U.S. patent application number 12/103761 was filed with the patent office on 2008-10-23 for novel compounds.
Invention is credited to Stephanie Jane Clegg, Eric Dobrzynski, Jonathan H. Ellis, Volker Germaschewski, Alexis Paul Godillot, Zdenka Ludmila Jonak, Alan P. Lewis, John R. White.
Application Number | 20080262203 12/103761 |
Document ID | / |
Family ID | 39872910 |
Filed Date | 2008-10-23 |
United States Patent
Application |
20080262203 |
Kind Code |
A1 |
Clegg; Stephanie Jane ; et
al. |
October 23, 2008 |
NOVEL COMPOUNDS
Abstract
The present invention relates to an antibody which has multiple
specificities. In particular the antibody of the present invention
binds to (cross react with) human IL-8, Gro-alpha, Gro-beta,
Gro-gamma, and ENA-78.
Inventors: |
Clegg; Stephanie Jane;
(Stevenage, GB) ; Dobrzynski; Eric; (King of
Prussia, PA) ; Ellis; Jonathan H.; (Stevenage,
GB) ; Germaschewski; Volker; (Stevenage, GB) ;
Godillot; Alexis Paul; (King of Prussia, PA) ; Jonak;
Zdenka Ludmila; (King of Prussia, PA) ; Lewis; Alan
P.; (Stevenage, GB) ; White; John R.; (King of
Prussia, PA) |
Correspondence
Address: |
SMITHKLINE BEECHAM CORPORATION;CORPORATE INTELLECTUAL PROPERTY-US, UW2220
P. O. BOX 1539
KING OF PRUSSIA
PA
19406-0939
US
|
Family ID: |
39872910 |
Appl. No.: |
12/103761 |
Filed: |
April 16, 2008 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
60912229 |
Apr 17, 2007 |
|
|
|
61044132 |
Apr 11, 2008 |
|
|
|
Current U.S.
Class: |
530/387.3 |
Current CPC
Class: |
A61P 1/04 20180101; A61P
31/04 20180101; A61P 7/00 20180101; A61P 19/02 20180101; A61P 19/06
20180101; A61P 37/00 20180101; A61P 11/00 20180101; A61P 15/00
20180101; C07K 16/24 20130101; A61P 37/06 20180101; A61K 2039/505
20130101; C07K 2317/56 20130101; A61P 9/10 20180101; A61P 17/06
20180101; A61P 35/00 20180101; C07K 2317/76 20130101; A61P 25/00
20180101; C07K 16/18 20130101; C07K 16/244 20130101; C07K 2317/31
20130101; C07K 2317/24 20130101; A61P 9/00 20180101; A61P 29/00
20180101; A61P 11/06 20180101; C07K 2317/34 20130101 |
Class at
Publication: |
530/387.3 |
International
Class: |
C07K 16/24 20060101
C07K016/24; C07K 16/18 20060101 C07K016/18 |
Claims
1. An antibody comprising heavy and light chains comprising the
amino acid sequences of SEQ ID NO:46 and SEQ ID NO:48,
respectively.
2. An antibody comprising heavy and light chains comprising the
amino acid sequences of SEQ ID NO:46 and SEQ ID NO: 62,
respectively.
3. An antibody comprising heavy and light chains comprising the
amino acid sequences of SEQ ID NO:46 and SEQ ID NO: 60,
respectively.
4. An antibody comprising heavy and light chains comprising the
amino acid sequences of SEQ ID NO:46 and SEQ ID NO: 64,
respectively
Description
CROSS-REFERENCE TO RELATED APPLICATION
[0001] This application claims priority to U.S. provisional
application 60/912,229 filed Apr. 17, 2007 and 61/044,132 filed
Apr. 11, 2008, which are incorporated by reference in their
entirety.
FIELD OF THE INVENTION
[0002] The present invention relates to an antibody which has
multiple specificities. In particular the antibody of the present
invention binds to (cross react with) human IL-8, Gro-alpha,
Gro-beta, Gro-gamma, and ENA-78. The present invention also
concerns with methods of treating diseases or disorders
characterised by elevated or unbalanced level of one or more of
human IL-8, Gro-alpha, Gro-beta, Gro-gamma, and ENA-78,
particularly COPD, osteoarthritis, rheumatoid arthritis, erosive
arthritis, asthma, atherosclerosis, inflammatory bowel disease,
psoriasis, transplant rejection, gout, cancer, acute lung injury,
acute lung disease, sepsis, ARDS, peripheral artery disease,
systemic sclerosis, neonatal respiratory distress syndrome,
exacerbation of asthma and COPD, cystic fibrosis, diffuse
panbronchiolitis, reperfusion injury, and/or endometriosis with
said antibody.
BACKGROUND OF THE INVENTION
[0003] Published data and reports indicate that the members of the
ELRCXC subfamily of CXCL chemokines are elevated in a number of
diseases. There are a total of 16 CXCL family members. The
chemokines are reported to be up-regulated in a number of
inflammatory diseases, including COPD, in which CXCL1-3, 5, and 8,
also known as Gro-1-.alpha., -.beta., -.gamma. (Haskill, S., et al.
Proc. Natl. Acad. Sci., 1990: 87, 7732-7736), ENA-78 (Wang, D. and
Richmond, A., Cytokine Reference. Oppenheim, J. J. and Feldman, M.
ed., Academic Press, London, 1023-1027, Powerm C. A. et al. Gene.,
1994: 151, 333-334), and IL-8 (Iizasa, H. and Matsushima, K.,
Cytokine Reference. Oppenheim, J. J. and Feldman, M. ed., Academic
Press, London, 1061-1067, Matsushima, K. et al., J. Exp. Med. 1988:
167, 1883-1893) respectively (Am. J. Respir. Crit Care Med., 163:
349-355, 2001, Am. J. Respir. Crit Care Med., 168: 968-975, 2003,
Thorax, 57: 590-595, 2002). It has be postulated that prolonged and
elevated expression of these chemokines could be involved in the
development of diseases such as COPD, osteoarthritis, rheumatoid
arthritis, erosive arthritis, asthma, atherosclerosis, inflammatory
bowel disease, psoriasis, transplant rejection, gout, cancer, acute
lung injury, acute lung disease, sepsis, ARDS, peripheral artery
disease, systemic sclerosis, neonatal respiratory distress
syndrome, exacerbation of asthma and COPD, cystic fibrosis, diffuse
panbronchiolitis, reperfusion injury, or endometriosis. These CXC
chemokines are known to stimulate neutrophil chemotaxis by engaging
and activating the CXCR1 and/or CXCR2 receptors. Thus the
inhibition of these chemokines could prevent inflammatory cells
from infiltrating the lung tissue and thus prevent tissue damage.
The present invention is directed to inhibiting the activation of
CXCR1 and CXCR2 receptors by using an antibody having the ability
to bind to human IL-8, Gro-alpha, Gro-beta, Gro-gamma, and ENA-78,
i.e. a penta-specific antibody.
SUMMARY OF THE INVENTION
[0004] The present invention relates to an antibody
(immunoglobulin) which has multiple specificities contained within
one immunoglobulin. In particular the antibody of the present
invention binds to (cross react with) human IL-8, Gro-alpha,
Gro-beta, Gro-gamma, and ENA-78. The present invention also
concerns with methods of treating diseases or disorders
characterised by elevated or unbalanced level of one or more of
human IL-8, Gro-alpha, Gro-beta, Gro-gamma, and ENA-78,
particularly COPD, osteoarthritis, rheumatoid arthritis, erosive
arthritis, asthma, atherosclerosis, inflammatory bowel disease,
psoriasis, transplant rejection, gout, cancer, acute lung injury,
acute lung disease, sepsis, ARDS, peripheral artery disease,
systemic sclerosis, neonatal respiratory distress syndrome,
exacerbation of asthma and COPD, cystic fibrosis, diffuse
panbronchiolitis, reperfusion injury, and/or endometriosis with
said antibody.
[0005] In one aspect, the present invention relates to an isolated
antibody which has multiple specificity to (or cross reacts with)
human IL-8, Gro-alpha, Gro-beta, Gro-gamma, and ENA-78; thus we
define the antibody of the present invention as penta-specific (or
pan-ELR) antibody. The definition of antibody includes an antigen
binding portion (or fragment) of the antibody such that the antigen
binding portion (or fragment) binds to human IL-8, Gro-alpha,
Gro-beta, Gro-gamma, and ENA-78. The penta-specific antibody of the
invention is preferably murine monoclonal, chimeric, human or
humanized. For avoidance of doubt, the penta-specific antibody of
the present invention need not bind solely to human IL-8,
Gro-alpha, Gro-beta, Gro-gamma, and ENA-78 antigens, but it may
also to bind to other related proteins (such as human GCP-2, or may
even bind to non-human orthologues of IL-8, Gro-alpha, Gro-beta,
Gro-gamma, ENA-78, and GCP-2); in other words, the penta-specific
antibody of the present invention minimally binds to human IL-8,
Gro-alpha, Gro-beta, Gro-gamma, and ENA-78.
[0006] Preferably, a penta-specific antibody of the present
invention binds to each of human IL-8, Gro-alpha, Gro-beta,
Gro-gamma, and ENA-78 with equilibrium constant, KD, values of less
than 10.sup.-7 M, more preferably less than 10.sup.-8 M, and even
more preferably less than 10.sup.-9 M as determined by surface
plasmon resonance. Typically surface plasmon resonance measurement
is conducted as described below.
[0007] In one embodiment the present invention comprises a method
of decreasing the neutrophil chemotaxis through inhibition of CXCR1
and CXCR2 receptor activation by neutralizing human IL-8,
Gro-alpha, Gro-beta, Gro-gamma, GCP-2 and ENA-78 with a
penta-specific antibody of the present invention.
[0008] In one embodiment the present invention relates to a method
of decreasing the neutrophil chemotaxis in a patient in need
thereof by administering a penta-specific antibody of the present
invention.
[0009] In one embodiment, a penta-specific antibody binds within
epitope of KELRCQCIKTYSKP (SEQ ID NO: 54) in human IL-8.
[0010] In one embodiment, the penta-specific antibody of the
present invention is generated by a method comprising the steps of
using RIMMs (Kilpatrick, K. E., et al. Hybridoma. 1997: 16, 381)
type protocol using a mixture (cocktail) of human IL-8, Gro-alpha,
Gro-beta, Gro-gamma, and ENA-78 together with a set of five
multiple antigenic peptides (MAPs) each MAP unit having one
separate sequence from polypeptides of ID NOs: 49-53.
TABLE-US-00001 LATELRSQSLQTLQG SEQ ID NO: 49 SAKELRSQSIKTYSK SEQ ID
NO: 50 LRELRSVSLQTTQG SEQ ID NO: 51 SPGPHSAQTEVIAT SEQ ID NO: 52
ESGPHSANTEIIVK SEQ ID NO: 53
[0011] Without being bound by theory, MAPs serve two functions
within the immunization protocol. First, MAPs allow for a selective
multiple presentation of a known target amino acid sequence to the
host immune system. Secondly, the increase in mass, due to multiple
copies of the sequence linked via a core, such as, but not limited
to lysine, increases the immunogenicity of the sequence over that
of individual peptides (Francis, J. P., et al., Immunology, 1991:
73; 249, Schott, M. E., et al., Cell. Immuno. 1996: 174: 199-209,
Tam, J. P. Proc. Natl. Acad. Sci. 1988: 85; 5409-5413).
[0012] The MAPs used to generate this invention are comprised of
multiple copies of the conserved target sequences (e.g. SEQ ID NOs:
49-53) found with and around the ELRCXC and GPHCA regions of target
chemokines. Exemplary MAP set is depicted in FIG. 1.
[0013] In one embodiment, a penta-specific antibody of the present
invention is generated by a method comprising the steps of: [0014]
a. injecting into a mouse a mixture of human IL-8, Gro-alpha,
Gro-beta, Gro-gamma, and ENA-78 in complete Freund's adjuvant
(cFA); [0015] b. injecting into the mouse a mixture of human IL-8,
Gro-alpha, Gro-beta, Gro-gamma, and ENA-78 in incomplete Freund's
adjuvant (iFA); and [0016] c. injecting into the mouse a mixture of
human IL-8, Gro-alpha, Gro-beta, Gro-gamma, and ENA-78, and a set
of five multiple antigenic peptides (MAPs), each MAP unit having
one separate sequence from polypeptides of ID NOs: 49-53 in
incomplete Freund's adjuvant; [0017] d. isolating B cells from the
mouse; [0018] e. fusing the B cells with myeloma cells to form
immortal hybridoma cells that secrete the desired penta-specific
antibody; and [0019] f. isolating the penta-specific antibody from
the culture supernatant of the hybridoma. [0020] If desired, one
can optionally inject into the mouse a mixture of human IL-8,
Gro-alpha, Gro-beta, Gro-gamma, and ENA-78, and a set of MAPs
comprising amino acid sequences of SEQ ID NOs: 49-53 in PBS between
steps c and d.
[0021] In another embodiment, a penta-specific antibody of the
present invention is generated by a method comprising the steps of:
[0022] a. injecting into a mouse a set of five multiple antigenic
peptides (MAPs) each MAP unit having one separate sequence from
polypeptides of ID NOs: 49-53 (hereinafter also referred to as the
MAP set) in complete Freund's adjuvant; [0023] b. injecting into
the mouse the MAP set in incomplete Freund adjuvant; [0024] c.
injecting into the mouse a mixture of all human IL-8, Gro-alpha,
Gro-beta, Gro-gamma, and ENA-78, and the MAP set in incomplete
Freund's adjuvant; [0025] d. isolating B cells from the mouse; and
[0026] e. fusing the B cells with myeloma cells to form immortal
hybridoma cells that secrete the desired penta-specific antibody;
and [0027] f. isolating the penta-specific antibody from the
culture supernatant of the hybridoma. [0028] If desired, one can
optionally inject into the mouse a mixture of human IL-8,
Gro-alpha, Gro-beta, Gro-gamma, and ENA-78, and a set of MAPs
having SEQ ID NOs: 49-53 in PBS between steps c and d.
[0029] In another embodiment, the present invention concerns a
penta-specific antibody made by the foregoing process.
[0030] In one embodiment, a penta-specific antibody has heavy and
light chain variable regions encoded by nucleotide sequences
comprising sequences of SEQ ID NO: 1 and SEQ ID NO:3, respectively,
or conservative sequence modifications thereof.
[0031] In one embodiment, a penta-specific antibody has heavy and
light chain variable regions encoded by nucleotide sequences
comprising sequences of SEQ ID NO:5 and SEQ ID NO:7, respectively,
or conservative sequence modifications thereof.
[0032] In one embodiment, a penta-specific antibody has heavy chain
variable region encoded by a nucleotide sequence comprising
sequence of SEQ ID NO:9, or conservative sequence modifications
thereof.
[0033] In one embodiment, a penta-specific antibody has heavy and
light chain variable regions comprising the amino acid sequences of
SEQ ID NO:2 and SEQ ID NO:4, respectively, or conservative sequence
modifications thereof.
[0034] In one embodiment, a penta-specific antibody has heavy and
light chain variable regions comprising polypeptides which are at
least 90%, 95%, 98% or 99% identical to the amino acid sequences of
SEQ ID NO:2 and SEQ ID NO:4, respectively.
[0035] In one embodiment, a penta-specific antibody has heavy and
light chain variable regions comprising the amino acid sequences of
SEQ ID NO:6 and SEQ ID NO:8, respectively, or conservative sequence
modifications thereof.
[0036] In one embodiment, a penta-specific antibody has heavy and
light chain variable regions comprising polypeptides which are at
least 90%, 95%, 98% or 99% identical to the amino acid sequences of
SEQ ID NO:6 and SEQ ID NO:8, respectively.
[0037] In one embodiment, a penta-specific antibody has heavy and
light variable regions comprising the amino acid sequences of SEQ
ID NOs:10 and 12, respectively, or conservative sequence
modifications thereof.
[0038] In one embodiment, a penta-specific antibody has heavy and
light chain variable regions comprising polypeptide sequences which
are at least 90%, 95%, 98% or 99% identical to the amino acid
sequences of SEQ ID NOs:10 and 12, respectively.
[0039] In one embodiment, a penta-specific antibody comprises at
least one variable region selected from (i) the amino acid SEQ ID
NO: 2, 4, 6, 8, 10, or 12; or (ii) an amino acid sequence which is
at least 90%, 95%, 98% or 99% identical to any one of the amino
acid sequences of (i) above.
[0040] In one embodiment, a penta-specific antibody comprises CDR
sequences of SEQ ID NOs: 13, 14, 15, 16, 17, and 18; or one or more
of the CDR sequences can be conservative sequence modifications of
the sequences SEQ ID NOs: 13, 14, 15, 16, 17, and 18.
In one embodiment, the present invention relates to hybridoma or
transfectoma which produces a penta-specific antibody which
comprises CDR sequences of SEQ ID NOs: 13, 14, 15, 16, 17, and 18.
In one embodiment, the present invention relates to a recombinant
eukaryotic or prokaryotic cell which produces a penta-specific
antibody which comprises CDR sequences of SEQ ID NOs: 13, 14, 15,
16, 17, and 18.
[0041] In one embodiment, a penta-specific antibody comprises at
least one CDR sequence selected from (i) SEQ ID NO: 13, 14, 15, 16,
17, or 18; or (ii) a conservative sequence modification of the
sequences listed in (i).
[0042] In one embodiment, a penta-specific antibody comprises a
polypeptide of SEQ ID NO:15.
[0043] In one embodiment, a penta-specific antibody comprises at
least four CDR sequences selected from the group consisting of SEQ
ID NOs: 13, 14, 15, 16, 17, and 18; or one or more of the CDR
sequences can be conservative sequence modifications of the
sequences listed in SEQ ID NOs: 13, 14, 15, 16, 17, and 18.
In one embodiment, a penta-specific antibody comprises heavy and
light chain variable regions which comprise the CDR amino acid
sequences of SEQ ID NOs: 13, 14, and 15, and SEQ ID NOs: 16, 17,
and 18, respectively.
[0044] In one embodiment, a penta-specific antibody comprises CDR
sequences of SEQ ID NOs: 19, 20, 21, 22, 23, and 24; or one or more
the CDR sequences can be conservative sequence modifications of the
sequences listed in SEQ ID NOs: 19, 20, 21, 22, 23, and 24.
In one embodiment, the present invention relates to an hybridoma or
transfectoma which produces a penta-specific antibody which
comprises CDR sequences of SEQ ID NOs: 19, 20, 21, 22, 23, and
24.
[0045] In one embodiment, the present invention relates to a
recombinant eukaryotic or a prokaryotic cell which produces a
penta-specific antibody which comprises CDR sequences of SEQ ID
NOs: 19, 20, 21, 22, 23, and 24.
[0046] In one embodiment, a penta-specific antibody comprises at
least one CDR sequence selected from (i) SEQ ID NO: 19, 20, 21, 22,
23, or 24; or (ii) a conservative sequence modification of the
sequences listed in (i).
[0047] In one embodiment, a penta-specific antibody comprises a
polypeptide of SEQ ID NO:21.
[0048] In one embodiment, a penta-specific antibody comprises at
least four CDR sequences selected from the group consisting of: SEQ
ID NOs: 19, 20, 21, 22, 23, and 24; or one or more of the CDR
sequences can be conservative sequence modifications of the
sequences listed in SEQ ID NOs: 19, 20, 21, 22, 23, and 24.
In one embodiment, a penta-specific antibody comprises heavy and
light chain variable regions which comprise the CDR amino acid
sequences of SEQ ID NOs: 19, 20, and 21, and SEQ ID NOs: 22, 23,
and 24, respectively.
[0049] In one embodiment, a penta-specific antibody comprises CDR
sequences of SEQ ID NOs: 25, 26, 27, 28, 29, and 30; or one or more
the CDR sequences can be conservative sequence modifications of the
sequences listed in SEQ ID NOs: 25, 26, 27, 28, 29, and 30.
In one embodiment, the present invention relates to an hybridoma or
transfectoma which produces a penta-specific antibody which
comprises CDR sequences of SEQ ID NOs: 25, 26, 27, 28, 29, and
30.
[0050] In one embodiment, the present invention relates to a
recombinant eukaryotic or prokaryotic cell which produces a
penta-specific antibody which comprises CDR sequences of SEQ ID
NOs: 25, 26, 27, 28, 29 and 30.
[0051] In one embodiment, a penta-specific antibody comprises at
least one CDR sequence selected from (i) SEQ ID NO: 25, 26, 27, 28,
29, or 30; or (ii) a conservative sequence modification of the
sequences listed in (i).
[0052] In one embodiment, a penta-specific antibody comprises a
polypeptide of SEQ ID NO:27.
[0053] In one embodiment, a penta-specific antibody comprises at
least four CDR sequences selected from the group consisting of: SEQ
ID NOs: 25, 26, 27, 28, 29, and 30; or one or more of the CDR
sequences can be conservative modifications of the sequences listed
in SEQ ID NOs: 25, 26, 27, 28, 29, and 30.
[0054] In one embodiment, a penta-specific antibody comprises heavy
and light variable chain regions which comprise the CDR amino acid
sequences of SEQ ID NOs: 25, 26, and 27, and SEQ ID NOs: 28, 29 and
30, respectively.
[0055] In one embodiment, the present invention concerns a
hybridoma which produces a monoclonal antibody having heavy or
light chain variable region encoded by nucleotide sequences
comprising nucleotide sequences of SEQ ID NO:1, 5, or 9, or SEQ ID
NO:3 or 7, respectively.
[0056] In one embodiment, the present invention concerns a
hybridoma which produces a monoclonal antibody having heavy or
light chain variable region comprising the amino acid sequences of
SEQ ID NO:2, 6, or 10, or SEQ ID NO: 4, 8, or 12, respectively, and
conservative sequence modifications thereof.
[0057] In one embodiment, the present invention relates to a
recombinant eukaryotic or a prokaryotic host cell which produces a
penta-specific antibody having heavy or light variable region which
comprise the amino acid sequences of SEQ ID NO:2, 6, or 10, or SEQ
ID NO:4, 8, or 12, respectively, and conservative sequence
modifications thereof.
[0058] In one embodiment, the present invention relates to an
expression vector comprising nucleotide sequences encoding a
variable heavy or light chain of a penta-specific antibody
comprising the CDR sequences of SEQ ID NOs: 13, 14, and 15; or SEQ
ID NOs: 16, 17, and 18, respectively.
[0059] In one embodiment, the present invention relates to an
expression vector comprising a nucleotide sequence encoding a CDR
sequence of a penta-specific antibody selected from SEQ ID NO: 13,
14, 15, 16, 17, or 18.
[0060] In one embodiment, the present invention relates to an
expression vector comprising nucleotide sequences encoding at least
four CDR sequences of a penta-specific antibody selected from the
group consisting of SEQ ID NOs: 13, 14, 15, 16, 17, and 18.
[0061] In one embodiment, the present invention relates to an
expression vector comprising polynucleotide sequences of SEQ ID
NOs: 31, 32, or 33.
[0062] In one embodiment, the present invention relates to an
expression vector comprising polynucleotide sequences of SEQ ID
NOs: 34, 35, and 36.
[0063] In one embodiment the present invention relates to an
expression vector comprising at least four polynucleotide sequences
selected from the group of SEQ ID NOs: 31, 32, 33, 34, 35, and
36.
[0064] In one embodiment, the present invention relates to an
expression vector comprising nucleotide sequences encoding a
variable heavy or light chain of a penta-specific antibody
comprising the CDR sequences of SEQ ID NOs: 19, 20, and 21; or 22,
23, and 24, respectively.
[0065] In one embodiment, the present invention relates to an
expression vector comprising a nucleotide sequence encoding a CDR
sequence of a penta-specific antibody selected from SEQ ID NO: 19,
20, 21, 22, 23, or 24.
[0066] In one embodiment, the present invention relates to an
expression vector comprising nucleotide sequences encoding at least
four CDR sequences of a penta-specific antibody selected from the
group consisting of SEQ ID NOs: 19, 20, 21, 22, 23, and 24.
[0067] In one embodiment, the present invention relates to an
expression vector comprising polynucleotide sequences of SEQ ID
NOs: 37, 38, and 39.
[0068] In one embodiment, the present invention relates to an
expression vector comprising polynucleotide sequences of SEQ ID
NOs: 40, 41, and 42.
[0069] In one embodiment the present invention relates to an
expression vector comprising at least four polynucleotide sequences
selected from the group of SEQ ID NOs: 37, 38, 39, 40, 41, and
42.
[0070] In one embodiment, the present invention relates to an
expression vector comprising nucleotide sequences encoding a
variable heavy chain of a penta-specific antibody comprising the
CDR sequences of SEQ ID NOs: 25, 26, and 27.
[0071] In one embodiment, the present invention relates to an
expression vector comprising a nucleotide sequence encoding a CDR
sequence of a penta-specific antibody selected from SEQ ID NO: 25,
26, or 27.
[0072] In one embodiment, the present invention relates to an
expression vector comprising polynucleotide sequences of SEQ ID
NOs: 43, 44, and 45.
[0073] In one embodiment, a penta-specific antibody has heavy and
light chains encoded by nucleotide sequences comprising sequences
of SEQ ID NO:11, and SEQ ID NO:47, 59, 61, or 63, respectively.
[0074] In one embodiment, a penta-specific antibody has heavy and
light chains encoded by nucleotide sequences comprising sequences
which are at least 90%, 95%, 98% or 99% identical to sequences of
SEQ ID NO:11, and SEQ ID NO:47, 59, 61, or 63, respectively.
[0075] In one embodiment, a penta-specific antibody has heavy and
light chains comprising the amino acid sequences of SEQ ID NO:46,
and SEQ ID NO:48, 60, 62, or 64, respectively.
[0076] In one embodiment, a penta-specific antibody has heavy and
light chains comprising the amino acid sequences of SEQ ID NO:46
and SEQ ID NO:48, respectively.
[0077] In one embodiment, a penta-specific antibody has heavy and
light chains comprising the amino acid sequences of SEQ ID NO:46
and SEQ ID NO:60, respectively.
[0078] In one embodiment, a penta-specific antibody has heavy and
light chains comprising the amino acid sequences of SEQ ID NO:46
and SEQ ID NO: 62, respectively.
[0079] In one embodiment, a penta-specific antibody has heavy and
light chains comprising the amino acid sequences of SEQ ID NO:46
and SEQ ID NO:64, respectively.
[0080] In one embodiment, a penta-specific antibody has heavy and
light chains comprising polypeptides which are at least 90%, 95%,
98% or 99% identical to the amino acid sequences of SEQ ID NO:46,
and SEQ ID NO:48, 60, 62, or 64, respectively.
[0081] In one embodiment, the present invention relates to a
recombinant eukaryotic or a prokaryotic host cell which produces a
penta-specific antibody having heavy or light chain comprising the
amino acid sequence of SEQ ID NO: 46, or SEQ ID NO:48, 60, 62, or
64, respectively.
[0082] In one embodiment, the present invention relates to a
recombinant eukaryotic or a prokaryotic host cell which produces a
penta-specific antibody having heavy and light chains comprising
the amino acid sequences of SEQ ID NO: 46, and SEQ ID NO:48, 60,
62, or 64, respectively.
[0083] In one embodiment, the present invention relates to a
recombinant eukaryotic or a prokaryotic host cell which produces a
penta-specific antibody having heavy or light chain comprising the
amino acid sequence which is at least 90%, 95%, 98% or 99%
identical to the amino acid sequence of SEQ ID NO: 46, or SEQ ID
NO:48, 60, 62, or 64, respectively.
[0084] In one embodiment, the present invention relates to a
recombinant eukaryotic or a prokaryotic host cell which produces a
penta-specific antibody having heavy and light chains comprising
the amino acid sequences which are at least 90%, 95%, 98% or 99%
identical to the amino acid sequences of SEQ ID NO: 46, and SEQ ID
NO:48, 60, 62, or 64, respectively.
[0085] In one embodiment, the present invention relates to an
expression vector comprising polynucleotide sequences comprising
sequences of SEQ ID NO:11, and SEQ ID NO:47, 59, 61, or 63,
respectively.
[0086] In one embodiment, the present invention relates to an
expression vector comprising polynucleotide sequences comprising
sequences which are at least 90%, 95%, 98% or 99% identical to
sequences of SEQ ID NO:11, and SEQ ID NO:47, 59, 61, or 63,
respectively.
[0087] In one embodiment, the present invention relates to an
expression vector comprising a polynucleotide sequence comprising a
sequence of SEQ ID NO:11, 47, 59, 61, or 63.
[0088] In one embodiment, the present invention relates to an
expression vector comprising a polynucleotide sequence comprising a
sequence which is at least 90%, 95%, 98% or 99% identical to a
sequence of SEQ ID NO:11, 47, 59, 61, or 63, respectively.
[0089] In one embodiment, the present invention relates to an
expression vector comprising polynucleotide sequences which encode
a penta-specific antibody comprising heavy and light chains
comprising the amino acid sequences of SEQ ID NO:46, and SEQ ID
NO:48, 60, 62, or 64, respectively.
[0090] In one embodiment, the present invention relates to an
expression vector comprising polynucleotide sequences which encode
a penta-specific antibody comprising heavy and light chains
comprising the amino acid sequences which are at least 90%, 95%,
98% or 99% identical to the amino acid sequences of SEQ ID NO:46,
and SEQ ID NO:48, 60, 62, or 64, respectively.
[0091] In one embodiment, the present invention relates to an
expression vector comprising a polynucleotide sequence which encode
a polypeptide comprising the amino acid sequence of SEQ ID NO:46,
48, 60, 62, or 64.
[0092] In one embodiment, the present invention relates to an
expression vector comprising a polynucleotide sequence which encode
a polypeptide comprising an amino acid sequence which is at least
90%, 95%, 98% or 99% identical to the amino acid sequences of SEQ
ID NO:46, 48, 60, 62, or 64.
[0093] In one embodiment the present invention relates to a process
for producing a penta-specific antibody (immunoglobulin) in a
single host cell, comprising the steps of: [0094] (i) transforming
said single host cell with a first DNA sequence encoding a heavy
chain comprising polypeptide of SEQ ID NO: 46; and a second DNA
sequence encoding a light chain comprising a polypeptide of SEQ ID
NO: 48, 60, 62, or 64; and [0095] (ii) expressing said first DNA
sequence and said second DNA sequence so that said immunoglobulin
heavy and light chains are produced as separate molecules in said
transformed single host cell; [0096] furthermore, this process can
be carried out such that said first and second DNA sequences are
present in different vectors or said first and second DNA sequences
are present in a single vector.
[0097] In one embodiment the present invention relates to a process
for producing a penta-specific antibody (immunoglobulin) in a
single host cell, comprising the steps of: [0098] (i) transforming
said single host cell with a first DNA sequence encoding at least
the variable domain of the immunoglobulin heavy chain comprising
CDR domains of SEQ ID NOs: 13, 14, and 15; and a second DNA
sequence encoding at least the variable domain of the
immunoglobulin light chain comprising CDR domains of SEQ ID NOs:
16, 17, and 18; and [0099] (ii) expressing said first DNA sequence
and said second DNA sequence so that said immunoglobulin heavy and
light chains are produced as separate molecules in said transformed
single host cell; furthermore, this process can be carried out such
that said first and second DNA sequences are present in different
vectors or said first and second DNA sequences are present in a
single vector.
[0100] In one embodiment the present invention relates to a process
for producing a penta-specific antibody (immunoglobulin) in a
single host cell, comprising the steps of: [0101] (i) transforming
said single host cell with a first DNA sequence encoding at least
the variable domain of the immunoglobulin heavy chain comprising
CDR domains of SEQ ID NOs: 19, 20, and 21; and a second DNA
sequence encoding at least the variable domain of the
immunoglobulin light chain comprising CDR domains of SEQ ID NOs:
22, 23, and 24; and [0102] (ii) expressing said first DNA sequence
and said second DNA sequence so that said immunoglobulin heavy and
light chains are produced as separate molecules in said transformed
single host cell; this process can be carried out such that said
first and second DNA sequences are present in different vectors or
said first and second DNA sequences are present in a single
vector.
[0103] In one embodiment the present invention relates to an
antibody that fully or partially blocks the binding of any one of
the aforementioned penta-specific antibody to human IL-8,
Gro-alpha, Gro-beta, Gro-gamma, ENA-78, and GCP-2 in an
immunoassay, such as ELISA assay. In one embodiment, partial
blocking occurs when the antibody blocks the binding of the
penta-specific antibody by more than 10%, 20%, 40% or 50%.
[0104] In one embodiment the present invention relates to an
antibody that competes with the binding of any of the
aforementioned penta-specific antibody to human IL-8, Gro-alpha,
Gro-beta, Gro-gamma, ENA-78, and GCP-2.
[0105] In one embodiment the present invention relates to an
antibody that fully or partially blocks the binding of any one of
the aforementioned penta-specific antibody to epitope of
KELRCQCIKTYSKP (SEQ ID NO: 54) in human IL-8 in an immunoassay,
such as ELISA assay. In one embodiment, partial blocking occurs
when the antibody blocks the binding of the penta-specific antibody
by more than 10%, 20%, 40% or 50%.
[0106] In one embodiment the present invention relates to an
antibody that competes with the binding of any one of the
aforementioned penta-specific antibody to epitope of KELRCQCIKTYSKP
(SEQ ID NO: 54) in human IL-8.
[0107] In one embodiment, the present invention relates to a
composition comprising an aforementioned penta-specific antibody
and a pharmaceutically acceptable carrier.
[0108] In one embodiment, the present invention relates to a method
of treating or preventing in a mammal COPD, osteoarthritis,
rheumatoid arthritis, erosive arthritis, asthma, atherosclerosis,
inflammatory bowel disease, psoriasis, transplant rejection, gout,
cancer, acute lung injury, acute lung disease, sepsis, ARDS,
peripheral artery disease, systemic sclerosis, neonatal respiratory
distress syndrome, exacerbation of asthma and COPD, cystic
fibrosis, diffuse panbronchiolitis, reperfusion injury, and/or
endometriosis comprising administering an effective amount of an
aforementioned penta-specific antibody to said mammal.
[0109] In one embodiment the present invention relates to an
aforementioned penta-specific antibody for use in the treatment of
diseases or disorders characterised by elevated or unbalanced level
of one or more of human IL-8, Gro-alpha, Gro-beta, Gro-gamma, GCP-2
and ENA-78, particularly COPD, osteoarthritis, rheumatoid
arthritis, erosive arthritis, asthma, atherosclerosis, inflammatory
bowel disease, psoriasis, transplant rejection, gout, cancer, acute
lung injury, acute lung disease, sepsis, ARDS, peripheral artery
disease, systemic sclerosis, neonatal respiratory distress
syndrome, exacerbation of asthma and COPD, cystic fibrosis, diffuse
panbronchiolitis, reperfusion injury, or endometriosis.
[0110] In one aspect, the present invention relates to an
aforementioned penta-specific antibody for use in preventing and/or
treating COPD, osteoarthritis, rheumatoid arthritis, erosive
arthritis, asthma, atherosclerosis, inflammatory bowel disease,
psoriasis, transplant rejection, gout, cancer, acute lung injury,
acute lung disease, sepsis, ARDS, peripheral artery disease,
systemic sclerosis, neonatal respiratory distress syndrome,
exacerbation of asthma and COPD, cystic fibrosis, diffuse
panbronchiolitis, reperfusion injury, and/or endometriosis in a
mammal.
[0111] In one aspect, the present invention relates to use of an
aforementioned penta-specific antibody in the manufacture of a
medicament for use in preventing and/or treating COPD,
osteoarthritis, rheumatoid arthritis, erosive arthritis, asthma,
atherosclerosis, inflammatory bowel disease, psoriasis, transplant
rejection, gout, cancer, acute lung injury, acute lung disease,
sepsis, ARDS, peripheral artery disease, systemic sclerosis,
neonatal respiratory distress syndrome, exacerbation of asthma and
COPD, cystic fibrosis, diffuse panbronchiolitis, reperfusion
injury, and/or endometriosis in a mammal.
[0112] In one aspect, the present invention relates to use of an
aforementioned penta-specific antibody in the manufacture of a
medicament for preventing and/or treating COPD, osteoarthritis,
rheumatoid arthritis, erosive arthritis, asthma, atherosclerosis,
inflammatory bowel disease, psoriasis, transplant rejection, gout,
cancer, acute lung injury, acute lung disease, sepsis, ARDS,
peripheral artery disease, systemic sclerosis, neonatal respiratory
distress syndrome, exacerbation of asthma and COPD, cystic
fibrosis, diffuse panbronchiolitis, reperfusion injury, and/or
endometriosis in a mammal.
[0113] In one embodiment, above mammal is human.
DESCRIPTION OF FIGURES
[0114] FIG. 1 depicts an exemplary set of MAPs to generate a
penta-specific antibody. For avoidance of doubt, five MAP peptide
units are depicted. Each unit contains one identical amino acid
sequence selected from linear peptides of SEQ ID NO: 49-53.
[0115] FIG. 2 shows flow cytometric data comparing neutrophils
present in BAL samples. Sessions 1, 2 and 3 are presented. The
black solid bars show the baselines 5 day pre-LPS challenge. The
grey solid bars depict the BAL data 6-hours post LPS challenge. The
Chimera Antibody (HcLc) treatment significantly and dose
dependently inhibited neutrophil infiltration. The grey hatched
bars represent 24-hour data. (n=6, *p.ltoreq.0.05,
.dagger.p.ltoreq.0.01, error bars represent standard
deviation).
[0116] FIG. 3 shows hematological analysis of total circulating
neutrophils (cell count). IV injection of 1 (open squares,
.quadrature.) and 10 mg/kg (closed circles, ) of the Chimera
Antibody (HcLc) prevented inhaled LPS stimulation of circulating
neutrophils. Both 1 and 10 mg/kg treatments are significantly
reduced compared to the vehicle NHP (.dagger.) and 10 mg/kg
treatment was also significantly reduced compared to the 1 mg/kg
dose (*). Data are represented as total count per ul of blood (n=6,
*p.ltoreq.0.05 vs. 1 mg/kg, .dagger.p.ltoreq.0.01 vs. vehicle,
error bars represent standard deviation).
[0117] FIG. 4 shows inhibition human IL-8 stimulated neutrophil
activation (increased CD11b surface expression). Various
concentrations of the humanized penta-specific antibodies were
pre-incubated with 10 nM hIL-8 prior to addition to purified human
neutrophils. Data are expressed as mean values of 4 different
donors (n=4). Bars represent standard error. All samples are
compared to purified neutrophils stimulated with hIL-8 only (no mAb
prior to addition to purified neutrophils). Humanized construct
H0L10 and H0M0 are more effective at inhibiting hIL-8 stimulated
CD11b surface expression.
[0118] FIG. 5A shows mouse 656.35 mAb binding to target human
chemokines.
[0119] FIG. 5B shows the Chimera Antibody (HcLc) mAb binding to
human target chemokines.
[0120] FIG. 5C shows humanized mAbs binding to human target
chemokines.
DETAILED DESCRIPTION OF THE INVENTION
[0121] An "isolated penta-specific antibody" or simply
"penta-specific antibody", as used herein, is intended to refer to
an antibody that binds to and therefore cross reacts with human
IL-8, Gro-alpha, Gro-beta, Gro-gamma, and ENA-78, and is
substantially free of other antibodies having different antigenic
specificities, and furthermore, is a single composition of matter.
For avoidance of doubt, the penta-specific antibody of the present
invention need not bind solely to human IL-8, Gro-alpha, Gro-beta,
Gro-gamma, and ENA-78 antigens, but it may also happen to bind to
other related proteins, such as human GCP-2, or may even bind to
non-human orthologues of IL-8, Gro-alpha, Gro-beta, Gro-gamma,
ENA-78, and GCP-2; in other words the penta-specific antibody of
the present invention minimally binds to human IL-8, Gro-alpha,
Gro-beta, Gro-gamma, and ENA-78. Moreover, an isolated
penta-specific antibody is substantially free of other cellular
material and/or chemicals. A penta-specific antibody, as used in
this context, also includes antigen binding fragments and/or
derivatives having the binding characteristics of their "parent"
penta-specific antibody. The penta-specific antibody of the present
invention may comprise two identical heavy chains and two identical
light chains, forming the typical, bilaterally symmetric
immunoglobulin molecule comprised of two heterodimers which are
each comprised of a heavy chain and a light chain. Accordingly, the
penta-specific antibody of the present invention may comprise two
copies of the same antigen binding domain formed by the association
of one heavy chain with one light chain. The penta-specific
antibody of the present invention, though having only one kind of
binding domain is still able to bind to and therefore cross react
with human IL-8, Gro-alpha, Gro-beta, Gro-gamma, and ENA-78.
[0122] As used herein, "antibody" is also referred to as
"immunoglobulin".
[0123] As used herein, "an antibody that cross reacts with" means
the antibody binds not only to one antigen but binds to other
antigens as well.
[0124] "Neutralizing," as used herein is intended to refer to a
partial or full inhibition of at least one biological activities of
human IL-8, Gro-alpha, Gro-beta, Gro-gamma, GCP-2, or ENA-78. For
example, one of the biological activities of human IL-8, Gro-alpha,
Gro-beta, Gro-gamma, GCP-2, or ENA-78 is its ability to induce
neutrophil chemotaxis.
[0125] One way of measuring the binding kinetics of an antibody is
by surface plasmon resonance. The term "surface plasmon resonance",
as used herein, refers to an optical phenomenon that allows for the
analysis of real-time biospecific interactions by detection of
alterations in protein concentrations within a biosensor matrix,
for example using the BIAcore system (Pharmacia Biosensor AB,
Uppsala, Sweden and Piscataway, N.J.). For further descriptions,
see Jonsson, U., et al. (1993) Ann. Biol. Clin. 51:19-26; Jonsson,
U., et al. (1991) Biotechniques 11:620-627; Johnsson, B., et al.
(1995) J. Mol. Recognit. 8:125-131; and Johnnson, B., et al. (1991)
Anal. Biochem. 198:268-277. The term "epitope" means a protein
determinant capable of specific binding to an antibody. Epitopes
usually consist of chemically active surface groupings of molecules
such as amino acids or sugar side chains and usually have specific
three dimensional structural characteristics, as well as specific
charge characteristics.
[0126] A "monoclonal antibody" or mAb (as opposed to polyclonal
antibody) as used herein is intended to refer to a preparation of
antibody molecules of single molecular composition. For example, a
murine derived monoclonal antibody (mouse monoclonal antibody) can
be prepared by hybridoma technology, such as the standard Kohler
and Milstein hybridoma methodology.
[0127] Antibody-producing cells can be obtained from the subject
and used to prepare monoclonal antibodies by standard techniques,
such as the hybridoma technique originally described by Kohler and
Milstein (1975, Nature 256:495-497) (see also, Brown et al. (1981)
J. Immunol 127:539-46; Brown et al. (1980) J Biol Chem 255:4980-83;
Yeh et al. (1976) PNAS 76:2927-31; and Yeh et al. (1982) Int. J.
Cancer 29:269-75). The technology for producing monoclonal antibody
hybridomas is well known (see generally R. H. Kenneth, in
Monoclonal Antibodies: A New Dimension In Biological Analyses,
Plenum Publishing Corp., New York, N.Y. (1980); E. A. Lerner (1981)
Yale J. Biol. Med., 54:387-402; M. L. Gefter et al. (1977) Somatic
Cell Genet., 3:231-36).
[0128] The term "transfectoma", as used herein, includes
recombinant eukaryotic host cell expressing the antibody, such as
CHO cells, NS/0 cells, HEK293 cells, plant cells, or fungi,
including yeast cells.
[0129] As used herein, "specific" binding refers to antibody
binding to a predetermined antigen. Typically, the antibody binds
with an equilibrium constant, KD, corresponding to about
1.times.10.sup.-7 M or less, and binds to the predetermined antigen
with an affinity corresponding to a KD that is at least two orders
of magnitude lower than its affinity for binding to a non-specific
antigen (e.g., BSA, casein) other than the predetermined antigen or
a closely-related antigen. The phrases "an antibody recognizing an
antigen" and "an antibody specific for an antigen" are used
interchangeably herein with the term "an antibody which binds
specifically to an antigen".
[0130] As used herein, the term "kd" (sec-1), as used herein, is
intended to refer to the dissociation rate constant of a particular
antibody-antigen interaction.
[0131] The term "ka" (M.times.sec-1), as used herein, is intended
to refer to the association rate constant of a particular
antibody-antigen interaction.
[0132] The term "KD" (M), as used herein, is intended to refer to
the equilibrium constant of a particular antibody-antigen
interaction and is obtained by dividing the kd by the ka.
[0133] "Conservative sequence modifications" for nucleotide and
amino acid sequence modifications means changes which do not
significantly affect or alter the binding characteristics of the
antibody encoded by the nucleotide sequence or containing the amino
acid sequence. Such conservative sequence modifications include
nucleotide and amino acid substitutions, additions and deletions.
Modifications can be introduced into the sequences by standard
techniques known in the art, such as site-directed mutagenesis and
PCR-mediated mutagenesis. Conservative amino acid substitutions
include ones in which the amino acid residue is replaced with an
amino acid residue having a similar side chain. Families of amino
acid residues having similar side chains have been defined in the
art. These families include amino acids with basic side chains
(e.g., lysine, arginine, histidine), acidic side chains (e.g.,
aspartic acid, glutamic acid), uncharged polar side chains (e.g.,
glycine, asparagine, glutamine, serine, threonine, tyrosine,
cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine,
leucine, isoleucine, proline, phenylalanine, methionine),
beta-branched side chains (e.g., threonine, valine, isoleucine) and
aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan,
histidine). Thus, a predicted nonessential amino acid residue in an
antibody for which sequence is specifically disclosed is preferably
replaced with another amino acid residue from the same side chain
family. Thus in one aspect, the penta-specific antibody of the
present invention includes all the conservative sequence
modifications of the specifically disclosed amino acid
sequences.
[0134] The present invention also encompasses "derivatives" of the
amino acid sequences as specifically disclosed, wherein one or more
of the amino acid residues have been derivatized, e.g., by
acylation or glycosylation, without significantly affecting or
altering the binding characteristics of the antibody containing the
amino acid sequences.
[0135] For nucleic acids, the term "substantial identity" indicates
that two nucleic acids, or designated sequences thereof, when
optimally aligned and compared, are identical, with appropriate
nucleotide insertions or deletions, in at least about 80% of the
nucleotides, usually at least about 90% to 95%, and more preferably
at least about 98% to 99.5% of the nucleotides. Alternatively,
substantial identity when the segments will hybridize under
selective hybridization conditions, to the complement of the
strand.
[0136] For nucleotide and amino acid sequences, the term "identity"
indicates the degree of identity between two nucleic acid or amino
acid sequences when optimally aligned and compared with appropriate
insertions or deletions. Alternatively, substantial identity exists
when the DNA segments will hybridize under selective hybridization
conditions, to the complement of the strand.
The percent identity between two sequences is a function of the
number of identical positions shared by the sequences (i.e., %
identity=# of identical positions/total # of positions times 100),
taking into account the number of gaps, and the length of each gap,
which need to be introduced for optimal alignment of the two
sequences. The comparison of sequences and determination of percent
identity between two sequences can be accomplished using a
mathematical algorithm, as described in the non-limiting examples
below.
[0137] The percent identity between two nucleotide or polypeptide
sequences can be determined using the GAP program in the GCG
software package (available at http://www.gcg.com), using a
NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and
a length weight of 1, 2, 3, 4, 5, or 6. The percent identity
between two nucleotide or amino acid sequences can also be
determined using the algorithm of E. Meyers and W. Miller (Comput.
Appl. Biosci., 4:11-17 (1988)) which has been incorporated into the
ALIGN program (version 2.0), using a PAM120 weight residue table, a
gap length penalty of 12 and a gap penalty of 4. In addition, the
percent identity between two amino acid sequences can be determined
using the Needleman and Wunsch (J. Mol. Biol. 48:444-453 (1970))
algorithm which has been incorporated into the GAP program in the
GCG software package (available at http://www.gcg.com), using
either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of
16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or
6.
[0138] A nucleic acid is "operably linked" when it is placed into a
functional relationship with another nucleic acid sequence. For
instance, a promoter or enhancer is operably linked to a coding
sequence if it affects the transcription of the sequence. With
respect to transcription of regulatory sequences, operably linked
means that the DNA sequences being linked are contiguous and, where
necessary to join two protein coding regions, contiguous and in
reading frame. For switch sequences, operably linked indicates that
the sequences are capable of effecting switch recombination.
[0139] The term "vector," as used herein, is intended to refer to a
nucleic acid molecule capable of transporting another nucleic acid
to which it has been linked. One type of vector is a "plasmid",
which refers to a circular double stranded DNA loop into which
additional DNA segments may be ligated. Another type of vector is a
viral vector, wherein additional DNA segments may be ligated into
the viral genome. Certain vectors are capable of autonomous
replication in a host cell into which they are introduced (e.g.,
bacterial vectors having a bacterial origin of replication and
episomal mammalian vectors). Other vectors (e.g., non-episomal
mammalian vectors) can be integrated into the genome of a host cell
upon introduction into the host cell, and thereby are replicated
along with the host genome. Moreover, certain vectors are capable
of directing the expression of genes to which they are operatively
linked. Such vectors are referred to herein as "recombinant
expression vectors" (or simply, "expression vectors"). In general,
expression vectors of utility in recombinant DNA techniques are
often in the form of plasmids. In the present specification,
"plasmid" and "vector" may be used interchangeably as the plasmid
is the most commonly used form of vector. However, the invention is
intended to include such other forms of expression vectors, such as
viral vectors (e.g., replication defective retroviruses,
adenoviruses and adeno-associated viruses), which serve equivalent
functions.
[0140] The term "recombinant host cell" (or simply "host cell"), as
used herein, is intended to refer to a cell into which a
recombinant expression vector has been introduced. It should be
understood that such terms are intended to refer not only to the
particular subject cell but to the progeny of such a cell. Because
certain modifications may occur in succeeding generations due to
either mutation or environmental influences, such progeny may not,
in fact, be identical to the parent cell, but are still included
within the scope of the term "host cell" as used herein.
Recombinant host cells include, for example, transfectomas, such as
CHO cells, NS/0 cells, and lymphocytic cells.
[0141] As used herein, the term "subject" includes any human or
non-human animal. The term "non-human animal" includes all
vertebrates, e.g., mammals and non-mammals, such as non-human
primates, sheep, dog, cow, chickens, amphibians, reptiles, etc.
1. Antibody Structures
Intact Antibodies
[0142] Intact antibodies are usually heteromultimeric glycoproteins
comprising at least two heavy and two light chains. Aside from IgM,
intact antibodies are heterotetrameric glycoproteins of
approximately 150 Kda, composed of two identical light (L) chains
and two identical heavy (H) chains. Typically, each light chain is
linked to a heavy chain by one covalent disulfide bond while the
number of disulfide linkages between the heavy chains of different
immunoglobulin isotypes varies. Each heavy and light chain also has
intrachain disulfide bridges. Each heavy chain has at one end a
variable domain (V.sub.H) followed by a number of constant regions.
Each light chain has a variable domain (V.sub.L) and a constant
region at its other end; the constant region of the light chain is
aligned with the first constant region of the heavy chain and the
light chain variable domain is aligned with the variable domain of
the heavy chain. The light chains of antibodies from most
vertebrate species can be assigned to one of two types called Kappa
and Lambda based on the amino acid sequence of the constant region.
Depending on the amino acid sequence of the constant region of
their heavy chains, human antibodies can be assigned to five
different classes, IgA, IgD, IgE, IgG and IgM. IgG and IgA can be
further subdivided into subclasses, IgG1, IgG2, IgG3 and IgG4; and
IgA1 and IgA2. Species variants exist with mouse and rat having at
least IgG2a, IgG2b. The variable domain of the antibody confers
binding specificity upon the antibody with certain regions
displaying particular variability called complementarity
determining regions (CDRs). The more conserved portions of the
variable region are called framework regions (FR). The variable
domains of intact heavy and light chains each comprise four FR
connected by three CDRs. The CDRs in each chain are held together
in close proximity by the FR regions and with the CDRs from the
other chain contribute to the formation of the antigen binding site
of antibodies. The constant regions are not directly involved in
the binding of the antibody to the antigen but exhibit various
effector functions such as participation in antibody dependent
cell-mediated cytotoxicity (ADCC), phagocytosis via binding to
Fc.gamma. receptor, half-life/clearance rate via neonatal Fc
receptor (FcRn) and complement dependent cytotoxicity via the C1q
component of the complement cascade. The human IgG2 constant region
lacks the ability to activate complement by the classical pathway
or to mediate antibody-dependent cellular cytotoxicity. The IgG4
constant region lacks the ability to activate complement by the
classical pathway and mediates antibody-dependent cellular
cytotoxicity only weakly. Antibodies essentially lacking these
effector functions may be termed `non-lytic` antibodies.
Human Antibodies
[0143] Human antibodies may be produced by a number of methods
known to those of skill in the art. Human antibodies can be made by
the hybridoma method using human myeloma or mouse-human
heteromyeloma cells lines see Kozbor J. Immunol 133, 3001, (1984)
and Brodeur, Monoclonal Antibody Production Techniques and
Applications, pp 51-63 (Marcel Dekker Inc, 1987). Alternative
methods include the use of phage libraries or transgenic mice both
of which utilize human V region repertories (see Winter G, (1994),
Annu. Rev. Immunol 12, 433-455, Green L L (1999), J. Immunol.
methods 231, 11-23).
[0144] Several strains of transgenic mice are now available wherein
their mouse immunoglobulin loci has been replaced with human
immunoglobulin gene segments (see Tomizuka K, (2000) PNAS 97,
722-727; Fishwild D. M (1996) Nature Biotechnol. 14, 845-851,
Mendez M J, 1997, Nature Genetics, 15, 146-156). Upon antigen
challenge such mice are capable of producing a repertoire of human
antibodies from which antibodies of interest can be selected.
[0145] Of particular note is the Trimera.TM. system (see Eren R et
al, (1998) Immunology 93:154-161) where human lymphocytes are
transplanted into irradiated mice, the Selected Lymphocyte Antibody
System (SLAM, see Babcook et al, PNAS (1996) 93:7843-7848) where
human (or other species) lymphocytes are effectively put through a
massive pooled in vitro antibody generation procedure followed by
deconvulated, limiting dilution and selection procedure and the
Xenomouse II.TM. (Abgenix Inc). An alternative approach is
available from Morphotek Inc using the Morphodoma.TM.
technology.
[0146] Phage display technology can be used to produce human
antibodies (and fragments thereof), see McCafferty; Nature, 348,
552-553 (1990) and Griffiths A D et al (1994) EMBO 13:3245-3260.
According to this technique antibody V domain genes are cloned in
frame into either a major or minor coat of protein gene of a
filamentous bacteriophage such as M13 or fd and displayed (usually
with the aid of a helper phage) as functional antibody fragments on
the surface of the phage particle. Selections based on the
functional properties of the antibody result in selection of the
gene encoding the antibody exhibiting those properties. The phage
display technique can be used to select antigen specific antibodies
from libraries made from human B cells taken from individuals
afflicted with a disease or disorder described above or
alternatively from unimmunized human donors (see Marks; J. Mol.
Bio. 222, 581-597, 1991). Where an intact human antibody is desired
comprising a Fc domain it is necessary to reclone the phage
displayed derived fragment into a mammalian expression vectors
comprising the desired constant regions and establishing stable
expressing cell lines.
[0147] The technique of affinity maturation (Marks; Bio/technol 10,
779-783 (1992)) may be used to improve binding affinity wherein the
affinity of the primary human antibody is improved by sequentially
replacing the H and L chain V regions with naturally occurring
variants and selecting on the basis of improved binding affinities.
Variants of this technique such as "epitope imprinting" are now
also available see WO 93/06213. See also Waterhouse; Nucl. Acids
Res 21, 2265-2266 (1993).
Chimaeric and Humanised Antibodies
[0148] The use of intact non-human antibodies in the treatment of
human diseases or disorders carries with it the now well
established problems of potential immunogenicity especially upon
repeated administration of the antibody that is the immune system
of the patient may recognise the non-human intact antibody as
non-self and mount a neutralising response. In addition to
developing fully human antibodies (see above) various techniques
have been developed over the years to overcome these problems and
generally involve reducing the composition of non-human amino acid
sequences in the intact therapeutic antibody whilst retaining the
relative ease in obtaining non-human antibodies from an immunised
animal e.g. mouse, rat or rabbit. Broadly two approaches have been
used to achieve this. The first are chimaeric antibodies, which
generally comprise a non-human (e.g. rodent such as mouse) variable
domain fused to a human constant region. Because the
antigen-binding site of an antibody is localised within the
variable regions the chimaeric antibody retains its binding
affinity for the antigen but acquires the effector functions of the
human constant region and are therefore able to perform effector
functions such as described supra. Chimaeric antibodies are
typically produced using recombinant DNA methods. DNA encoding the
antibodies (e.g. cDNA) is isolated and sequenced using conventional
procedures (e.g. by using oligonucleotide probes that are capable
of binding specifically to genes encoding the H and L chain
variable regions of the antibody of the invention. Hybridoma cells
serve as a typical source of such DNA. Once isolated, the DNA is
placed into expression vectors which are then transfected into host
cells such as E. Coli, COS cells, CHO cells or myeloma cells that
do not otherwise produce immunoglobulin protein to obtain synthesis
of the antibody. The DNA may be modified by substituting the coding
sequence for human L and H chains for the corresponding non-human
(e.g. murine) H and L constant regions see e.g. Morrison; PNAS 81,
6851 (1984). Thus another embodiment of the invention there is
provided a chimaeric antibody comprising a V.sub.H domain having
the sequence: SEQ ID No:2, 6, or 10 and a V.sub.L domain having the
sequence: SEQ ID No: 4, 8, or 12 fused to a human constant region
(which maybe of a IgG isotype e.g. IgG1).
[0149] The second approach involves the generation of humanised
antibodies wherein the non-human content of the antibody is reduced
by humanizing the variable regions. Two techniques for humanisation
have gained popularity. The first is humanisation by CDR grafting.
CDRs build loops close to the antibody's N-terminus where they form
a surface mounted in a scaffold provided by the framework regions.
Antigen-binding specificity of the antibody is mainly defined by
the topography and by the chemical characteristics of its CDR
surface. These features are in turn determined by the conformation
of the individual CDRs, by the relative disposition of the CDRs,
and by the nature and disposition of the side chains of the
residues comprising the CDRs. A large decrease in immunogenicity
can be achieved by grafting only the CDRs of a non-human (e.g.
murine) antibodies ("donor" antibodies) onto a suitable human
framework ("acceptor framework") and constant regions (see Jones et
al (1986) Nature 321, 522-525 and Verhoeyen M et al (1988) Science
239, 1534-1536). However, CDR grafting per se may not result in the
complete retention of antigen-binding properties and it is
frequently found that some framework residues of the donor antibody
need to be preserved (sometimes referred to as "backmutations") in
the humanised molecule if significant antigen-binding affinity is
to be recovered (see Queen C et al (1989) PNAS 86, 10,029-10,033,
Co, M et al (1991) Nature 351, 501-502). In this case, human V
regions showing the greatest sequence homology (typically 60% or
greater) to the non-human donor antibody maybe chosen from a
database in order to provide the human framework (FR). The
selection of human FRs can be made either from human consensus or
individual human antibodies. Where necessary key residues from the
donor antibody are substituted into the human acceptor framework to
preserve CDR conformations. Computer modelling of the antibody
maybe used to help identify such structurally important residues,
see WO99/48523.
[0150] Alternatively, humanisation maybe achieved by a process of
"veneering". A statistical analysis of unique human and murine
immunoglobulin heavy and light chain variable regions revealed that
the precise patterns of exposed residues are different in human and
murine antibodies, and most individual surface positions have a
strong preference for a small number of different residues (see
Padlan E. A. et al; (1991) Mol. Immunol. 28, 489-498 and Pedersen
J. T. et al (1994) J. Mol. Biol. 235; 959-973). Therefore it is
possible to reduce the immunogenicity of a non-human Fv by
replacing exposed residues in its framework regions that differ
from those usually found in human antibodies. Because protein
antigenicity can be correlated with surface accessibility,
replacement of the surface residues may be sufficient to render the
mouse variable region "invisible" to the human immune system (see
also Mark G. E. et al (1994) in Handbook of Experimental
Pharmacology vol. 113: The pharmacology of monoclonal Antibodies,
Springer-Verlag, pp 105-134). This procedure of humanisation is
referred to as "veneering" because only the surface of the antibody
is altered, the supporting residues remain undisturbed. A further
alternative approach is set out in WO04/006955. Further alternative
approaches include that set out in WO04/006955 and the procedure of
Humaneering.TM. (Kalobios) which makes use of bacterial expression
systems and produces antibodies that are close to human germline in
sequence (Alfenito-M Advancing Protein Therapeutics January 2007,
San Diego, Calif.). Another, approach to humanisation involves
selecting human acceptor frameworks on the basis of structural
similarity of the human CDR regions to those of the donor mouse
antibody CDR regions rather than on homology between other regions
of the antibody such as framework regions. This process is also
known as Superhumanisation.TM. (Evogenix Inc.; Hwang et al (2005)
Methods 36:35-42).
[0151] It will be apparent to those skilled in the art that the
term "derived" is intended to define not only the source in the
sense of it being the physical origin for the material but also to
define material which is structurally identical to the material but
which does not originate from the reference source. Thus "residues
found in the donor antibody" need not necessarily have been
purified from the donor antibody.
Antibody Fragments
[0152] In certain embodiments of the invention there is provided
therapeutic antibody which is an antigen binding fragment. Such
fragments may be functional antigen binding fragments of intact
and/or humanised and/or chimaeric antibodies such as Fab, Fd, Fab',
F(ab').sub.2, Fv, ScFv fragments of the antibodies described supra.
Fragments lacking the constant region lack the ability to activate
complement by the classical pathway or to mediate
antibody-dependent cellular cytotoxicity. Traditionally such
fragments are produced by the proteolytic digestion of intact
antibodies by e.g. papain digestion (see for example, WO 94/29348)
but may be produced directly from recombinantly transformed host
cells. For the production of ScFv, see Bird et al; (1988) Science,
242, 423-426. In addition, antibody fragments may be produced using
a variety of engineering techniques as described below.
[0153] Fv fragments appear to have lower interaction energy of
their two chains than Fab fragments. To stabilise the association
of the V.sub.H and V.sub.L domains, they have been linked with
peptides (Bird et al, (1988) Science 242, 423-426, Huston et al,
PNAS, 85, 5879-5883), disulphide bridges (Glockshuber et al, (1990)
Biochemistry, 29, 1362-1367) and "knob in hole" mutations (Zhu et
al (1997), Protein Sci., 6, 781-788). ScFv fragments can be
produced by methods well known to those skilled in the art see
Whitlow et al (1991) Methods companion Methods Enzymol, 2, 97-105
and Huston et al (1993) Int. Rev. Immunol 10, 195-217. ScFv may be
produced in bacterial cells such as E. Coli but are more typically
produced in eukaryotic cells. One disadvantage of ScFv is the
monovalency of the product, which precludes an increased avidity
due to polyvalent binding, and their short half-life. Attempts to
overcome these problems include bivalent (ScFv').sub.2 produced
from ScFV containing an additional C terminal cysteine by chemical
coupling (Adams et al (1993) Can. Res 53, 4026-4034 and McCartney
et al (1995) Protein Eng. 8, 301-314) or by spontaneous
site-specific dimerization of ScFv containing an unpaired C
terminal cysteine residue (see Kipriyanov et al (1995) Cell.
Biophys 26, 187-204). Alternatively, ScFv can be forced to form
multimers by shortening the peptide linker to between 3 to 12
residues to form "diabodies", see Holliger et al PNAS (1993), 90,
6444-6448. Reducing the linker still further can result in ScFV
trimers ("triabodies", see Kortt et al (1997) Protein Eng, 10,
423-433) and tetramers ("tetrabodies", see Le Gall et al (1999)
FEBS Lett, 453, 164-168). Construction of bivalent ScFV molecules
can also be achieved by genetic fusion with protein dimerizing
motifs to form "miniantibodies" (see Pack et al (1992) Biochemistry
31, 1579-1584) and "minibodies" (see Hu et al (1996), Cancer Res.
56, 3055-3061). ScFv-Sc-Fv tandems ((ScFV).sub.2) may also be
produced by linking two ScFv units by a third peptide linker, see
Kurucz et al (1995) J. Immol. 154, 4576-4582. Bispecific diabodies
can be produced through the noncovalent association of two single
chain fusion products consisting of V.sub.H domain from one
antibody connected by a short linker to the V.sub.L domain of
another antibody, see Kipriyanov et al (1998), Int. J. Can 77,
763-772. The stability of such bispecific diabodies can be enhanced
by the introduction of disulphide bridges or "knob in hole"
mutations as described supra or by the formation of single chain
diabodies (ScDb) wherein two hybrid ScFv fragments are connected
through a peptide linker see Kontermann et al (1999) J. Immunol.
Methods 226 179-188. Tetravalent bispecific molecules are available
by e.g. fusing a ScFv fragment to the CH3 domain of an IgG molecule
or to a Fab fragment through the hinge region see Coloma et al
(1997) Nature Biotechnol. 15, 159-163. Alternatively, tetravalent
bispecific molecules have been created by the fusion of bispecific
single chain diabodies (see Alt et al, (1999) FEBS Lett 454, 90-94.
Smaller tetravalent bispecific molecules can also be formed by the
dimerization of either ScFv-ScFv tandems with a linker containing a
helix-loop-helix motif (DiBi miniantibodies, see Muller et al
(1998) FEBS Lett 432, 45-49) or a single chain molecule comprising
four antibody variable domains (V.sub.H and V.sub.L) in an
orientation preventing intramolecular pairing (tandem diabody, see
Kipriyanov et al, (1999) J. Mol. Biol. 293, 41-56). Bispecific
F(ab')2 fragments can be created by chemical coupling of Fab'
fragments or by heterodimerization through leucine zippers (see
Shalaby et al, (1992) J. Exp. Med. 175, 217-225 and Kostelny et al
(1992), J. Immunol. 148, 1547-1553). Also available are so-called
domain antibodies based on isolated V.sub.H or V.sub.L domains
(Domantis Ltd.), see U.S. Pat. No. 6,248,516; U.S. Pat. No.
6,291,158; U.S. Pat. No. 6,172,197.
Heteroconjugate Antibodies
[0154] Heteroconjugate antibodies are derivatives which also form
an embodiment of the present invention. Heteroconjugate antibodies
are composed of two covalently joined antibodies formed using any
convenient cross-linking methods. See U.S. Pat. No. 4,676,980.
Other Modifications.
[0155] Antibodies of the present invention may also incorporate any
other modifications in the constant regions. For example
glycosylation of antibodies at conserved positions in their
constant regions is known to have a profound effect on antibody
function, particularly effector functioning such as those described
above, see for example, Boyd et al (1996), Mol. Immunol. 32,
1311-1318. Glycosylation variants of the therapeutic antibodies of
the present invention wherein one or more carbohydrate moiety is
added, substituted, deleted or modified are contemplated.
Introduction of an asparagine-X-serine or asparagine-X-threonine
motif creates a potential site for enzymatic attachment of
carbonhydrate moieties and may therefore be used to manipulate the
glycosylation of an antibody. In Raju et al (2001) Biochemistry 40,
8868-8876 the terminal sialyation of a TNFR-IgG immunoadhesin was
increased through a process of regalactosylation and/or
resialylation using beta-1,4-galactosyltransferace and/or alpha,
2,3 sialyltransferase. Increasing the terminal sialylation is
believed to increase the half-life of the immunoglobulin.
Antibodies, in common with most glycoproteins, are typically
produced in nature as a mixture of glycoforms. This mixture is
particularly apparent when antibodies are produced in eukaryotic,
particularly mammalian cells. A variety of methods have been
developed to manufacture defined glycoforms, see Zhang et al
Science (2004), 303, 371, Sears et al, Science, (2001) 291, 2344,
Wacker et al (2002) Science, 298 1790, Davis et al (2002) Chem.
Rev. 102, 579, Hang et al (2001) Acc. Chem. Res 34, 727. Thus the
invention concerns a plurality of therapeutic antibodies (which
maybe of the IgG isotype, e.g. IgG1) as described herein comprising
a defined number (e.g. 7 or less, for example 5 or less such as two
or a single) glycoform(s) of said antibodies.
[0156] Derivatives according to the invention also include
therapeutic antibodies of the invention coupled to a
non-proteinaeous polymer such as polyethylene glycol (PEG),
polypropylene glycol or polyoxyalkylene. Conjugation of proteins to
PEG is an established technique for increasing half-life of
proteins, as well as reducing antigenicity and immunogenicity of
proteins. The use of PEGylation with different molecular weights
and styles (linear or branched) has been investigated with intact
antibodies as well as Fab' fragments, see Koumenis I. L. et al
(2000) Int. J. Pharmaceut. 198:83-95. A particular embodiment
comprises an antigen-binding fragment of the invention without the
effector functions of a) activation of complement by the classical
pathway; and b) mediating antibody-dependent cellular cytotoxicity;
(such as a Fab fragment or a scFv) coupled to PEG.
The interaction between the Fc region of an antibody and various Fc
receptors (Fc.gamma.R) is believed to mediate the effector
functions of the antibody which include antibody-dependent cellular
cytotoxicity (ADCC), fixation of complement, phagocytosis and
half-life/clearance of the antibody. Various modifications to the
Fc region of antibodies of the invention may be carried out
depending on the desired effector property. In particular, human
constant regions which essentially lack the functions of a)
activation of complement by the classical pathway; and b) mediating
antibody-dependent cellular cytotoxicity include the IgG4 constant
region, the IgG2 constant region and IgG1 constant regions
containing specific mutations as for example mutations at positions
234, 235, 236, 237, 297, 318, 320 and/or 322 disclosed in EP0307434
(WO8807089), EP 0629 240 (WO9317105) and WO 2004/014953. Mutations
at residues 235 or 237 within the CH2 domain of the heavy chain
constant region (Kabat numbering; EU Index system) have separately
been described to reduce binding to Fc.gamma.RI, Fc.gamma.RII and
Fc.gamma.RIII binding and therefore reduce antibody-dependent
cellular cytotoxicity (ADCC) (Duncan et al. Nature 1988, 332;
563-564; Lund et al. J. Immunol. 1991, 147; 2657-2662; Chappel et
al. PNAS 1991, 88; 9036-9040; Burton and Woof, Adv. Immunol. 1992,
51; 1-84; Morgan et al., Immunology 1995, 86; 319-324; Hezareh et
al., J. Virol. 2001, 75 (24); 12161-12168). Further, some reports
have also described involvement of some of these residues in
recruiting or mediating complement dependent cytotoxicity (CDC)
(Morgan et al., 1995; Xu et al., Cell. Immunol. 2000; 200:16-26;
Hezareh et al., J. Virol. 2001, 75 (24); 12161-12168). Residues 235
and 237 have therefore both been mutated to alanine residues (Brett
et al. Immunology 1997, 91; 346-353; Bartholomew et al. Immunology
1995, 85; 41-48; and WO9958679) to reduce both complement mediated
and Fc.gamma.R-mediated effects. Antibodies comprising these
constant regions may be termed `non-lytic` antibodies.
[0157] One may incorporate a salvage receptor binding epitope into
the antibody to increase serum half life see U.S. Pat. No.
5,739,277.
[0158] There are five currently recognised human Fc.gamma.
receptors, Fc.gamma.R (I), Fc.gamma.RIIa, Fc.gamma.RIIb,
Fc.gamma.RIIIa and neonatal FcRn. Shields et al, (2001) J. Biol.
Chem 276, 6591-6604 demonstrated that a common set of IgG1 residues
is involved in binding all Fc.gamma.Rs, while Fc.gamma.RII and
Fc.gamma.RIII utilize distinct sites outside of this common set.
One group of IgG1 residues reduced binding to all Fc.gamma.Rs when
altered to alanine: Pro-238, Asp-265, Asp-270, Asn-297 and Pro-239.
All are in the IgG CH2 domain and clustered near the hinge joining
CH1 and CH2. While Fc.gamma.RI utilizes only the common set of IgG1
residues for binding, Fc.gamma.RII and Fc.gamma.RIII interact with
distinct residues in addition to the common set. Alteration of some
residues reduced binding only to Fc.gamma.RII (e.g. Arg-292) or
Fc.gamma.RIII (e.g. Glu-293). Some variants showed improved binding
to Fc.gamma.RII or Fc.gamma.RIII but did not affect binding to the
other receptor (e.g. Ser-267Ala improved binding to Fc.gamma.RII
but binding to Fc.gamma.RIII was unaffected). Other variants
exhibited improved binding to Fc.gamma.RII or Fc.gamma.RIII with
reduction in binding to the other receptor (e.g. Ser-298Ala
improved binding to Fc.gamma.RIII and reduced binding to
Fc.gamma.RII). For Fc.gamma.RIIIa, the best binding IgG1 variants
had combined alanine substitutions at Ser-298, Glu-333 and Lys-334.
The neonatal FcRn receptor is believed to be involved in protecting
IgG molecules from degradation and thus enhancing serum half life
and the transcytosis across tissues (see Junghans R. P (1997)
Immunol. Res 16. 29-57 and Ghetie et al (2000) Annu. Rev. Immunol.
18, 739-766). Human IgG1 residues determined to interact directly
with human FcRn includes Ile253, Ser254, Lys288, Thr307, Gln311,
Asn434 and His435.
[0159] The therapeutic antibody of the invention may incorporate
any of the above constant region modifications.
2. Production Methods
[0160] Antibodies of the present invention may be produced in
transgenic organisms such as goats (see Pollock et al (1999), J.
Immunol. Methods 231:147-157), chickens (see Morrow K J J (2000)
Genet. Eng. News 20:1-55), mice (see Pollock et al ibid) or plants
(see Doran P M, (2000) Curr. Opinion Biotechnol. 11, 199-204, Ma J
K-C (1998), Nat. Med. 4; 601-606, Baez J et al, BioPharm (2000) 13:
50-54, Stoger E et al; (2000) Plant Mol. Biol. 42:583-590).
Antibodies may also be produced by chemical synthesis. However,
antibodies of the invention are typically produced using
recombinant cell culturing technology well known to those skilled
in the art. A polynucleotide encoding the antibody is isolated and
inserted into a replicable vector such as a plasmid for further
cloning (amplification) or expression in a host cell. One useful
expression system is a glutamate synthetase system (such as sold by
Lonza Biologics), particularly where the host cell is CHO or NS0
(see below). Polynucleotide encoding the antibody is readily
isolated and sequenced using conventional procedures (e.g.
oligonucleotide probes). Vectors that may be used include plasmid,
virus, phage, transposons, minichromsomes of which plasmids are a
typical embodiment. Generally such vectors further include a signal
sequence, origin of replication, one or more marker genes, an
enhancer element, a promoter and transcription termination
sequences operably linked to the light and/or heavy chain
polynucleotide so as to facilitate expression. Polynucleotide
encoding the light and heavy chains may be inserted into separate
vectors and introduced (e.g. by transformation, transfection,
electroporation or transduction) into the same host cell
concurrently or sequentially or, if desired both the heavy chain
and light chain can be inserted into the same vector prior to such
introduction.
[0161] It will be immediately apparent to those skilled in the art
that due to the redundancy of the genetic code, alternative
polynucleotides to those disclosed herein are also available that
will encode the polypeptides of the invention.
Signal Sequences
[0162] Antibodies of the present invention maybe produced as a
fusion protein with a heterologous signal sequence having a
specific cleavage site at the N terminus of the mature protein. The
signal sequence should be recognised and processed by the host
cell. For prokaryotic host cells, the signal sequence may be an
alkaline phosphatase, penicillinase, or heat stable enterotoxin II
leaders. For yeast secretion the signal sequences may be a yeast
invertase leader, a factor leader or acid phosphatase leaders see
e.g. WO90/13646. In mammalian cell systems, viral secretory leaders
such as herpes simplex gD signal and a native immunoglobulin signal
sequence (such as human Ig heavy chain) are available. Typically
the signal sequence is ligated in reading frame to polynucleotide
encoding the antibody of the invention.
Origin of Replication
[0163] Origin of replications are well known in the art with pBR322
suitable for most gram-negative bacteria, 2.mu. plasmid for most
yeast and various viral origins such as SV40, polyoma, adenovirus,
VSV or BPV for most mammalian cells. Generally the origin of
replication component is not needed for integrated mammalian
expression vectors, unless vector propagation is required in E.
Coli. However the SV40 ori may be used since it contains the early
promoter.
Selection Marker
[0164] Typical selection genes encode proteins that (a) confer
resistance to antibiotics or other toxins e.g. ampicillin,
neomycin, methotrexate or tetracycline or (b) complement
auxotrophic deficiencies or supply nutrients not available in the
complex media or (c) combinations of both. The selection scheme may
involve arresting growth of the host cells that contain no vector
or vectors. Cells, which have been successfully transformed with
the genes encoding the therapeutic antibody of the present
invention, survive due to e.g. drug resistance conferred by the
co-delivered selection marker. One example is the DHFR-selection
system wherein transformants are generated in DHFR negative host
strains (eg see Page and Sydenham 1991 Biotechnology 9: 64-68). In
this system the DHFR gene is co-delivered with antibody
polynucleotide sequences of the invention and DHFR positive cells
then selected by nucleoside withdrawal. If required, the DHFR
inhibitor methotrexate is also employed to select for transformants
with DHFR gene amplification. By operably linking DHFR gene to the
antibody coding sequences of the invention or functional
derivatives thereof, DHFR gene amplification results in concomitant
amplification of the desired antibody sequences of interest. CHO
cells are a particularly useful cell line for this
DHFR/methotrexate selection and methods of amplifying and selecting
host cells using the DHFR system are well established in the art
see Kaufman R. J. et al J. Mol. Biol. (1982) 159, 601-621, for
review, see Werner R G, Noe W, Kopp K, Schluter M, "Appropriate
mammalian expression systems for biopharmaceuticals",
Arzneimittel-Forschung. 48(8):870-80, 1998 Aug. A further example
is the glutamate synthetase expression system (Lonza Biologics). A
suitable selection gene for use in yeast is the trp1 gene; see
Stinchcomb et al Nature 282, 38, 1979.
Promoters
[0165] Suitable promoters for expressing antibodies of the
invention are operably linked to DNA/polynucleotide encoding the
antibody. Promoters for prokaryotic hosts include phoA promoter,
Beta-lactamase and lactose promoter systems, alkaline phosphatase,
tryptophan and hybrid promoters such as Tac. Promoters suitable for
expression in yeast cells include 3-phosphoglycerate kinase or
other glycolytic enzymes e.g. enolase, glyceralderhyde 3 phosphate
dehydrogenase, hexokinase, pyruvate decarboxylase,
phosphofructokinase, glucose 6 phosphate isomerase,
3-phosphoglycerate mutase and glucokinase, among others. Inducible
yeast promoters include alcohol dehydrogenase 2, isocytochrome C,
acid phosphatase, metallothionein and enzymes responsible for
nitrogen metabolism or maltose/galactose utilization, among others.
Promoters for expression in mammalian cell systems include RNA
polymerase II promoters including viral promoters such as polyoma,
fowlpox and adenoviruses (e.g. adenovirus 2), bovine papilloma
virus, avian sarcoma virus, cytomegalovirus (in particular the
immediate early gene promoter), retrovirus, hepatitis B virus,
actin, rous sarcoma virus (RSV) promoter and the early or late
Simian virus 40 and non-viral promoters such as EF-1alpha
(Mizushima and Nagata Nucleic Acids Res 1990 18(17):5322, among
others. The choice of promoter may be based upon suitable
compatibility with the host cell used for expression.
Enhancer Element
[0166] Where appropriate, e.g. for expression in higher
eukaroytics, additional enhancer elements can included instead of
or as well as those found located in the promoters described above.
Suitable mammalian enhancer sequences include enhancer elements
from globin, elastase, albumin, fetoprotein, metallothionine and
insulin. Alternatively, one may use an enhancer element from a
eukaroytic cell virus such as SV40 enhancer, cytomegalovirus early
promoter enhancer, polyoma enhancer, baculoviral enhancer or murine
IgG2a locus (see WO04/009823). Whilst such enhancers are typically
located on the vector at a site upstream to the promoter, they can
also be located elsewhere e.g. within the untranslated region or
downstream of the polydenalytion signal. The choice and positioning
of enhancer may be based upon suitable compatibility with the host
cell used for expression.
Polyadenylation/Termination
[0167] In eukaryotic systems, polyadenylation signals are operably
linked to polynucleotide encoding the antibody of this invention.
Such signals are typically placed 3' of the open reading frame. In
mammalian systems, non-limiting example signals include those
derived from growth hormones, elongation factor-1 alpha and viral
(eg SV40) genes or retroviral long terminal repeats. In yeast
systems non-limiting examples of polydenylation/termination signals
include those derived from the phosphoglycerate kinase (PGK) and
the alcohol dehydrogenase 1 (ADH) genes. In prokaryotic system
polyadenylation signals are typically not required and it is
instead usual to employ shorter and more defined terminator
sequences. The choice of polyadenylation/termination sequences may
be based upon suitable compatibility with the host cell used for
expression.
Other Methods/Elements for Enhanced Yields
[0168] In addition to the above, other features that can be
employed to enhance yields include chromatin remodelling elements,
introns and host-cell specific codon modification. The codon usage
of the antibody of this invention thereof can be modified to
accommodate codon bias of the host cell such to augment transcript
and/or product yield (eg Hoekema A et al Mol Cell Biol 1987
7(8):2914-24). The choice of codons may be based upon suitable
compatibility with the host cell used for expression.
Host Cells
[0169] Suitable host cells for cloning or expressing vectors
encoding antibodies of the invention are, for example, prokaroytic,
yeast or higher eukaryotic cells. Suitable prokaryotic cells
include eubacteria e.g. enterobacteriaceae such as Escherichia e.g.
E. Coli (for example ATCC 31,446; 31,537; 27,325), Enterobacter,
Erwinia, Klebsiella Proteus, Salmonella e.g. Salmonella
typhimurium, Serratia e.g. Serratia marcescans and Shigella as well
as Bacilli such as B. subtilis and B. licheniformis (see DD 266
710), Pseudomonas such as P. aeruginosa and Streptomyces. Of the
yeast host cells, Saccharomyces cerevisiae, schizosaccharomyces
pombe, Kluyveromyces (e.g. ATCC 16,045; 12,424; 24178; 56,500),
yarrowia (EP402, 226), Pichia Pastoris (EP183, 070, see also Peng
et al J. Biotechnol. 108 (2004) 185-192), Candida, Trichoderma
reesia (EP244, 234), Penicillin, Tolypocladium and Aspergillus
hosts such as A. nidulans and A. niger are also contemplated.
[0170] Although Prokaryotic and yeast host cells are specifically
contemplated by the invention, typically however, host cells of the
present invention are vertebrate cells. Suitable vertebrate host
cells include mammalian cells such as COS-1 (ATCC No. CRL 1650)
COS-7 (ATCC CRL 1651), human embryonic kidney line 293, PerC6
(Crucell), baby hamster kidney cells (BHK) (ATCC CRL. 1632), BHK570
(ATCC NO: CRL 10314), 293 (ATCC NO. CRL 1573), Chinese hamster
ovary cells CHO (e.g. CHO-K1, ATCC NO: CCL 61, DHFR-CHO cell line
such as DG44 (see Urlaub et al, (1986) ibid), particularly those
CHO cell lines adapted for suspension culture, mouse sertoli cells,
monkey kidney cells, African green monkey kidney cells (ATCC
CRL-1587), HELA cells, canine kidney cells (ATCC CCL 34), human
lung cells (ATCC CCL 75), Hep G2 and myeloma or lymphoma cells e.g.
NS0 (see U.S. Pat. No. 5,807,715), Sp2/0, Y0.
[0171] Thus in one embodiment of the invention there is provided a
stably transformed host cell comprising a vector encoding a heavy
chain and/or light chain of the therapeutic antibody as described
herein. Typically such host cells comprise a first vector encoding
the light chain and a second vector encoding said heavy chain.
[0172] Such host cells may also be further engineered or adapted to
modify quality, function and/or yield of the antibody of this
invention. Non-limiting examples include expression of specific
modifying (eg glycosylation) enzymes and protein folding
chaperones.
Cell Culturing Methods.
[0173] Host cells transformed with vectors encoding the therapeutic
antibodies of the invention may be cultured by any method known to
those skilled in the art. Host cells may be cultured in spinner
flasks, shake flasks, roller bottles or hollow fibre systems but it
is preferred for large scale production that stirred tank reactors
or bag reactors (eg Wave Biotech, Somerset, N.J. USA) are used
particularly for suspension cultures. Typically the stirred tankers
are adapted for aeration using e.g. spargers, baffles or low shear
impellers. For bubble columns and airlift reactors direct aeration
with air or oxygen bubbles maybe used. Where the host cells are
cultured in a serum free culture media it is preferred that the
media is supplemented with a cell protective agent such as pluronic
F-68 to help prevent cell damage as a result of the aeration
process. Depending on the host cell characteristics, either
microcarriers maybe used as growth substrates for anchorage
dependent cell lines or the cells maybe adapted to suspension
culture (which is typical). The culturing of host cells,
particularly vertebrate host cells may utilise a variety of
operational modes such as batch, fed-batch, repeated batch
processing (see Drapeau et al (1994) cytotechnology 15: 103-109),
extended batch process or perfusion culture. Although recombinantly
transformed mammalian host cells may be cultured in
serum-containing media such media comprising fetal calf serum
(FCS), it is preferred that such host cells are cultured in
synthetic serum-free media such as disclosed in Keen et al (1995)
Cytotechnology 17:153-163, or commercially available media such as
ProCHO-CDM or UltraCHO.TM. (Cambrex N.J., USA), supplemented where
necessary with an energy source such as glucose and synthetic
growth factors such as recombinant insulin. The serum-free
culturing of host cells may require that those cells are adapted to
grow in serum free conditions. One adaptation approach is to
culture such host cells in serum containing media and repeatedly
exchange 80% of the culture medium for the serum-free media so that
the host cells learn to adapt in serum free conditions (see e.g.
Scharfenberg K et al (1995) in Animal Cell technology: Developments
towards the 21st century (Beuvery E. C. et al eds), pp 619-623,
Kluwer Academic publishers).
[0174] Antibodies of the invention secreted into the media may be
recovered and purified from the media using a variety of techniques
to provide a degree of purification suitable for the intended use.
For example the use of therapeutic antibodies of the invention for
the treatment of human patients typically mandates at least 95%
purity as determined by reducing SDS-PAGE, more typically 98% or
99% purity, when compared to the culture media comprising the
therapeutic antibodies. In the first instance, cell debris from the
culture media is typically removed using centrifugation followed by
a clarification step of the supernatant using e.g. microfiltration,
ultrafiltration and/or depth filtration. Alternatively, the
antibody can be harvested by microfiltration, ultrafiltration or
depth filtration without prior centrifugation. A variety of other
techniques such as dialysis and gel electrophoresis and
chromatographic techniques such as hydroxyapatite (HA), affinity
chromatography (optionally involving an affinity tagging system
such as polyhistidine) and/or hydrophobic interaction
chromatography (HIC, see U.S. Pat. No. 5,429,746) are available. In
one embodiment, the antibodies of the invention, following various
clarification steps, are captured using Protein A or G affinity
chromatography followed by further chromatography steps such as ion
exchange and/or HA chromatography, anion or cation exchange, size
exclusion chromatography and ammonium sulphate precipitation.
Typically, various virus removal steps are also employed (e.g.
nanofiltration using e.g. a DV-20 filter). Following these various
steps, a purified (typically monoclonal) preparation comprising at
least 10 mg/ml or greater e.g. 100 mg/ml or greater of the antibody
of the invention is provided and therefore forms an embodiment of
the invention. Concentration to 100 mg/ml or greater can be
generated by ultracentrifugation. Suitably such preparations are
substantially free of aggregated forms of antibodies of the
invention.
[0175] Bacterial systems are particularly suited for the expression
of antibody fragments. Such fragments are localised intracellularly
or within the periplasma. Insoluble periplasmic proteins can be
extracted and refolded to form active proteins according to methods
known to those skilled in the art, see Sanchez et al (1999) J.
Biotechnol. 72, 13-20 and Cupit P M et al (1999) Lett Appl
Microbiol, 29, 273-277.
3. Pharmaceutical Compositions and Mode of Administration
[0176] Purified preparations of antibodies of the invention as
described supra, may be incorporated into pharmaceutical
compositions for use in the treatment of human diseases and
disorders such as those outlined above. Typically such compositions
further comprise a pharmaceutically acceptable (i.e. inert) carrier
as known and called for by acceptable pharmaceutical practice, see
e.g. Remingtons Pharmaceutical Sciences, 16th ed, (1980), Mack
Publishing Co. Examples of such carriers include sterilised carrier
such as saline, Ringers solution or dextrose solution, buffered
with suitable buffers to a pH within a range of 5 to 8.
Pharmaceutical compositions for injection (e.g. by intravenous,
intraperitoneal, intradermal, subcutaneous, intramuscular or
intraportal) or continuous infusion are suitably free of visible
particulate matter and may comprise from 0.1 mg to 10 g of
therapeutic antibody, typically between 5 mg and 25 mg of antibody.
Methods for the preparation of such pharmaceutical compositions are
well known to those skilled in the art. In one embodiment,
pharmaceutical compositions comprise from 0.1 mg to 10 g of
therapeutic antibodies of the invention in unit dosage form,
optionally together with instructions for use. Pharmaceutical
compositions of the invention may be lyophilised (freeze dried) for
reconstitution prior to administration according to methods well
known or apparent to those skilled in the art. Where embodiments of
the invention comprise antibodies of the invention with an IgG1
isotype, a chelator of copper such as citrate (e.g. sodium citrate)
or EDTA or histidine may be added to the pharmaceutical composition
to reduce the degree of copper-mediated degradation of antibodies
of this isotype, see EP0612251.
[0177] Effective doses and treatment regimes for administering the
antibody of the invention are generally determined empirically and
are dependent on factors such as the age, weight and health status
of the patient and disease or disorder to be treated. Such factors
are within the purview of the attending physician. Guidance in
selecting appropriate doses may be found in e.g. Smith et al (1977)
Antibodies in human diagnosis and therapy, Raven Press, New York
but will in general be between 0.1 mg and 1 g. In one embodiment,
the dosing regime for treating a human patient is 0.1 mg to 10 g of
therapeutic antibody of the invention administered subcutaneously
once per week or every two weeks, or by intravenous infusion every
1 or 2 months. Compositions of the present invention may also be
used in prophylatically.
4. Clinical Uses.
[0178] The present invention relates to an antibody which binds to
human IL-8, Gro-alpha, Gro-beta, Gro-gamma, and ENA-78 The present
invention also concerns methods of treating diseases or disorders
characterised by elevated or unbalanced level of one or more of
human IL-8, Gro-alpha, Gro-beta, Gro-gamma, and ENA-78,
particularly, COPD, osteoarthritis, rheumatoid arthritis, erosive
arthritis, asthma, atherosclerosis, inflammatory bowel disease,
psoriasis, transplant rejection, gout, cancer, acute lung injury,
acute lung disease, sepsis, ARDS, peripheral artery disease,
systemic sclerosis, neonatal respiratory distress syndrome,
exacerbation of asthma and COPD, cystic fibrosis, diffuse
panbronchiolitis, reperfusion injury, and/or endometriosis with
said antibody, pharmaceutical compositions comprising said antibody
and methods of manufacture.
[0179] The present invention also relates to use of an antibody in
the manufacture of a medicament for the treatment of diseases or
disorders characterised by elevated or unbalanced level of one or
more of human IL-8, Gro-alpha, Gro-beta, Gro-gamma, GCP-2 and
ENA-78, particularly COPD, osteoarthritis, rheumatoid arthritis,
erosive arthritis, asthma, atherosclerosis, inflammatory bowel
disease, psoriasis, transplant rejection, gout, cancer, acute lung
injury, acute lung disease, sepsis, ARDS, peripheral artery
disease, systemic sclerosis, neonatal respiratory distress
syndrome, exacerbation of asthma and COPD, cystic fibrosis, diffuse
panbronchiolitis, reperfusion injury, or endometriosis. Although
the present invention has been described principally in relation to
the treatment of human diseases or disorders, the present invention
may also have applications in the treatment of similar diseases or
disorders in non-human mammals.
SPECIFIC EMBODIMENTS
Example 1
Generation of Mouse Monoclonal Antibody 656.35, 197.2, and 81.1
[0180] Generation of a Penta-Specific mAb Against the Target
Chemokines Human IL-8, Gro-Alpha, Gro-Beta, Gro-Gamma, and
ENA-78).
[0181] Multiple methods and schemes were used to immunize mice in
an attempt to generate pan-specific mAbs. The generation of
pan-specific mAbs were generated using various mixtures of multiple
antigenic peptides (MAPs) and/or intact target chemokines (IL-8,
Gro-.alpha., -.beta., -.gamma., and ENA-78) mixed in complete or
incomplete Freund's Adjuvant (cFA or iFA), following a modified
Repetitive Immunization Multiple Sites (RIMMS) protocol in the
SJL/JOrlCrl mouse strain.
MAPs or multiple antigenic peptides serve two functions within the
immunization protocol. First, MAPs allow for a selective multiple
presentation of a known target amino acid sequence. Secondly, there
is an increase in mass, due to multiple copies of the sequence
linked, for example, via a lysine core, which also increases the
immunogenicity of the sequence over that of individual peptides
(Francis, J. P., et al., Immunology, 1991: 73; 249, Schott, M. E.,
et al., Cell. Immuno. 1996:174:199-209, Tam, J. P. Proc. Natl.
Acad. Sci. 1988: 85; 5409-5413). FIG. 1 is a schematic drawing of a
set of MAPs having amino acid sequences SEQ ID NOs:49-53. A linker
in MAPs can be any linker other than lysines.
General Immunization Time Line:
[0182] Two different immunization protocols following the above
time line produced pan-specific mAbs: [0183] 1. Initial
immunization (day 0) consists of multiple subcutaneous injections
(hind quarters, back and neck) of all target chemokines mixed in
cFA (10 .mu.g each). The following 4 boosts consisted of a mixture
of all the target chemokines mixed in iFA (10 .mu.g each). The
fifth and all subsequent boosts consisted of a cocktail of all the
target chemokines and all 5 linear MAPs (10 .mu.g each) in iFA. The
final boost 3 days prior to sacrifice and fusion consisted of all
the target chemokines and linear MAPs in PBS and was delivered via
an intraperitoneal (IP) injection. [0184] 2. Initial immunization
(day 0) consists of multiple subcutaneous injections (hind
quarters, back and neck) of all five linear MAPs mixed in cFA (10
.mu.g each). The following 4 boosts consisted of a mixture of all
five linear MAPs in iFA (10 .mu.g each). The fifth and all
subsequent boosts consisted of a cocktail of all the all 5 linear
MAPs and all target chemokines (10 .mu.g each) in iFA. The final
boost 3 days prior to sacrifice and fusion consisted of all the all
5 linear MAPs and all target chemokines (10 .mu.g each) in PBS and
was delivered via an intraperitoneal (IP) injection.
Example 2
[0185] Pan-binding of the mAb to the target chemokines (human IL-8,
Gro-alpha, Gro-beta, Gro-gamma, GCP-2, and ENA-78) has been
confirmed via a time-resolved fluorescence immunofluorescent assay
(TRFIA).
Briefly, each antigen (human IL-8, Gro-alpha, Gro-beta, Gro-gamma,
GCP-2, and ENA-78, and hIL-18 when used as negative control) is
individually coated onto a 96-well immunofluorescent plate. The
plates are then washed and blocked with a commercially available
blocking solution. Blocking solution is emptied and samples
containing the mAb are added into each well and incubated for 40 to
60 minutes (this allows the mAb to bind to the target chemokines).
The plates are then washed again and a detection Ab is added to
each well. Detection reagents were as follows for 2.times.656.35,
chimera (HcLc) and humanized MAbs respectively: biotinylated
anti-mouse IgG, biotinylated anti-human IgG Fab2 reagent, and
europium anti-human IgG. The detection antibody is conjugated to
either europium or biotin. Following another round of washing, to
remove unbound detection Ab, a solution of streptavidin-europium
was added to biotin detected assays. Streptavidin-europium binds to
the biotin allowing for detection. After a final wash to remove
unbound streptavidin-europium, or in the case of the humanized MAb
assay after the europium conjugate secondary is washed, each well
is filled with a chelating detergent solution to activate the
europium producing fluorescence. The greater the fluorescence
recorded is directly proportionate to the amount of detection Ab
present in the well which is directly linked and proportionate to
the amount of the chemokine binding mAb. FIG. 5A shows mouse 656.35
mAb binding to target human chemokines. FIG. 5B shows the Chimera
Antibody (HcLc) mAb binding to human target chemokines. FIG. 5C
shows humanized mAbs binding to human target chemokines.
Example 3
Functional Pan-Inhibition by Murine mAb was Confirmed Using a
Variety of Methods: CXCR2 Mediated Ca.sup.2+ Mobilization, Human
Neutrophil Chemotaxis, and Human Neutrophil Activation (CD11b
Surface Expression)
[0186] A microtiter plate based calcium mobilization assay, FLIPR
(Fluorometric Imaging Plate Reader, Molecular Devices, Sunnyvale
Calif., [Schroeder, 1996]), was used for the functional
characterization of the neutralizing effect of antibodies on ELR+
chemokine induced [Ca.sup.2+]i-mobilization in CHO-K1 cells
transfected with and stably expressing hCXCR2 and G.alpha.16.
[0187] On the day prior to assay, cells were plated in 96 well,
blackwall, clear bottom plates (Packard View) at a concentration of
40000 cells per well. After 18 to 24 hours, media was aspirated off
cells and replaced with 100 .mu.l load media containing Eagles
Minimal Essential Medium (EMEM) with Earl's salts and L-Glutamine,
0.1% BSA (Serologicals Corporation), 4 .mu.M Fluo-4-acetoxymethyl
ester fluorescent indicator dye (Fluo-4 AM) and 2.5 mM probenecid.
Cells were incubated in this dye containing media for 1 hour at
37.degree. C. The dye containing media was then aspirated off the
cells and replaced with identical media without Fluo-4 AM and with
0.1% Gelatin (BSA removed) and 2.5 mM probenecid. Cells were
incubated for 10 min. at 37.degree. C. and then washed 3 times with
KRH assay buffer [Krebs Ringer Henseleit (120 mM NaCl, 4.6 mM KCl,
1.03 mM KH.sub.2PO.sub.4, 25 mM NaHCO.sub.3, 1.0 mM CaCl.sub.2, 11
mM MgCl.sub.2, 11 mM Glucose, 20 mM HEPES (pH 7.4)) with 0.1%
gelatin and 2.5 mM probenecid]. After the final buffer wash, 100
.mu.l KRH assay buffer with 0.1% gelatin and 2.5 mM probenecid was
added to cells and warmed to 37.degree. C. for 10 min. before being
placed in FLIPR where dye loaded cells were exposed to excitation
light (488 nm) from a 6 watt Argon Laser. [Ca.sup.2+]i-mobilization
was monitored as a result of an increase in 516 nm emission
intensity of Fluo-4 when bound to Ca.sup.2+. Change in emission
intensity is directly related to cytosolic calcium levels,
[Ca.sup.2+]i. After monitoring baseline for 10 sec., 50 .mu.l of
3.times.ELR+ chemokine, which had been pre-incubated with a
concentration range of antibody, was added to the cell plate and
data collected every sec. for 1 min., followed by an additional
half min. of recording in 3 sec. intervals. Maximal cellular
response above basal reading was exported for plotting in GraphPad
Prism (v4.03).
[0188] The IC.sub.50 was defined as the concentration of antibody
required, during pre-treatment of 3.times.EC.sub.80 chemokine, to
neutralize the CXCR2 mediated stimulatory effect of an EC.sub.80
concentration of the ELR+ chemokine by 50%. A secondary cellular
response to 25 .mu.M ATP was monitored to test cell viability
[Sarau, 1999].
TABLE-US-00002 TABLE Inhibition of human ELR+ chemokine induced
calcium flux (geometrically meaned IC50, ug/ml) by three murine
mAb. (n = 3 to 6) 3 nM hIL-8 10 nM hGRO.alpha. 6 nM hGRO.beta. 30
nM hENA-78 100 nM hGCP-2 murine IC.sub.50 IC.sub.50 IC.sub.50
IC.sub.50 IC.sub.50 mAB (ug/ml) 95% C. I. (ug/ml) 95% C. I. (ug/ml)
95% C. I. (ug/ml) 95% C. I. (ug/ml) 95% C. I. 656.35 0.18 0.14-0.25
1.43 0.60-3.42 1.06 0.78-1.42 2.09 0.71-6.14 9.58 1.17-78.57 81.1
67.65 18.80-243.50 0.94 0.37-2.38 n.d. N/A 1.84 0.69-4.93 9.11
1.44-57.61 197.2 2.19 0.61-7.88 2.24 0.39-12.98 n.d. N/A 13.86
1.71-112.49 >157 N/A (n.d. = not determined, N/A = not
available)
Schroeder K S, Neagle, B D. FLIPR: a new instrument for accurate,
high throughput optical screening. J. Biomol. Screen. 1996:1-75.
Sarau H M, Ames R S, Chambers J, Ellis C, Elshourbagy N, Foley J J
et al. Identification, molecular cloning, expression, and
characterization of a cysteinyl leukotrien receptor. Mol Pharmacol.
1999; 56:657-663.
[0189] Inhibition of IL-8 stimulated human neutrophil chemotaxis
was also demonstrated using a micro-Boyden chamber. The
micro-Boyden apparatus consists of two small chambers one above and
one below a 3 micron-porous membrane. The lower chamber is loaded
with the chemotaxic agent (i.e. IL-8) or a mixture of the chemokine
with the penta-specific mAb. The upper chamber contains purified
non-activated human neutrophils. Once the chamber is assembled a
concentration gradient is formed from the bottom well to the upper,
stimulating the neutrophils to chemotax across the membrane. The
assay is expressed as a CI (chemotactic index) which is a ratio of
the number of cells which chemotax in response to a stimulant over
non-stimulated chemotaxic cell number. Pre-incubating the chemokine
(i.e. IL-8) with the penta-specific mAb in the lower chamber, dose
dependently inhibited IL-8 stimulated neutrophil chemotaxis. IL-8
at 10 nM achieved a CI of 3.6.+-.0.8. Pre-incubation of IL-8 with
increasing concentrations of the penta-specific mAb (656.35) dose
dependently inhibited human neutrophil chemotaxis, significance was
reached at CI of 2.2.+-.0.6 at 1 .mu.g/ml. Due to the amounts and
sensitivity of the assay the other chemokines were unable to be
examined (Gro-.alpha., -.beta., -.gamma., and ENA-78).
[0190] Inhibition of purified human neutrophil activation via
monitoring surface expression of CD11b. CD11b or Mac-1 mediates
adhesion to substrates, aggregation and chemotaxis and is known to
be up-regulated on the surface activated neutrophils (Molad, Y.,
J., et al., Clin. Immunol. Immunopathol. 1994: 71; 281-286).
Briefly, non-activated human neutrophils are purified and ex vivo
stimulated with either target chemokines (i.e. IL-8) or with
chemokines pre-incubated with a chemokine penta-specific mAb. Data
are presented as percent activation set to the maximal CD11b
surface expression due to IL-8 stimulation. Pre-incubation of IL-8
with the 656.35 mAb dose dependently inhibited increased levels of
surface expression of CD11b and thus indicates inhibition of
neutrophil activation (79.9%.+-.3.7, 48.5%.+-.7.2, 28.7%.+-.3.2,
and 31.6%.+-.3.4, at 0.01, 0.1, 1, 10 and 50 .mu.g/ml
respectively).
Example 4
Penta-Specific mAbs Association/Dissociation Values for Each Target
Chemokine (human IL-8, Gro-Beta, and ENA-78)
Methods for Biacore Analysis.
[0191] For experiment designated KL, rabbit anti mouse IgG-Fc
(Biacore BR-1005-14) is immobilized on a CM5 chip by primary amine
coupling in accordance with the manufactures instructions.
[0192] For experiment designated BE, purified antibodies directly
immobilized to the chip by amine coupling was used.
[0193] Supernatant or purified antibody from parental mouse mAb is
captured on the anti-mouse IgG-Fc surface. Defined concentrations
of each analyte (IL8, Gro-band ENA-78) are passed over the
immobilized or captured antibody surface, a separate capture event
is used for each analyte injection. After each injection of analyte
the surface is regenerated by injection
of a mild acidic solution, which removes the captured antibody but
does not significantly affect the capability anti mouse IgG-Fc
surface to perform another capture event nor does it affect the
directly immobilized antibodies. An injection of buffer is also
injected over the antibody captured surface and this is used for
double referencing. The data is analyzed using the analysis
software inherent to the machine, using the 1:1 model of
binding.
TABLE-US-00003 IL-8 Gro-B ENA-78 mAb kd ka KD kd ka KD kd ka KD KL
656.35 1.48E-03 1.53E+06 9.64E-10 2.01E-03 3.82E+06 5.26E-10
1.87E-03 1.07E+06 1.74E-09 BE 6.87E-04 8.19E+06 8.39E-11 1.46E-03
1.32E+07 1.11E-10 7.96E-04 2.94E+06 2.71E-10 KL 81.1 9.32E-03
1.95E+06 4.80E-09 3.12E-04 2.76E+06 1.13E-10 3.76E-04 6.11E+05
6.16E-10 BE 1.08E-01 1.95E+06 5.55E-08 4.89E-04 5.44E+06 8.98E-11
3.94E-06 1.65E+05 2.39E-11 KL 197.2 3.69E-03 6.27E+05 5.89E-09
9.93E-04 1.55E+05 6.39E-10 2.69E-03 2.99E+05 9.00E-09 BE 4.99E-04
7.23E+05 6.90E-10 4.80E-08 1.04E+06 4.62E-14 3.02E-03 3.01E+05
1.01E-08
Example 5
Epitope Mapping
[0194] 656.35 mAb was epitope mapped and found to bind within
KELRCQCIKTYSKP (SEQ ID NO: 54) in human IL-8. Thus in another
embodiment, the present invention relates to a penta-specific
antibody which binds within epitope of SEQ ID NO:54 of human
IL-8.
Example 6
Efficacy Study of a Chimera Antibody Made from 656.35 Having Heavy
Chain Sequence of SEQ ID NO: 56, and Light Chain Sequence of SEQ ID
NO:58. (This Antibody Will be Referred to as the Chimera
Antibody)
[0195] In Vivo Studies:
[0196] An inhaled LPS acute lung inflammatory model was used to
examine the ability of the a penta-specific antibody to inhibit
infiltration of neutrophils into the lungs of non-human primates
(NHPs--cynomolgus). Briefly, NHP (non-human primate) were
pre-screened for health and responsiveness to exogenously added
cynomolgus IL-8 (cynoIL-8). Selected NHP were then subjected to
baseline sample collections (blood and bronchoalveolar lavage--BAL)
five days prior to the first LPS challenge. LPS challenged
consisted of tranquilizing the NHP with a single IM injection of
ketamine HCl (.about.10 mg/kg). Once the NHP is sedated, anesthesia
is administered, via an intravenous infusion of propofol
(.about.0.2 mg/kg/min, as necessary). Anesthetized animals are
placed on a circulating warm-water heating blanket and/or within a
circulating warm-air blanket and an ophthalmic lubricant is
administered to each eye. The animals are then intubated and
mechanically ventilated for challenge procedure. A volume regulated
Positive Pressure ventilator is used during the procedure
(Stoelting Cat/Rabbit ventilator www.stoeltingco.com Cat #5019510).
Lipopolysaccharide (LPS) challenge is performed via aerosol
inhalation using a DeVilbiss Ultraneb-99 ultrasonic nebulizer.
Aerosolized LPS is administered for 5 minutes at 100 ug/ml. Heart
rate, body temperature, and respiration rate are monitored and
recorded during challenge procedures. The initial challenge
confirms that the NHP respond to LPS (increased neutrophil
infiltration into the lungs and elevated cynoIL-8 levels).
Individual NHP responses were confirmed by sample collections at 6
and 24-hours post challenge.
[0197] The initial LPS challenged NHP were then randomly divided
into two groups. Following a 4-week recovery all participating NHP
were subjected to another baseline sample (blood and BAL). Four
days post baseline measurements the subject groups received IV
injection of either a vehicle or an injection of 1 mg/kg of the
Chimera Antibody. The next day the NHP were challenged again with
inhaled LPS and samples for analysis were collected 6 and 24-hour
post challenge. Following an additional recovery period base line
samples were collected from the vehicle NHP, 4 days later these NHP
were treated with a single IV bolus injection of the Chimera
Antibody at 10 mg/kg. The next day the animals were exposed to an
LPS challenge and samples were collected for analysis at 6 and 24
hours.
[0198] The LPS inhalation is an acute inflammatory model which
stimulates an elevation of chemotactic chemokines such at IL-8,
which lead to increased infiltration of neutrophils into the lungs.
The primary efficacy parameter for the Chimera Antibody treatment
is inhibition of infiltrating neutrophils into the lungs of NHP
challenged with LPS. Neutrophil infiltration in this acute
inflammatory model occurs during the first 24 hours following LPS
challenge at which point other inflammatory processes are becoming
more prominent.
[0199] Pretreatment of with the Chimera Antibody significantly and
dose dependently inhibited neutrophil infiltration into lungs of
LPS challenged NHP. Treatment with the Chimera Antibody also
prevented elevation of circulating neutrophils, while not affecting
the actual neutrophil function, (i.e. the cells ability to
phagocytos). Treatment also did not greatly affect other cell types
such as macrophages/monocytes in the lung or circulation. See FIG.
2.
Example 7
Further Studies on Humanized mAbs
[0200] Multiple humanized penta-specific antibody constructs have
been produced, four of which have been shown to bind tightly to,
and inhibit all target chemokines. (For each sequence, see Sequence
Information below). This analysis consisted of affinity
measurements (BiaCore), calcium mobilization assays (in vitro
functional assay, FLIPR), and CD11b human and NHP neutrophil
stimulation assay (ex vivo functional assay, flow cytometry).
[0201] BiaCore
[0202] A Protein A capture method was used to generate kinetics for
the humanised and chimeric constructs as follows:
Protein A is immobilised on a CM5 chip by primary amine coupling in
accordance with the manufactures instructions. Purified humanised
or chimeric antibody is captured on the Protein A surface. After
capture defined concentrations of each analyte (IL8, Gro-.beta. and
ENA-78) are passed over the antibody captured surface, a separate
capture event is used for each analyte injection. After each
injection of analyte the surface is regenerated by injection of a
mild acidic solution, which removes the captured antibody but does
not significantly affect the capability of the Protein A to perform
another capture event. An injection of buffer is also injected over
the antibody captured surface and this is used for double
referencing. The data is analysed using the analysis software
inherent to the machine, using the 1:1 model of binding.
TABLE-US-00004 Construct ka (1/Ms) kd(1/s) KD(M) Measurements with
Gro-beta HcLc 7.39E+06 8.16E-04 1.11E-10 HcLc 2.11E+07 0.0011
5.21E-11 HcLc 1.59E+07 8.88E-04 5.57E-11 HcLc 1.19E+07 6.16E-04
5.17E-11 HcLc 1.43E+07 5.43E-04 3.79E-11 HcLc 1.33E+07 6.76E-04
5.09E-11 HcLc 1.51E+07 6.73E-04 4.45E-11 HcLc 1.49E+07 6.44E-04
4.33E-11 HcLc 2.54E+07 0.001163 4.57E-11 HcLc 1.81E+07 0.001058
5.85E-11 HcLc 2.04E+07 8.54E-04 4.18E-11 HcLc 1.82E+07 5.06E-04
2.78E-11 H0L7 6.99E+06 9.66E-04 1.38E-10 H0L7 1.76E+07 0.001305
7.40E-11 H0L7 1.63E+07 0.001039 6.39E-11 H0L7 1.14E+07 0.005616
4.93E-10 H0L7 1.20E+07 0.004398 3.66E-10 H0L7 1.42E+07 9.57E-04
6.73E-11 H0L7 1.76E+07 0.00118 6.72E-11 H0L7 1.63E+07 0.001389
8.52E-11 H0L7 1.12E+07 0.008212 7.32E-10 H0L7 2.63E+07 0.001546
5.88E-11 H0L7 2.10E+07 9.28E-04 4.41E-11 H0L8 1.28E+07 0.005462
4.27E-10 H0L8 1.99E+07 0.01065 5.36E-10 H0L8 1.19E+07 0.007727
6.52E-10 H0L8 1.18E+07 0.007799 6.60E-10 H0L8 1.61E+07 0.006903
4.29E-10 H0L8 1.85E+07 0.004586 2.48E-10 H0L10 1.23E+07 0.001395
1.13E-10 H0L10 1.45E+07 0.001261 8.68E-11 H0L10 1.44E+07 0.001477
1.03E-10 H0L10 1.28E+07 0.001394 1.09E-10 H0L10 1.98E+07 0.00144
7.28E-11 H0L10 1.94E+07 0.00109 5.62E-11 H0M0 1.20E+07 0.001394
1.17E-10 H0M0 1.13E+07 0.007071 6.24E-10 H0M0 1.58E+07 0.001708
1.08E-10 H0M0 1.43E+07 0.001829 1.28E-10 H0M0 1.03E+07 0.009588
9.34E-10 H0M0 1.85E+07 0.001728 9.35E-11 H0M0 1.81E+07 0.001252
6.91E-11 Measurements with IL8 HcLc 3.77E+06 2.34E-04 6.22E-11 HcLc
1.03E+07 2.87E-04 2.78E-11 HcLc 8.20E+06 2.76E-04 3.37E-11 HcLc
1.04E+07 2.68E-04 2.58E-11 HcLc 9.44E+06 2.53E-04 2.68E-11 HcLc
9.97E+06 2.30E-04 2.31E-11 H0L7 2.74E+06 2.84E-04 1.04E-10 H0L7
8.99E+06 4.00E-04 4.45E-11 H0L7 7.64E+06 2.84E-04 3.71E-11 H0L7
5.98E+06 0.001167 1.95E-10 H0L7 8.74E+06 3.52E-04 4.03E-11 H0L7
7.51E+06 3.63E-04 4.83E-11 H0L7 9.10E+06 3.89E-04 4.28E-11 H0L8
5.90E+06 0.00111 1.88E-10 H0L8 7.89E+06 0.001126 1.43E-10 H0L8
6.80E+06 0.001193 1.75E-10 H0L8 7.30E+06 0.001112 1.52E-10 H0L10
6.86E+06 4.57E-04 6.66E-11 H0L10 7.20E+06 3.67E-04 5.10E-11 H0L10
7.21E+06 3.96E-04 5.48E-11 H0L10 7.43E+06 3.73E-04 5.02E-11 H0M0
7.02E+06 3.98E-04 5.67E-11 H0M0 6.40E+06 0.001467 2.29E-10 H0M0
7.96E+06 4.09E-04 5.14E-11 H0M0 7.97E+06 4.60E-04 5.77E-11 H0M0
7.50E+06 4.18E-04 5.57E-11 Measurements with ENA78 HcLc 3.67E+06
1.70E-04 4.63E-11 HcLc 5.81E+06 1.71E-04 2.94E-11 HcLc 5.11E+06
1.84E-04 3.60E-11 HcLc 5.28E+06 1.54E-04 2.91E-11 HcLc 4.87E+06
1.56E-04 3.20E-11 HcLc 4.78E+06 1.23E-04 2.58E-11 H0L7 2.95E+06
2.04E-04 6.93E-11 H0L7 5.28E+06 2.97E-04 5.63E-11 H0L7 4.59E+06
2.17E-04 4.74E-11 H0L7 3.03E+06 3.33E-04 1.10E-10 H0L7 5.11E+06
2.58E-04 5.04E-11 H0L7 4.76E+06 3.07E-04 6.45E-11 H0L7 4.91E+06
2.77E-04 5.63E-11 H0L8 2.88E+06 2.88E-04 1.00E-10 H0L8 2.82E+06
2.66E-04 9.41E-11 H0L8 2.95E+06 2.69E-04 9.12E-11 H0L8 3.29E+06
2.48E-04 7.55E-11 H0L10 4.07E+06 3.66E-04 8.99E-11 H0L10 4.72E+06
3.40E-04 7.22E-11 H0L10 4.20E+06 3.12E-04 7.42E-11 H0L10 4.38E+06
2.68E-04 6.13E-11 H0M0 3.91E+06 3.09E-04 7.89E-11 H0M0 2.97E+06
3.49E-04 1.17E-10 H0M0 4.39E+06 3.16E-04 7.20E-11 H0M0 4.18E+06
3.34E-04 7.99E-11 H0M0 4.52E+06 2.94E-04 6.51E-11 Affinity (KD) is
determined by examining the association rate (ka) and
disassociation rate (kd) of proteins. HcLc refers to chimera
antibody made from 656.35 having heavy chain sequence of SEQ ID NO:
56, and light chain sequence of SEQ ID NO: 58.
[0203] Functional Assay: Calcium Mobilization (FLIPR) Using CHO-K1
CXCR2 (w/G .alpha.16)
[0204] A microtiter plate based calcium mobilization assay, FLIPR
(Fluorometric Imaging Plate Reader, Molecular Devices, Sunnyvale
Calif., [Schroeder, 1996]), was used for the functional
characterization of the neutralizing effect of antibodies on ELR+
chemokine induced [Ca.sup.2+]i-mobilization in CHO-K1 cells
transfected with and stably expressing hCXCR2 and G.alpha.16.
[0205] On the day prior to assay, cells were plated in 96 well,
blackwall, clear bottom plates (Packard View) at a concentration of
40000 cells per well. After 18 to 24 hours, media was aspirated off
cells and replaced with 100 .mu.l load media containing Eagles
Minimal Essential Medium (EMEM) with Earl's salts and L-Glutamine,
0.1% BSA (Serologicals Corporation), 4 .mu.M Fluo-4-acetoxymethyl
ester fluorescent indicator dye (Fluo-4 AM) and 2.5 mM probenecid.
Cells were incubated in this dye containing media for 1 hour at
37.degree. C. The dye containing media was then aspirated off the
cells and replaced with identical media without Fluo-4 AM and with
0.1% Gelatin (BSA removed) and 2.5 mM probenecid. Cells were
incubated for 10 min. at 37.degree. C. and then washed 3 times with
KRH assay buffer [Krebs Ringer Henseleit (120 mM NaCl, 4.6 mM KCl,
1.03 mM KH.sub.2PO.sub.4, 25 mM NaHCO.sub.3, 1.0 mM CaCl.sub.2, 1.1
mM MgCl.sub.2, 11 mM Glucose, 20 mM HEPES (pH 7.4)) with 0.1%
gelatin and 2.5 mM probenecid]. After the final buffer wash, 100
.mu.l KRH assay buffer with 0.1% gelatin and 2.5 mM probenecid was
added to cells and warmed to 37.degree. C. for 10 min. before being
placed in FLIPR where dye loaded cells were exposed to excitation
light (488 nm) from a 6 watt Argon Laser. [Ca.sup.2+]i-mobilization
was monitored as a result of an increase in 516 nm emission
intensity of Fluo-4 when bound to Ca.sup.2+. Change in emission
intensity is directly related to cytosolic calcium levels,
[Ca.sup.2+]i. After monitoring baseline for 10 sec., 50 .mu.l of
3.times.ELR+ chemokine, which had been pre-incubated with a
concentration range of antibody, was added to the cell plate and
data collected every sec. for 1 min., followed by an additional
half min. of recording in 3 sec. intervals. Maximal cellular
response above basal reading was exported for plotting in GraphPad
Prism (v4.03).
[0206] The IC.sub.50 was defined as the concentration of antibody
required, during pre-treatment of 3.times.EC.sub.80 chemokine, to
neutralize the CXCR2 mediated stimulatory effect of an EC.sub.80
concentration of the ELR+ chemokine by 50%. A secondary cellular
response to 25 .mu.M ATP was monitored to test cell viability
[Sarau, 1999].
TABLE-US-00005 TABLE Inhibition of human ELR+ chemokine induced
calcium flux (geometrically meaned IC50, ug/ml) by four humanized
mAb constructs. (n = 3) Pre-treated 3X H0L7 H0L8 H0L10 H0M0
EC.sub.80 ELR+ IC.sub.50 IC.sub.50 IC.sub.50 IC.sub.50 Chemokine
(ug/ml) 95% C.I. (ug/ml) 95% C.I. (ug/ml) 95% C.I. (ug/ml) 95% C.I.
3 nM hIL8 0.30 0.12-0.72 0.83 0.70-0.98 0.19 0.15-0.22 0.19
0.15-0.23 10 nM hGROa 1.48 0.98-2.23 3.52 2.74-4.53 1.09 0.58-2.06
1.11 0.67-1.83 6 nM hGROb 1.04 0.19-5.58 7.93 4.20-14.97 0.66
0.24-1.86 0.99 0.35-2.76 30 nM hENA-78 2.48 0.78-7.91 2.42
1.27-4.63 1.88 0.83-4.26 1.75 1.33-2.29 100 nM hGCP-2 11.43
8.19-15.96 40.38 38.45-42.41 11.54 6.30-21.17 13.03 7.20-23.56
Schroeder K S, Neagle, B D. FLIPR: a new instrument for accurate,
high throughput optical screening. J. Biomol. Screen. 1996:1-75.
Sarau H M, Ames R S, Chambers J, Ellis C, Elshourbagy N, Foley J J
et al. Identification, molecular cloning, expression, and
characterization of a cysteinyl leukotrien receptor. Mol Pharmacol.
1999; 56:657-663.
[0207] Ex Vivo CD11b Human Neutrophil Stimulation Assay
[0208] Flow cytometry was used to examine the humanized
penta-specific antibodies' ability to prevent chemokine induced
human purified neutrophil activation, by following physical
cellular changes (size and shape--granulation) and by examining
surface activation markers (increased CD11b surface expression).
The neutrophil control stimulant FMLP was used to confirm the
purified human neutrophils ability to activate. See FIG. 4.
Sequence Information
[0209] Total RNA was extracted from 656.35, 197.2 and 81.1
hybridoma cells, heavy and light variable domain cDNA sequence was
then generated by reverse transcription and polymerase chain
reaction (RT-PCR). The forward primer for RT-PCR was a mixture of
degenerate primers specific for murine immunoglobulin gene
leader-sequences and the reverse primer was specific for the
antibody constant regions, in this case isotype IgG2a/.kappa..
Primers were designed according to the strategy described by Jones
and Bendig (Bio/Technology 9:88, 1991). RT-PCR was carried out in
duplicate for both V-region sequences to enable subsequent
verification of the correct V-region sequences. The V-region
products generated by the RT-PCR were cloned (Invitrogen TA Cloning
Kit) and sequence data obtained. This process was not successful
for 81.1 light variable domain. Thus, the amino acid sequence shown
below (Seq ID NO: 12) was therefore generated by protein sequencing
the light chain isolated on a SDS-polyacrylamide gel run under
reducing conditions. Complementarity Determining Regions (CDRs) are
underlined. Polynucleotide sequences for heavy and light variable
regions (SEQ ID NO: 1 and 3, respectively) for 656.35
TABLE-US-00006 SEQ ID NO: 1
CAGGTCCAGTTGCAGCAGTCTGGAGCTGAACTGGTAAGGCCTGGGACTTC
AGTGACGATATCCTGTAAGGCTTCTGGCTACACCTTCACTAACTACTGGA
TAGTTTGGGTCAAACAGAGGCCTGGACATGGACTTGAGTGGATTGGAGAT
CTTTACTCTGGAGGTGGTTATACTTTCTACAGTGAAAATTTCAAGGGGAA
GGCCACACTGACTGCAGACACATCCTCCAGCACTGCCTACATGCACCTCA
TTAGCCTGACATCTGAGGACTCTGCTGTCTATTTCTGTGCAAGATCGGGT
TACGACAGAACCTGGTTTGCTCACTGGGGCCAAGGGTCTCTGGTCACTGT CTCTGCA SEQ ID
NO: 3 GACATCAAGATGACCCAGTCTCCATCCTCCATGTCTGCATCGCTGGGAGA
GAGAGTCACTATCACTTGTCAGGCGAGTCAGGACATTGAAAGCTATTTAA
GCTGGTATCAGCAGAAACCATGGAAATCTCCTAAGACCCTGATCTATTAC
GCTACAAGGTTGGCAGATGGGGTCCCATCAAGATTCAGTGGCAGTGGATC
TGGTCAAGATTATTCTCTAACCATCAGCAGCCTGGAGTCTGACGATACAG
CAACTTATTACTGTCTACAACATGGTGAGAGCCCTCCCACGTTCGGTGCT
GGGACCAAGCTGGAGCTGAAACGG
Polypeptide sequences for heavy and light variable regions (SEQ ID
NO: 2 and 4, respectively) for 656.35
TABLE-US-00007 SEQ ID NO: 2
QVQLQQSGAELVRPGTSVTISCKASGYTFTNYWIVWVKQRPGHGLEWIGD
LYSGGGYTFYSENFKGKATLTADTSSSTAYMHLISLTSEDSAVYFCARSG
YDRTWFAHWGQGSLVTVSA SEQ ID NO: 4
DIKMTQSPSSMSASLGERVTITCQASQDIESYLSWYQQKPWKSPKTLIYY
ATRLADGVPSRFSGSGSGQDYSLTISSLESDDTATYYCLQHGESPPTFGA GTKLELKR
Polypeptide sequences for heavy chain CDRs (SEQ ID NO: 13, 14, 15,
respectively) for 656.35
TABLE-US-00008 NYWIV SEQ ID NO: 13 DLYSGGGYTFYSENFKG SEQ ID NO: 14
SGYDRTWFAH SEQ ID NO: 15
Polypeptide sequences for light chain CDRs (SEQ ID NO: 16, 17, 18)
for 656.35
TABLE-US-00009 QASQDIESYLS SEQ ID NO: 16 YATRLAD SEQ ID NO: 17
LQHGESPPT SEQ ID NO: 18
Polynucleotide sequences for heavy chain CDRs (SEQ ID NO: 31, 32,
33) for 656.35
TABLE-US-00010 SEQ ID NO: 31 AACTACTGGATAGTT SEQ ID NO: 32
GATCTTTACTCTGGAGGTGGTTATACTTTCTACAGTGAAAATTTCAAGG GG SEQ ID NO: 33
TCGGGTTACGACAGAACCTGGTTTGCTCAC
Polynucleotide sequences for light chain CDRs (SEQ ID NO:34, 35,
36) for 656.35
TABLE-US-00011 CAGGCGAGTCAGGACATTGAAAGCTATTTAAGC SEQ ID NO: 34
TACGCTACAAGGTTGGCAGAT SEQ ID NO: 35 CTACAACATGGTGAGAGCCCTCCCACG SEQ
ID NO: 36
Polynucleotide sequences for heavy and light variable regions (SEQ
ID NO: 5 and 7, respectively) for 197.2
TABLE-US-00012 SEQ ID NO: 5
GAGTTCCAGCTGCAGCAGTCTGGACCTGAGCTGGTGAAGCCTGGCGCTTC
AGTGAAGATATCCTGCAAGGCTTCTGGTTACTCATTCACTGACTACAACA
TGAACTGGGTGAAGCAGAGCAATGGAAAGAGCCTTGAGTGGATTGGAGTA
ATTAATCCTAAGTATGGTACTACTAGTTACAATCAGAAGTTCAAGGGCAA
GGCCACGTTGACTGTAGACCAATCCTCCAACACAGCCTACATGCAGCTCA
GCAGCCTGACATCTGAGGACTCTGCAGTCTATCACTGTGCAAGAGGAATG
GGACTCCTCTTTGGTATGGACTACTGGGGCCAAGGAACCTCTGTCACCGT CTCCTCA SEQ ID
NO: 7 GACATTGTGATGACACAGTCTCCATCCTCCCTGAGTGTGTCAGCAGGAGA
GAAGGTCACTATGAGCTGCAAGTCCAGTCAGAGTCTGTTAAACAGTGGAA
ATCARAAGAACTACTTGGCCTGGTACCAGCAGAAACCAGGGCAGCCTCCT
AAACTGTTGATCTACGGGGCATCCACTAGGAAATCTGGGGTCCCTGATCG
CTTCACAGGCAGTGGATCTGGAACCGATTTCACTCTTACCATCAGCAGTG
TGCAGGCTGAAGACCTGGCAGTTTATTACTGTCAGAATGATCATAGTTTT
CCGTGCACGTTCGGAGGGGGGACCAAGCTGGAAATAAAACGG
Polypeptide sequences for heavy and light variable regions (SEQ ID
NO: 6 and 8, respectively) for 197.2
TABLE-US-00013 SEQ ID NO: 6
EFQLQQSGPELVKPGASVKISCKASGYSFTDYNMNWVKQSNGKSLEWIGV
INPKYGTTSYNQKFKGKATLTVDQSSNTAYMQLSSLTSEDSAVYHCARGM
GLLFGMDYWGQGTSVTVSS SEQ ID NO: 8
DIVMTQSPSSLSVSAGEKVTMSCKSSQSLLNSGNQKNYLAWYQQKPGQPP
KLLIYGASTRKSGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDHSF
PCTFGGGTKLEIKR
Polypeptide sequences for heavy chain CDRs (SEQ ID NO: 19, 20, 21,
respectively) for 197.2
TABLE-US-00014 DYNMN SEQ ID NO: 19 VINPKYGTTSYNQKFKG SEQ ID NO: 20
GMGLLFGMDY SEQ ID NO: 21
Polypeptide sequences for light chain CDRs (SEQ ID NO: 22, 23, 24)
for 197.2
TABLE-US-00015 KSSQSLLNSGNQKNYLA SEQ ID NO: 22 GASTRKS SEQ ID NO:
23 QNDHSFPCT SEQ ID NO: 24
Polynucleotide sequences for heavy chain CDRs (SEQ ID NO: 37, 38,
39) for 197.2
TABLE-US-00016 SEQ ID NO: 37 GACTACAACATGAAC SEQ ID NO: 38
GTAATTAATCCTAAGTATGGTACTACTAGTTACAATCAGAAGTTCAAG GGC SEQ ID NO: 39
GGAATGGGACTCCTCTTTGGTATGGACTAC
Polynucleotide sequences for light chain CDRs (SEQ ID NO:40, 41,
42) for 197.2
TABLE-US-00017 SEQ ID NO: 40
AAGTCCAGTCAGAGTCTGTTAAACAGTGGAAATCAAAAGAACTACTTG GCC SEQ ID NO: 41
GGGGCATCCACTAGGAAATCT SEQ ID NO: 42 CAGAATGATCATAGTTTTCCGTGCACG
Polynucleotide sequence for heavy variable region (SEQ ID NO: 9)
for 81.1
TABLE-US-00018 SEQ ID NO: 9
GAGGTCCAGCTGCAGCAGTCTGGACCTGAACTGGAGAAGCCTGGCGCTTC
AGTGAAGATATCCTGCAAGGCTTCTGGTTACTCTTTCACTGTCTACGGCA
TGAACTGGGTGAGACAGAGCAATGGAAAGAGCCTTGAATGGATTGGAAAT
TTTGATCCTTACTTTAGTGTCACTTCCTACAACCAGAAGTTCCAGGACAA
GGCCACATTGACTGTAGACAAATCCTCCAGCACAGCCTACATGCAGCTCA
AGAACCTCACATCTGAAGACTCTGCAGTCTATTTCTGTGCAAGAGGGAGC
TGGGAAACCATTTTTGCTTACTGGGGCCAAGGGACTCTGGTCACTGTCTC TGCA
Polypeptide sequence for heavy variable region (SEQ ID NO: 10) for
81.1
TABLE-US-00019 SEQ ID NO: 10
EVQLQQSGPELEKPGASVKISCKASGYSFTVYGMNWVRQSNGKSLEWIGN
FDPYFSVTSYNQKFQDKATLTVDKSSSTAYMQLKNLTSEDSAVYFCARGS
WETIFAYWGQGTLVTVSA
Polypeptide sequences for heavy chain CDRs (SEQ ID NO: 25, 26, 27,
respectively) for 81.1
TABLE-US-00020 VYGMN SEQ ID NO: 25 NFDPYFSVTSYNQKFQD SEQ ID NO: 26
GSWETIFAY SEQ ID NO: 27
Polynucleotide sequences for heavy chain CDRs (SEQ ID NO: 43, 44,
45) for 81.1
TABLE-US-00021 SEQ ID NO: 43 GTCTACGGCATGAAC SEQ ID NO: 44
AATTTTGATCCTTACTTTAGTGTCACTTCCTACAACCAGAAGTTCCAGG AC SEQ ID NO: 45
GGGAGCTGGGAAACCATTTTTGCTTAC
Polypeptide sequence for light variable region (SEQ ID NO: 12) for
81.1
TABLE-US-00022 QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLI
GGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHVFG GGTKLTVLQPK
Polypeptide sequences for light chain CDRs (SEQ ID NO: 28, 29, and
30, respectively) for 81.1
TABLE-US-00023 RSSTGAVTTSNYAN SEQ ID NO:28 GTNNRAP SEQ ID NO:29
ALWYSNHV SEQ ID NO:30
A chimera* polynucleotide sequence (variable heavy region+codon
optimised IgG1)
TABLE-US-00024 SEQ ID NO: 55
CAGGTCCAGTTGCAGCAGTCTGGAGCTGAACTGGTAAGGCCTGGGACTTC
AGTGACGATATCCTGTAAGGCTTCTGGCTACACCTTCACTAACTACTGGA
TAGTTTGGGTCAAACAGAGGCCTGGACATGGACTTGAGTGGATTGGAGAT
CTTTACTCTGGAGGTGGTTATACTTTCTACAGTGAAAATTTCAAGGGGAA
GGCCACACTGACTGCAGACACATCCTCCAGCACTGCCTACATGCACCTCA
TTAGCCTGACATCTGAGGACTCTGCTGTCTATTTCTGTGCAAGATCGGGT
TACGACAGAACCTGGTTTGCTCACTGGGGCCAAGGGTCACTAGTGACCGT
GTCCAGCGCCAGCACCAAGGGCCCCAGCGTGTTCCCCCTGGCCCCCAGCA
GCAAGAGCACCAGCGGCGGCACAGCCGCCCTGGGCTGCCTGGTGAAGGAC
TACTTCCCCGAACCGGTGACCGTGTCCTGGAACAGCGGAGCCCTGACCAG
CGGCGTGCACACCTTCCCCGCCGTGCTGCAGAGCAGCGGCCTGTACAGCC
TGAGCAGCGTGGTGACCGTGCCCAGCAGCAGCCTGGGCACCCAGACCTAC
ATCTGTAACGTGAACCACAAGCCCAGCAACACCAAGGTGGACAAGAAGG
TGGAGCCCAAGAGCTGTGACAAGACCCACACCTGCCCCCCCTGCCCTGCC
CCCGAGCTGCTGGGAGGCCCCAGCGTGTTCCTGTTCCCCCCCAAGCCTAA
GGACACCCTGATGATCAGCAGAACCCCCGAGGTGACCTGTGTGGTGGTGG
ATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTGGTACGTGGACGGC
GTGGAGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAGTACAACA
GCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTG
AACGGCAAGGAGTACAAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCC
TATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCCAG
GTGTACACCCTGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGTGTC
CCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGT
GGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGT
GCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACA
AGAGCAGATGGCAGCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGA
GGCCCTGCACAATCACTACACCCAGAAGAGCCTGAGCCTGTCCCCTGGCA AG
chimera* polypeptide sequence (variable heavy region+codon
optimised IgG1)
TABLE-US-00025 SEQ ID NO: 56
QVQLQQSGAELVRPGTSVTISCKASGYTFTNYWIVWVKQRPGHGLEWIGD
LYSGGGYTFYSENFKGKATLTADTSSSTAYMHLISLTSEDSAVYFCARSG
YDRTWFAHWGQGSLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY
ICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK
DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV
YTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL
DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
A chimera* polynucleotide sequence (variable light region+codon
optimised human cK)
TABLE-US-00026 SEQ ID NO: 57
GACATCAAGATGACCCAGTCTCCATCCTCCATGTCTGCATCGCTGGGAGA
GAGAGTCACTATCACTTGTCAGGCGAGTCAGGACATTGAAAGCTATTTAA
GCTGGTATCAGCAGAAACCATGGAAATCTCCTAAGACCCTGATCTATTAC
GCTACAAGGTTGGCAGATGGGGTCCCATCAAGATTCAGTGGCAGTGGATC
TGGTCAAGATTATTCTCTAACCATCAGCAGCCTGGAGTCTGACGATACAG
CAACTTATTACTGTCTACAACATGGTGAGAGCCCTCCCACGTTCGGTGCT
GGGACCAAGCTGGAGCTGAAACGTACGGTGGCCGCCCCCAGCGTGTTCAT
CTTCCCCCCCAGCGATGAGCAGCTGAAGAGCGGCACCGCCAGCGTGGTGT
GTCTGCTGAACAACTTCTACCCCCGGGAGGCCAAGGTGCAGTGGAAGGTG
GACAATGCCCTGCAGAGCGGCAACAGCCAGGAGAGCGTGACCGAGCAGGA
CAGCAAGGACTCCACCTACAGCCTGAGCAGCACCCTGACCCTGAGCAAGG
CCGACTACGAGAAGCACAAGGTGTACGCCTGTGAGGTGACCCACCAGGG
CCTGTCCAGCCCCGTGACCAAGAGCTTCAACCGGGGCGAGTGC
Chimera* polypeptide sequence (variable light region+codon
optimised human cK)
TABLE-US-00027 SEQ ID NO: 58
DIKMTQSPSSMSASLGERVTITCQASQDIESYLSWYQQKPWKSPKTLIYY
ATRLADGVPSRFSGSGSGQDYSLTISSLESDDTATYYCLQHGESPPTFGA
GTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG
LSSPVTKSFNRGEC
Chimera* refers to chimeric antibody made from murine 656.35
antibody
TABLE-US-00028 H0 DNA sequence of mature heavy chain SEQ ID NO: 11
CAGGTGCAGCTCGTGCAGAGCGGCGCCGAAGTGAAGAAGCCCGGGGCCAG
CGTGAAGGTGAGCTGCAAGGCCAGCGGCTACACCTTCACCAACTACTGGA
TCGTGTGGGTCAGGCAGGCCCCCGGCCAGGGACTGGAGTGGATGGGCGAC
CTGTATAGCGGCGGCGGCTACACCTTCTACAGCGAGAACTTCAAGGGCAG
GGTGACCATGACCAGGGACACCAGCACCAGCACCGTGTACATGGAGCTGA
GCAGCCTGAGGAGCGAGGACACCGCCGTGTACTACTGCGCCAGGAGCGGC
TACGACAGGACTTGGTTTGCTCACTGGGGCCAGGGCACACTAGTGACCGT
GTCCAGCGCCAGCACCAAGGGCCCCAGCGTGTTCCCCCTGGCCCCCAGCA
GCAAGAGCACCAGCGGCGGCACAGCCGCCCTGGGCTGCCTGGTGAAGGAC
TACTTCCCCGAACCGGTGACCGTGTCCTGGAACAGCGGAGCCCTGACCAG
CGGCGTGCACACCTTCCCCGCCGTGCTGCAGAGCAGCGGCCTGTACAGCC
TGAGCAGCGTGGTGACCGTGCCCAGCAGCAGCCTGGGCACCCAGACCTAC
ATCTGTAACGTGAACCACAAGCCCAGCAACACCAAGGTGGACAAGAAGGT
GGAGCCCAAGAGCTGTGACAAGACCCACACCTGCCCCCCCTGCCCTGCCC
CCGAGCTGCTGGGAGGCCCCAGCGTGTTCCTGTTCCCCCCCAAGCCTAAG
GACACCCTGATGATCAGCAGAACCCCCGAGGTGACCTGTGTGGTGGTGGA
TGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTGGTACGTGGACGGCG
TGGAGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAGTACAACAGC
ACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTGAA
CGGCAAGGAGTACAAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCCTA
TCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCCAGGTG
TACACCCTGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCT
GACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGG
AGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTG
GACAGCGATGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAG
CAGATGGCAGCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGAGGCCC
TGCACAATCACTACACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAG H0 protein sequence
of mature heavy chain SEQ ID NO: 46
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYWIVWVRQAPGQGLEWMGD
LYSGGGYTFYSENFKGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSG
YDRTWFAHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY
ICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK
DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV
YTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL
DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK L7 DNA sequence
of mature light chain SEQ ID NO: 47
GATATCCAGATGACCCAGAGCCCTAGCTCCCTCAGCGCATCAGTCGGCGA
CAGAGTGACAATCACCTGCCAGGCATCCCAGGACATCGAGTCTTACCTGA
GCTGGTACCAGCAGAAGCCCGGAAAGGCCCCAAAGCTCCTGATCTACTAC
GCCACTCGGCTGGCAgacGGCGTGCCTAGCAGGTTCTCCGGCTCAGGGTC
TGGGACAGACTTCACCCTGACCATCAGCTCACTGCAGCCCGAGGATTTCG
CCACCTACTACTGTCTGCAGCACGGAGAGAGCCCCCCAACCTTTGGCCAG
GGAACCAAGCTGGAGATCaagCGTACGGTGGCCGCCCCCAGCGTGTTCAT
CTTCCCCCCCAGCGATGAGCAGCTGAAGAGCGGCACCGCCAGCGTGGTGT
GTCTGCTGAACAACTTCTACCCCCGGGAGGCCAAGGTGCAGTGGAAGGTG
GACAATGCCCTGCAGAGCGGCAACAGCCAGGAGAGCGTGACCGAGCAGGA
CAGCAAGGACTCCACCTACAGCCTGAGCAGCACCCTGACCCTGAGCAAGG
CCGACTACGAGAAGCACAAGGTGTACGCCTGTGAGGTGACCCACCAGGGC
CTGTCCAGCCCCGTGACCAAGAGCTTCAACCGGGGCGAGTGC L7 protein sequence of
mature light chain SEQ ID NO: 48
DIQMTQSPSSLSASVGDRVTITCQASQDIESYLSWYQQKPGKAPKLLIYY
ATRLADGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQHGESPPTFGQ
GTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG LSSPVTKSFNRGEC
L8 DNA sequence of mature light chain SEQ ID NO: 59
GATATCCAGATGACCCAGAGCCCTAGCTCCCTCAGCGCATCAGTCGGCGA
CAGAGTGACAATCACCTGCCAGGCATCCCAGGACATCGAGTCTTACCTGA
GCTGGTACCAGCAGAAGCCCGGAAAGGCCCCAAAGCTCCTGATCTACTAC
GCCACTCGGCTGGCAgacGGCGTGCCTAGCAGGTTCTCCGGCTCAGGGTC
TGGGACAGACTTCACCttcACCATCAGCTCACTGCAGCCCGAGGATatcG
CCACCTACTACTGTCTGCAGCACGGAGAGAGCCCCCCAACCTTTGGCCAG
GGAACCAAGCTGGAGATCaagCGTACGGTGGCCGCCCCCAGCGTGTTCAT
CTTCCCCCCCAGCGATGAGCAGCTGAAGAGCGGCACCGCCAGCGTGGTGT
GTCTGCTGAACAACTTCTACCCCCGGGAGGCCAAGGTGCAGTGGAAGGTG
GACAATGCCCTGCAGAGCGGCAACAGCCAGGAGAGCGTGACCGAGCAGGA
CAGCAAGGACTCCACCTACAGCCTGAGCAGCACCCTGACCCTGAGCAAGG
CCGACTACGAGAAGCACAAGGTGTACGCCTGTGAGGTGACCCACCAGGGC
CTGTCCAGCCCCGTGACCAAGAGCTTCAACCGGGGCGAGTGC L8 protein sequence of
mature light chain SEQ ID NO: 60
DIQMTQSPSSLSASVGDRVTITCQASQDIESYLSWYQQKPGKAPKLLIYY
ATRLADGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCLQHGESPPTFGQ
GTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG LSSPVTKSFNRGEC
L10 DNA sequence of mature light chain SEQ ID NO: 61
GATATCCAGATGACCCAGAGCCCTAGCTCCCTCAGCGCATCAGTCGGCGA
CAGAGTGACAATCACCTGCCAGGCATCCCAGGACATCGAGTCTTACCTGA
GCTGGTACCAGCAGAAGCCCGGAAAGGCCCCAAAGCTCCTGATCTACTAC
GCCACTCGGCTGGCAgacGGCGTGCCTAGCAGGTTCTCCGGCTCAGGGTC
TGGGcagGACtacACCCTGACCATCAGCTCACTGCAGCCCGAGGATTTCG
CCACCTACTACTGTCTGCAGCACGGAGAGAGCCCCCCAACCTTTGGCCAG
GGAACCAAGCTGGAGATCAAGCGTACGGTGGCCGCCCCCAGCGTGTTCAT
CTTCCCCCCCAGCGATGAGCAGCTGAAGAGCGGCACCGCCAGCGTGGTGT
GTCTGCTGAACAACTTCTACCCCCGGGAGGCCAAGGTGCAGTGGAAGGTG
GACAATGCCCTGCAGAGCGGCAACAGCCAGGAGAGCGTGACCGAGCAGGA
CAGCAAGGACTCCACCTACAGCCTGAGCAGCACCCTGACCCTGAGCAAGG
CCGACTACGAGAAGCACAAGGTGTACGCCTGTGAGGTGACCCACCAGGGC
CTGTCCAGCCCCGTGACCAAGAGCTTCAACCGGGGCGAGTGC L10 protein sequence of
mature light chain SEQ ID NO: 62
DIQMTQSPSSLSASVGDRVTITCQASQDIESYLSWYQQKPGKAPKLLIYY
ATRLADGVPSRFSGSGSGQDYTLTISSLQPEDFATYYCLQHGESPPTFGQ
GTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG LSSPVTKSFNRGEC
M0 DNA sequence of mature light chain SEQ ID NO:63
GAGATCGTGCTGACCCAGTCTCCCGCCACCCTGTCACTGTCTCCCGGCGA
AAGGGCAACCCTGAGCTGCCAGGCCAGCCAGGACATCGAGAGCTACCTGA
GCTGGTACCAGCAGAAGCCCGGCCAGGCCCCCAGGCTGCTGATCTACTAC
GCCACCAGGCTGGCCGACGGCATTCCCGCCAGGTTCAGCGGAAGCGGCAG
CGGCACCGACTTCACTCTGACCATCAGCAGCCTGGAGCCCGAGGACTTCG
CCGTGTACTACTGCCTGCAGCACGGCGAGAGCCCTCCCACCTTCGGCCAG
GGCACCAAGCTCGAGATCAAGCGTACGGTGGCCGCCCCCAGCGTGTTCAT
CTTCCCCCCCAGCGATGAGCAGCTGAAGAGCGGCACCGCCAGCGTGGTGT
GTCTGCTGAACAACTTCTACCCCCGGGAGGCCAAGGTGCAGTGGAAGGTG
GACAATGCCCTGCAGAGCGGCAACAGCCAGGAGAGCGTGACCGAGCAGGA
CAGCAAGGACTCCACCTACAGCCTGAGCAGCACCCTGACCCTGAGCAAGG
CCGACTACGAGAAGCACAAGGTGTACGCCTGTGAGGTGACCCACCAGGGC
CTGTCCAGCCCCGTGACCAAGAGCTTCAACCGGGGCGAGTGC M0 protein sequence of
mature light chain SEQ ID NO: 64
EIVLTQSPATLSLSPGERATLSCQASQDIESYLSWYQQKPGQAPRLLIYY
ATRLADGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCLQHGESPPTFGQ
GTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG LSSPVTKSFNRGEC
Sequence CWU 1
1
641357DNAMurine 1caggtccagt tgcagcagtc tggagctgaa ctggtaaggc
ctgggacttc agtgacgata 60tcctgtaagg cttctggcta caccttcact aactactgga
tagtttgggt caaacagagg 120cctggacatg gacttgagtg gattggagat
ctttactctg gaggtggtta tactttctac 180agtgaaaatt tcaaggggaa
ggccacactg actgcagaca catcctccag cactgcctac 240atgcacctca
ttagcctgac atctgaggac tctgctgtct atttctgtgc aagatcgggt
300tacgacagaa cctggtttgc tcactggggc caagggtctc tggtcactgt ctctgca
3572119PRTMurine 2Gln Val Gln Leu Gln Gln Ser Gly Ala Glu Leu Val
Arg Pro Gly Thr1 5 10 15Ser Val Thr Ile Ser Cys Lys Ala Ser Gly Tyr
Thr Phe Thr Asn Tyr 20 25 30Trp Ile Val Trp Val Lys Gln Arg Pro Gly
His Gly Leu Glu Trp Ile 35 40 45Gly Asp Leu Tyr Ser Gly Gly Gly Tyr
Thr Phe Tyr Ser Glu Asn Phe 50 55 60Lys Gly Lys Ala Thr Leu Thr Ala
Asp Thr Ser Ser Ser Thr Ala Tyr65 70 75 80Met His Leu Ile Ser Leu
Thr Ser Glu Asp Ser Ala Val Tyr Phe Cys 85 90 95Ala Arg Ser Gly Tyr
Asp Arg Thr Trp Phe Ala His Trp Gly Gln Gly 100 105 110Ser Leu Val
Thr Val Ser Ala 1153324DNAMurine 3gacatcaaga tgacccagtc tccatcctcc
atgtctgcat cgctgggaga gagagtcact 60atcacttgtc aggcgagtca ggacattgaa
agctatttaa gctggtatca gcagaaacca 120tggaaatctc ctaagaccct
gatctattac gctacaaggt tggcagatgg ggtcccatca 180agattcagtg
gcagtggatc tggtcaagat tattctctaa ccatcagcag cctggagtct
240gacgatacag caacttatta ctgtctacaa catggtgaga gccctcccac
gttcggtgct 300gggaccaagc tggagctgaa acgg 3244108PRTMurine 4Asp Ile
Lys Met Thr Gln Ser Pro Ser Ser Met Ser Ala Ser Leu Gly1 5 10 15Glu
Arg Val Thr Ile Thr Cys Gln Ala Ser Gln Asp Ile Glu Ser Tyr 20 25
30Leu Ser Trp Tyr Gln Gln Lys Pro Trp Lys Ser Pro Lys Thr Leu Ile
35 40 45Tyr Tyr Ala Thr Arg Leu Ala Asp Gly Val Pro Ser Arg Phe Ser
Gly 50 55 60Ser Gly Ser Gly Gln Asp Tyr Ser Leu Thr Ile Ser Ser Leu
Glu Ser65 70 75 80Asp Asp Thr Ala Thr Tyr Tyr Cys Leu Gln His Gly
Glu Ser Pro Pro 85 90 95Thr Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys
Arg 100 1055357DNAMurine 5gagttccagc tgcagcagtc tggacctgag
ctggtgaagc ctggcgcttc agtgaagata 60tcctgcaagg cttctggtta ctcattcact
gactacaaca tgaactgggt gaagcagagc 120aatggaaaga gccttgagtg
gattggagta attaatccta agtatggtac tactagttac 180aatcagaagt
tcaagggcaa ggccacgttg actgtagacc aatcctccaa cacagcctac
240atgcagctca gcagcctgac atctgaggac tctgcagtct atcactgtgc
aagaggaatg 300ggactcctct ttggtatgga ctactggggc caaggaacct
ctgtcaccgt ctcctca 3576119PRTMurine 6Glu Phe Gln Leu Gln Gln Ser
Gly Pro Glu Leu Val Lys Pro Gly Ala1 5 10 15Ser Val Lys Ile Ser Cys
Lys Ala Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30Asn Met Asn Trp Val
Lys Gln Ser Asn Gly Lys Ser Leu Glu Trp Ile 35 40 45Gly Val Ile Asn
Pro Lys Tyr Gly Thr Thr Ser Tyr Asn Gln Lys Phe 50 55 60Lys Gly Lys
Ala Thr Leu Thr Val Asp Gln Ser Ser Asn Thr Ala Tyr65 70 75 80Met
Gln Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr His Cys 85 90
95Ala Arg Gly Met Gly Leu Leu Phe Gly Met Asp Tyr Trp Gly Gln Gly
100 105 110Thr Ser Val Thr Val Ser Ser 1157342DNAMurine 7gacattgtga
tgacacagtc tccatcctcc ctgagtgtgt cagcaggaga gaaggtcact 60atgagctgca
agtccagtca gagtctgtta aacagtggaa atcaraagaa ctacttggcc
120tggtaccagc agaaaccagg gcagcctcct aaactgttga tctacggggc
atccactagg 180aaatctgggg tccctgatcg cttcacaggc agtggatctg
gaaccgattt cactcttacc 240atcagcagtg tgcaggctga agacctggca
gtttattact gtcagaatga tcatagtttt 300ccgtgcacgt tcggaggggg
gaccaagctg gaaataaaac gg 3428114PRTMurine 8Asp Ile Val Met Thr Gln
Ser Pro Ser Ser Leu Ser Val Ser Ala Gly1 5 10 15Glu Lys Val Thr Met
Ser Cys Lys Ser Ser Gln Ser Leu Leu Asn Ser 20 25 30Gly Asn Gln Lys
Asn Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln 35 40 45Pro Pro Lys
Leu Leu Ile Tyr Gly Ala Ser Thr Arg Lys Ser Gly Val 50 55 60Pro Asp
Arg Phe Thr Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr65 70 75
80Ile Ser Ser Val Gln Ala Glu Asp Leu Ala Val Tyr Tyr Cys Gln Asn
85 90 95Asp His Ser Phe Pro Cys Thr Phe Gly Gly Gly Thr Lys Leu Glu
Ile 100 105 110Lys Arg9354DNAMurine 9gaggtccagc tgcagcagtc
tggacctgaa ctggagaagc ctggcgcttc agtgaagata 60tcctgcaagg cttctggtta
ctctttcact gtctacggca tgaactgggt gagacagagc 120aatggaaaga
gccttgaatg gattggaaat tttgatcctt actttagtgt cacttcctac
180aaccagaagt tccaggacaa ggccacattg actgtagaca aatcctccag
cacagcctac 240atgcagctca agaacctcac atctgaagac tctgcagtct
atttctgtgc aagagggagc 300tgggaaacca tttttgctta ctggggccaa
gggactctgg tcactgtctc tgca 35410118PRTMurine 10Glu Val Gln Leu Gln
Gln Ser Gly Pro Glu Leu Glu Lys Pro Gly Ala1 5 10 15Ser Val Lys Ile
Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Val Tyr 20 25 30Gly Met Asn
Trp Val Arg Gln Ser Asn Gly Lys Ser Leu Glu Trp Ile 35 40 45Gly Asn
Phe Asp Pro Tyr Phe Ser Val Thr Ser Tyr Asn Gln Lys Phe 50 55 60Gln
Asp Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr65 70 75
80Met Gln Leu Lys Asn Leu Thr Ser Glu Asp Ser Ala Val Tyr Phe Cys
85 90 95Ala Arg Gly Ser Trp Glu Thr Ile Phe Ala Tyr Trp Gly Gln Gly
Thr 100 105 110Leu Val Thr Val Ser Ala 115111347DNAMurine
11caggtgcagc tcgtgcagag cggcgccgaa gtgaagaagc ccggggccag cgtgaaggtg
60agctgcaagg ccagcggcta caccttcacc aactactgga tcgtgtgggt caggcaggcc
120cccggccagg gactggagtg gatgggcgac ctgtatagcg gcggcggcta
caccttctac 180agcgagaact tcaagggcag ggtgaccatg accagggaca
ccagcaccag caccgtgtac 240atggagctga gcagcctgag gagcgaggac
accgccgtgt actactgcgc caggagcggc 300tacgacagga cttggtttgc
tcactggggc cagggcacac tagtgaccgt gtccagcgcc 360agcaccaagg
gccccagcgt gttccccctg gcccccagca gcaagagcac cagcggcggc
420acagccgccc tgggctgcct ggtgaaggac tacttccccg aaccggtgac
cgtgtcctgg 480aacagcggag ccctgaccag cggcgtgcac accttccccg
ccgtgctgca gagcagcggc 540ctgtacagcc tgagcagcgt ggtgaccgtg
cccagcagca gcctgggcac ccagacctac 600atctgtaacg tgaaccacaa
gcccagcaac accaaggtgg acaagaaggt ggagcccaag 660agctgtgaca
agacccacac ctgccccccc tgccctgccc ccgagctgct gggaggcccc
720agcgtgttcc tgttcccccc caagcctaag gacaccctga tgatcagcag
aacccccgag 780gtgacctgtg tggtggtgga tgtgagccac gaggaccctg
aggtgaagtt caactggtac 840gtggacggcg tggaggtgca caatgccaag
accaagccca gggaggagca gtacaacagc 900acctaccggg tggtgtccgt
gctgaccgtg ctgcaccagg attggctgaa cggcaaggag 960tacaagtgta
aggtgtccaa caaggccctg cctgccccta tcgagaaaac catcagcaag
1020gccaagggcc agcccagaga gccccaggtg tacaccctgc cccctagcag
agatgagctg 1080accaagaacc aggtgtccct gacctgcctg gtgaagggct
tctaccccag cgacatcgcc 1140gtggagtggg agagcaacgg ccagcccgag
aacaactaca agaccacccc ccctgtgctg 1200gacagcgatg gcagcttctt
cctgtacagc aagctgaccg tggacaagag cagatggcag 1260cagggcaacg
tgttcagctg ctccgtgatg cacgaggccc tgcacaatca ctacacccag
1320aagagcctga gcctgtcccc tggcaag 134712111PRTMurine 12Gln Ala Val
Val Thr Gln Glu Ser Ala Leu Thr Thr Ser Pro Gly Glu1 5 10 15Thr Val
Thr Leu Thr Cys Arg Ser Ser Thr Gly Ala Val Thr Thr Ser 20 25 30Asn
Tyr Ala Asn Trp Val Gln Glu Lys Pro Asp His Leu Phe Thr Gly 35 40
45Leu Ile Gly Gly Thr Asn Asn Arg Ala Pro Gly Val Pro Ala Arg Phe
50 55 60Ser Gly Ser Leu Ile Gly Asp Lys Ala Ala Leu Thr Ile Thr Gly
Ala65 70 75 80Gln Thr Glu Asp Glu Ala Ile Tyr Phe Cys Ala Leu Trp
Tyr Ser Asn 85 90 95His Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu
Gln Pro Lys 100 105 110135PRTMurine 13Asn Tyr Trp Ile Val1
51417PRTMurine 14Asp Leu Tyr Ser Gly Gly Gly Tyr Thr Phe Tyr Ser
Glu Asn Phe Lys1 5 10 15Gly1510PRTMurine 15Ser Gly Tyr Asp Arg Thr
Trp Phe Ala His1 5 101611PRTMurine 16Gln Ala Ser Gln Asp Ile Glu
Ser Tyr Leu Ser1 5 10177PRTMurine 17Tyr Ala Thr Arg Leu Ala Asp1
5189PRTProtein 18Leu Gln His Gly Glu Ser Pro Pro Thr1 5195PRTMurine
19Asp Tyr Asn Met Asn1 52017PRTMurine 20Val Ile Asn Pro Lys Tyr Gly
Thr Thr Ser Tyr Asn Gln Lys Phe Lys1 5 10 15Gly2110PRTMurine 21Gly
Met Gly Leu Leu Phe Gly Met Asp Tyr1 5 102217PRTMurine 22Lys Ser
Ser Gln Ser Leu Leu Asn Ser Gly Asn Gln Lys Asn Tyr Leu1 5 10
15Ala237PRTMurine 23Gly Ala Ser Thr Arg Lys Ser1 5249PRTMurine
24Gln Asn Asp His Ser Phe Pro Cys Thr1 5255PRTMurine 25Val Tyr Gly
Met Asn1 52617PRTMurine 26Asn Phe Asp Pro Tyr Phe Ser Val Thr Ser
Tyr Asn Gln Lys Phe Gln1 5 10 15Asp279PRTMurine 27Gly Ser Trp Glu
Thr Ile Phe Ala Tyr1 52814PRTMurine 28Arg Ser Ser Thr Gly Ala Val
Thr Thr Ser Asn Tyr Ala Asn1 5 10297PRTMurine 29Gly Thr Asn Asn Arg
Ala Pro1 5308PRTMurine 30Ala Leu Trp Tyr Ser Asn His Val1
53115DNAMurine 31aactactgga tagtt 153251DNAMurine 32gatctttact
ctggaggtgg ttatactttc tacagtgaaa atttcaaggg g 513330DNAMurine
33tcgggttacg acagaacctg gtttgctcac 303433DNAMurine 34caggcgagtc
aggacattga aagctattta agc 333521DNAMurine 35tacgctacaa ggttggcaga t
213627DNAMurine 36ctacaacatg gtgagagccc tcccacg 273715DNAMurine
37gactacaaca tgaac 153851DNAMurine 38gtaattaatc ctaagtatgg
tactactagt tacaatcaga agttcaaggg c 513930DNAMurine 39ggaatgggac
tcctctttgg tatggactac 304051DNAMurine 40aagtccagtc agagtctgtt
aaacagtgga aatcaaaaga actacttggc c 514121DNAMurine 41ggggcatcca
ctaggaaatc t 214227DNAMurine 42cagaatgatc atagttttcc gtgcacg
274315DNAMurine 43gtctacggca tgaac 154451DNAMurine 44aattttgatc
cttactttag tgtcacttcc tacaaccaga agttccagga c 514527DNAMurine
45gggagctggg aaaccatttt tgcttac 2746449PRTMurine 46Gln Val Gln Leu
Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys
Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asn Tyr 20 25 30Trp Ile
Val Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45Gly
Asp Leu Tyr Ser Gly Gly Gly Tyr Thr Phe Tyr Ser Glu Asn Phe 50 55
60Lys Gly Arg Val Thr Met Thr Arg Asp Thr Ser Thr Ser Thr Val Tyr65
70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Ala Arg Ser Gly Tyr Asp Arg Thr Trp Phe Ala His Trp Gly
Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly
Pro Ser Val Phe 115 120 125Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser
Gly Gly Thr Ala Ala Leu 130 135 140Gly Cys Leu Val Lys Asp Tyr Phe
Pro Glu Pro Val Thr Val Ser Trp145 150 155 160Asn Ser Gly Ala Leu
Thr Ser Gly Val His Thr Phe Pro Ala Val Leu 165 170 175Gln Ser Ser
Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser 180 185 190Ser
Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro 195 200
205Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys
210 215 220Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly
Gly Pro225 230 235 240Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp
Thr Leu Met Ile Ser 245 250 255Arg Thr Pro Glu Val Thr Cys Val Val
Val Asp Val Ser His Glu Asp 260 265 270Pro Glu Val Lys Phe Asn Trp
Tyr Val Asp Gly Val Glu Val His Asn 275 280 285Ala Lys Thr Lys Pro
Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val 290 295 300Val Ser Val
Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu305 310 315
320Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys
325 330 335Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val
Tyr Thr 340 345 350Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln
Val Ser Leu Thr 355 360 365Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp
Ile Ala Val Glu Trp Glu 370 375 380Ser Asn Gly Gln Pro Glu Asn Asn
Tyr Lys Thr Thr Pro Pro Val Leu385 390 395 400Asp Ser Asp Gly Ser
Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 405 410 415Ser Arg Trp
Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu 420 425 430Ala
Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 435 440
445Lys 47642DNAMurine 47gatatccaga tgacccagag ccctagctcc ctcagcgcat
cagtcggcga cagagtgaca 60atcacctgcc aggcatccca ggacatcgag tcttacctga
gctggtacca gcagaagccc 120ggaaaggccc caaagctcct gatctactac
gccactcggc tggcagacgg cgtgcctagc 180aggttctccg gctcagggtc
tgggacagac ttcaccctga ccatcagctc actgcagccc 240gaggatttcg
ccacctacta ctgtctgcag cacggagaga gccccccaac ctttggccag
300ggaaccaagc tggagatcaa gcgtacggtg gccgccccca gcgtgttcat
cttccccccc 360agcgatgagc agctgaagag cggcaccgcc agcgtggtgt
gtctgctgaa caacttctac 420ccccgggagg ccaaggtgca gtggaaggtg
gacaatgccc tgcagagcgg caacagccag 480gagagcgtga ccgagcagga
cagcaaggac tccacctaca gcctgagcag caccctgacc 540ctgagcaagg
ccgactacga gaagcacaag gtgtacgcct gtgaggtgac ccaccagggc
600ctgtccagcc ccgtgaccaa gagcttcaac cggggcgagt gc 64248214PRTMurine
48Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1
5 10 15Asp Arg Val Thr Ile Thr Cys Gln Ala Ser Gln Asp Ile Glu Ser
Tyr 20 25 30Leu Ser Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu
Leu Ile 35 40 45Tyr Tyr Ala Thr Arg Leu Ala Asp Gly Val Pro Ser Arg
Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser
Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Leu Gln
His Gly Glu Ser Pro Pro 85 90 95Thr Phe Gly Gln Gly Thr Lys Leu Glu
Ile Lys Arg Thr Val Ala Ala 100 105 110Pro Ser Val Phe Ile Phe Pro
Pro Ser Asp Glu Gln Leu Lys Ser Gly 115 120 125Thr Ala Ser Val Val
Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140Lys Val Gln
Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145 150 155
160Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser
165 170 175Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys
Val Tyr 180 185 190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro
Val Thr Lys Ser 195 200 205Phe Asn Arg Gly Glu Cys 2104915PRTMurine
49Leu Ala Thr Glu Leu Arg Ser Gln Ser Leu Gln Thr Leu Gln Gly1 5 10
155015PRTMurine 50Ser Ala Lys Glu Leu Arg Ser Gln Ser Ile Lys Thr
Tyr Ser Lys1 5 10 155114PRTMurine 51Leu Arg Glu Leu Arg Ser Val Ser
Leu Gln Thr Thr Gln Gly1 5 105214PRTMurine 52Ser Pro Gly Pro His
Ser Ala Gln Thr Glu Val Ile Ala Thr1
5 105314PRTMurine 53Glu Ser Gly Pro His Ser Ala Asn Thr Glu Ile Ile
Val Lys1 5 105414PRTMurine 54Lys Glu Leu Arg Cys Gln Cys Ile Lys
Thr Tyr Ser Lys Pro1 5 10551347DNAMurine 55caggtccagt tgcagcagtc
tggagctgaa ctggtaaggc ctgggacttc agtgacgata 60tcctgtaagg cttctggcta
caccttcact aactactgga tagtttgggt caaacagagg 120cctggacatg
gacttgagtg gattggagat ctttactctg gaggtggtta tactttctac
180agtgaaaatt tcaaggggaa ggccacactg actgcagaca catcctccag
cactgcctac 240atgcacctca ttagcctgac atctgaggac tctgctgtct
atttctgtgc aagatcgggt 300tacgacagaa cctggtttgc tcactggggc
caagggtcac tagtgaccgt gtccagcgcc 360agcaccaagg gccccagcgt
gttccccctg gcccccagca gcaagagcac cagcggcggc 420acagccgccc
tgggctgcct ggtgaaggac tacttccccg aaccggtgac cgtgtcctgg
480aacagcggag ccctgaccag cggcgtgcac accttccccg ccgtgctgca
gagcagcggc 540ctgtacagcc tgagcagcgt ggtgaccgtg cccagcagca
gcctgggcac ccagacctac 600atctgtaacg tgaaccacaa gcccagcaac
accaaggtgg acaagaaggt ggagcccaag 660agctgtgaca agacccacac
ctgccccccc tgccctgccc ccgagctgct gggaggcccc 720agcgtgttcc
tgttcccccc caagcctaag gacaccctga tgatcagcag aacccccgag
780gtgacctgtg tggtggtgga tgtgagccac gaggaccctg aggtgaagtt
caactggtac 840gtggacggcg tggaggtgca caatgccaag accaagccca
gggaggagca gtacaacagc 900acctaccggg tggtgtccgt gctgaccgtg
ctgcaccagg attggctgaa cggcaaggag 960tacaagtgta aggtgtccaa
caaggccctg cctgccccta tcgagaaaac catcagcaag 1020gccaagggcc
agcccagaga gccccaggtg tacaccctgc cccctagcag agatgagctg
1080accaagaacc aggtgtccct gacctgcctg gtgaagggct tctaccccag
cgacatcgcc 1140gtggagtggg agagcaacgg ccagcccgag aacaactaca
agaccacccc ccctgtgctg 1200gacagcgatg gcagcttctt cctgtacagc
aagctgaccg tggacaagag cagatggcag 1260cagggcaacg tgttcagctg
ctccgtgatg cacgaggccc tgcacaatca ctacacccag 1320aagagcctga
gcctgtcccc tggcaag 134756449PRTMurine 56Gln Val Gln Leu Gln Gln Ser
Gly Ala Glu Leu Val Arg Pro Gly Thr1 5 10 15Ser Val Thr Ile Ser Cys
Lys Ala Ser Gly Tyr Thr Phe Thr Asn Tyr 20 25 30Trp Ile Val Trp Val
Lys Gln Arg Pro Gly His Gly Leu Glu Trp Ile 35 40 45Gly Asp Leu Tyr
Ser Gly Gly Gly Tyr Thr Phe Tyr Ser Glu Asn Phe 50 55 60Lys Gly Lys
Ala Thr Leu Thr Ala Asp Thr Ser Ser Ser Thr Ala Tyr65 70 75 80Met
His Leu Ile Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Phe Cys 85 90
95Ala Arg Ser Gly Tyr Asp Arg Thr Trp Phe Ala His Trp Gly Gln Gly
100 105 110Ser Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser
Val Phe 115 120 125Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly
Thr Ala Ala Leu 130 135 140Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu
Pro Val Thr Val Ser Trp145 150 155 160Asn Ser Gly Ala Leu Thr Ser
Gly Val His Thr Phe Pro Ala Val Leu 165 170 175Gln Ser Ser Gly Leu
Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser 180 185 190Ser Ser Leu
Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro 195 200 205Ser
Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys 210 215
220Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly
Pro225 230 235 240Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
Leu Met Ile Ser 245 250 255Arg Thr Pro Glu Val Thr Cys Val Val Val
Asp Val Ser His Glu Asp 260 265 270Pro Glu Val Lys Phe Asn Trp Tyr
Val Asp Gly Val Glu Val His Asn 275 280 285Ala Lys Thr Lys Pro Arg
Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val 290 295 300Val Ser Val Leu
Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu305 310 315 320Tyr
Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys 325 330
335Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
340 345 350Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser
Leu Thr 355 360 365Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
Val Glu Trp Glu 370 375 380Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys
Thr Thr Pro Pro Val Leu385 390 395 400Asp Ser Asp Gly Ser Phe Phe
Leu Tyr Ser Lys Leu Thr Val Asp Lys 405 410 415Ser Arg Trp Gln Gln
Gly Asn Val Phe Ser Cys Ser Val Met His Glu 420 425 430Ala Leu His
Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 435 440 445Lys
57642DNAMurine 57gacatcaaga tgacccagtc tccatcctcc atgtctgcat
cgctgggaga gagagtcact 60atcacttgtc aggcgagtca ggacattgaa agctatttaa
gctggtatca gcagaaacca 120tggaaatctc ctaagaccct gatctattac
gctacaaggt tggcagatgg ggtcccatca 180agattcagtg gcagtggatc
tggtcaagat tattctctaa ccatcagcag cctggagtct 240gacgatacag
caacttatta ctgtctacaa catggtgaga gccctcccac gttcggtgct
300gggaccaagc tggagctgaa acgtacggtg gccgccccca gcgtgttcat
cttccccccc 360agcgatgagc agctgaagag cggcaccgcc agcgtggtgt
gtctgctgaa caacttctac 420ccccgggagg ccaaggtgca gtggaaggtg
gacaatgccc tgcagagcgg caacagccag 480gagagcgtga ccgagcagga
cagcaaggac tccacctaca gcctgagcag caccctgacc 540ctgagcaagg
ccgactacga gaagcacaag gtgtacgcct gtgaggtgac ccaccagggc
600ctgtccagcc ccgtgaccaa gagcttcaac cggggcgagt gc 64258214PRTMurine
58Asp Ile Lys Met Thr Gln Ser Pro Ser Ser Met Ser Ala Ser Leu Gly1
5 10 15Glu Arg Val Thr Ile Thr Cys Gln Ala Ser Gln Asp Ile Glu Ser
Tyr 20 25 30Leu Ser Trp Tyr Gln Gln Lys Pro Trp Lys Ser Pro Lys Thr
Leu Ile 35 40 45Tyr Tyr Ala Thr Arg Leu Ala Asp Gly Val Pro Ser Arg
Phe Ser Gly 50 55 60Ser Gly Ser Gly Gln Asp Tyr Ser Leu Thr Ile Ser
Ser Leu Glu Ser65 70 75 80Asp Asp Thr Ala Thr Tyr Tyr Cys Leu Gln
His Gly Glu Ser Pro Pro 85 90 95Thr Phe Gly Ala Gly Thr Lys Leu Glu
Leu Lys Arg Thr Val Ala Ala 100 105 110Pro Ser Val Phe Ile Phe Pro
Pro Ser Asp Glu Gln Leu Lys Ser Gly 115 120 125Thr Ala Ser Val Val
Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140Lys Val Gln
Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145 150 155
160Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser
165 170 175Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys
Val Tyr 180 185 190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro
Val Thr Lys Ser 195 200 205Phe Asn Arg Gly Glu Cys
21059642DNAMurine 59gatatccaga tgacccagag ccctagctcc ctcagcgcat
cagtcggcga cagagtgaca 60atcacctgcc aggcatccca ggacatcgag tcttacctga
gctggtacca gcagaagccc 120ggaaaggccc caaagctcct gatctactac
gccactcggc tggcagacgg cgtgcctagc 180aggttctccg gctcagggtc
tgggacagac ttcaccttca ccatcagctc actgcagccc 240gaggatatcg
ccacctacta ctgtctgcag cacggagaga gccccccaac ctttggccag
300ggaaccaagc tggagatcaa gcgtacggtg gccgccccca gcgtgttcat
cttccccccc 360agcgatgagc agctgaagag cggcaccgcc agcgtggtgt
gtctgctgaa caacttctac 420ccccgggagg ccaaggtgca gtggaaggtg
gacaatgccc tgcagagcgg caacagccag 480gagagcgtga ccgagcagga
cagcaaggac tccacctaca gcctgagcag caccctgacc 540ctgagcaagg
ccgactacga gaagcacaag gtgtacgcct gtgaggtgac ccaccagggc
600ctgtccagcc ccgtgaccaa gagcttcaac cggggcgagt gc 64260214PRTMurine
60Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1
5 10 15Asp Arg Val Thr Ile Thr Cys Gln Ala Ser Gln Asp Ile Glu Ser
Tyr 20 25 30Leu Ser Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu
Leu Ile 35 40 45Tyr Tyr Ala Thr Arg Leu Ala Asp Gly Val Pro Ser Arg
Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Phe Thr Ile Ser
Ser Leu Gln Pro65 70 75 80Glu Asp Ile Ala Thr Tyr Tyr Cys Leu Gln
His Gly Glu Ser Pro Pro 85 90 95Thr Phe Gly Gln Gly Thr Lys Leu Glu
Ile Lys Arg Thr Val Ala Ala 100 105 110Pro Ser Val Phe Ile Phe Pro
Pro Ser Asp Glu Gln Leu Lys Ser Gly 115 120 125Thr Ala Ser Val Val
Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140Lys Val Gln
Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145 150 155
160Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser
165 170 175Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys
Val Tyr 180 185 190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro
Val Thr Lys Ser 195 200 205Phe Asn Arg Gly Glu Cys
21061642DNAMurine 61gatatccaga tgacccagag ccctagctcc ctcagcgcat
cagtcggcga cagagtgaca 60atcacctgcc aggcatccca ggacatcgag tcttacctga
gctggtacca gcagaagccc 120ggaaaggccc caaagctcct gatctactac
gccactcggc tggcagacgg cgtgcctagc 180aggttctccg gctcagggtc
tgggcaggac tacaccctga ccatcagctc actgcagccc 240gaggatttcg
ccacctacta ctgtctgcag cacggagaga gccccccaac ctttggccag
300ggaaccaagc tggagatcaa gcgtacggtg gccgccccca gcgtgttcat
cttccccccc 360agcgatgagc agctgaagag cggcaccgcc agcgtggtgt
gtctgctgaa caacttctac 420ccccgggagg ccaaggtgca gtggaaggtg
gacaatgccc tgcagagcgg caacagccag 480gagagcgtga ccgagcagga
cagcaaggac tccacctaca gcctgagcag caccctgacc 540ctgagcaagg
ccgactacga gaagcacaag gtgtacgcct gtgaggtgac ccaccagggc
600ctgtccagcc ccgtgaccaa gagcttcaac cggggcgagt gc 64262214PRTMurine
62Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1
5 10 15Asp Arg Val Thr Ile Thr Cys Gln Ala Ser Gln Asp Ile Glu Ser
Tyr 20 25 30Leu Ser Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu
Leu Ile 35 40 45Tyr Tyr Ala Thr Arg Leu Ala Asp Gly Val Pro Ser Arg
Phe Ser Gly 50 55 60Ser Gly Ser Gly Gln Asp Tyr Thr Leu Thr Ile Ser
Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Leu Gln
His Gly Glu Ser Pro Pro 85 90 95Thr Phe Gly Gln Gly Thr Lys Leu Glu
Ile Lys Arg Thr Val Ala Ala 100 105 110Pro Ser Val Phe Ile Phe Pro
Pro Ser Asp Glu Gln Leu Lys Ser Gly 115 120 125Thr Ala Ser Val Val
Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140Lys Val Gln
Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145 150 155
160Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser
165 170 175Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys
Val Tyr 180 185 190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro
Val Thr Lys Ser 195 200 205Phe Asn Arg Gly Glu Cys
21063642DNAMurine 63gagatcgtgc tgacccagtc tcccgccacc ctgtcactgt
ctcccggcga aagggcaacc 60ctgagctgcc aggccagcca ggacatcgag agctacctga
gctggtacca gcagaagccc 120ggccaggccc ccaggctgct gatctactac
gccaccaggc tggccgacgg cattcccgcc 180aggttcagcg gaagcggcag
cggcaccgac ttcactctga ccatcagcag cctggagccc 240gaggacttcg
ccgtgtacta ctgcctgcag cacggcgaga gccctcccac cttcggccag
300ggcaccaagc tcgagatcaa gcgtacggtg gccgccccca gcgtgttcat
cttccccccc 360agcgatgagc agctgaagag cggcaccgcc agcgtggtgt
gtctgctgaa caacttctac 420ccccgggagg ccaaggtgca gtggaaggtg
gacaatgccc tgcagagcgg caacagccag 480gagagcgtga ccgagcagga
cagcaaggac tccacctaca gcctgagcag caccctgacc 540ctgagcaagg
ccgactacga gaagcacaag gtgtacgcct gtgaggtgac ccaccagggc
600ctgtccagcc ccgtgaccaa gagcttcaac cggggcgagt gc 64264214PRTMurine
64Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly1
5 10 15Glu Arg Ala Thr Leu Ser Cys Gln Ala Ser Gln Asp Ile Glu Ser
Tyr 20 25 30Leu Ser Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu
Leu Ile 35 40 45Tyr Tyr Ala Thr Arg Leu Ala Asp Gly Ile Pro Ala Arg
Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser
Ser Leu Glu Pro65 70 75 80Glu Asp Phe Ala Val Tyr Tyr Cys Leu Gln
His Gly Glu Ser Pro Pro 85 90 95Thr Phe Gly Gln Gly Thr Lys Leu Glu
Ile Lys Arg Thr Val Ala Ala 100 105 110Pro Ser Val Phe Ile Phe Pro
Pro Ser Asp Glu Gln Leu Lys Ser Gly 115 120 125Thr Ala Ser Val Val
Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140Lys Val Gln
Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145 150 155
160Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser
165 170 175Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys
Val Tyr 180 185 190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro
Val Thr Lys Ser 195 200 205Phe Asn Arg Gly Glu Cys 210
* * * * *
References