURE(3)..(3)Xaa is
cyclohexylalanine. 34Ala Lys Xaa Val Ala Ala Tyr Thr Leu Lys Ala
Ala Ala1 5 103513PRTMus sp. 35Ala Lys Tyr Val Ala Ala Tyr Thr Leu
Lys Ala Ala Ala1 5 103613PRTMus sp. 36Ala Lys Phe Val Ala Ala His
Thr Leu Lys Ala Ala Ala1 5 103713PRTMus sp.MISC_FEATURE(3)..(3)Xaa
is cyclohexylalanine. 37Ala Lys Xaa Val Ala Ala His Thr Leu Lys Ala
Ala Ala1 5 103813PRTMus sp. 38Ala Lys Tyr Val Ala Ala His Thr Leu
Lys Ala Ala Ala1 5 103913PRTMus sp. 39Ala Lys Phe Val Ala Ala Asn
Thr Leu Lys Ala Ala Ala1 5 104013PRTMus sp.MISC_FEATURE(3)..(3)Xaa
is cyclohexylalanine. 40Ala Lys Xaa Val Ala Ala Asn Thr Leu Lys Ala
Ala Ala1 5 104113PRTMus sp. 41Ala Lys Tyr Val Ala Ala Asn Thr Leu
Lys Ala Ala Ala1 5 104213PRTMus sp.MISC_FEATURE(1)..(1)Ala is
either D-alanine or L-alanine. 42Ala Lys Xaa Val Ala Ala Xaa Thr
Leu Lys Ala Ala Ala1 5 104313PRTMus sp.MISC_FEATURE(1)..(1)Ala is
D-alanine. 43Ala Lys Xaa Val Ala Ala Trp Thr Leu Lys Ala Ala Ala1 5
10
* * * * *