U.S. patent application number 11/926480 was filed with the patent office on 2008-05-29 for soluble t cell receptors.
This patent application is currently assigned to AVIDEX LIMITED. Invention is credited to Meir Glick, Bent Karsten Jakobsen.
Application Number | 20080125369 11/926480 |
Document ID | / |
Family ID | 27256272 |
Filed Date | 2008-05-29 |
United States Patent
Application |
20080125369 |
Kind Code |
A1 |
Jakobsen; Bent Karsten ; et
al. |
May 29, 2008 |
SOLUBLE T CELL RECEPTORS
Abstract
The present invention provides a soluble T cell receptor (sTCR),
which comprises (i) all or part of a TCR.alpha. chain, except the
transmembrane domain thereof, and (ii) all or part of a TCR .beta.
chain, except the transmembrane domain thereof. (i) and (ii) each
comprise a functional variable domain and at least a part of the
constant domain of the TCR chain, and are linked by a disulphide
bond between constant domain residues which is not present in
native TCR.
Inventors: |
Jakobsen; Bent Karsten;
(Abingdon, GB) ; Glick; Meir; (Morristown,
NJ) |
Correspondence
Address: |
BANNER & WITCOFF, LTD.
1100 13th STREET, N.W., SUITE 1200
WASHINGTON
DC
20005-4051
US
|
Assignee: |
AVIDEX LIMITED
Abingdon
GB
|
Family ID: |
27256272 |
Appl. No.: |
11/926480 |
Filed: |
October 29, 2007 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
10486924 |
Sep 1, 2004 |
7329731 |
|
|
PCT/GB02/03986 |
Aug 30, 2002 |
|
|
|
11926480 |
|
|
|
|
60404182 |
Aug 16, 2002 |
|
|
|
Current U.S.
Class: |
424/192.1 ;
514/19.3; 530/350 |
Current CPC
Class: |
A61P 31/18 20180101;
A61P 3/10 20180101; A61P 31/12 20180101; C07K 14/7051 20130101;
A61K 38/00 20130101; A61P 35/00 20180101; A61P 37/02 20180101 |
Class at
Publication: |
514/12 ;
530/350 |
International
Class: |
A61K 38/17 20060101
A61K038/17; C07K 14/435 20060101 C07K014/435 |
Foreign Application Data
Date |
Code |
Application Number |
Aug 31, 2001 |
GB |
0121187.9 |
Aug 16, 2002 |
GB |
0219146.8 |
Claims
1. A soluble T cell receptor (sTCR), which comprises: (i) all or
part of a TCR .alpha. chain, except the transmembrane domain
thereof, and (ii) all or part of a TCR .beta. chain, except the
transmembrane domain thereof, wherein (i) and (ii) each comprise a
functional variable domain and at least a part of the constant
domain of the TCR chain, and are linked by a disulphide bond
between constant domain residues which is not present in native TCR
and wherein an interchain disulphide bond in native TCR is not
present.
2. The sTCR of claim 1, wherein one or both of (i) and (ii)
comprise all of the extracellular constant Ig domain of the TCR
chain.
3. A soluble .alpha..beta.-form T cell receptor (sTCR), wherein a
covalent disulphide bond links a residue of the immunoglobulin
region of the constant domain of the .alpha. chain to a residue of
the immunoglobulin region of the constant domain of the .beta.
chain, wherein an interchain disulphide bond in native TCR is not
present.
4. The sTCR of claim 1, wherein the disulphide bond which is not
present in native TCR is between cysteine residues substituted for
residues whose .beta. carbon atoms are less than 0.6 nm apart in
the native TCR structure.
5. The sTCR of claim 1, wherein native .alpha. and .beta. TCR
chains are truncated at the C-terminus such that the cysteine
residues which form the native interchain disulphide bond are
excluded.
6. The sTCR of claim 1, wherein cysteine residues which form the
native interchain disulphide bond are substituted to another
residue.
7. The sTCR of claim 6, wherein cysteine residues which form the
native interchain disulphide bond are substituted to serine or
alanine.
8. The sTCR of claim 1, wherein an unpaired cysteine residue
present in native TCR chain is not present.
9. The sTCR of claim 1, wherein one or both of the chains are
derivatised with, or fused to, a moiety at its C or N terminus.
10. The sTCR of claim 1, further comprising a detectable label.
11. The sTCR of claim 1, associated with a therapeutic agent.
12. The sTCR of claim 8, wherein one or both of the chains are
derivatised with, or fused to, a moiety at its C or N terminus.
13. The sTCR of claim 8, further comprising a detectable label.
14. The sTCR of claim 8, associated with a therapeutic agent.
15. A multivalent T cell receptor (TCR) complex comprising a
plurality of the sTCRs of 1.
16. A multivalent T cell receptor (TCR) complex comprising a
plurality of the sTCRs of 8.
17. A pharmaceutical formulation comprising: (a) at least one of:
(i) a soluble T cell receptor (sTCR), which comprises: (1) all or
part of a TCR .alpha. chain, except the transmembrane domain
thereof, and (2) all or part of a TCR .beta. chain, except the
transmembrane domain thereof, wherein (i) and (ii) each comprise a
functional variable domain and at least a part of the constant
domain of the TCR chain, and are linked by a disulphide bond
between constant domain residues which is not present in native TCR
and wherein an interchain disulphide bond in native TCR is not
present, (ii) a multivalent T cell receptor (TCR) complex
comprising a plurality of the sTCRs of (i); (iii) the sTCR of (i),
wherein an unpaired cysteine residue present in native TCR .beta.
chain is not present; and (iv) a multivalent T cell receptor (TCR)
complex comprising a plurality of the sTCRs of (iii); and (b) a
pharmaceutically acceptable carrier.
Description
[0001] This application is a division of Ser. No. 10/486,924 filed
Feb. 24, 2004, which is a national stage application of
PCT/GB02/03986 filed Aug. 30, 2002, which was published in English
on Mar. 13, 2003 and which claims the benefit of GB 0121187.9 filed
Aug. 31, 2001, GB 0219146.8 filed Aug. 16, 2002, and Ser. No.
60/404,182 filed Aug. 16, 2002.
[0002] The present invention relates to soluble T cell receptors
(TCRs).
[0003] As is described in WO 99/60120, TCRs mediate the recognition
of specific Major Histocompatibility Complex (MHC)-peptide
complexes by T cells and, as such, are essential to the functioning
of the cellular arm of the immune system.
[0004] Antibodies and TCRs are the only two types of molecules
which recognise antigens in a specific manner, and thus the TCR is
the only receptor for particular peptide antigens presented in MHC,
the alien peptide often being the only sign of an abnormality
within a cell. T cell recognition occurs when a T-cell and an
antigen presenting cell (APC) are in direct physical contact, and
is initiated by ligation of antigen-specific TCRs with pMHC
complexes.
[0005] The TCR is a heterodimeric cell surface protein of the
immunoglobulin superfamily which is associated with invariant
proteins of the CD3 complex involved in mediating signal
transduction. TCRs exist in .alpha..beta. and .gamma..delta. forms,
which are structurally similar but T cells expressing them have
quite distinct anatomical locations and probably functions. The
extracellular portion of the receptor consists of two
membrane-proximal constant domains, and two membrane-distal
variable domains bearing polymorphic loops analogous to the
complementarity determining regions (CDRs) of antibodies. It is
these loops which form the binding site of the TCR molecule and
determine peptide specificity. The MHC class I and class II ligands
are also immunoglobulin superfamily proteins but are specialised
for antigen presentation, with a polymorphic peptide binding site
which enables them to present a diverse array of short peptide
fragments at the APC cell surface.
[0006] Soluble TCRs are useful, not only for the purpose of
investigating specific TCR-pMHC interactions, but also potentially
as a diagnostic tool to detect infection, or to detect autoimmune
disease markers. Soluble TCRs also have applications in staining,
for example to stain cells for the presence of a particular peptide
antigen presented in the context of the MHC. Similarly, soluble
TCRs can be used to deliver a therapeutic agent, for example a
cytotoxic compound or an immunostimulating compound, to cells
presenting a particular antigen. Soluble TCRs may also be used to
inhibit T cells, for example, those reacting to an auto-immune
peptide antigen.
[0007] Proteins which are made up of more than one polypeptide
subunit and which have a transmembrane domain can be difficult to
produce in soluble form because, in many cases, the protein is
stabilised by its transmembrane region. This is the case for the
TCR, and is reflected in the scientific literature which describes
truncated forms of TCR, containing either only extracellular
domains or extracellular and cytoplasmic domains, which can be
recognised by TCR-specific antibodies (indicating that the part of
the recombinant TCR recognised by the antibody has correctly
folded), but which cannot be produced at a good yield, which are
not stable at low concentrations and/or which cannot recognise
MHC-peptide complexes. This literature is reviewed in WO
99/60120.
[0008] A number of papers describe the production of TCR
heterodimers which include the native disulphide bridge which
connects the respective subunits (Garboczi, et al., (1996), Nature
384(6605): 134-41; Garboczi, et al., (1996), J Immunol 157(12):
5403-10; Chang et al., (1994), PNAS USA 91: 11408-11412; Davodeau
et al., (1993), J. Biol. Chem. 268(21): 15455-15460; Golden et al.,
(1997), J. Imm. Meth. 206: 163-169; U.S. Pat. No. 6,080,840).
However, although such TCRs can be recognised by TCR-specific
antibodies, none were shown to recognise its native ligand at
anything other than relatively high concentrations and/or were not
stable.
[0009] In WO 99/60120, a soluble TCR is described which is
correctly folded so that it is capable of recognising its native
ligand, is stable over a period of time, and can be produced in
reasonable quantities. This TCR comprises a TCR .alpha. or .gamma.
chain extracellular domain dimerised to a TCR .beta. or .delta.
chain extracellular domain respectively, by means of a pair of
C-terminal dimerisation peptides, such as leucine zippers. This
strategy of producing TCRs is generally applicable to all TCRs.
[0010] Reiter et al, Immunity, 1995, 2:281-287, details the
construction of a soluble molecule comprising disulphide-stabilised
TCR .alpha. and .beta. variable domains, one of which is linked to
a truncated form of Pseudomonas exotoxin (PE38). One of the stated
reasons for producing this molecule was to overcome the inherent
instability of single-chain TCRs. The position of the novel
disulphide bond in the TCR variable domains was identified via
homology with the variable domains of antibodies, into which these
have previously been introduced (for example see Brinkmann, et al.
(1993), Proc. Natl. Acad. Sci. USA 90: 7538-7542, and Reiter, et
al. (1994) Biochemistry 33: 5451-5459). However, as there is no
such homology between antibody and TCR constant domains, such a
technique could not be employed to identify appropriate sites for
new inter-chain disulphide bonds between TCR constant domains.
[0011] Given the importance of soluble TCRs, it would be desirable
to provide an alternative way of producing such molecules.
[0012] According to a first aspect, the present invention provides
a soluble T cell receptor (sTCR), which comprises (i) all or part
of a TCR .alpha. chain, except the transmembrane domain thereof,
and (ii) all or part of a TCR .beta. chain, except the
transmembrane domain thereof, wherein (i) and (ii) each comprise a
functional variable domain and at least a part of the constant
domain of the TCR chain, and are linked by a disulphide bond
between constant domain residues which is not present in native
TCR.
[0013] In another aspect, the invention provides a soluble
.alpha..beta.-form T cell receptor (sTCR), wherein a covalent
disulphide bond links a residue of the immunoglobulin region of the
constant domain of the .alpha. chain to a residue of the
immunoglobulin region of the constant domain of the .beta.
chain.
[0014] The sTCRs of the present invention have the advantage that
they do not contain heterologous polypeptides which may be
immunogenic, or which may result in the sTCR being cleared quickly
from the body. Furthermore, TCRs of the present invention have a
three-dimensional structure which is highly similar to the native
TCRs from which they are derived and, due to this structural
similarity, they are not likely to be immunogenic. sTCRs in
accordance with the invention may be for recognising Class I
MHC-peptide complexes or Class II MHC-peptide complexes.
[0015] TCRs of the present invention are soluble. In the context of
this application, solubility is defined as the ability of the TCR
to be purified as a mono disperse heterodimer in phosphate buffered
saline (PBS) (KCL 2.7 mM, KH.sub.2PO.sub.4 1.5 mM, NaCl 137 mM and
Na.sub.2PO4 8 mM, pH 7.1-7.5. Life Technologies, Gibco BRL) at a
concentration of 1 mg/ml and for >90% of said TCR to remain as a
mono disperse heterodimer after incubation at 25.degree. C. for 1
hour. In order to assess the solubility of the TCR, it is first
purified as described in Example 2. Following this purification,
100 .mu.g of the TCR is analysed by analytical size exclusion
chromatography e.g. using a Pharmacia Superdex 75 HR column
equilibrated in PBS. A further 100 .mu.g of the TCR is incubated at
25.degree. C. for 1 hour and then analysed by size exclusion
chromatography as before. The size exclusion traces are then
analysed by integration and the areas under the peaks corresponding
to the mono disperse heterodimer are compared. The relevant peaks
may be identified by comparison with the elution position of
protein standards of known molecular weight. The mono disperse
heterodimeric soluble TCR has a molecular weight of approximately
50 kDa. As stated above, the TCRs of the present invention are
soluble. However, as explained in more detail below, the TCRs can
be coupled to a moiety such that the resulting complex is
insoluble, or they may be presented on the surface of an insoluble
solid support.
[0016] The numbering of TCR amino acids used herein follows the
IMGT system described in The T Cell Receptor Factsbook, 2001,
LeFranc & LeFranc, Academic Press. In this system, the .alpha.
chain constant domain has the following notation: TRAC*01, where
"TR" indicates T Cell Receptor gene; "A" indicates .alpha. chain
gene; C indicates constant region; and "*01" indicates allele 1.
The .beta. chain constant domain has the following notation:
TRBC1*01. In this instance, there are two possible constant region
genes "C1" and "C2". The translated domain encoded by each allele
can be made up from the genetic code of several exons; therefore
these are also specified. Amino acids are numbered according to the
exon of the particular domain in which they are present.
[0017] The extracellular portion of native TCR consists of two
polypeptides (.alpha..beta. or .gamma..delta.) each of which has a
membrane-proximal constant domain, and a membrane-distal variable
domain (see FIG. 1). Each of the constant and variable domains
includes an intra-chain disulphide bond. The variable domains
contain the highly polymorphic loops analogous to the
complementarity determining regions (CDRs) of antibodies. CDR3 of
the TCR interacts with the peptide presented by MHC, and CDRs 1 and
2 interact with the peptide and the MHC. The diversity of TCR
sequences is generated via somatic rearrangement of linked variable
(V), diversity (D), joining (J), and constant genes. Functional
.alpha. chain polypeptides are formed by rearranged V-J-C regions,
whereas .beta. chains consist of V-D-J-C regions. The extracellular
constant domain has a membrane proximal region and an
immunoglobulin region. The membrane proximal region consists of the
amino acids between the transmembrane domain and the membrane
proximal cysteine residue. The constant immunoglobulin domain
consists of the remainder of the constant domain amino acid
residues, extending from the membrane proximal cysteine to the
beginning of the joining region, and is characterised by the
presence of an immunoglobulin-type fold. There is a single .alpha.
chain constant domain, known as C.alpha.1 or TRAC*01, and two
different .beta. constant domains, known as C.beta.1 or TRBC1*01
and C.beta.2 or TRBC2*01. The difference between these different
.beta. constant domains is in respect of amino acid residues 4, 5
and 37 of exon 1. Thus, TRBC1*01 has 4N, 5K and 37 in exon 1
thereof, and TRBC2*01 has 4K, 5N and 37Y in exon 1 thereof. The
extent of each of the TCR extracellular domains is somewhat
variable.
[0018] In the present invention, the disulphide bond is introduced
between residues located in the constant domains (or parts thereof)
of the respective chains. The respective chains of the TCR comprise
sufficient of the variable domains thereof to be able to interact
with its pMHC complex. Such interaction can be measured using a
BIAcore 3000.TM. or BIAcore 2000.TM. instrument as described in
Example 3 herein or in WO99/6120 respectively.
[0019] In one embodiment, the respective chains of the sTCR of the
invention also comprise the intra-chain disulphide bonds thereof.
The TCR of the present invention may comprise all of the
extracellular constant Ig region of the respective TCR chains, and
preferably all of the extracellular domain of the respective
chains, i.e. including the membrane proximal region. In native TCR,
there is a disulphide bond linking the conserved membrane proximal
regions of the respective chains. In one embodiment of the present
invention, this disulphide bond is not present. This may be
achieved by mutating the appropriate cysteine residues (amino acid
4, exon 2 of the TRAC*01 gene and amino acid 2 of both the TRBC1*01
and TRBC2*01 genes respectively) to another amino acid, or
truncating the respective chains so that the cysteine residues are
not included. A preferred soluble TCR according to the invention
comprises the native .alpha. and .beta. TCR chains truncated at the
C-terminus such that the cysteine residues which form the native
interchain disulphide bond are excluded, i.e. truncated at the
residue 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 residues N-terminal to the
cysteine residues. It is to be noted however that the native
inter-chain disulphide bond may be present in TCRs of the present
invention, and that, in certain embodiments, only one of the TCR
chains has the native cysteine residue which forms the native
interchain disulphide bond. This cysteine can be used to attach
moieties to the TCR.
[0020] However, the respective TCR chains may be shorter. Because
the constant domains are not directly involved in contacts with the
peptide-MHC ligands, the C-terminal truncation point may be altered
substantially without loss of functionality.
[0021] Alternatively, a larger fragment of the constant domains may
be present than is preferred herein, i.e. the constant domains need
not be truncated just prior to the cysteines forming the interchain
disulphide bond. For instance, the entire constant domain except
the transmembrane domain (i.e. the extracellular and cytoplasmic
domains) could be included. It may be advantageous in this case to
mutate one or more of the cysteine residues forming the interchain
disulphide bond in the cellular TCR to another amino acid residue
which is not involved in disulphide bond formation, or to delete
one or more of these residues.
[0022] The signal peptide may be omitted if the soluble TCR is to
be expressed in prokaryotic cells, for example E. coli, since it
does not serve any purpose in the mature TCR for its ligand binding
ability, and may in some circumstances prevent the formation of a
functional soluble TCR. In most cases, the cleavage site at which
the signal peptide is removed from the mature TCR chains is
predicted but not experimentally determined. Engineering the
expressed TCR chains such that they are a few, i.e. up to about 10
for example, amino acids longer or shorter at the N-terminal end
may have no significance for the functionality (i.e. the ability to
recognise pMHC) of the soluble TCR. Certain additions which are not
present in the original protein sequence could be added. For
example, a short tag sequence which can aid in purification of the
TCR chains could be added, provided that it does not interfere with
the correct structure and folding of the antigen binding site of
the TCR.
[0023] For expression in E. coli, a methionine residue may be
engineered onto the N-terminal starting point of the predicted
mature protein sequence in order to enable initiation of
translation.
[0024] Far from all residues in the variable domains of TCR chains
are essential for antigen specificity and functionality. Thus, a
significant number of mutations can be introduced in this domain
without affecting antigen specificity and functionality. Far from
all residues in the constant domains of TCR chains are essential
for antigen specificity and functionality. Thus, a significant
number of mutations can be introduced in this region without
affecting antigen specificity.
[0025] The TCR .beta. chain contains a cysteine residue which is
unpaired in the cellular or native TCR. It is preferred if this
cysteine residue is removed or mutated to another residue to avoid
incorrect intrachain or interchain pairing. Substitutions of this
cysteine residue for another residue, for example serine or
alanine, can have a significant positive effect on refolding
efficiencies in vitro.
[0026] The disulphide bond may be formed by mutating non-cysteine
residues on the respective chains to cysteine, and causing the bond
to be formed between the mutated residues. Residues whose
respective .beta. carbons are approximately 6 .ANG. (0.6 nm) or
less, and preferably in the range 3.5 .ANG. (0.35 nm) to 5.9 .ANG.
(0.59 nm) apart in the native TCR are preferred, such that a
disulphide bond can be formed between cysteine residues introduced
in place of the native residues. It is preferred if the disulphide
bond is between residues in the constant immunoglobulin region,
although it could be between residues of the membrane proximal
region. Preferred sites where cysteines can be introduced to form
the disulphide bond are the following residues in exon 1 of TRAC*01
for the TCR .alpha. chain and TRBC1*01 or TRBC2*01 for the TCR
.beta. chain:
TABLE-US-00001 Native .beta. carbon TCR .alpha. chain TCR .beta.
chain separation (nm) Thr 48 Ser 57 0.473 Thr 45 Ser 77 0.533 Tyr
10 Ser 17 0.359 Thr 45 Asp 59 0.560 Ser 15 Glu 15 0.59
[0027] One sTCR of the present invention is derived from the A6 Tax
TCR (Garboczi et al, Nature, 1996, 384(6605): 134-141). In one
embodiment, the sTCR comprises the whole of the TCR .alpha. chain
which is N-terminal of exon 2, residue 4 of TRAC*01 (amino acid
residues 1-182 of the .alpha. chain according to the numbering used
in Garboczi et al) and the whole of the TCR .beta. chain which is
N-terminal of exon 2, residue 2 of both TRBC1*01 and TRCB2*01
(amino acid residues 1-210 of the .beta. chain according to the
numbering used in Garboczi et al). In order to form the disulphide
bond, threonine 48 of exon 1 in TRAC*01 (threonine 158 of the
.alpha. chain according to the numbering used in Garboczi et al)
and serine 57 of exon 1 in both TRBC1*01 and TRBC2*01 (serine 172
of the .beta. chain according to the numbering used in Garboczi et
al) may each be mutated to cysteine. These amino acids are located
in .beta. strand D of the constant domain of .alpha. and .beta. TCR
chains respectively.
[0028] It is to be noted that, in FIGS. 3a and 3b, residue 1
(according to the numbering used in Garboczi et al) is K and N
respectively. The N-terminal methionine residue is not present in
native A6 Tax TCR and, as mentioned above, is sometimes present
when the respective chains are produced in bacterial expression
systems.
[0029] Now that the residues in human TCRs which can be mutated
into cysteine residues to form a new interchain disulphide bond
have been identified, those of skill in the art will be able to
mutate any TCR in the same way to produce a soluble form of that
TCR having a new interchain disulphide bond. In humans, the skilled
person merely needs to look for the following motifs in the
respective TCR chains to identify the residue to be mutated (the
shaded residue is the residue for mutation to a cysteine).
TABLE-US-00002 .alpha. Chain Thr 48: ##STR00001## (amino acids
39-58 of exon 1 of the TRAC*01 gene) (SEQ ID NO:1) .alpha. Chain
Thr 45: ##STR00002## (amino acids 36-55 of exon 1 of the TRAC*01
gene) (SEQ ID NO:2) .alpha. Chain Tyr 10: ##STR00003## (amino acids
1-20 of exon 1 of the TRAC*01 gene) (SEQ ID NO:3) .alpha. Chain Ser
15: ##STR00004## (amino acids 6-25 of exon 1 of the TRAC*O1 gene)
(SEQ ID NO:4) .alpha. Chain Ser 57: ##STR00005## (amino acids 48-67
of exon 1 of the TRBC1*01 & TRBC2*01 genes) (SEQ ID NO:5)
.beta. Chain Ser 77: ##STR00006## (amino acids 68-87 of exon 1 of
the TRBC1*01 & TRBC2*01 genes) (SEQ ID NO:6) .beta. Chain Ser
17: ##STR00007## (amino acids 8-27 of exon 1 of the TRBC1*01 &
TRBC2*01 genes) (SEQ ID NO:7) .beta. Chain Asp 59: ##STR00008##
(amino acids 50-69 of exon 1 of the TRBC1*01 & TRBC2*01 genes
gene) (SEQ ID NO:8) .beta. Chain Glu 15: ##STR00009## (amino acids
6-25 of exon 1 of the TRBC1*01 & TRBC2*01 genes) (SEQ ID
NO:9)
[0030] In other species, the TCR chains may not have a region which
has 100% identity to the above motifs. However, those of skill in
the art will be able to use the above motifs to identify the
equivalent part of the TCR .alpha. or .beta. chain and hence the
residue to be mutated to cysteine. Alignment techniques may be used
in this respect. For example, ClustalW, available on the European
Bioinformatics Institute website can be used to compare the motifs
above to a particular TCR chain sequence in order to locate the
relevant part of the TCR sequence for mutation.
[0031] The present invention includes within its scope human
disulphide-linked .alpha..beta. TCRs, as well as disulphide-linked
.alpha..beta. TCRs of other mammals, including, but not limited to,
mouse, rat, pig, goat and sheep. As mentioned above, those of skill
in the art will be able to determine sites equivalent to the
above-described human sites at which cysteine residues can be
introduced to form an inter-chain disulphide bond. For example, the
following shows the amino acid sequences of the mouse C.alpha. and
C.beta. soluble domains, together with motifs showing the murine
residues equivalent to the human residues mentioned above that can
be mutated to cysteines to form a TCR interchain disulphide bond
(where the relevant residues are shaded):
TABLE-US-00003 Mouse C.alpha. soluble domain:
PYIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDS
KSNGAIAWSNQTSFTCQDIFKETNATYPSSDVP (SEQ ID NO: 10) Mouse C.beta.
soluble domain:
EDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGREVHSGVST
DPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQN
ISAEAWGRAD (SEQ ID NO:11) Murine equivalent of human .alpha. Chain
Thr 48: ##STR00010## (SEQ ID NO:12) Murine equivalent of human
.alpha. Chain Thr 45: ##STR00011## (SEQ ID NO:13) Murine equivalent
of human .alpha. Chain Tyr 10: ##STR00012## (SEQ ID NO:14) Murine
equivalent of human .alpha. Chain Ser 15: ##STR00013## (SEQ ID
NO:15) Murine equivalent of human .beta. Chain Ser 57: ##STR00014##
(SEQ ID NO:16) Murine equivalent of human .beta. Chain Ser 77:
##STR00015## (SEQ ID NO:17) Murine equivalent of human .beta. Chain
Ser 17: ##STR00016## (SEQ ID NO:18) Murine equivalent of human
.beta. Chain Asp 59: ##STR00017## (SEQ ID NO:19) Murine equivalent
of human .beta. Chain Glu 15: ##STR00018## (SEQ ID NO:20)
[0032] In a preferred embodiment of the present invention, (i) and
(ii) of the TCR each comprise the functional variable domain of a
first TCR fused to all or part of the constant domain of a second
TCR, the first and second TCRs being from the same species and the
inter-chain disulphide bond being between residues in said
respective all or part of the constant domain not present in native
TCR. In one embodiment, the first and second TCRs are human. In
other words, the disulphide bond-linked constant domains act as a
framework on to which variable domains can be fused. The resulting
TCR will be substantially identical to the native TCR from which
the first TCR is obtained. Such a system allows the easy expression
of any functional variable domain on a stable constant domain
framework.
[0033] The constant domains of the A6 Tax sTCR described above, or
indeed the constant domains of any of the mutant .alpha..beta. TCRs
having a new interchain disulphide bond described above, can be
used as framework onto which heterologous variable domains can be
fused. It is preferred if the fusion protein retains as much of the
conformation of the heterologous variable domains as possible.
Therefore, it is preferred that the heterologous variable domains
are linked to the constant domains at any point between the
introduced cysteine residues and the N terminus of the constant
domain. For the A6 Tax TCR, the introduced cysteine residues on the
.alpha. and .beta. chains are preferably located at threonine 48 of
exon 1 in TRAC*01 (threonine 158 of the .alpha. chain according to
the numbering used in Garboczi et al) and serine 57 of exon 1 in
both TRBC1*01 and TRBC2*01 (serine 172 of the .beta. chain
according to the numbering used in Garboczi et al) respectively.
Therefore it is preferred if the heterologous .alpha. and .beta.
chain variable domain attachment points are between residues 48
(159 according to the numbering used in Garboczi et al) or 58 (173
according to the numbering used in Garboczi et al) and the N
terminus of the .alpha. or .beta. constant domains
respectively.
[0034] The residues in the constant domains of the heterologous
.alpha. and .beta. chains corresponding to the attachment points in
the A6 Tax TCR can be identified by sequence homology. The fusion
protein is preferably constructed to include all of the
heterologous sequence N-terminal to the attachment point.
[0035] As is discussed in more detail below, the sTCR of the
present invention may be derivatised with, or fused to, a moiety at
its C or N terminus. The C terminus is preferred as this is distal
from the binding domain. In one embodiment, one or both of the TCR
chains have a cysteine residue at its C and/or N terminus to which
such a moiety can be fused.
[0036] A soluble TCR (which is preferably human) of the present
invention may be provided in substantially pure form, or as a
purified or isolated preparation. For example, it may be provided
in a form which is substantially free of other proteins.
[0037] A plurality of soluble TCRs of the present invention may be
provided in a multivalent complex. Thus, the present invention
provides, in one aspect, a multivalent T cell receptor (TCR)
complex, which comprises a plurality of soluble T cell receptors as
described herein. Each of the plurality of soluble TCRs is
preferably identical.
[0038] In another aspect, the invention provides a method for
detecting MHC-peptide complexes which method comprises:
[0039] (i) providing a soluble T cell receptor or a multivalent T
cell receptor complex as described herein;
[0040] (ii) contacting the soluble T cell receptor or multivalent
TCR complex with the MHC-peptide complexes; and
[0041] (iii) detecting binding of the soluble T cell receptor or
multivalent TCR complex to the MHC-peptide complexes.
[0042] In the multivalent complex of the present invention, the
TCRs may be in the form of multimers, and/or may be present on or
associated with a lipid bilayer, for example, a liposome.
[0043] In its simplest form, a multivalent TCR complex according to
the invention comprises a multimer of two or three or four or more
T cell receptor molecules associated (e.g. covalently or otherwise
linked) with one another, preferably via a linker molecule.
Suitable linker molecules include, but are not limited to,
multivalent attachment molecules such as avidin, streptavidin,
neutravidin and extravidin, each of which has four binding sites
for biotin. Thus, biotinylated TCR molecules can be formed into
multimers of T cell receptors having a plurality of TCR binding
sites. The number of TCR molecules in the multimer will depend upon
the quantity of TCR in relation to the quantity of linker molecule
used to make the multimers, and also on the presence or absence of
any other biotinylated molecules. Preferred multimers are dimeric,
trimeric or tetrameric TCR complexes.
[0044] Structures which are a good deal larger than TCR tetramers
may be used in tracking or targeting cells expressing specific
MHC-peptide complex. Preferably the structures are in the range 10
nm to 10 .mu.m in diameter. Each structure may display multiple TCR
molecules at a sufficient distance apart to enable two or more TCR
molecules on the structure to bind simultaneously to two or more
MHC-peptide complexes on a cell and thus increase the avidity of
the multimeric binding moiety for the cell.
[0045] Suitable structures for use in the invention include
membrane structures such as liposomes and solid structures which
are preferably particles such as beads, for example latex beads.
Other structures which may be externally coated with T cell
receptor molecules are also suitable. Preferably, the structures
are coated with T cell receptor multimers rather than with
individual T cell receptor molecules.
[0046] In the case of liposomes, the T cell receptor molecules or
multimers thereof may be attached to or otherwise associated with
the membrane. Techniques for this are well known to those skilled
in the art.
[0047] A label or another moiety, such as a toxic or therapeutic
moiety, may be included in a multivalent TCR complex of the present
invention. For example, the label or other moiety may be included
in a mixed molecule multimer. An example of such a multimeric
molecule is a tetramer containing three TCR molecules and one
peroxidase molecule. This could be achieved by mixing the TCR and
the enzyme at a molar ratio of 3:1 to generate tetrameric
complexes, and isolating the desired complex from any complexes not
containing the correct ratio of molecules. These mixed molecules
could contain any combination of molecules, provided that steric
hindrance does not compromise or does not significantly compromise
the desired function of the molecules. The positioning of the
binding sites on the streptavidin molecule is suitable for mixed
tetramers since steric hindrance is not likely to occur.
[0048] Alternative means of biotinylating the TCR may be possible.
For example, chemical biotinylation may be used. Alternative
biotinylation tags may be used, although certain amino acids in the
biotin tag sequence are essential (Schatz, (1993). Biotechnology N
Y 11(10): 1138-43). The mixture used for biotinylation may also be
varied. The enzyme requires Mg-ATP and low ionic strength, although
both of these conditions may be varied e.g. it may be possible to
use a higher ionic strength and a longer reaction time. It may be
possible to use a molecule other than avidin or streptavidin to
form multimers of the TCR. Any molecule which binds biotin in a
multivalent manner would be suitable. Alternatively, an entirely
different linkage could be devised (such as poly-histidine tag to
chelated nickel ion (Quiagen Product Guide 1999, Chapter 3 "Protein
Expression, Purification, Detection and Assay" p. 35-37).
Preferably, the tag is located towards the C-terminus of the
protein so as to minimise the amount of steric hindrance in the
interaction with peptide-MHC complexes.
[0049] One or both of the TCR chains may be labelled with a
detectable label, for example a label which is suitable for
diagnostic purposes. Thus, the invention provides a method for
detecting MHC-peptide complexes which method comprises contacting
the MHC-peptide complexes with a TCR or multimeric TCR complex in
accordance with the invention which is specific for the MHC-peptide
complex; and detecting binding of the TCR or multimeric TCR complex
to the MHC-peptide complex. In tetrameric TCR formed using
biotinylated heterodimers, fluorescent streptavidin (commercially
available) can be used to provide a detectable label. A
fluorescently-labelled tetramer is suitable for use in FACS
analysis, for example to detect antigen presenting cells carrying
the peptide for which the TCR is specific.
[0050] Another manner in which the soluble TCRs of the present
invention may be detected is by the use of TCR-specific antibodies,
in particular monoclonal antibodies. There are many commercially
available anti-TCR antibodies, such as .alpha.F1 and .beta.F1,
which recognise the constant regions of the .alpha. and .beta.
chain, respectively.
[0051] The TCR (or multivalent complex thereof) of the present
invention may alternatively or additionally be associated with
(e.g. covalently or otherwise linked to) a therapeutic agent which
may be, for example, a toxic moiety for use in cell killing, or an
immunostimulating agent such as an interleukin or a cytokine. A
multivalent TCR complex of the present invention may have enhanced
binding capability for a pMHC compared to a non-multimeric T cell
receptor heterodimer. Thus, the multivalent TCR complexes according
to the invention are particularly useful for tracking or targeting
cells presenting particular antigens in vitro or in vivo, and are
also useful as intermediates for the production of further
multivalent TCR complexes having such uses. The TCR or multivalent
TCR complex may therefore be provided in a pharmaceutically
acceptable formulation for use in vivo.
[0052] The invention also provides a method for delivering a
therapeutic agent to a target cell, which method comprises
contacting potential target cells with a TCR or multivalent TCR
complex in accordance with the invention under conditions to allow
attachment of the TCR or multivalent TCR complex to the target
cell, said TCR or multivalent TCR complex being specific for the
MHC-peptide complexes and having the therapeutic agent associated
therewith.
[0053] In particular, the soluble TCR or multivalent TCR complex
can be used to deliver therapeutic agents to the location of cells
presenting a particular antigen. This would be useful in many
situations and, in particular, against tumours. A therapeutic agent
could be delivered such that it would exercise its effect locally
but not only on the cell it binds to. Thus, one particular strategy
envisages anti-tumour molecules linked to T cell receptors or
multivalent TCR complexes specific for tumour antigens.
[0054] Many therapeutic agents could be employed for this use, for
instance radioactive compounds, enzymes (perforin for example) or
chemotherapeutic agents (cis-platin for example). To ensure that
toxic effects are exercised in the desired location the toxin could
be inside a liposome linked to streptavidin so that the compound is
released slowly. This will prevent damaging effects during the
transport in the body and ensure that the toxin has maximum effect
after binding of the TCR to the relevant antigen presenting
cells.
[0055] Other suitable therapeutic agents include: [0056] small
molecule cytotoxic agents, i.e. compounds with the ability to kill
mammalian cells having a molecular weight of less than 700 daltons.
Such compounds could also contain toxic metals capable of having a
cytotoxic effect. Furthermore, it is to be understood that these
small molecule cytotoxic agents also include pro-drugs, i.e.
compounds that decay or are converted under physiological
conditions to release cytotoxic agents. Examples of such agents
include cis-platin, maytansine derivatives, rachelmycin,
calicheamicin, docetaxel, etoposide, gemcitabine, ifosfamide,
irinotecan, melphalan, mitoxantrone, sorfimer sodiumphotofrin II,
temozolmide, topotecan, trimetreate glucuronate, auristatin E
vincristine and doxorubicin; [0057] peptide cytotoxins, i.e.
proteins or fragments thereof with the ability to kill mammalian
cells. Examples include ricin, diphtheria toxin, pseudomonas
bacterial exotoxin A, DNAase and RNAase; [0058] radio-nuclides,
i.e. unstable isotopes of elements which decay with the concurrent
emission of one or more of .alpha. or .beta. particles, or .gamma.
rays. Examples include iodine 131, rhenium 186, indium 111, yttrium
90, bismuth 210 and 213, actinium 225 and astatine 213; [0059]
prodrugs, such as antibody directed enzyme pro-drugs; [0060]
immuno-stimulants, i.e. moieties which stimulate immune response.
Examples include cytokines such as IL-2, chemokines such as IL-8,
platelet factor 4, melanoma growth stimulatory protein, etc,
antibodies or fragments thereof, complement activators, xenogeneic
protein domains, allogeneic protein domains, viral/bacterial
protein domains and viral/bacterial peptides.
[0061] Soluble TCRs or multivalent TCR complexes of the invention
may be linked to an enzyme capable of converting a prodrug to a
drug. This allows the prodrug to be converted to the drug only at
the site where it is required (i.e. targeted by the sTCR).
[0062] Examples of suitable MHC-peptide targets for the TCR
according to the invention include, but are not limited to, viral
epitopes such as HTLV-1 epitopes (e.g. the Tax peptide restricted
by HLA-A2; HTLV-1 is associated with leukaemia), HIV epitopes, EBV
epitopes, CMV epitopes; melanoma epitopes (e.g. MAGE-1 HLA-A1
restricted epitope) and other cancer-specific epitopes (e.g. the
renal cell carcinoma associated antigen G250 restricted by HLA-A2);
and epitopes associated with autoimmune disorders, such as
rheumatoid arthritis. Further disease-associated pMHC targets,
suitable for use in the present invention, are listed in the HLA
Factbook (Barclay (Ed) Academic Press), and many others are being
identified.
[0063] A multitude of disease treatments can potentially be
enhanced by localising the drug through the specificity of soluble
TCRs.
[0064] Viral diseases for which drugs exist, e.g. HIV, SIV, EBV,
CMV, would benefit from the drug being released or activated in the
near vicinity of infected cells. For cancer, the localisation in
the vicinity of tumours or metastasis would enhance the effect of
toxins or immunostimulants. In autoimmune diseases,
immunosuppressive drugs could be released slowly, having more local
effect over a longer time-span while minimally affecting the
overall immuno-capacity of the subject. In the prevention of graft
rejection, the effect of immunosuppressive drugs could be optimised
in the same way. For vaccine delivery, the vaccine antigen could be
localised in the vicinity of antigen presenting cells, thus
enhancing the efficacy of the antigen. The method can also be
applied for imaging purposes.
[0065] The soluble TCRs of the present invention may be used to
modulate T cell activation by binding to specific pMHC and thereby
inhibiting T cell activation. Autoimmune diseases involving T
cell-mediated inflammation and/or tissue damage would be amenable
to this approach, for example type I diabetes. Knowledge of the
specific peptide epitope presented by the relevant pMHC is required
for this use.
[0066] Medicaments in accordance with the invention will usually be
supplied as part of a sterile, pharmaceutical composition which
will normally include a pharmaceutically acceptable carrier. This
pharmaceutical composition may be in any suitable form, (depending
upon the desired method of administering it to a patient). It may
be provided in unit dosage form, will generally be provided in a
sealed container and may be provided as part of a kit. Such a kit
would normally (although not necessarily) include instructions for
use. It may include a plurality of said unit dosage forms.
[0067] The pharmaceutical composition may be adapted for
administration by any appropriate route, for example by the oral
(including buccal or sublingual), rectal, nasal, topical (including
buccal, sublingual or transdermal), vaginal or parenteral
(including subcutaneous, intramuscular, intravenous or intradermal)
route. Such compositions may be prepared by any method known in the
art of pharmacy, for example by admixing the active ingredient with
the carrier(s) or excipient(s) under sterile conditions.
[0068] Pharmaceutical compositions adapted for oral administration
may be presented as discrete units such as capsules or tablets; as
powders or granules; as solutions, syrups or suspensions (in
aqueous or non-aqueous liquids; or as edible foams or whips; or as
emulsions). Suitable excipients for tablets or hard gelatine
capsules include lactose, maize starch or derivatives thereof,
stearic acid or salts thereof. Suitable excipients for use with
soft gelatine capsules include for example vegetable oils, waxes,
fats, semi-solid, or liquid polyols etc.
[0069] For the preparation of solutions and syrups, excipients
which may be used include for example water, polyols and sugars.
For the preparation of suspensions oils (e.g. vegetable oils) may
be used to provide oil-in-water or water in oil suspensions.
[0070] Pharmaceutical compositions adapted for transdermal
administration may be presented as discrete patches intended to
remain in intimate contact with the epidermis of the recipient for
a prolonged period of time. For example, the active ingredient may
be delivered from the patch by iontophoresis as generally described
in Pharmaceutical Research, 3(6):318 (1986). Pharmaceutical
compositions adapted for topical administration may be formulated
as ointments, creams, suspensions, lotions, powders, solutions,
pastes, gels, sprays, aerosols or oils. For infections of the eye
or other external tissues, for example mouth and skin, the
compositions are preferably applied as a topical ointment or cream.
When formulated in an ointment, the active ingredient may be
employed with either a paraffinic or a water-miscible ointment
base. Alternatively, the active ingredient may be formulated in a
cream with an oil-in-water cream base or a water-in-oil base.
Pharmaceutical compositions adapted for topical administration to
the eye include eye drops wherein the active ingredient is
dissolved or suspended in a suitable carrier, especially an aqueous
solvent. Pharmaceutical compositions adapted for topical
administration in the mouth include lozenges, pastilles and mouth
washes.
[0071] Pharmaceutical compositions adapted for rectal
administration may be presented as suppositories or enemas.
Pharmaceutical compositions adapted for nasal administration
wherein the carrier is a solid include a coarse powder having a
particle size for example in the range 20 to 500 microns which is
administered in the manner in which snuff is taken, i.e. by rapid
inhalation through the nasal passage from a container of the powder
held close up to the nose. Suitable compositions wherein the
carrier is a liquid, for administration as a nasal spray or as
nasal drops, include aqueous or oil solutions of the active
ingredient. Pharmaceutical compositions adapted for administration
by inhalation include fine particle dusts or mists which may be
generated by means of various types of metered dose pressurised
aerosols, nebulizers or insufflators. Pharmaceutical compositions
adapted for vaginal administration may be presented as pessaries,
tampons, creams, gels, pastes, foams or spray formulations.
Pharmaceutical compositions adapted for parenteral administration
include aqueous and non-aqueous sterile injection solution which
may contain anti-oxidants, buffers, bacteriostats and solutes which
render the formulation substantially isotonic with the blood of the
intended recipient; and aqueous and non-aqueous sterile suspensions
which may include suspending agents and thickening agents.
Excipients which may be used for injectable solutions include
water, alcohols, polyols, glycerine and vegetable oils, for
example. The compositions may be presented in unit-dose or
multi-dose containers, for example sealed ampoules and vials, and
may be stored in a freeze-dried (lyophilized) condition requiring
only the addition of the sterile liquid carried, for example water
for injections, immediately prior to use. Extemporaneous injection
solutions and suspensions may be prepared from sterile powders,
granules and tablets.
[0072] The pharmaceutical compositions may contain preserving
agents, solubilising agents, stabilising agents, wetting agents,
emulsifiers, sweeteners, colourants, odourants, salts (substances
of the present invention may themselves be provided in the form of
a pharmaceutically acceptable salt), buffers, coating agents or
antioxidants. They may also contain therapeutically active agents
in addition to the substance of the present invention.
[0073] Dosages of the substances of the present invention can vary
between wide limits, depending upon the disease or disorder to be
treated, the age and condition of the individual to be treated,
etc. and a physician will ultimately determine appropriate dosages
to be used. The dosage may be repeated as often as appropriate. If
side effects develop the amount and/or frequency of the dosage can
be reduced, in accordance with normal clinical practice.
[0074] Gene cloning techniques may be used to provide a sTCR of the
invention, preferably in substantially pure form. These techniques
are disclosed, for example, in J. Sambrook et al Molecular Cloning
2nd Edition, Cold Spring Harbor Laboratory Press (1989). Thus, in a
further aspect, the present invention provides a nucleic acid
molecule comprising a sequence encoding a chain of the soluble TCR
of the present invention, or a sequence complementary thereto. Such
nucleic acid sequences may be obtained by isolating TCR-encoding
nucleic acid from T-cell clones and making appropriate mutations
(by insertion, deletion or substitution).
[0075] The nucleic acid molecule may be in isolated or recombinant
form. It may be incorporated into a vector and the vector may be
incorporated into a host cell. Such vectors and suitable hosts form
yet further aspects of the present invention.
[0076] The invention also provides a method for obtaining a TCR
chain, which method comprises incubating such a host cell under
conditions causing expression of the TCR chain and then purifying
the polypeptide.
[0077] The soluble TCRs of the present invention may obtained by
expression in a bacterium such as E. coli as inclusion bodies, and
subsequent refolding in vitro.
[0078] Refolding of the TCR chains may take place in vitro under
suitable refolding conditions. In a particular embodiment, a TCR
with correct conformation is achieved by refolding solubilised TCR
chains in a refolding buffer comprising a solubilising agent, for
example urea. Advantageously, the urea may be present at a
concentration of at least 0.1M or at least 1M or at least 2.5M, or
about 5M. An alternative solubilising agent which may be used is
guanidine, at a concentration of between 0.1M and 8M, preferably at
least 1M or at least 2.5M. Prior to refolding, a reducing agent is
preferably employed to ensure complete reduction of cysteine
residues. Further denaturing agents such as DTT and guanidine may
be used as necessary. Different denaturants and reducing agents may
be used prior to the refolding step (e.g. urea,
.beta.-mercaptoethanol). Alternative redox couples may be used
during refolding, such as a cystamine/cysteamine redox couple, DTT
or .beta.-mercaptoethanol/atmospheric oxygen, and cysteine in
reduced and oxidised forms.
[0079] Folding efficiency may also be increased by the addition of
certain other protein components, for example chaperone proteins,
to the refolding mixture. Improved refolding has been achieved by
passing protein through columns with immobilised mini-chaperones
(Altamirano, et al. (1999). Nature Biotechnology 17: 187-191;
Altamirano, et al. (1997). Proc Natl Acad Sci USA 94(8):
3576-8).
[0080] Alternatively, soluble TCR the present invention may
obtained by expression in a eukaryotic cell system, such as insect
cells.
[0081] Purification of the TCR may be achieved by many different
means. Alternative modes of ion exchange may be employed or other
modes of protein purification may be used such as gel filtration
chromatography or affinity chromatography.
[0082] Soluble TCRs and multivalent TCR complexes of the present
invention also find use in screening for agents, such as small
chemical compounds, which have the ability to inhibit the binding
of the TCR to its pMHC complex. Thus, in a further aspect, the
present invention provides a method for screening for an agent
which inhibits the binding of a T cell receptor to a peptide-MHC
complex, comprising monitoring the binding of a soluble T cell
receptor of the invention with a peptide-MHC complex in the
presence of an agent; and selecting agents which inhibit such
binding.
[0083] Suitable techniques for such a screening method include the
Surface Plasmon Resonance-based method described in WO 01/22084.
Other well-known techniques that could form the basis of this
screening method are Scintillation Proximity Analysis (SPA) and
Amplified Luminescent Proximity Assay.
[0084] Agents selected by screening methods of the invention can be
used as drugs, or as the basis of a drug development programme,
being modified or otherwise improved to have characteristics making
them more suitable for administration as a medicament. Such
medicaments can be used for the treatment of conditions which
include an unwanted T cell response component. Such conditions
include cancer (e.g. renal, ovarian, bowel, head & neck,
testicular, lung, stomach, cervical, bladder, prostate or
melanoma), autoimmune disease, graft rejection and graft versus
host disease.
[0085] Preferred features of each aspect of the invention are as
for each of the other aspects mutatis mutandis. The prior art
documents mentioned herein are incorporated to the fullest extent
permitted by law.
EXAMPLES
[0086] The invention is further described in the following
examples, which do not limit the scope of the invention in any
way.
[0087] Reference is made in the following to the accompanying
drawings in which:
[0088] FIG. 1 is a schematic diagram of a soluble TCR with an
introduced inter-chain di-sulphide bond in accordance with the
invention;
[0089] FIGS. 2a and 2b show respectively the nucleic acid sequences
of the .alpha. (SEQ ID NO:107) and .beta. (SEQ ID NO:108) chains of
a soluble A6 TCR, mutated so as to introduce a cysteine codon. The
shading indicates the introduced cysteine codon;
[0090] FIG. 3a shows the A6 TCR .alpha. chain extracellular amino
acid sequence (SEQ ID NO:128), including the T.sub.48.fwdarw.C
mutation (underlined) used to produce the novel disulphide
inter-chain bond, and FIG. 3b shows the A6 TCR .beta. chain
extracellular amino acid sequence (SEQ ID NO:109), including the
S.sub.57.fwdarw.C mutation (underlined) used to produce the novel
disulphide inter-chain bond;
[0091] FIG. 4 is a trace obtained after anion exchange
chromatography of soluble A6 TCR, showing protein elution from a
POROS 50HQ column using a 0-500 mM NaCl gradient, as indicated by
the dotted line;
[0092] FIG. 5--A. Reducing SDS-PAGE (Coomassie-stained) of
fractions from column run in FIG. 4, as indicated. B. Non-reducing
SDS-PAGE (Coomassie-stained) of fractions from column run in FIG.
4, as indicated. Peak 1 clearly contains mainly non-disulphide
linked .beta.-chain, peak 2 contains TCR heterodimer which is
inter-chain disulphide linked, and the shoulder is due to E. coli
contaminants, mixed in with the inter-chain disulphide linked sTCR,
which are poorly visible on this reproduction;
[0093] FIG. 6 is a trace obtained from size-exclusion
chromatography of pooled fractions from peak 1 in FIG. 5. The
protein elutes as a single major peak, corresponding to the
heterodimer;
[0094] FIG. 7 is a BIAcore response curve of the specific binding
of disulphide-linked A6 soluble TCR to HLA-A2-tax complex. Insert
shows binding response compared to control for a single injection
of disulphide-linked A6 soluble TCR;
[0095] FIG. 8a shows the A6 TCR .alpha. chain sequence (SEQ ID
NO:107) including novel cysteine residue mutated to incorporate a
BamH1 restriction site. Shading indicates the mutations introduced
to form the BamH1 restriction site. FIGS. 8b and 8c show the DNA
sequence of .alpha. (SEQ ID NO:107) and .beta. (SEQ ID NO:112)
chain of the JM22 TCR mutated to include additional cysteine
residues to form a non-native disulphide bond;
[0096] FIGS. 9a and 9b show respectively the JM22 TCR .alpha. (SEQ
ID NO:113) and .beta. (SEQ ID NO:114) chain extracellular amino
acid sequences produced from the DNA sequences of FIGS. 8a and
8b;
[0097] FIG. 10 is a trace obtained after anion exchange
chromatography of soluble disulphide-linked JM22 TCR showing
protein elution from a POROS 50HQ column using a 0-500 mM NaCl
gradient, as indicated by the dotted line;
[0098] FIG. 11a shows a reducing SDS-PAGE (Coomassie-stained) of
fractions from column run in FIG. 10, as indicated and FIG. 11b
shows a non-reducing SDS-PAGE (Coomassie-stained) of fractions from
column run in FIG. 10, as indicated. Peak 1 clearly contains TCR
heterodimer which is inter-chain disulphide linked.
[0099] FIG. 12 is a trace obtained from size-exclusion
chromatography of pooled fractions from peak 1 in FIG. 10. The
protein elutes as a single major peak, corresponding to the
heterodimer. Yield is 80%;
[0100] FIG. 13--A. BIAcore response curve of the specific binding
of disulphide-linked JM22 soluble TCR to HLA-Flu complex. B.
Binding response compared to control for a single injection of
disulphide-linked JM22 soluble TCR;
[0101] FIGS. 14a and 14b show the DNA sequence of .alpha. (SEQ ID
NO:115) and .beta. (SEQ ID NO:116) chain of the NY-ESO mutated to
include additional cysteine residues to form a non-native
disulphide bond;
[0102] FIGS. 15a and 15b show respectively the NY-ESO TCR .alpha.
(SEQ ID NO:117) and .beta. (SEQ ID NO:118) chain extracellular
amino acid sequences produced from the DNA sequences of FIGS. 14a
and 14b
[0103] FIG. 16 is a trace obtained from anion exchange
chromatography of soluble NY-ESO disulphide-linked TCR showing
protein elution from a POROS 50HQ column using a 0-500 mM NaCl
gradient, as indicated by the dotted line;
[0104] FIG. 17--A. Reducing SDS-PAGE (Coomassie-stained) of
fractions from column run in FIG. 16, as indicated. B. Non-reducing
SDS-PAGE (Coomassie-stained) of fractions from column run in FIG.
16, as indicated. Peak 1 and 2 clearly contain TCR heterodimer
which is inter-chain disulphide linked;
[0105] FIG. 18. Size-exclusion chromatography of pooled fractions
from peak 1 (A) and peak 2 (B) in FIG. 17. The protein elutes as a
single major peak, corresponding to the heterodimer;
[0106] FIG. 19 shows a BIAcore response curve of the specific
binding of disulphide-linked NY-ESO soluble TCR to HLA-NYESO
complex. A. peak 1, B. peak 2;
[0107] FIGS. 20a and 20b show respectively the DNA sequences of the
.alpha. (SEQ ID NO:119) and .beta. (SEQ ID NO:120) chains of a
soluble NY-ESO TCR, mutated so as to introduce a novel cysteine
codon (indicated by shading). The sequences include the cysteine
involved in the native disulphide inter-chain bond (indicated by
the codon in bold);
[0108] FIGS. 21a and 21b show respectively the NY-ESO TCR .alpha.
(SEQ ID NO:121) and .beta. (SEQ ID NO:122) chain extracellular
amino acid sequences produced from the DNA sequences of FIGS. 20a
and 21b;
[0109] FIG. 22 shows a trace obtained from anion exchange
chromatography of soluble NY-ESO TCR.alpha..sup.cys.beta..sup.cys
showing protein elution from a POROS 50HQ column using a 0-500 mM
NaCl gradient, as indicated by the dotted line;
[0110] FIG. 23 shows a trace obtained from anion exchange
chromatography of soluble NY-ESO TCR.alpha..sup.cys showing protein
elution from a POROS 50HQ column using a 0-500 mM NaCl gradient, as
indicated by the dotted line;
[0111] FIG. 24 shows a trace obtained from anion exchange
chromatography of soluble NY-ESO TCR.beta..sup.cys showing protein
elution from a POROS 50HQ column using a 0-500 mM NaCl gradient, as
indicated by the dotted line;
[0112] FIG. 25 shows a reducing SDS-PAGE (Coomassie-stained) of
NY-ESO TCR.alpha..sup.cys .beta..sup.cys, TCR.alpha..sup.cys, and
TCR.beta..sup.cys fractions from anion exchange column runs in
FIGS. 22-24 respectively. Lanes 1 and 7 are MW markers, lane 2 is
NYESOdsTCR1g4 .alpha.-cys .beta. peak (EB/084/033); lane 3 is
NYESOdsTCR1g4 .alpha.-cys .beta. small peak (EB/084/033), lane 4 is
NYESOdsTCR1g4 .alpha. .beta.-cys (EB/084/034), lane 5 is
NYESOdsTCR1g4 .alpha.-cys .beta.-cys small peak (EB/084/035), and
lane 6 is NYESOdsTCR1g4 .alpha.-cys .beta.-cys peak
(EB/084/035);
[0113] FIG. 26 shows a non-reducing SDS-PAGE (Coomassie-stained) of
NY-ESO TCR.alpha..sup.cys.beta..sup.cys, TCR.alpha..sup.cys, and
TCR.beta..sup.cys fractions from anion exchange column runs in
FIGS. 22-24 respectively. Lanes 1 and 7 are MW markers, lane 2 is
NYESOdsTCR1g4 .alpha.-cys .beta. peak (EB/084/033); lane 3 is
NYESOdsTCR1g4 .alpha.-cys .beta. small peak (EB/084/033), lane 4 is
NYESOdsTCR1g4 .alpha. .beta.-cys (EB/084/034), lane 5 is
NYESOdsTCR1g4 .alpha.-cys .beta.-cys small peak (EB/084/035), and
lane 6 is NYESOdsTCR1g4 .alpha.-cys .beta.-cys peak
(EB/084/035);
[0114] FIG. 27 is a trace obtained from size exclusion exchange
chromatography of soluble NY-ESO TCR.alpha..sup.cys.beta..sup.cys
showing protein elution of pooled fractions from FIG. 22. The
protein elutes as a single major peak, corresponding to the
heterodimer;
[0115] FIG. 28 is a trace obtained from size exclusion exchange
chromatography of soluble NY-ESO TCR.alpha..sup.cys showing protein
elution of pooled fractions from FIG. 22. The protein elutes as a
single major peak, corresponding to the heterodimer;
[0116] FIG. 29 is a trace obtained from size exclusion exchange
chromatography of soluble NY-ESO TCR.beta..sup.cys showing protein
elution of pooled fractions from FIG. 22. The protein elutes as a
single major peak, corresponding to the heterodimer;
[0117] FIG. 30 is a BIAcore response curve of the specific binding
of NY-ESO TCR.alpha..sup.cys .beta..sup.cys to HLA-NY-ESO
complex;
[0118] FIG. 31 is a BIAcore response curve of the specific binding
of NY-ESO TCR.alpha..sup.cys to HLA-NY-ESO complex;
[0119] FIG. 32 is a BIAcore response curve of the specific binding
of NY-ESO TCR.beta..sup.cys to HLA-NY-ESO complex;
[0120] FIGS. 33a and 33b show respectively the DNA sequences of the
.alpha. (SEQ ID NO:123) and .beta. (SEQ ID NO:124) chains of a
soluble AH-1.23 TCR, mutated so as to introduce a novel cysteine
codon (indicated by shading). The sequences include the cysteine
involved in the native disulphide inter-chain bond (indicated by
the codon in bold);
[0121] FIGS. 34a and 34b show respectively the AH-1.23 TCR .alpha.
(SEQ ID NO:125) and .beta. (SEQ ID NO:126) chain extracellular
amino acid sequences produced from the DNA sequences of FIGS. 33a
and 33b;
[0122] FIG. 35 is a trace obtained from anion exchange
chromatography of soluble AH-1.23 TCR showing protein elution from
a POROS 50HQ column using a 0-500 mM NaCl gradient, as indicated by
the dotted line;
[0123] FIG. 36 is a reducing SDS-PAGE (10% Bis-Tris gel,
Coomassie-stained) of AH-1.23 TCR fractions from anion exchange
column run in FIG. 35. Proteins examined are the anion exchange
fractions of TCR 1.23 S-S from refold 3. Lane 1 is MW markers, lane
2 is B4, lane 3 is C2, lane 4 is C3, lane 5 is C4, lane 6 is C5,
lane 7 is C6, lane 8 is C7, lane 9 is C8, and lane 10 is C9;
[0124] FIG. 37 is a non-reducing SDS-PAGE (10% Bis-Tris gel,
Coomassie-stained) of AH-1.23 TCR fractions from anion exchange
column run in FIG. 35. Proteins examined are the anion exchange
fractions of TCR 1.23 S-S from refold 3. Lane 1 is MW markers, lane
2 is B4, lane 3 is C2, lane 4 is C3, lane 5 is C4, lane 6 is C5,
lane 7 is C6, lane 8 is C7, lane 9 is C8, and lane 10 is C9;
[0125] FIG. 38 is a trace obtained from size exclusion exchange
chromatography of soluble AH-1.23 TCR showing protein elution of
pooled fractions from FIG. 35. The protein elutes as a single major
peak, corresponding to the heterodimer;
[0126] FIGS. 39a and 39b show respectively the DNA (SEQ ID NO:127)
and amino acid (SEQ ID NO:128) sequences of the .alpha. chain of a
soluble A6 TCR, mutated so as to introduce a novel cysteine at
residue 48 in exon 1 of TRAC*01. The shaded nucleotides indicate
the introduced novel cysteine codon and the underlined amino acid
indicates the introduced cysteine;
[0127] FIGS. 40a and 40b show respectively the DNA (SEQ ID NO:129)
and amino acid (SEQ ID NO:130) sequences of the .alpha. chain of a
soluble A6 TCR, mutated so as to introduce a novel cysteine at
residue 45 in exon 1 of TRAC*01. The shaded nucleotides indicate
the introduced novel cysteine codon and the underlined amino acid
indicates the introduced cysteine;
[0128] FIGS. 41a and 41b show respectively the DNA (SEQ ID NO:131)
and amino acid (SEQ ID NO:132) sequences of the .alpha. chain of a
soluble A6 TCR, mutated so as to introduce a novel cysteine at
residue 61 in exon 1 of TRAC*01. The shaded nucleotides indicate
the introduced novel cysteine codon and the underlined amino acid
indicates the introduced cysteine;
[0129] FIGS. 42a and 42b show respectively the DNA (SEQ ID NO:133)
and amino acid (SEQ ID NO:134) sequences of the .alpha. chain of a
soluble A6 TCR, mutated so as to introduce a novel cysteine at
residue 50 in exon 1 of TRAC*01. The shaded nucleotides indicate
the introduced novel cysteine codon and the underlined amino acid
indicates the introduced cysteine;
[0130] FIGS. 43a and 43b show respectively the DNA (SEQ ID NO:135)
and amino acid (SEQ ID NO:136) sequences of the .alpha. chain of a
soluble A6 TCR, mutated so as to introduce a novel cysteine at
residue 10 in exon 1 of TRAC*01. The shaded nucleotides indicate
the introduced novel cysteine codon and the underlined amino acid
indicates the introduced cysteine;
[0131] FIGS. 44a and 44b show respectively the DNA (SEQ ID NO:137)
and amino acid (SEQ ID NO:138) sequences of the .alpha. chain of a
soluble A6 TCR, mutated so as to introduce a novel cysteine at
residue 15 in exon 1 of TRAC*01. The shaded nucleotides indicate
the introduced novel cysteine codon and the underlined amino acid
indicates the introduced cysteine;
[0132] FIGS. 45a and 45b show respectively the DNA (SEQ ID NO:139)
and amino acid (SEQ ID NO:140) sequences of the .alpha. chain of a
soluble A6 TCR, mutated so as to introduce a novel cysteine at
residue 12 in exon 1 of TRAC*01. The shaded nucleotides indicate
the introduced novel cysteine codon and the underlined amino acid
indicates the introduced cysteine;
[0133] FIGS. 46a and 46b show respectively the DNA (SEQ ID NO:141)
and amino acid (SEQ ID NO:142) sequences of the .alpha. chain of a
soluble A6 TCR, mutated so as to introduce a novel cysteine at
residue 22 in exon 1 of TRAC*01. The shaded nucleotides indicate
the introduced novel cysteine codon and the underlined amino acid
indicates the introduced cysteine;
[0134] FIGS. 47a and 47b show respectively the DNA (SEQ ID NO:143)
and amino acid (SEQ ID NO:144) sequences of the .alpha. chain of a
soluble A6 TCR, mutated so as to introduce a novel cysteine at
residue 52 in exon 1 of TRAC*01. The shaded nucleotides indicate
the introduced novel cysteine codon and the underlined amino acid
indicates the introduced cysteine;
[0135] FIGS. 48a and 48b show respectively the DNA (SEQ ID NO:145)
and amino acid (SEQ ID NO:146) sequences of the .alpha. chain of a
soluble A6 TCR, mutated so as to introduce a novel cysteine at
residue 43 in exon 1 of TRAC*01. The shaded nucleotides indicate
the introduced novel cysteine codon and the underlined amino acid
indicates the introduced cysteine;
[0136] FIGS. 49a and 49b show respectively the DNA (SEQ ID NO:147)
and amino acid (SEQ ID NO:148) sequences of the .alpha. chain of a
soluble A6 TCR, mutated so as to introduce a novel cysteine at
residue 57 in exon 1 of TRAC*01. The shaded nucleotides indicate
the introduced novel cysteine codon and the underlined amino acid
indicates the introduced cysteine;
[0137] FIGS. 50a and 50b show respectively the DNA (SEQ ID NO:149)
and amino acid (SEQ ID NO:150) sequences of the .beta. chain of a
soluble A6 TCR, mutated so as to introduce a novel cysteine at
residue 77 in exon 1 of TRBC2*01. The shaded nucleotides indicate
the introduced novel cysteine codon and the underlined amino acid
indicates the introduced cysteine;
[0138] FIGS. 51a and 51b show respectively the DNA (SEQ ID NO:151)
and amino acid (SEQ ID NO:152) sequences of the .beta. chain of a
soluble A6 TCR, mutated so as to introduce a novel cysteine at
residue 17 in exon 1 of TRBC2*01. The shaded nucleotides indicate
the introduced novel cysteine codon and the underlined amino acid
indicates the introduced cysteine;
[0139] FIGS. 52a and 52b show respectively the DNA (SEQ ID NO:153)
and amino acid (SEQ ID NO:154) sequences of the .beta. chain of a
soluble A6 TCR, mutated so as to introduce a novel cysteine at
residue 13 in exon 1 of TRBC2*01. The shaded nucleotides indicate
the introduced novel cysteine codon and the underlined amino acid
indicates the introduced cysteine;
[0140] FIGS. 53a and 53b show respectively the DNA (SEQ ID NO:155)
and amino acid (SEQ ID NO:156) sequences of the .beta. chain of a
soluble A6 TCR, mutated so as to introduce a novel cysteine at
residue 59 in exon 1 of TRBC2*01. The shaded nucleotides indicate
the introduced novel cysteine codon and the underlined amino acid
indicates the introduced cysteine;
[0141] FIGS. 54a and 54b show respectively the DNA (SEQ ID NO:157)
and amino acid (SEQ ID NO:158) sequences of the .beta. chain of a
soluble A6 TCR, mutated so as to introduce a novel cysteine at
residue 79 in exon 1 of TRBC2*01. The shaded nucleotides indicate
the introduced novel cysteine codon and the underlined amino acid
indicates the introduced cysteine;
[0142] FIGS. 55a and 55b show respectively the DNA (SEQ ID NO:159)
and amino acid (SEQ ID NO:160) sequences of the .beta. chain of a
soluble A6 TCR, mutated so as to introduce a novel cysteine at
residue 14 in exon 1 of TRBC2*01. The shaded nucleotides indicate
the introduced novel cysteine codon and the underlined amino acid
indicates the introduced cysteine;
[0143] FIGS. 56a and 56b show respectively the DNA (SEQ ID NO:161)
and amino acid (SEQ ID NO:162) sequences of the .beta. chain of a
soluble A6 TCR, mutated so as to introduce a novel cysteine at
residue 55 in exon 1 of TRBC2*01. The shaded nucleotides indicate
the introduced novel cysteine codon and the underlined amino acid
indicates the introduced cysteine;
[0144] FIGS. 57a and 57b show respectively the DNA (SEQ ID NO:163)
and amino acid (SEQ ID NO:164) sequences of the .beta. chain of a
soluble A6 TCR, mutated so as to introduce a novel cysteine at
residue 63 in exon 1 of TRBC2*01. The shaded nucleotides indicate
the introduced novel cysteine codon and the underlined amino acid
indicates the introduced cysteine;
[0145] FIGS. 58a and 58b show respectively the DNA (SEQ ID NO:165)
and amino acid (SEQ ID NO:166) sequences of the .beta. chain of a
soluble A6 TCR, mutated so as to introduce a novel cysteine at
residue 15 in exon 1 of TRBC2*01. The shaded nucleotides indicate
the introduced novel cysteine codon and the underlined amino acid
indicates the introduced cysteine;
[0146] FIGS. 59-64 are traces obtained from anion exchange
chromatography of soluble A6 TCR containing a novel disulphide
inter-chain bond between: residues 48 of exon 1 of TRAC*01 and 57
of exon 1 of TRBC2*01; residues 45 of exon 1 of TRAC*01 and 77 of
exon 1 of TRBC2*01; residues 10 of exon 1 of TRAC*01 and 17 of exon
1 of TRBC2*01; residues 45 of exon 1 of TRAC*01 and 59 of exon 1 of
TRBC2*01; residues 52 of exon 1 of TRAC*01 and 55 of exon 1 of
TRBC2*01; residues 15 of exon 1 of TRAC*01 and 15 of exon 1 of
TRBC2*01, respectively, showing protein elution from a POROS 50
column using a 0-500 mM NaCl gradient, as indicated by the dotted
line;
[0147] FIGS. 65a and 65b are, respectively, reducing and
non-reducing SDS-PAGE (Coomassie-stained) of soluble A6 TCR
containing a novel disulphide inter-chain bond between residues 48
of exon 1 of TRAC*01 and 57 of exon 1 of TRBC2*01, fractions run
were collected from anion exchange column run in FIG. 59;
[0148] FIGS. 66a and 66b are, respectively, reducing and
non-reducing SDS-PAGE (Coomassie-stained) of soluble A6 TCR
containing a novel disulphide inter-chain bond between residues 45
of exon 1 of TRAC*01 and 77 of exon 1 of TRBC2*01, fractions run
were collected from anion exchange column run in FIG. 60;
[0149] FIGS. 67a and 67b are, respectively, reducing and
non-reducing SDS-PAGE (Coomassie-stained) of soluble A6 TCR
containing a novel disulphide inter-chain bond between residues 10
of exon 1 of TRAC*01 and 17 exon 1 of TRBC2*01, fractions run were
collected from anion exchange column run in FIG. 61;
[0150] FIGS. 68a and 68b are, respectively, reducing and
non-reducing SDS-PAGE (Coomassie-stained) of soluble A6 TCR
containing a novel disulphide inter-chain bond between residues 45
of exon 1 of TRAC*01 and 59 of exon 1 of TRBC2*01, fractions run
were collected from anion exchange column run in FIG. 62;
[0151] FIGS. 69a and 69b are, respectively, reducing and
non-reducing SDS-PAGE (Coomassie-stained) of soluble A6 TCR
containing a novel disulphide inter-chain bond between residues 52
of exon 1 of TRAC*01 and 55 of exon 1 of TRBC2*01, fractions run
were collected from anion exchange column run in FIG. 63;
[0152] FIGS. 70a and 70b are, respectively, reducing and
non-reducing SDS-PAGE (Coomassie-stained) of soluble A6 TCR
containing a novel disulphide inter-chain bond between residues 15
of exon 1 of TRAC*01 and 15 of exon 1 of TRBC2*01, fractions run
were collected from anion exchange column run in FIG. 64;
[0153] FIG. 71 is a trace obtained from size exclusion
chromatography of soluble A6 TCR containing a novel disulphide
inter-chain bond between residues 48 of exon 1 of TRAC*01 and 57 of
exon 1 of TRBC2*01, showing protein elution from a Superdex 200 HL
gel filtration column. Fractions run were collected from anion
exchange column run in FIG. 59;
[0154] FIG. 72 is a trace obtained from size exclusion
chromatography of soluble A6 TCR containing a novel disulphide
inter-chain bond between residues 45 of exon 1 of TRAC*01 and 77 of
exon 1 of TRBC2*01, showing protein elution from a Superdex 200 HL
gel filtration column. Fractions run were collected from anion
exchange column run in FIG. 60;
[0155] FIG. 73 is a trace obtained from size exclusion
chromatography of soluble A6 TCR containing a novel disulphide
inter-chain bond between residues 10 of exon 1 of TRAC*01 and 17 of
exon 1 of TRBC2*01, showing protein elution from a Superdex 200 HL
gel filtration column. Fractions run were collected from anion
exchange column run in FIG. 61;
[0156] FIG. 74 is a trace obtained from size exclusion
chromatography of soluble A6 TCR containing a novel disulphide
inter-chain bond between residues 45 of exon 1 of TRAC*01 and 59 of
exon 1 of TRBC2*01, showing protein elution from a Superdex 200 HL
gel filtration column. Fractions run were collected from anion
exchange column run in FIG. 62;
[0157] FIG. 75 is a trace obtained from size exclusion
chromatography of soluble A6 TCR containing a novel disulphide
inter-chain bond between residues 52 of exon 1 of TRAC*01 and 55 of
exon 1 of TRBC2*01, showing protein elution from a Superdex 200 HL
gel filtration column. Fractions run were collected from anion
exchange column run in FIG. 63;
[0158] FIG. 76 is a trace obtained from size exclusion
chromatography of soluble A6 TCR containing a novel disulphide
inter-chain bond between residues 15 of exon 1 of TRAC*01 and 15 of
exon 1 of TRBC2*01, showing protein elution from a Superdex 200 HL
gel filtration column. Fractions run were collected from anion
exchange column run in FIG. 64; and
[0159] FIGS. 77-80 are BIAcore response curves showing,
respectively, binding of soluble A6 TCR containing a novel
disulphide inter-chain bond between: residues 48 of exon 1 of
TRAC*01 and 57 of exon 1 of TRBC2*01; residues 45 of exon 1 of
TRAC*01 and 77 of exon 1 of TRBC2*01; residues 10 of exon 1 of
TRAC*01 and 17 of exon 1 of TRBC2*01; and residues 45 of exon 1 of
TRAC*01 and 59 of exon 1 of TRBC2*01 to HLA-A2-tax pMHC.
[0160] FIG. 81 is a BIAcore trace showing non-specific binding of
soluble A6 TCR containing a novel disulphide inter-chain bond
between residues 52 of exon 1 of TRAC*01 and 55 of exon 1 of
TRBC2*01 to HLA-A2-tax and to HLA-A2-NY-ESO pMHC;
[0161] FIG. 82 is a BIAcore response curve showing binding of
soluble A6 TCR containing a novel disulphide inter-chain bond
between residues 15 of exon 1 of TRAC*01 and 15 of exon 1 of
TRBC2*01 to HLA-A2-tax pMHC;
[0162] FIG. 83a is an electron density map around the model with
1BD2 sequence (Chain A Thr164, Chain B Ser 174). Map contoured at
1.0, 2.0 and 3.0 .sigma.. FIG. 83b is an electron density map after
refinement with Cys in the two positions A1164 and B174. The map is
contoured at the same .sigma. levels as for FIG. 83a;
[0163] FIG. 84 compares the structures of 1BD2 TCR with an NY-ESO
TCR of the present invention by overlaying said structures in
ribbon and coil representations;
[0164] FIGS. 85a and 85b show the DNA (SEQ ID NO:167) and amino
acid sequences (SEQ ID NO:168) respectively of the .beta. chain of
the NY-ESO TCR incorporating a biotin recognition site. The biotin
recognition site is highlighted;
[0165] FIGS. 86a and 86b show the DNA (SEQ ID NO:169) and amino
acid (SEQ ID NO:170) sequences respectively of the .beta. chain of
the NY-ESO TCR incorporating the hexa-hisitidine tag. The
hexa-hisitidine tag is highlighted;
[0166] FIG. 87 illustrates the elution of soluble NY-ESO TCR
containing a novel disulphide bond and a biotin recognition
sequence from a POROS 50HQ anion exchange column using a 0-500 mM
NaCl gradient, as indicated by the dotted line;
[0167] FIG. 88 illustrates the elution of soluble NY-ESO TCR
containing a novel disulphide bond and a hexa-histidine tag from a
POROS 50HQ anion exchange columns using a 0-500 mM NaCl gradient,
as indicated by the dotted line;
[0168] FIG. 89 is a protein elution profile from gel filtration
chromatography of pooled fractions from the NY-ESO-biotin tagged
anion exchange column run illustrated by FIG. 87;
[0169] FIG. 90 is a protein elution profile from gel filtration
chromatography of pooled fractions from the NY-ESO-hexa-histidine
tagged anion exchange column run illustrated by FIG. 88;
[0170] FIGS. 91a-h are FACS histograms illustrating the staining
intensity produced from 25,000 events for HLA-A2 positive EBV
transformed B cell line (PP LCL) incubated with the following
concentrations of NY-ESO peptide and fluorescent NY-ESO TCR
tetramers respectively: NYESO 0 TCR 5 .mu.g, NYESO 10.sup.-4M TCR 5
.mu.g, NYESO 10.sup.-5M TCR 5 .mu.g, NYESO 10.sup.-6M TCR 5 .mu.g,
NYESO 0 TCR 10 .mu.g, NYESO 10.sup.-4M TCR 10 .mu.g, NYESO
10.sup.-5M TCR 10 .mu.g, NYESO 10.sup.-6M TCR 10 .mu.g;
[0171] FIG. 92 is the DNA sequence (SEQ ID NO:165) of the
beta-chain of A6 TCR incorporating the TRBC1*01 constant
region;
[0172] FIG. 93 is an anion exchange chromatography trace of soluble
A6 TCR incorporating the TRBC1*01 constant region showing protein
elution from a POROS 50HQ column using a 0-500 mM NaCl gradient, as
indicated by the dotted line;
[0173] FIG. 94--A. Reducing SDS-PAGE (Coomassie-stained) of
fractions from column run in FIG. 93, as indicated. B. Non-reducing
SDS-PAGE (Coomassie-stained) of fractions from column run in FIG.
93, as indicated;
[0174] FIG. 95--Size-exclusion chromatography of pooled fractions
from peak 2 in FIG. 93. Peak 1 contains TCR heterodimer which is
inter-chain disulphide linked;
[0175] FIG. 96--A. BIAcore analysis of the specific binding of
disulphide-linked A6 soluble TCR to HLA-Flu complex. B. Binding
response compared to control for a single injection of
disulphide-linked A6 soluble TCR;
[0176] FIG. 97 shows the nucleic acid sequence (SEQ ID NO:165) of
the mutated beta chain of the A6 TCR incorporating the `free`
cysteine;
[0177] FIG. 98--Anion exchange chromatography of soluble A6 TCR
incorporating the `free` cysteine showing protein elution from a
POROS 50HQ column using a 0-500 mM NaCl gradient, as indicated by
the dotted line;
[0178] FIG. 99--A. Reducing SDS-PAGE (Coomassie-stained) of
fractions from column run in FIG. 98, as indicated. B. Non-reducing
SDS-PAGE (Coomassie-stained) of fractions from column run in FIG.
98, as indicated;
[0179] FIG. 100--Size-exclusion chromatography of pooled fractions
from peak 2 in FIG. 98. Peak 1 contains TCR heterodimer which is
inter-chain disulphide linked;
[0180] FIG. 101--A. BIAcore analysis of the specific binding of
disulphide-linked A6 soluble TCR incorporating the `free` cysteine
to HLA-Flu complex. B. Binding response compared to control for a
single injection of disulphide-linked A6 soluble TCR;
[0181] FIG. 102 shows the nucleic acid sequence (SEQ ID NO:173) of
the mutated beta chain of the A6 TCR incorporating a serine residue
mutated in for the `free` cysteine;
[0182] FIG. 103--Anion exchange chromatography of soluble A6 TCR
incorporating a serine residue mutated in for the `free` cysteine
showing protein elution from a POROS 50HQ column using a 0-500 mM
NaCl gradient, as indicated by the dotted line;
[0183] FIG. 104--A. Reducing SDS-PAGE (Coomassie-stained) of
fractions from column run in FIG. 103, as indicated. B.
Non-reducing SDS-PAGE (Coomassie-stained) of fractions from column
run in FIG. 103, as indicated. Peak 2 clearly contains TCR
heterodimer which is inter-chain disulphide linked;
[0184] FIG. 105--Size-exclusion chromatography of pooled fractions
from peak 2 in FIG. 103. Peak 1 contains TCR heterodimer which is
inter-chain disulphide linked;
[0185] FIG. 106--A. BIAcore analysis of the specific binding of
disulphide-linked A6 soluble TCR incorporating a serine residue
mutated in for the `free` cysteine to HLA-Flu complex. B. Binding
response compared to control for a single injection of
disulphide-linked A6 soluble TCR;
[0186] FIG. 107 shows the nucleotide sequence of pYX112 (SEQ ID
NO:174);
[0187] FIG. 108 shows the nucleotide sequence of pYX122 (SEQ ID
NO:175);
[0188] FIG. 109 shows the DNA (SEQ ID NO:177) and protein (SEQ ID
NO:178) sequences of pre-pro mating factor alpha fused to TCR
.alpha. chain;
[0189] FIG. 110 shows the DNA (SEQ ID NO:179) and protein (SEQ ID
NO:178) sequence of pre-pro mating factor alpha fused to TCR .beta.
chain;
[0190] FIG. 111 shows a Western Blot of soluble TCR expressed in S.
cerevisiae strain SEY6210. Lane C contains 60 ng of purified
soluble NY-ESO TCR as a control. Lanes 1 and 2 contain the proteins
harvested from the two separate TCR transformed yeast cultures;
[0191] FIG. 112 shows the nucleic acid sequence (SEQ ID NO:180) of
the KpnI to EcoRI insert of the pEX172 plasmid. The remainder of
the plasmid is pBlueScript II KS-;
[0192] FIG. 113 is a schematic diagram of the TCR chains for
cloning into baculovirus;
[0193] FIG. 114 shows the nucleic acid sequence (SEQ ID NO:181) of
disulphide A6 .alpha. TCR construct as a BamHI insert for insertion
into pAcAB3 expression plasmid;
[0194] FIG. 115 shows the disulphide A6 .beta. TCR construct (SEQ
ID NO:182) as a BamHI for insertion into pAcAB3 expression plasmid;
and
[0195] FIG. 116 shows a Coomassie stained gel and Western Blot
against the bacterially-produced disulphide A6 TCR and the Insect
disulphide A6 TCR.
[0196] In all of the following examples, unless otherwise stated,
the soluble TCR chains produced are truncated immediately
C-terminal to the cysteine residues which form the native
interchain disulphide bond.
Example 1
Design of Primers and Mutagenesis of A6 Tax TCR .alpha. and .beta.
Chains
[0197] For mutating A6 Tax threonine 48 of exon 1 in TRAC*01 to
cysteine, the following primers were designed (mutation shown in
lower case):
TABLE-US-00004 (SEQ ID NO:21) 5'-C ACA GAC AAA tgT GTG CTA GAC AT
(SEQ ID NO:22) 5'-AT GTC TAG CAC Aca TTT GTC TGT G
[0198] For mutating A6 Tax serine 57 of exon 1 in both TRBC1*01 and
TRBC2*01 to cysteine, the following primers were designed (mutation
shown in lower case):
TABLE-US-00005 (SEQ ID NO:23) 5'-C AGT GGG GTC tGC ACA GAC CC (SEQ
ID NO:24) 5'-GG GTC TGT GCa GAC CCC ACT G
PCR Mutagenesis:
[0199] Expression plasmids containing the genes for the A6 Tax TCR
.alpha. or .beta. chain were mutated using the .alpha.-chain
primers or the .beta.-chain primers respectively, as follows. 100
ng of plasmid was mixed with 5 .mu.l 10 mM dNTP, 25 .mu.l
10.times.Pfu-buffer (Stratagene), 10 units Pfu polymerase
(Stratagene) and the final volume was adjusted to 240 .mu.l with
H.sub.2O. 48 .mu.l of this mix was supplemented with primers
diluted to give a final concentration of 0.2 .mu.M in 50 .mu.l
final reaction volume. After an initial denaturation step of 30
seconds at 95.degree. C., the reaction mixture was subjected to 15
rounds of denaturation (95.degree. C., 30 sec.), annealing
(55.degree. C., 60 sec.), and elongation (73.degree. C., 8 min.) in
a Hybaid PCR express PCR machine. The product was then digested for
5 hours at 37.degree. C. with 10 units of DpnI restriction enzyme
(New England Biolabs). 10 .mu.l of the digested reaction was
transformed into competent XL1-Blue bacteria and grown for 18 hours
at 37.degree. C. A single colony was picked and grown over night in
5 ml TYP+ampicillin (16 g/l Bacto-Tryptone, 16 g/l Yeast Extract, 5
g/l NaCl, 2.5 g/l K.sub.2HPO.sub.4, 100 mg/l Ampicillin). Plasmid
DNA was purified on a Qiagen mini-prep column according to the
manufacturer's instructions and the sequence was verified by
automated sequencing at the sequencing facility of Department of
Biochemistry, Oxford University. The respective mutated nucleic
acid and amino acid sequences are shown in FIGS. 2a and 3a for the
.alpha. chain and FIGS. 2b and 3b for the .beta. chain.
Example 2
Expression, Refolding and Purification of Soluble TCR
[0200] The expression plasmids containing the mutated .alpha.-chain
and .beta.-chain respectively were transformed separately into E.
coli strain BL21pLysS, and single ampicillin-resistant colonies
were grown at 37.degree. C. in TYP (ampicillin 100 .mu.g/ml) medium
to OD.sub.600 of 0.4 before inducing protein expression with 0.5 mM
IPTG. Cells were harvested three hours post-induction by
centrifugation for 30 minutes at 4000 rpm in a Beckman J-6B. Cell
pellets were re-suspended in a buffer containing 50 mM Tris-HCl,
25% (w/v) sucrose, 1 mM NaEDTA, 0.1% (w/v) NaAzide, 10 mM DTT, pH
8.0. After an overnight freeze-thaw step, re-suspended cells were
sonicated in 1 minute bursts for a total of around 10 minutes in a
Milsonix XL2020 sonicator using a standard 12 mm diameter probe.
Inclusion body pellets were recovered by centrifugation for 30
minutes at 13000 rpm in a Beckman J2-21 centrifuge. Three detergent
washes were then carried out to remove cell debris and membrane
components. Each time the inclusion body pellet was homogenised in
a Triton buffer (50 mM Tris-HCl, 0.5% Triton-X100, 200 mM NaCI, 10
mM NaEDTA, 0.1% (w/v) NaAzide, 2 mM DTT, pH 8.0) before being
pelleted by centrifugation for 15 minutes at 13000 rpm in a Beckman
J2-21. Detergent and salt was then removed by a similar wash in the
following buffer: 50 mM Tris-HCl, 1 mM NaEDTA, 0.1% (w/v) NaAzide,
2 mM DTT, pH 8.0. Finally, the inclusion bodies were divided into
30 mg aliquots and frozen at -70.degree. C. Inclusion body protein
yield was quantitated by solubilising with 6M guanidine-HCl and
measurement with a Bradford dye-binding assay (PerBio).
[0201] Approximately 30 mg (i.e. 1 .mu.mole) of each solubilised
inclusion body chain was thawed from frozen stocks, samples were
then mixed and the mixture diluted into 15 ml of a guanidine
solution (6 M Guanidine-hydrochloride, 10 mM Sodium Acetate, 10 mM
EDTA), to ensure complete chain de-naturation. The guanidine
solution containing fully reduced and denatured TCR chains was then
injected into 1 litre of the following refolding buffer: 100 mM
Tris pH 8.5, 400 mM L-Arginine, 2 mM EDTA, 5 mM reduced
Glutathione, 0.5 mM oxidised Glutathione, 5M urea, 0.2 mM PMSF. The
solution was left for 24 hrs. The refold was then dialysed twice,
firstly against 10 litres of 100 mM urea, secondly against 10
litres of 100 mM urea, 10 mM Tris pH 8.0. Both refolding and
dialysis steps were carried out at 6-8.degree. C.
[0202] sTCR was separated from degradation products and impurities
by loading the dialysed refold onto a POROS 50HQ anion exchange
column and eluting bound protein with a gradient of 0-500 mM NaCl
over 50 column volumes using an Akta purifier (Pharmacia) as in
FIG. 4. Peak fractions were stored at 4.degree. C. and analysed by
Coomassie-stained SDS-PAGE (FIG. 5) before being pooled and
concentrated. Finally, the sTCR was purified and characterised
using a Superdex 200HR gel filtration column (FIG. 6)
pre-equilibrated in HBS-EP buffer (10 mM HEPES pH 7.4, 150 mM NaCl,
3.5 mM EDTA, 0.05% nonidet p40). The peak eluting at a relative
molecular weight of approximately 50 kDa was pooled and
concentrated prior to characterisation by BIAcore surface plasmon
resonance analysis.
Example 3
BIAcore Surface Plasmon Resonance Characterisation of sTCR Binding
to Specific pMHC
[0203] A surface plasmon resonance biosensor (BIAcore 3000.TM.) was
used to analyse the binding of a sTCR to its peptide-MHC ligand.
This was facilitated by producing single pMHC complexes (described
below) which were immobilised to a streptavidin-coated binding
surface in a semi-oriented fashion, allowing efficient testing of
the binding of a soluble T-cell receptor to up to four different
pMHC (immobilised on separate flow cells) simultaneously. Manual
injection of HLA complex allows the precise level of immobilised
class I molecules to be manipulated easily.
[0204] Such immobilised complexes are capable of binding both
T-cell receptors and the coreceptor CD8.alpha..alpha., both of
which may be injected in the soluble phase. Specific binding of TCR
is obtained even at low concentrations (at least 40 .mu.g/ml),
implying the TCR is relatively stable. The pMHC binding properties
of sTCR are observed to be qualitatively and quantitatively similar
if sTCR is used either in the soluble or immobilised phase. This is
an important control for partial activity of soluble species and
also suggests that biotinylated pMHC complexes are biologically as
active as non-biotinylated complexes.
[0205] Biotinylated class I HLA-A2-peptide complexes were refolded
in vitro from bacterially-expressed inclusion bodies containing the
constituent subunit proteins and synthetic peptide, followed by
purification and in vitro enzymatic biotinylation (O'Callaghan et
al. (1999) Anal. Biochem. 266: 9-15). HLA-heavy chain was expressed
with a C-terminal biotinylation tag which replaces the
transmembrane and cytoplasmic domains of the protein in an
appropriate construct. Inclusion body expression levels of
.about.75 mg/litre bacterial culture were obtained. The HLA
light-chain or .beta.2-microglobulin was also expressed as
inclusion bodies in E. coli from an appropriate construct, at a
level of 500 mg/litre bacterial culture.
[0206] E. coli cells were lysed and inclusion bodies are purified
to approximately 80% purity. Protein from inclusion bodies was
denatured in 6 M guanidine-HCl, 50 mM Tris pH 8.1, 100 mM NaCl, 10
mM DTT, 10 mM EDTA, and was refolded at a concentration of 30
mg/litre heavy chain, 30 mg/litre .beta.2m into 0.4 M
L-Arginine-HCl, 100 mM Tris pH 8.1, 3.7 mM cystamine, mM
cysteamine, 4 mg/ml peptide (e.g. tax 11-19), by addition of a
single pulse of denatured protein into refold buffer at
<5.degree. C. Refolding was allowed to reach completion at
4.degree. C. for at least 1 hour.
[0207] Buffer was exchanged by dialysis in 10 volumes of 10 mM Tris
pH 8.1. Two changes of buffer were necessary to reduce the ionic
strength of the solution sufficiently. The protein solution was
then filtered through a 1.5 .mu.m cellulose acetate filter and
loaded onto a POROS 50HQ anion exchange column (8 ml bed volume).
Protein was eluted with a linear 0-500 mM NaCl gradient.
HLA-A2-peptide complex eluted at approximately 250 mM NaCl, and
peak fractions were collected, a cocktail of protease inhibitors
(Calbiochem) was added and the fractions were chilled on ice.
[0208] Biotinylation tagged HLA complexes were buffer exchanged
into 10 mM Tris pH 8.1, 5 mM NaCl using a Pharmacia fast desalting
column equilibrated in the same buffer. Immediately upon elution,
the protein-containing fractions were chilled on ice and protease
inhibitor cocktail (Calbiochem) was added. Biotinylation reagents
were then added: 1 mM biotin, 5 mM ATP (buffered to pH 8), 7.5 mM
MgCl2, and 5 .mu.g/ml BirA enzyme (purified according to
O'Callaghan et al. (1999) Anal. Biochem. 266: 9-15). The mixture
was then allowed to incubate at room temperature overnight.
[0209] Biotinylated HLA complexes were purified using gel
filtration chromatography. A Pharmacia Superdex 75 HR 10/30 column
was pre-equilibrated with filtered PBS and 1 ml of the
biotinylation reaction mixture was loaded and the column was
developed with PBS at 0.5 ml/min. Biotinylated HLA complexes eluted
as a single peak at approximately 15 ml. Fractions containing
protein were pooled, chilled on ice, and protease inhibitor
cocktail was added. Protein concentration was determined using a
Coomassie-binding assay (PerBio) and aliquots of biotinylated HLA
complexes were stored frozen at -20.degree. C. Streptavidin was
immobilised by standard amine coupling methods.
[0210] The interactions between A6 Tax sTCR containing a novel
inter-chain bond and its ligand/MHC complex or an irrelevant
HLA-peptide combination, the production of which is described
above, were analysed on a BIAcore 3000.TM. surface plasmon
resonance (SPR) biosensor. SPR measures changes in refractive index
expressed in response units (RU) near a sensor surface within a
small flow cell, a principle that can be used to detect receptor
ligand interactions and to analyse their affinity and kinetic
parameters. The probe flow cells were prepared by immobilising the
individual HLA-peptide complexes in separate flow cells via binding
between the biotin cross linked onto .beta.2m and streptavidin
which have been chemically cross linked to the activated surface of
the flow cells. The assay was then performed by passing sTCR over
the surfaces of the different flow cells at a constant flow rate,
measuring the SPR response in doing so. Initially, the specificity
of the interaction was verified by passing sTCR at a constant flow
rate of 5 .mu.l min-1 over two different surfaces; one coated with
.about.5000 RU of specific peptide-HLA complex, the second coated
with .about.5000 RU of non-specific peptide-HLA complex (FIG. 7
insert). Injections of soluble sTCR at constant flow rate and
different concentrations over the peptide-HLA complex were used to
define the background resonance. The values of these control
measurements were subtracted from the values obtained with specific
peptide-HLA complex and used to calculate binding affinities
expressed as the dissociation constant, Kd (Price & Dwek,
Principles and Problems in Physical Chemistry for Biochemists
(2.sup.nd Edition) 1979, Clarendon Press, Oxford), as in FIG.
7.
[0211] The Kd value obtained (1.8 .mu.M) is close to that reported
for the interaction between A6 Tax sTCR without the novel
di-sulphide bond and pMHC (0.91 .mu.M--Ding et al, 1999, Immunity
11:45-56).
Example 4
Production of Soluble JM22 TCR Containing a Novel Disulphide
Bond
[0212] The .beta. chain of the soluble A6 TCR prepared in Example 1
contains in the native sequence a BglII restriction site (AAGCTT)
suitable for use as a ligation site.
[0213] PCR mutagenesis was carried as detailed below to introduce a
BamH1 restriction site (GGATCC) into the .alpha. chain of soluble
A6 TCR, 5' of the novel cysteine codon. The sequence described in
FIG. 2a was used as a template for this mutagenesis. The following
primers were used:
TABLE-US-00006 |BamHI | 5'-ATATCCAGAACCCgGAtCCTGCCGTGTA-3' (SEQ ID
NO:25) 5'-TACACGGCAGGAaTCcGGGTTCTGGATAT-3' (SEQ ID NO:26)
[0214] 100 ng of plasmid was mixed with 5 .mu.l 10 mM dNTP, 25
.mu.l 10.times.Pfu-buffer (Stratagene), 10 units Pfu polymerase
(Stratagene) and the final volume was adjusted to 240 .mu.l with
H.sub.2O. 48 .mu.l of this mix was supplemented with primers
diluted to give a final concentration of 0.2 .mu.M in 50 .mu.l
final reaction volume. After an initial denaturation step of 30
seconds at 95.degree. C., the reaction mixture was subjected to 15
rounds of denaturation (95.degree. C., 30 sec.), annealing
(55.degree. C., 60 sec.), and elongation (73.degree. C., 8 min.) in
a Hybaid PCR express PCR machine. The product was then digested for
5 hours at 37.degree. C. with 10 units of DpnI restriction enzyme
(New England Biolabs). 10 .mu.l of the digested reaction was
transformed into competent XL1-Blue bacteria and grown for 18 hours
at 37.degree. C. A single colony was picked and grown over night in
5 ml TYP+ampicillin (16 g/l Bacto-Tryptone, 16 g/l Yeast Extract, 5
g/l NaCl, 2.5 g/l K.sub.2HPO.sub.4, 100 mg/l Ampicillin). Plasmid
DNA was purified on a Qiagen mini-prep column according to the
manufacturer's instructions and the sequence was verified by
automated sequencing at the sequencing facility of Department of
Biochemistry, Oxford University. The mutations introduced into the
.alpha. chain were "silent", therefore the amino acid sequence of
this chain remained unchanged from that detailed in FIG. 3a. The
DNA sequence for the mutated .alpha. chain is shown in FIG. 8a.
[0215] In order to produce a soluble JM22 TCR incorporating a novel
disulphide bond, A6 TCR plasmids containing the .alpha. chain BamH1
and .beta. chain BglII restriction sites were used as templates.
The following primers were used:
TABLE-US-00007 | Nde1 | 5'-GGAGATATACATATGCAACTACTAGAACAA-3' (SEQ
ID NO:27) 5'-TACACGGCAGGATCCGGGTTCTGGATATT-3' (SEQ ID NO:28) |
BamHI| |Nde1 | 5'-GGAGATATACATATGGTGGATGGTGGAATC-3' (SEQ ID NO:29)
5'-CCCAAGCTTAGTCTGCTCTACCCCAGGCCTCGGC-3' (SEQ ID NO:30) |BglII|
[0216] JM22 TCR .alpha. and .beta.-chain constructs were obtained
by PCR cloning as follows. PCR reactions were performed using the
primers as shown above, and templates containing the JM22 TCR
chains. The PCR products were restriction digested with the
relevant restriction enzymes, and cloned into pGMT7 to obtain
expression plasmids. The sequence of the plasmid inserts were
confirmed by automated DNA sequencing. FIGS. 8b and 8c show the DNA
sequence of the mutated .alpha. and .beta. chains of the JM22 TCR
respectively, and FIGS. 9a and 9b show the resulting amino acid
sequences.
[0217] The respective TCR chains were expressed, co-refolded and
purified as described in Examples 1 and 2. FIG. 10 illustrates the
elution of soluble disulphide-linked JM22 TCR protein elution from
a POROS 50HQ column using a 0-500 mM NaCl gradient, as indicated by
the dotted line. FIG. 11 shows the results of both reducing
SDS-PAGE (Coomassie-stained) and non-reducing SDS-PAGE
(Coomassie-stained) gels of fractions from the column run
illustrated by FIG. 10. Peak 1 clearly contains TCR heterodimer
which is inter-chain disulphide linked. FIG. 12 shows protein
elution from a size-exclusion column of pooled fractions from peak
1 in FIG. 10.
[0218] A BIAcore analysis of the binding of the JM22 TCR to pMHC
was carried out as described in Example 3. FIG. 13a shows BIAcore
analysis of the specific binding of disulphide-linked JM22 soluble
TCR to HLA-Flu complex. FIG. 13b shows the binding response
compared to control for a single injection of disulphide-linked
JM22 soluble TCR. The Kd of this disulphide-linked TCR for the
HLA-flu complex was determined to be 7.9.+-.0.51 .mu.M
Example 5
Production of Soluble NY-ESO TCR Containing a Novel Disulphide
Bond
[0219] cDNA encoding NY-ESO TCR was isolated from T cells supplied
by Enzo Cerundolo (Institute of Molecular Medicine, University of
Oxford) according to known techniques. cDNA encoding NY-ESO TCR was
produced by treatment of the mRNA with reverse transcriptase.
[0220] In order to produce a soluble NY-ESO TCR incorporating a
novel disulphide bond, A6 TCR plasmids containing the .alpha. chain
BamHI and .beta. chain BglII restriction sites were used as
templates as described in Example 4. The following primers were
used:
TABLE-US-00008 | NdeI | 5'-GGAGATATACATATGCAGGAGGTGACACAG-3' (SEQ
ID NO:31) 5'-TACACGGCAGGATCCGGGTTCTGGATATT-3' (SEQ ID NO:32) |
BamHI| |NdeI | 5'-GGAGATATACATATGGGTGTCACTCAGACC-3' (SEQ ID NO:33)
5'-CCCAAGCTTAGTCTGCTCTACCCCAGGCCTCGGC-3' (SEQ ID NO:34) |BglII|
[0221] NY-ESO TCR .alpha. and .beta.-chain constructs were obtained
by PCR cloning as follows. PCR reactions were performed using the
primers as shown above, and templates containing the NY-ESO TCR
chains. The PCR products were restriction digested with the
relevant restriction enzymes, and cloned into pGMT7 to obtain
expression plasmids. The sequence of the plasmid inserts were
confirmed by automated DNA sequencing. FIGS. 14a and 14b show the
DNA sequence of the mutated .alpha. and .beta. chains of the NY-ESO
TCR respectively, and FIGS. 15a and 15b show the resulting amino
acid sequences.
[0222] The respective TCR chains were expressed, co-refolded and
purified as described in Examples 1 and 2, except for the following
alterations in protocol
[0223] Denaturation of soluble TCRs; 30 mg of the solubilised TCR
.beta.-chain inclusion body and 60 mg of the solubilised TCR
.alpha.-chain inclusion body was thawed from frozen stocks. The
inclusion bodies were diluted to a final concentration of 5 mg/ml
in 6M guanidine solution, and DTT (2M stock) was added to a final
concentration of 10 mM. The mixture was incubated at 37.degree. C.
for 30 min.
[0224] Refolding of soluble TCRs: 1 L refolding buffer was stirred
vigorously at 5.degree. C..+-.3.degree. C. The redox couple
(2-mercaptoethylamine and cystamine (to final concentrations of 6.6
mM and 3.7 mM, respectively) were added approximately 5 minutes
before addition of the denatured TCR chains. The protein was then
allowed to refold for approximately 5 hours.+-.15 minutes with
stirring at 5.degree. C..+-.3.degree. C.
[0225] Dialysis of refolded soluble TCRs: The refolded TCR was
dialysed in Spectrapor 1 membrane (Spectrum; Product No. 132670)
against 10 L 10 mM Tris pH 8.1 at 5.degree. C..+-.3.degree. C. for
18-20 hours. After this time, the dialysis buffer was changed to
fresh 10 mM Tris pH 8.1 (10 L) and dialysis was continued at
5.degree. C..+-.3.degree. C. for another 20-22 hours.
[0226] FIG. 16 illustrates the elution of soluble NY-ESO
disulphide-linked TCR protein elution from a POROS 50HQ column
using a 0-500 mM NaCl gradient, as indicated by the dotted line.
FIG. 17 shows the results of both reducing SDS-PAGE
(Coomassie-stained) and non-reducing SDS-PAGE (Coomassie-stained)
gels of fractions from the column run illustrated by FIG. 16. Peaks
1 and 2 clearly contain TCR heterodimer which is inter-chain
disulphide linked. FIG. 18 shows size-exclusion chromatography of
pooled fractions from peak 1 (A) and peak 2 (B) in FIG. 17. The
protein elutes as a single major peak, corresponding to the
heterodimer.
[0227] A BIAcore analysis of the binding of the disulphide-linked
NY-ESO TCR to pMHC was carried out as described in Example 3. FIG.
19 shows BIAcore analysis of the specific binding of
disulphide-linked NY-ESO soluble TCR to HLA-NYESO complex. A. peak
1, B. peak 2.
[0228] The Kd of this disulphide-linked TCR for the HLA-NY-ESO
complex was determined to be 9.4.+-.0.84 .mu.M.
Example 6
Production of Soluble NY-ESO TCR Containing a Novel Disulphide
Inter-Chain Bond, and at Least One of the Two Cysteines Required to
Form the Native Disulphide Inter-Chain Bond
[0229] In order to produce a soluble NY-ESO TCR incorporating a
novel disulphide bond and at least one of the cysteine residues
involved in the native disulphide inter-chain bond, plasmids
containing the .alpha. chain BamHI and .beta. chain BglII
restriction sites were used as a framework as described in Example
4. The following primers were used:
TABLE-US-00009 | NdeI | 5'-GGAGATATACATATGCAGGAGGTGACACAG-3' (SEQ
ID NO:35) 5'-CCCAAGCTTAACAGGAACTTTCTGGGCTGGGGAAGAA-3' (SEQ ID
NO:36) | HindIII| | NdeI | 5'-GGAGATATACATATGGGTGTCACTCAGACC-3'
(SEQ ID NO:37) 5'-CCCAAGCTTAACAGTCTGCTCTACCCCAGGCCTCGGC-3' (SEQ ID
NO:38) |BglII |
[0230] NY-ESO TCR .alpha. and .beta.-chain constructs were obtained
by PCR cloning as follows. PCR reactions were performed using the
primers as shown above, and templates containing the NY-ESO TCR
chains. The PCR products were restriction digested with the
relevant restriction enzymes, and cloned into pGMT7 to obtain
expression plasmids. The sequence of the plasmid inserts were
confirmed by automated DNA sequencing. FIGS. 20a and 20b show the
DNA sequence of the mutated .alpha. and .beta. chains of the NY-ESO
TCR respectively, and FIGS. 21a and 21b show the resulting amino
acid sequences.
[0231] To produce a soluble NY-ESO TCR containing both a non-native
disulphide inter-chain bond and the native disulphide inter-chain
bond, DNA isolated using both of the above primers was used. To
produce soluble NY-ESO TCRs with a non-native disulphide
inter-chain bond and only one of the cysteine residues involved in
the native disulphide inter-chain bond, DNA isolated using one of
the above primers together with the appropriate primer from Example
5 was used.
[0232] The respective TCR chains were expressed, co-refolded and
purified as described in Example 5.
[0233] FIGS. 22-24 illustrate the elution of soluble NY-ESO
TCR.alpha..sup.cys.beta..sup.cys (i.e. with non-native and native
cysteines in both chains), TCR.alpha..sup.cys (with non-native
cysteines in both chains but the native cysteine in the .alpha.
chain only), and TCR.beta..sup.cys (with non-native cysteines in
both chains but the native cysteine in the P chain only) protein
elution from POROS 50HQ anion exchange columns using a 0-500 mM
NaCl gradient, as indicated by the dotted line. FIGS. 25 and 26
respectively show the results of reducing SDS-PAGE
(Coomassie-stained) and non-reducing SDS-PAGE (Coomassie-stained)
gels of fractions from the NY-ESO TCR.alpha..sup.cys.beta..sup.cys,
TCR.alpha..sup.cys, and TCR.beta..sup.cys column runs illustrated
by FIGS. 22-24. These clearly indicate that TCR heterodimers which
are inter-chain disulphide linked have been formed. FIGS. 27-29 are
protein elution profiles from gel filtration chromatography of
pooled fractions from the NY-ESO TCR.alpha..sup.cys.beta..sup.cys,
TCR.alpha..sup.cys, and TCR.beta..sup.cys anion exchange column
runs illustrated by FIGS. 22-24 respectively. The protein elutes as
a single major peak, corresponding to the TCR heterodimer.
A BIAcore analysis of sTCR binding to pMHC was carried out as
described in Example 3. FIGS. 30-32 show BIAcore analysis of the
specific binding of NY-ESO TCR.alpha..sup.cys.beta..sup.cys,
TCR.alpha..sup.cys, and TCR.beta..sup.cys respectively to HLA-NYESO
complex.
[0234] TCR.alpha..sup.cys.beta..sup.cys had a K.sub.d of
18.08.+-.2.075 .mu.M, TCR.alpha..sup.cys had a K.sub.d of
19.24.+-.2.01 .mu.M, and TCR.beta..sup.cys had a K.sub.d of
22.5.+-.4.0692 .mu.M.
Example 7
Production of Soluble AH-1.23 TCR Containing a Novel Disulphide
Inter-Chain Bond
[0235] cDNA encoding AH-1.23 TCR was isolated from T cells supplied
by Hill Gaston (Medical School, Addenbrooke's Hospital, Cambridge)
according to known techniques. cDNA encoding NY-ESO TCR was
produced by treatment of the mRNA with reverse transcriptase.
[0236] In order to produce a soluble AH-1.23 TCR incorporating a
novel disulphide bond, TCR plasmids containing the .alpha. chain
BamHI and .beta. chain BglII restriction sites were used as a
framework as described in Example 4. The following primers were
used:
TABLE-US-00010 | NdeI |
5'-GGGAAGCTTACATATGAAGGAGGTGGAGCAGAATTCTGG-3' (SEQ ID NO:39)
5'-TACACGGCAGGATCCGGGTTCTGGATATT-3' (SEQ ID NO:40) | BamHI| | NdeI
| 5'-TTGGAATTCACATATGGGCGTCATGCAGAACCCAAGACAC-3' (SEQ ID NO:41)
5'-CCCAAGCTTAGTCTGCTCTACCCCAGGCCTCGGC-3' (SEQ ID NO:42) |BglII|
[0237] AH-1.23 TCR .alpha. and .beta.-chain constructs were
obtained by PCR cloning as follows. PCR reactions were performed
using the primers as shown above, and templates containing the
AH-1.23 TCR chains. The PCR products were restriction digested with
the relevant restriction enzymes, and cloned into pGMT7 to obtain
expression plasmids. The sequence of the plasmid inserts were
confirmed by automated DNA sequencing. FIGS. 33a and 33b show the
DNA sequence of the mutated .alpha. and .beta. chains of the
AH-1.23 TCR respectively, and FIGS. 34a and 34b show the resulting
amino acid sequences.
[0238] The respective TCR chains were expressed, co-refolded and
purified as described in Example 5.
[0239] FIG. 35 illustrates the elution of soluble AH-1.23
disulphide-linked TCR protein elution from a POROS 50HQ anion
exchange column using a 0-500 mM NaCl gradient, as indicated by the
dotted line. FIGS. 36 and 37 show the results of reducing SDS-PAGE
(Coomassie-stained) and non-reducing SDS-PAGE (Coomassie-stained)
gels respectively of fractions from the column run illustrated by
FIG. 35. These gels clearly indicate the presence of a TCR
heterodimer which is inter-chain disulphide linked. FIG. 38 is the
elution profile from a Superdex 75 HR gel filtration column of
pooled fractions from the anion exchange column run illustrated in
FIG. 35. The protein elutes as a single major peak, corresponding
to the heterodimer.
Example 8
Production of Soluble A6 TCRs Containing a Novel Disulphide
Inter-Chain Bond at Alternative Positions within the Immunoglobulin
Region of the Constant Domain
[0240] The following experiments were carried out in order to
investigate whether it was possible to form functional soluble TCRs
which include a novel disulphide bond in the TCR immunoglobulin
region at a position other than between threonine 48 of exon 1 in
TRAC*01 and serine 57 of exon 1 in both TRBC1*01/TRBC2*01.
[0241] For the mutating the A6 TCR .alpha.-chain, the following
primers were designed (the numbers in the primer names refer to the
position of the amino acid residue to be mutated in exon 1 of
TRAC*01, mutated residues are shown in lower case):
TABLE-US-00011 T48.fwdarw.C Mutation (SEQ ID NO:43)
5'-CACAGACAAAtgTGTGCTAGACAT-3' (SEQ ID NO:44)
5'-ATGTCTAGCACAcaTTTGTCTGTG-3' Y10.fwdarw.C Mutation (SEQ ID NO:45)
5'-CCCTGCCGTGTgCCAGCTGAGAG-3' (SEQ ID NO:46)
5'-CTCTCAGCTGGcACACGGCAGGG-3' L12.fwdarw.C Mutation (SEQ ID NO:47)
5'-CCGTGTACCAGtgcAGAGACTCTAAATC-3' (SEQ ID NO:48)
5'-GATTTAGAGTCTCTgcaCTGGTACACGG-3' S15.fwdarw.C Mutation (SEQ ID
NO:49) 5'-CAGCTGAGAGACTgTAAATCCAGTGAC-3' (SEQ ID NO:50)
5'-GTCACTGGATTTAcAGTCTCTCAGCTG-3' V22.fwdarw.C Mutation (SEQ ID
NO:51) 5'-CAGTGACAAGTCTtgCTGCCTATTCAC-3' (SEQ ID NO:52)
5'-GTGAATAGGCAGcaAGACTTGTCACTG-3' Y43.fwdarw.C Mutation (SEQ ID
NO:53) 5'-GATTCTGATGTGTgTATCACAGACAAAT-3' (SEQ ID NO:54)
5'-ATTTGTCTGTGATAcACACATCAGAATC-3' T45.fwdarw.C Mutation (SEQ ID
NO:55) 5'-CTGATGTGTATATCtgtGACAAAACTGTGC-3' (SEQ ID NO:56)
5'-GCACAGTTTTGTCacaGATATACACATCAG-3' L50.fwdarw.C Mutation (SEQ ID
NO:57) 5'-AGACAAAACTGTGtgtGACATGAGGTCT-3' (SEQ ID NO:58)
5'-AGACCTCATGTCacaCACAGTTTTGTCT-3' M52.fwdarw.C Mutation (SEQ ID
NO:59) 5'-ACTGTGCTAGACtgtAGGTCTATGGAC-3' (SEQ ID NO:60)
5'-GTCCATAGACCTacaGTCTAGCACAGT-3' S61.fwdarw.C Mutation (SEQ ID
NO:61) 5'-CTTCAAGAGCAACtGTGCTGTGGCC-3' (SEQ ID NO:62)
5'-GGCCACAGCACaGTTGCTCTTGAAG-3'
[0242] For mutating the TCR A6 .beta.-chain, the following primers
were designed (the numbers in the primer names refer to the
position of the amino acid residue to be mutated in exon 1 of
TRBC2*01. Mutated residues are shown in lower case):
TABLE-US-00012 S57.fwdarw.C Mutation (SEQ ID NO:63)
5'-CAGTGGGGTCtGCACAGACCC-3' (SEQ ID NO:64)
5'-GGGTCTGTGCaGACCCCACTG-3' V13.fwdarw.C Mutation (SEQ ID NO:65)
5'-CCGAGGTCGCTtgtTTTGAGCCATCAG-3' (SEQ ID NO:66)
5'-CTGATGGCTCAAAacaAGCGACCTCGG-3' F14.fwdarw.C Mutation (SEQ ID
NO:67) 5'-GGTCGCTGTGtgtGAGCCATCAGA-3' (SEQ ID NO:68)
5'-TCTGATGGCTCacaCACAGCGACC-3' S17.fwdarw.C Mutation (SEQ ID NO:69)
5'-GTGTTTGAGCCATgtGAAGCAGAGATC-3' (SEQ ID NO:70)
5'-GATCTCTGCTTCacATGGCTCAAACAC-3' G55.fwdarw.C Mutation (SEQ ID
NO:71) 5'-GAGGTGCACAGTtGtGTCAGCACAGAC-3' (SEQ ID NO:72)
5'-GTCTGTGCTGACaCaACTGTGCACCTC-3' D59.fwdarw.C Mutation (SEQ ID
NO:73) 5'-GGGTCAGCACAtgCCCGCAGCCC-3' (SEQ ID NO:74)
5'-GGGCTGCGGGcaTGTGCTGACCC-3' L63.fwdarw.C Mutation (SEQ ID NO:75)
5'-CCCGCAGCCCtgCAAGGAGCAGC-3' (SEQ ID NO:76)
5'-GCTGCTCCTTGCaGGGCTGCGGG-3' S77.fwdarw.C Mutation (SEQ ID NO:77)
5'-AGATACGCTCTGtGCAGCCGCCT-3' (SEQ ID NO:78)
5'-AGGCGGCTGCaCAGAGCGTATCT-3' R79.fwdarw.C Mutation (SEQ ID NO:79)
5'-CTCTGAGCAGCtGCCTGAGGGTC-3' (SEQ ID NO:80)
5'-GACCCTCAGGCaGCTGCTCAGAG-3' E15.fwdarw.C Mutation (SEQ ID NO:81)
5'-GCTGTGTTTtgtCCATCAGAA-3' (SEQ ID NO:82)
5'-TTCTGATGGacaAAACACAGC-3'
[0243] PCR mutagenesis, .alpha. and .beta. TCR construct
amplification, ligation and plasmid purification was carried out as
described in Example 1 using the appropriate combination of the
above primers in order to produce soluble TCRs including novel
disulphide inter-chain bonds between the following pairs of amino
acids:
TABLE-US-00013 TCR .alpha. chain TCR .beta. chain .alpha. Primer
used .beta. Primer used Thr 48 Ser 57 T48.fwdarw.C S57.fwdarw.C Thr
45 Ser 77 T45.fwdarw.C S77.fwdarw.C Ser 61 Ser 57 S61.fwdarw.C
S57.fwdarw.C Leu 50 Ser 57 L50.fwdarw.C S57.fwdarw.C Tyr 10 Ser 17
Y10.fwdarw.C S17.fwdarw.C Ser 15 Val 13 S15.fwdarw.C V13.fwdarw.C
Thr 45 Asp 59 T45.fwdarw.C D59.fwdarw.C Leu 12 Ser 17 L12.fwdarw.C
S17.fwdarw.C Ser 61 Arg 79 S61.fwdarw.C R79.fwdarw.C Leu 12 Phe 14
L12.fwdarw.C F14.fwdarw.C Val 22 Phe 14 V22.fwdarw.C F14.fwdarw.C
Met 52 Gly 55 M52.fwdarw.C G55.fwdarw.C Tyr 43 Leu 63 Y43.fwdarw.C
L63.fwdarw.C Ser 15 Glu 15 S15.fwdarw.C E15.fwdarw.C
[0244] FIGS. 39 to 58 show the DNA and amino acid sequences of the
mutated A6 TCR chains amplified by the above primers. The codons
encoding the mutated cysteines are highlighted.
[0245] The respective TCR chains were expressed, co-refolded and
purified as described in Example 5. Following purification on POROS
50HQ anion exchange column, the resulting proteins were run on
SDS-Page gels in order to assess whether any correctly-refolded
soluble TCR had been formed. These gels were also assessed to
ascertain the presence or absence of any disulphide-linked protein
of the correct molecular weight in the purified material. TCRs
under investigation containing the following novel disulphide
inter-chain bonds failed to produce disulphide-linked protein of
the correct molecular weight using this bacterial expression system
and these were not further assessed. However, alternative
prokaryotic or eukaryotic expression systems are available.
TABLE-US-00014 TCR .alpha. chain TCR .beta. chain Ser 61 Ser 57 Leu
50 Ser 57 Ser 15 Val 13 Leu 12 Ser 17 Ser 61 Arg 79 Leu 12 Phe 14
Val 22 Phe 14 Tyr 43 Leu 63
[0246] FIGS. 59 to 64 respectively illustrate the elution of
soluble TCRs containing novel disulphide interchain bonds between
the following residues: Thr 48-Ser 57, Thr 45-Ser 77, Tyr 10-Ser
17, Thr 45-Asp 59, Met 52-Gly 55 and Ser 15-Glu 15 from a POROS
200HQ anion exchange column using a 0-500 mM NaCl gradient, as
indicated by the dotted line. FIGS. 65 to 70 show the results of
reducing SDS-PAGE (Coomassie-stained) and non-reducing SDS-PAGE
(Coomassie-stained) gels respectively of fractions from the column
runs illustrated by FIGS. 59 to 64. These gels clearly indicate the
presence of TCR heterodimers that are inter-chain disulphide
linked.
[0247] FIGS. 71 to 76 are elution profiles from a Superdex 200 HR
gel filtration column of pooled fractions from the anion exchange
column runs illustrated in FIGS. 59 to 64. A BIAcore analysis of
the binding of the TCRs to pMHC was carried out as described in
Example 3. FIGS. 77-82 are BIAcore traces demonstrating the ability
of the purified soluble TCRs to bind to HLA-A2 tax pMHC
complexes.
[0248] Thr 48-Ser 57 had a K.sub.d of 7.8 .mu.M, Thr 45-Ser 77 had
a K.sub.d of 12.7 .mu.M, Tyr 10-Ser 17 had a K.sub.d of 34 .mu.M,
Thr 45-Asp 59 had a K.sub.d of 14.9 .mu.M, and Ser 15-Glu 15 had a
K.sub.d of 6.3 .mu.M Met 52-Gly 55 was capable of binding to its
native "target", the HLA-A2 tax complex, although it also bound in
a similar manner to an "irrelevant" target, the HLA-A2-NY-ESO
complex (see FIG. 81)
Example 9
X-ray Crystallography of the Disulphide-Linked NY-ESO T Cell
Receptor, Specific for the NY-ESO-HLA-A2 Complex
[0249] The NY-ESO dsTCR was cloned as described in Example 5, and
expressed as follows.
[0250] The expression plasmids containing the mutated .alpha.-chain
and .beta.-chain respectively were transformed separately into E.
coli strain BL21 pLysS, and single ampicillin-resistant colonies
were grown at 37.degree. C. in TYP (ampicillin 100 .mu.g/ml) medium
to OD.sub.600 of 0.7 before inducing protein expression with 0.5 mM
IPTG. Cells were harvested 18 hours post-induction by
centrifugation for 30 minutes at 4000 rpm in a Beckman J-6B. Cell
pellets were resuspended in lysis buffer containing 10 mM Tris-HCI
pH 8.1, 10 mM MgCl.sub.2, 150 mM NaCl, 2 mM DTT, 10% glycerol. For
every 1 L of bacterial culture 100 .mu.l of lysozyme (20 mg/ml) and
100 .mu.l of Dnase I (20 .mu.g/ml) were added. After incubation on
ice for 30 minutes, the bacterial suspension was sonicated in 1
minute bursts for a total of 10 minutes using a Milsonix XL2020
sonicator with a standard 12 mm diameter probe. Inclusion body
pellets were recovered by centrifugation for 30 minutes at 13000
rpm in a Beckman J2-21 centrifuge (4.degree. C.). Three washes were
then carried out in Triton wash buffer (50 mM Tris-HCI pH 8.1, 0.5%
Triton-X100, 100 mM NaCl, 10 mM NaEDTA, 0.1% (w/v), 2 mM DTT) to
remove cell debris and membrane components. Each time, the
inclusion body pellet was homogenised in Triton wash buffer before
being pelleted by centrifugation for 15 minutes at 13000 rpm in a
Beckman J2-21. Detergent and salt was then removed by a similar
wash in Resuspension buffer (50 mM Tris-HCl pH 8.1 100 mM NaCl, 10
mM NaEDTA, 0.1% (w/v) NaAzide, 2 mM DTT). Finally, the inclusion
bodies were solubilised in 6 M guanidine buffer (6 M
Guanidine-hydrochloride, 50 mM Tris pH 8.1, 100 mM NaCl, 10 mM
EDTA, 10 mM DTT), divided into 120 mg aliquots and frozen at
-70.degree. C. Inclusion bodies were quantitated by solubilising
with 6M guanidine-HCl and measurement with a Bradford dye-binding
assay (PerBio).
[0251] Approximately 60 mg (i.e. 2.4 .mu.mole) of frozen
solubilised alpha chain was mixed with 30 mg (i.e. 1.2 .mu.mole) of
frozen solubilised beta chain. The TCR mixture was diluted to a
final volume of 18 ml with 6 M guanidine buffer and heated to
37.degree. C. for 30 min to ensure complete chain denaturation. The
guanidine solution containing fully reduced and denatured TCR
chains was then mixed into 1 litre of cold refolding buffer (100 mM
Tris pH 8.1, 400 mM L-Arginine-HCl, 2 mM EDTA, 6.6 mM
2-mercapthoethylamine, 3.7 mM Cystamine, 5M urea) with stirring.
The solution was left for 5 hrs in the cold room (5.degree.
C..+-.3.degree. C.) to allow refolding to take place. The refold
was then dialysed against 12 litres of water for 18-20 hours,
followed by 12 litres of 10 mM Tris pH 8.1 for 18-20 hours
(5.degree. C..+-.3.degree. C.). Spectrapor 1 (Spectrum Laboratories
product no. 132670) dialysis membrane that has a molecular weight
cut off of 6-8000 kDa was used for this dialysis process. The
dialysed protein was filtered through 0.45 .mu.m pore size filters
(Schleicher and Schuell, Ref. number, 10 404012) fitted to a
Nalgene filtration unit.
[0252] The refolded NY-ESO TCR was separated from degradation
products and impurities by loading the dialysed refold onto a POROS
50HQ (Applied Biosystems) anion exchange column using an AKTA
purifier (Amersham Biotech). A POROS 50 HQ column was
pre-equilibrated with 10 column volumes of buffer A (10 mM Tris pH
8.1) prior to loading with protein. The bound protein was eluted
with a gradient of 0-500 mM NaCI over 7 column volumes. Peak
fractions (1 ml) were analysed on denaturing SDS-PAGE using
reducing and non-reducing sample buffer. Peak fractions containing
the heterodimeric alpha-beta complex were further purified using a
Superdex 75HR gel filtration column pre-equilibrated in 25 mM MES
pH 6.5. The protein peak eluting at a relative molecular weight of
approximately 50 kDa was pooled, concentrated to 42 mg/ml in
Ultrafree centrifugal concentrators (Millipore, part number
UFV2BGC40) and stored at -80.degree. C.
[0253] Crystallisation of NY-ESO TCR was performed by hanging drop
technique at 18.degree. C. using 1 .mu.l of protein solution (8.4
mg/ml) in 5 mM Mes pH 6.5 mixed with an equivalent volume of
crystallisation buffer. Crystals appeared under several different
conditions using Crystal Screen buffers (Hampton Research). Single
cubic crystals (<100 .mu.m) were grown in 30% PEG 4000, 0.1 M Na
Citrate pH 5.6, 0.2 M ammonium acetate buffer and used for
structure determination.
[0254] Crystals of the NY-ESO TCR were flash-frozen and tested for
diffraction in the X-ray beam of the Daresbury synchrotron. The
crystals diffracted to 0.25 nm (2.5 .ANG.) resolution. One data set
was collected and processed to give a 98.6% complete set of
amplitudes that were reasonable to around 0.27 nm (2.7 .ANG.), but
usable up to 0.25 nm (2.5 .ANG.). The merging R-factor, i.e. the
agreement between multiple measurements of crystallographically
equivalent reflections, was 10.8% for all the data. This is
marginal at the highest resolution shell. The space group was
P2.sub.1, with cell dimensions a=4.25 nm (42.5 .ANG.), b=5.95 nm
(59.5 .ANG.), c=8.17 nm (81.7 .ANG.), .beta.=91.5.degree.. The cell
dimensions and symmetry meant there were two copies in the cell.
The asymmetric unit, au or the minimum volume that needs to be
studied, has only 1 molecule, and the other molecule in the cell is
generated by the 2.sub.1 symmetry operation. The positioning of the
molecule in the au is arbitrary in the y-direction. As long as it
is in the correct position in the x-z plane, it can be translated
at will in the y-direction. This is referred to as a free
parameter, in this `polar` space group.
[0255] The PDB data base has only one entry containing an A/B
heterodimeric TCR, 1BD2. This entry also has co-ordinates of the
HLA-cognate peptide in complex with the TCR. The TCR chain B was
the same in NY-ESO, but chain A had small differences in the
C-domain and significant differences in the N-domain. Using the
1BD2 A/B model for molecular replacement, MR, gave an incorrect
solution, as shown by extensive overlap with symmetry equivalent
molecules. Using the B chain alone gave a better solution, which
did not have significant clashes with neighbours. The correlation
coefficient was 49%, the crystallographic R-factor 50%, and the
nearest approach (centre-of-gravity to c-o-g) was 0.49 nm (49
.ANG.). The rotation and translation operation needed to transform
the starting chain B model to the MR equivalent, was applied to
chain A. The hybrid MR solution thus generated, packed well in the
cell, with minimal clashes.
[0256] Electron density maps generally agreed with the model, and
allowed its adjustment to match the sequence of the NY-ESO TCR. But
the starting model had many gaps, specifically missing side-chains,
that are characteristic of poorly ordered portions of the model.
Many of the hair-pin loops in between strands had very low density,
and were difficult to model. The crystallographic R-factor of the
model is 30%. The R-factor is a residual, i.e. it is the difference
between the calculated and observed amplitudes.
[0257] As FIGS. 83a and 83b demonstrate, the input sequence from
1BD2 do not match up with the density very well. Changing the model
for Cys at positions 164 in chain A, and 174 in chain B, followed
by further refinement, showed clearly that this sequence assignment
is much better fitted to the density. But the differences in terms
of size of the side chain are minimal, so there was little
perturbation in the model. The electron density in that region is
little changed.
[0258] The most important aspect of this work is that the new TCR
is very similar in structure to the published model (1BD2). The
comparison could include all of the TCR, the constant domains, or
the small part near the mutation point.
[0259] The r.m.s deviation values are listed in the table below.
The comparison of structures is shown in FIG. 84.
TABLE-US-00015 Chain A Chain B Chain A Chain B Short Complete
Complete Constant Constant Stretch r.m.s 2.831 1.285 1.658 1.098
0.613 Displacement Mean 2.178 1.001 1.235 0.833 0.546 Displacement
Max 9.885 6.209 6.830 4.490 1.330 Displacement (All units are in
.ANG.)
[0260] The short stretch refers to the single strand from Chain A
(A157 to A169) and the single strand from Chain B (B170 to B183)
that are now joined by the disulphide bridge. The deviations were
calculated for only the main chain atoms.
[0261] These results show that the introduction of the disulphide
bond has minimal effect on the local structure of the TCR around
the bond. Some larger effects are observed when comparing the TCR
to the published structure (1BD2) of the A6 TCR, but the increase
in RMS displacement is largely due to differences in loop
conformations (see FIG. 84). These loops do not form part of the
core structure of the TCR, which is formed by a series of
.beta.-sheets which form a characteristic Ig fold. The RMS
deviation for the whole .alpha.-chain is particularly large because
of the difference in the sequence of the variable domains between
the A6 (1BD2) and the NY-ESO TCRs. However, the A6 and NY-ESO TCRs
have the same variable .beta.-domain and the RMS deviations for the
whole .beta.-chain show that the structure of this variable domain
is also maintained in the TCR with the new disulphide bond. These
data therefore indicate that the core structure of the TCR is
maintained in the crystal structure of the TCR with the new
disulphide bond.
Example 10
Production of Soluble NY-ESO TCRs Containing a Novel Disulphide
Inter-Chain Bond, and C-Terminal, Chain Tagging Sites
[0262] In order to produce a soluble NY-ESO TCR incorporating a
novel disulphide bond, A6 TCR plasmids containing the .alpha. chain
BamHI and .beta. chain BglII restriction sites were used as
frameworks as described in Example 4.
[0263] NY-ESO TCR .beta.-chain constructs were obtained by PCR
cloning as follows. PCR reactions were performed using the primers
as shown below, and templates containing the NY-ESO TCR chains.
TABLE-US-00016 | NdeI | Fwd5'-GGAGATATACATATGGGTGTCACTCAGAAC-3'
(SEQ ID NO:83) Rev5'-CCACCGGATCCGTCTGCTCTACCCCAGGC-3' | BamHI|
(nucleotides 1-29 of SEQ ID NO:84)
[0264] The PCR products were restriction digested with the relevant
restriction enzymes, and cloned into pGMT7 containing the biotin
recognition sequence to obtain expression plasmids. The sequence of
the plasmid inserts were confirmed by automated DNA sequencing.
FIG. 85a shows the DNA sequence of the .beta. chain of the NY-ESO
TCR incorporating the biotin recognition site, and FIG. 85b shows
the resulting amino acid sequence.
[0265] The .alpha. chain construct was produced as described in
Example 5. The respective TCR chains were expressed, co-refolded
and purified as described in Example 5.
[0266] In order to produce a soluble NY-ESO TCR containing a
non-native disulphide inter-chain bond and a hexa-histidine tag on
the C-terminus of the .beta. chain, the same primers and NY-ESO
template were used as above. The PCR products were restriction
digested with the relevant restriction enzymes, and cloned into
pGMT7 containing the hexa-histidine sequence to obtain expression
plasmids. FIG. 86a shows the DNA sequence of the .beta. chain of
the NY-ESO TCR incorporating the hexa-histidine tag, and FIG. 86b
shows the resulting amino acid sequence.
[0267] FIG. 87 illustrates the elution of soluble NY-ESO TCR
containing a novel disulphide bond and the biotin recognition
sequence from a POROS 50HQ anion exchange column using a 0-500 mM
NaCl gradient, as indicated by the dotted line. FIG. 88 illustrates
the elution of soluble NY-ESO TCR containing a novel disulphide
bond and the hexa-histidine tag from a POROS 50HQ anion exchange
columns using a 0-500 mM NaCl gradient, as indicated by the dotted
line.
[0268] FIGS. 89 and 90 are protein elution profiles from gel
filtration chromatography of pooled fractions from the
NY-ESO-biotin and NY-ESO-hexa-histidine tagged anion exchange
column runs illustrated by FIGS. 87 and 88 respectively. The
protein elutes as a single major peak, corresponding to the TCR
heterodimer.
[0269] A BIAcore analysis of sTCR binding to pMHC was carried out
as described in Example 3. The NY-ESO-biotin TCR had a Kd of 7.5
.mu.M, The NY-ESO-hexa-histidine tagged TCR had a Kd of 9.6
.mu.M
Example 11
Cell Staining Using Fluorescent Labelled Tetramers of Soluble
NY-ESO TCR Containing a Novel Disulphide Inter-Chain Bond
TCR Tetramer Preparation
[0270] The NY-ESO soluble TCRs containing a novel disulphide bond
and a biotin recognition sequence prepared as in Example 10 were
utilised to form the soluble TCR tetramers using required for cell
staining. 2.5 ml of purified soluble TCR solution (.about.0.2
mg/ml) was buffer exchanged into biotinylation reaction buffer (50
mM Tris pH 8.0, 10 mM MgCl.sub.2) using a PD-10 column (Pharmacia).
The eluate (3.5 ml) was concentrated to 1 ml using a centricon
concentrator (Amicon) with a 10 kDa molecular weight cut-off. This
was made up to 10 mM with ATP added from stock (0.1 g/ml adjusted
to pH 7.0). A volume of a cocktail of protease inhibitors was then
added (protease inhibitor cocktail Set 1, Calbiochem Biochemicals),
sufficient to give a final protease cocktail concentration of
1/100.sup.th of the stock solution as supplied, followed by 1 mM
biotin (added from 0.2M stock) and 20 .mu.g/ml enzyme (from 0.5
mg/ml stock). The mixture was then incubated overnight at room
temperature. Excess biotin was removed from the solution by size
exclusion chromatography on a S75 HR column. The level of
biotinylation present on the NY-ESO TCR was determined via a size
exclusion HPLC-based method as follows. A 50 ul aliquot of the
biotinylated NY-ESO TCR (2 mg/ml) was incubated with 50 ul of
streptavidin coated agarose beads (Sigma) for 1 hour. The beads
were then spun down, and 50 .mu.l of the unbound sample was run on
a TSK 2000 SW column (Tosoohaas) using a 0.5 ml/min flowrate (200
mM Phosphate Buffer pH 7.0) over 30 minutes. The presence of the
biotinylated NY-ESO TCR was detected by a UV spectrometer at both
214 nm and 280 nm. The biotinylated NY-ESO was run against a
non-bioninylated NY-ESO TCR control. The percentage of
biotinylation was calculated by subtracting the peak-area of the
biotinylated protein from that of the non-biotinylated protein.
[0271] Tetramerisation of the biotinylated soluble TCR was achieved
using neutravidin-phycoerythrin conjugate (Cambridge Biosciences,
UK). The concentration of biotinylated soluble TCR was measured
using a Coomassie protein assay (Pierce), and a ratio of soluble
TCR 0.8 mg/mg neutravidin-phycoerthrin conjugate was calculated to
achieve saturation of the neutravidin-PE by biotinylated TCR at a
ratio of 1:4. 19.5 .mu.l of a 6.15 mg/ml biotinylated NY-ESO
soluble TCR solution in phosphate buffered saline (PBS) was added
slowly to 150 .mu.l of a 1 mg/ml neutravidin-PE soluble over ice
with gentle agitation. 100.5 .mu.l of PBS was then added to this
solution to provide a final NY-ESO TCR tetramer concentration of 1
mg/ml.
Staining Protocol
[0272] Four aliquots of 0.3.times.10.sup.6 HLA-A2 positive EBV
transformed B cell line (PP LCL) in 0.5 ml of PBS were incubated
with varying concentrations (0, 10.sup.-4, 10.sup.-5 and 10.sup.-6
M) of HLA-A2 NYESO peptide (SLLMWITQC) (SEQ ID NO:106) for 2 h at
37.degree. C. These PP LCL cells were then washed twice in Hanks
buffered Saline solution (HBSS) (Gibco, UK).
[0273] Each of the four aliquots were divided equally and stained
with biotinylated NY-ESO disulphide linked TCR freshly tetramerised
with neutravidin-phycoerythrin. Cells were incubated with either 5
or 10 .mu.g of phycoerythrin labelled tetrameric dsTCR complexes on
ice for 30 minutes and washed with HBSS. Cells were washed again,
re-suspended in HBSS and analysed by FACSVantage. 25,000 events
were collected and data analysed using WinMIDI software.
Results
[0274] FIGS. 91a-h illustrate as histograms the FACSVantage data
generated for each of the samples prepared as described above. The
following table lists the percentage of positively stained cells
observed for each of the samples:
TABLE-US-00017 Sample Positive stained Cells (%) 0 NY-ESO peptide,
5 .mu.g TCR 0.75 10.sup.-4 M NY-ESO peptide, 5 .mu.g TCR 84.39
10.sup.-5 M NY-ESO peptide, 5 .mu.g TCR 35.29 10.sup.-6 M NY-ESO
peptide, 5 .mu.g TCR 7.98 0 NY-ESO peptide, 10 .mu.g TCR 0.94
10.sup.-4 M NY-ESO peptide, 10 .mu.g TCR 88.51 10.sup.-5 M NY-ESO
peptide, 10 .mu.g TCR 8.25 10.sup.-6 M NY-ESO peptide, 10 .mu.g TCR
3.45
[0275] These data clearly indicate that the proportion of the cells
labelled by the NY-ESO TCR tetramers increases in a manner
correlated to the concentration of the peptide (SLLMWITQC) in which
they had been incubated. Therefore, these NY-ESO TCR tetramers are
moieties suitable for specific cell labelling based on the
expression of the HLA-A2 NY-ESO complex.
[0276] In the present example, a fluorescent conjugated NY-ESO TCR
tetramer has been used. However, similar levels of cell binding
would be expected if this label were replaced by a suitable
therapeutic moiety.
Example 12
Production of Soluble A6 TCR with a Novel Disulphide Bond
Incorporating the C.beta.1 Constant Region
[0277] All of the previous examples describe the production of
soluble TCRs with a novel disulphide bond incorporating the
C.beta.2 constant region. The present example demonstrates that
soluble TCRs incorporating the C.beta.1 constant region can be
produced successfully.
Design of Primers for PCR Stitching of A6 TCR .beta.-Chain V-Domain
to C.beta.1.
[0278] For PCR construct of A6 TCR .beta.-chain V-domain, the
following primers were designed:
TABLE-US-00018 5'-GGAGATATACATATGAACGCTGGTGTCACT-3' (nucleotides
30-59 of SEQ ID NO:84) (SEQ ID NO:85)
5'-CCTTGTTCAGGTCCTCTGTGACCGTGAG-3'
[0279] For PCR construct of C.beta.1, the following primers were
designed:
TABLE-US-00019 (SEQ ID NO:86) 5'-CTCACGGTCACAGAGGACCTGAACAAGG-3'
(SEQ ID NO:87) 5'-CCCAAGCTTAGTCTGCTCTACCCCAGGCCTCGGC-3'
[0280] Beta VTCR construct and C.beta.1 construct were separately
amplified using standard PCR technology. They were connected to
each other using a stitching PCR. Plasmid DNA was purified on a
Qiagen mini-prep column according to the manufacturer's
instructions and the sequence was verified by automated sequencing
at the sequencing facility of Department of Biochemistry, Oxford
University. The sequence for A6+C.beta.1 is shown in FIG. 92.
[0281] Consequently, the A6+C.beta.1 chain was paired to A6 alpha
TCR by inter-chain disulphide bond after introducing cysteine in
C-domain of both chains.
[0282] The soluble TCR was expressed and refolded as described in
Example 2.
Purification of Refolded Soluble TCR:
[0283] sTCR was separated from degradation products and impurities
by loading the dialysed refold onto a POROS 50HQ anion exchange
column and eluting bound protein with a gradient of 0-500 mM NaCl
over 50 column volumes using an Akta purifier (Pharmacia) as in
FIG. 93. Peak fractions were stored at 4.degree. C. and analysed by
Coomassie-stained SDS-PAGE (FIG. 94) before being pooled and
concentrated. Finally, the sTCR was purified and characterised
using a Superdex 200HR gel filtration column (FIG. 95)
pre-equilibrated in HBS-EP buffer (10 mM HEPES pH 7.4, 150 mM NaCl,
3.5 mM EDTA, 0.05% nonidet p40). The peak eluting at a relative
molecular weight of approximately 50 kDa was pooled and
concentrated prior to characterisation by BIAcore surface plasmon
resonance analysis.
[0284] A BIAcore analysis of the binding of the disulphide-linked
A6 TCR to pMHC was carried out as described in Example 3. FIG. 96
shows BIAcore analysis of the specific binding of disulphide-linked
A6 soluble TCR to its cognate pMHC.
[0285] The soluble A6 TCR with a novel disulphide bond
incorporating the C.beta.1 constant region had a K.sub.d of
2.42.+-.0.55 .mu.M for its cognate pMHC. This value is very similar
to the K.sub.d of 1.8 .mu.M determined for the soluble A6 TCR with
a novel disulphide bond incorporating the C.beta.2 constant region
as determined in Example 3.
Example 13
Production of Soluble A6 TCR with a Novel Disulphide Bond
Incorporating the "Free" Cysteine in the .beta. Chain
[0286] The .beta. chain constant regions of TCRs include a cysteine
residue (residue 75 in exon 1 of TRBC1*01 and TRBC2*01) which is
not involved in either inter-chain or intra-chain disulphide bond
formation. All of the previous examples describe the production of
soluble TCRs with a novel disulphide bond in which this "free"
cysteine has been mutated to alanine in order to avoid the possible
formation of any "inappropriate" disulphide bonds which could
result in a reduced yield of functional TCR. The present example
demonstrates that soluble TCRs incorporating this "free" cysteine
can be produced.
Design of Primers and Mutagenesis of TCR .beta. Chain
[0287] For mutating TCR .beta.-chain alanine (residue 75 in exon 1
of TRBC1*01 and TRBC2*01) to cysteine, the following primers were
designed (mutation shown in lower case):
TABLE-US-00020 (SEQ ID NO:88) 5'-T GAC TCC AGA TAC tgT CTG AGC AGC
CG (SEQ ID NO:89) 5'-CG GCT GCT CAG Aca GTA TCT GGA GTC A
[0288] PCR mutagenesis, expression and refolding of the soluble TCR
was carried out as described in Example 2.
Purification of Refolded Soluble TCR:
[0289] sTCR was separated from degradation products and impurities
by loading the dialysed refold onto a POROS 50HQ anion exchange
column and eluting bound protein with a gradient of 0-500 mM NaCl
over 50 column volumes using an Akta purifier (Pharmacia) as in
FIG. 98. Peak fractions were stored at 4.degree. C. and analysed by
Coomassie-stained SDS-PAGE (FIG. 99) before being pooled and
concentrated. Finally, the sTCR was purified and characterised
using a Superdex 200HR gel filtration column (FIG. 100)
pre-equilibrated in HBS-EP buffer (10 mM HEPES pH 7.4, 150 mM NaCl,
3.5 mM EDTA, 0.05% nonidet p40). The peak eluting at a relative
molecular weight of approximately 50 kDa was pooled and
concentrated prior to characterisation by BIAcore surface plasmon
resonance analysis.
[0290] A BIAcore analysis of the binding of the disulphide-linked
A6 TCR to pMHC was carried out as described in Example 3. FIG. 101
shows BIAcore analysis of the specific binding of disulphide-linked
A6 soluble TCR to its cognate pMHC.
[0291] The soluble A6 TCR with a novel disulphide bond
incorporating the "free" cysteine in the .beta. chain had a K.sub.d
of 21.39.+-.3.55 .mu.M for its cognate pMHC.
Example 14
Production of Soluble A6 TCR with a Novel Disulphide Bond Wherein
"Free" Cysteine in the .beta. Chain is Mutated to Serine
[0292] The present example demonstrates that soluble TCRs with a
novel disulphide bond in which the "free" cysteine in the P chain
(residue 75 in exon 1 of TRBC1*01 and TRBC2*01) is mutated to
serine can be successfully produced.
Design of Primers and Mutagenesis of TCR .beta. Chain
[0293] For mutating TCR .beta.-chain alanine that had previously
been substituted for the native cysteine (residue 75 in exon 1 of
TRBC1*01 and TRBC2*01) to serine, the following primers were
designed (mutation shown in lower case):
TABLE-US-00021 (SEQ ID NO:90) 5'-T GAC TCC AGA TAC tCT CTG AGC AGC
CG (SEQ ID NO:91) 5'-CG GCT GCT CAG AGa GTA TCT GGA GTC A
[0294] PCR mutagenesis (resulting in a mutated beta chain as shown
in FIG. 102), expression and refolding of soluble TCR was carried
out as described in Example 2.
Purification of Refolded Soluble TCR:
[0295] sTCR was separated from degradation products and impurities
by loading the dialysed refold onto a POROS 50HQ anion exchange
column and eluting bound protein with a gradient of 0-500 mM NaCl
over 50 column volumes using an Akta purifier (Pharmacia) as shown
in FIG. 103. Peak fractions were stored at 4.degree. C. and
analysed by Coomassie-stained SDS-PAGE (FIG. 104) before being
pooled and concentrated. Finally, the sTCR was purified and
characterised using a Superdex 200HR gel filtration column (FIG.
105) pre-equilibrated in HBS-EP buffer (10 mM HEPES pH 7.4, 150 mM
NaCl, 3.5 mM EDTA, 0.05% nonidet p40). The peak eluting at a
relative molecular weight of approximately 50 kDa was pooled and
concentrated prior to characterisation by BIAcore surface plasmon
resonance analysis.
[0296] A BIAcore analysis of the binding of the disulphide-linked
A6 TCR to pMHC was carried out as described in Example 3. FIG. 106
shows BIAcore analysis of the specific binding of disulphide-linked
A6 soluble TCR to its cognate pMHC.
[0297] The soluble A6 TCR with a novel disulphide bond in which the
"free" cysteine in the .beta. chain was mutated to serine had a
K.sub.d of 2.98.+-.0.27 .mu.M for its cognate pMHC. This value is
very similar to the K.sub.d of 1.8 .mu.M determined for the soluble
A6 TCR with a novel disulphide bond in which the "free" cysteine in
the .beta. chain was mutated to alanine as determined in Example
3.
Example 15
Cloning of NY-ESO TCR .alpha. and .beta. Chains Containing a Novel
Disulphide Bond into Yeast Expression Vectors
[0298] NY-ESO TCR .alpha. and .beta. chains were fused to the
C-terminus of the pre-pro mating factor alpha sequence from
Saccharomyces cerevisiae and cloned into yeast expression vectors
pYX122 and pYX112 respectively (see FIGS. 107 and 108).
[0299] The following primers were designed to PCR amplify pre-pro
mating factor alpha sequence from S. cerevisiae strain SEY6210
(Robinson et al. (1991), Mol Cell Biol. 11(12):5813-24) for fusing
to the TCR .alpha. chain.
TABLE-US-00022 (SEQ ID NO:94) 5'-TCT GAA TTC ATG AGA TTT CCT TCA
ATT TTT AC-3' (SEQ ID NO:95) 5'-TCA CCT CCT GGG CTT CAG CCT CTC TTT
TAT C-3'
[0300] The following primers were designed to PCR amplify pre-pro
mating factor alpha sequence from S. cerevisiae strain SEY6210 for
fusing to the TCR .beta. chain.
TABLE-US-00023 5'-TCT GAA TTC ATG AGA TTT CCT TCA ATT TTT AC-3'
5'-GTG TCT CGA GTT AGT CTG CTC TAC CCC AGG C-3'
[0301] Yeast DNA was prepared by re-suspending a colony of S.
cerevisiae strain SEY6210 in 30 .mu.l of 0.25% SDS in water and
heating for 3 minutes at 90.degree. C. The pre-pro mating factor
alpha sequences for fusing to the TCR .alpha. and .beta. chains
were generated by PCR amplifying 0.25 .mu.l of yeast DNA with the
respective primer pairs mentioned above using the following PCR
conditions. 12.5 pmoles of each primer was mixed with 200 .mu.M
dNTP, 5 .mu.l of 10.times.Pfu buffer and 1.25 units of Pfu
polymerase (Stratagene) in a final volume of 50 .mu.l. After an
initial denaturation step of 30 seconds at 92.degree. C., the
reaction mixture was subjected to 30 rounds of denaturation
(92.degree. C., 30 sec.), annealing (46.9.degree. C., 60 sec.), and
elongation (72.degree. C., 2 min.) in a Hybaid PCR express PCR
machine.
[0302] The following primers were designed to PCR amplify the TCR
.alpha. chain to be fused to the pre-pro mating factor alpha
sequence mentioned above.
TABLE-US-00024 (SEQ ID NO:96) 5'-GGC TGA AGC CCA GGA GGT GAC ACA
GAT TCC-3' (SEQ ID NO:97) 5'-CTC CTC TCG AGT TAG GAA CTT TCT GGG
CTG GG-3'
[0303] The following primers were designed to PCR amplify the TCR
.beta. chain to be fused to the pre-pro mating factor alpha
sequence mentioned above.
TABLE-US-00025 (SEQ ID NO:98) 5'-GGC TGA AGC CGG CGT CAC TCA GAC
CCC AAA AT-3' (SEQ ID NO:99) 5'-GTG TCT CGA GTT AGT CTG CTC TAC CCC
AGG C-3'
[0304] The PCR conditions for amplifying the TCR .alpha. and .beta.
chains were the same as mentioned above except for the following
changes: the DNA template used for amplifying the TCR .alpha. and
.beta. chains were the NY-ESO TCR .alpha. and .beta. chains
respectively (as prepared in Example 5); and the annealing
temperature used was 60.1.degree. C.
[0305] The PCR products were then used in a PCR stitching reaction
utilising the complementary overlapping sequences introduced into
the initial PCR products to create a full length chimeric gene. The
resulting PCR products were digested with the restriction enzymes
EcoR I and Xho I and cloned into either pYX122 or pYX112 digested
with the same enzymes. The resulting plasmids were purified on a
Qiagen.TM. mini-prep column according to the manufacturer's
instructions, and the sequences verified by automated sequencing at
the sequencing facility of Genetics Ltd, Queensway, New Milton,
Hampshire, United Kingdom. FIGS. 109 and 110 show the DNA and
protein sequences of the cloned chimeric products.
Example 16
Expression of Soluble NY-ESO TCR Containing a Novel Disulphide Bond
in Yeast
[0306] The yeast expression plasmids containing the TCR .alpha. and
.beta. chains respectively produced as described in Example 15 were
co-transformed into S. cerevisiae strain SEY6210 using the protocol
by Agatep et al. (1998) (Technical Tips Online
(http://tto.trends.com) 1:51:P01525). A single colony growing on
synthetic dropout (SD) agar containing Histidine and Uracil
(Qbiogene, Illkirch, France) was cultured overnight at 30.degree.
C. in 10 ml SD media containing Histidine and Uracil. The overnight
culture was sub-cultured 1:10 in 10 ml of the fresh SD media
containing Histidine and Uracil and grown for 4 hours at 30.degree.
C. The culture was centrifuged for 5 minutes at 3800 rpm in a
Heraeus Megafuge 2.0R (Kendro Laboratory Products Ltd, Bishop's
Stortford, Hertfordshire, UK) and the supernatant harvested. 5
.mu.l StratClean Resin (Stratagene) was mixed with the supernatent
and kept rotating in a blood wheel at 4.degree. C. overnight. The
StrataClean resin was spun down at 3800 rpm in a Heraeus Megafuge
2.0R and the media discarded. 2511 of reducing sample buffer (950
.mu.l of Laemmli sample buffer (Biorad) containing 5011 of 2M DTT)
was added to the resin and the samples heated at 95.degree. C. for
5 minutes and then cooled on ice before 20 .mu.l of the mix was
loaded on a SDS-PAGE gel at 0.8 mA constant/cm.sup.2 of gel surface
for 1 hour. The proteins in the gel were transferred to Immuno-Blot
PVDF membranes (Bio-Rad) and probed with TCR anti .alpha. chain
antibody as described in Example 17 below except for the following
changes. The primary antibody (TCR anti .alpha. chain) and
secondary antibodies were used at 1 in 200 and 1 in 1000 dilutions
respectively. FIG. 111 shows a picture of the developed membrane.
The result shows that there is a low level of TCR secretion by the
yeast culture into the media.
Example 17
Disulphide A6 Tax TCR .alpha. and .beta. Chain Expression in
Baculovirus
Strategy for Cloning
[0307] The .alpha. and .beta. chains of the disulphide A6 Tax TCR
were cloned from pGMT7 into a pBlueScript KS2-based vector called
the pEX172. This vector was designed for cloning different MHC
class II .beta.-chains, for insect cell expression, using the
leader sequence from DRB1*0101, an AgeI site for insertion of
different peptide-coding sequences, a linker region, and then MluI
and SalI sites to clone the DR.beta. chains in front of the Jun
Leucine zipper sequence. The sequence where pEX 172 differs from
pBlueScript II KS-, located between the KpnI and EcoRI sites of
pBlueScript II KS-, is shown in FIG. 112. For the purposes of
cloning TCR chains in insect cells, this pEX172 was cut with AgeI
and SalI to remove the linker region and MluI site, and the TCR
chains go in where the peptide sequence would start. The TCR
sequences were cloned from pGMT7 with a BspEI site at the 5' end
(this had AgeI compatible sticky ends) and a SalI site at the 3'
end. In order to provide the cleavage site for the removal of the
DR.beta. leader sequence, the first three residues of the DR.beta.
chain (GDT) were preserved. In order to prevent the Jun Leucine
zipper sequence being transcribed, it was necessary to insert a
stop codon before the SalI site. For a schematic of this construct,
see FIG. 113. Once the TCR chains are in this plasmid, the BamHI
fragment were cut out and subcloned into the pAcAB3 vector, which
has homology recombination sites for Baculovirus. The pAcAB3 vector
has two divergent promoters, one with a BamHI site and one with a
BglII cloning site. There is a BglII site in the A6 TCR
.beta.-chain, so the A6 TCR .alpha.-chain was inserted into the
BglII site, and the .beta.-chain was then subcloned into the BamHI
site.
[0308] In accordance with the above cloning strategy, the following
primers were designed (homology to the vectors is in
uppercase):
TABLE-US-00026 A6.alpha.: (SEQ ID NO:100) F:
5'-gtagtccggagacaccggaCAGAAGGAAGTGGAGCAGAAC (SEQ ID NO:101) R:
5'-gtaggtcgacTAGGAACTTTCTGGGCTGGG A6.beta.: (SEQ ID NO:102) F:
5'-gtagtccggagacaccggaAACGCTGGTGTCACTCAGA (SEQ ID NO:103) R:
5'-gtaggtcgacTAGTCTGCTCTACCCCAGG
PCR, Cloning and Sub-Cloning:
[0309] Expression plasmids containing the genes for the disulphide
A6 Tax TCR .alpha. or .beta. chain were used as templates in the
following PCR reactions. 100 ng of .alpha. plasmid was mixed with 1
.mu.l 10 mM dNTP, 5 .mu.l 10.times.Pfu-buffer (Stratagene), 1.25
units Pfu polymerase (Stratagene), 50 .mu.mol of the A6.alpha.
primers above, and the final volume was adjusted to 50 .mu.l with
H.sub.2O. A similar reaction mixture was set up for the .beta.
chain, using the .beta. plasmid and the pair of .beta. primers. The
reaction mixtures were subjected to 35 rounds of denaturation
(95.degree. C., 60 sec.), annealing (50.degree. C., 60 sec.), and
elongation (72.degree. C., 8 min.) in a Hybaid PCR express PCR
machine. The product was then digested for 2 hours at 37.degree. C.
with 10 units of BspEI restriction enzyme then for a further 2
hours with 10 units of SalI (New England Biolabs). These digested
reactions were ligated into pEX172 that had been digested with AgeI
and SalI, and these were transformed into competent XL1-Blue
bacteria and grown for 18 hours at 37.degree. C. A single colony
was picked from each of the .alpha. and .beta. preps and grown over
night in 5 ml TYP+ampicillin (16 g/l Bacto-Tryptone, 16 g/l Yeast
Extract, 5 g/l NaCl, 2.5 g/l K.sub.2HPO.sub.4, 100 mg/l
Ampicillin). Plasmid DNA was purified on a QIAgen mini-prep column
according to the manufacturer's instructions and the sequence was
verified by automated sequencing at the sequencing facility of
Genetix. The amino acid sequences of the BamHI inserts are shown in
FIGS. 114 and 115 for the .alpha. chain and .beta. chain,
respectively.
[0310] These .alpha. and .beta. disulphide A6 Tax TCR chain
constructs in pEX172 were digested out for 2 hours at 37.degree. C.
with BamHI restriction enzyme (New England Biolabs). The .alpha.
chain BamHI insert was ligated into pAcAB3 vector (Pharmingen-BD
Biosciences: 21216P) that had been digested with BglII enzyme. This
was transformed into competent XL1-Blue bacteria and grown for 18
hours at 37.degree. C. A single colony was picked from this plate
and grown overnight in 5 ml TYP+ampicillin and the plasmid DNA was
purified as before. This plasmid was then digested with BamHI and
the .beta. chain BamHI insert was ligated in, transformed into
competent XL1-Blue bacteria, grown overnight, picked to
TYP-ampicillin, and grown before miniprepping as before using a
QIAgen mini-prep column. The correct orientation of both the
.alpha. and .beta. chains were confirmed by sequencing using the
following sequencing primers:
TABLE-US-00027 pAcAB3 .alpha. forwards: (SEQ ID NO:104)
5'-gaaattatgcatttgaggatg pAcAB3 .beta. forwards: (SEQ ID NO:105)
5'-attaggcctctagagatccg
Transfection, Infection, Expression and Analysis of A6 TCR in
Insect Cells
[0311] The expression plasmid containing the .alpha.-chain and
.beta.-chain was transfected into sf9 cells (Pharmingen-BD
Biosciences: 21300C) grown in serum free medium (Pharmingen-BD
Biosciences: 551411), using the Baculogold transfection kit
(Pharmingen-BD Biosciences: 21100K) as per the manufacturers
instructions. After 5 days at 27.degree. C., 200 .mu.l of the
medium these transfected cells had been growing in was added to 100
ml of High Five cells at 1.times.10.sup.6 cells/ml in serum free
medium. After a further 6 days at 27.degree. C., 1 ml of this
medium was removed and centrifuged at 13,000 RPM in a Hereus
microfuge for 5 minutes to pellet cell debris. 10 .mu.l of this
insect A6 disulphide linked TCR supernatant was run alongside
positive controls of bacterial A6 disulphide linked TCR 5 .mu.g and
10 .mu.g on a pre-cast 4-20% Tris/glycine gel (Invitrogen:
EC60252). Reduced samples were prepared by adding 10 .mu.p of
Reducing sample buffer (950 .mu.l of Laemmli sample buffer
(Bio-Rad: 161-0737) 50 .mu.l of 2M DTT) and heating at 95.degree.
C. for 5 minutes, cooling at room temperature for 10 minutes then
loading 20 .mu.l. Non-reduced samples were prepared by adding 10
.mu.l of Laemmli sample buffer, and loading 20 .mu.l.
[0312] The gel was run at 150 volts for 1 hour in a Novex-Xcell gel
tank after which the gel was stained in 50 ml of Coomassie gel
stain for 1 hour with gentle agitation (1.1 g Coomassie powder in
500 ml of methanol stir for 1 hour add 100 ml acetic acid make up
to 1 litre with H.sub.2O and stir for 1 hour then filter through
0.45 .mu.M filter). The gel was de-stained three times for 30 mins
with gentle agitation in 50 ml of de-stain (as Coomassie gel stain
but omitting the Coomassie powder).
[0313] Western Blots were performed by running SDS-PAGE gels as
before but the proteins were transferred to Immuno-Blot PVDF
membranes (Bio-Rad: 162-0174) rather than staining the gels with
Coomassie. Six filter papers were cut to the size of the gel and
soaked in transfer buffer (2.39 g Glycine, 5.81 g of Tris Base,
0.77 g DTT dissolved in 500 mls of H.sub.2O, 200 mls of methanol
added then made up to 1000 mls with H.sub.2O). The PVDF membrane
was prepared by soaking in methanol for 1 minute and then in
transfer buffer for 2 minutes. Three filter papers were placed on
the anode surface of the Immuno-blot apparatus
(Pharmacia--Novablot) then the membrane was placed on top followed
by the gel and then finally three more filter papers on the cathode
side. The Immuno-blot was run for 1 hour at 0.8 mA
constant/cm.sup.2 of gel surface.
[0314] After blotting, the membrane was blocked in 7.5 mls of
blocking buffer (4 Tris-buffered saline tablets (Sigma: T5030), 3 g
non-fat dried milk (Sigma: M7409), 30 .mu.l of Tween 20 made up to
30 mls with H.sub.2O) for 60 mins with gentle agitation. The
membrane was washed three times for 5 mins with TBS wash buffer (20
TBS tablets, 150 .mu.l Tween 20 made up to 300 ml with H.sub.2O).
The membrane was then incubated in primary antibody 1 in 50
dilution of anti TCR .alpha. chain clone 3A8 (Serotec: MCA987) or
anti TCR .beta. chain clone 8A3 (Serotec: MCA988) in 7.5 ml
blocking buffer for 1 hour with gentle agitation. The membrane was
washed as before in TBS wash buffer. Next, a secondary antibody
incubation of HRP labelled goat anti-mouse antibody (Santa Cruz
Biotech: Sc-2005) 1 in 1000 dilution in 7.5 ml of blocking buffer
was carried out for 30 min with gentle agitation. The membrane was
washed as before and then washed in 30 ml of H.sub.2O with 2 TBS
tablets.
[0315] The antibody binding was detected by Opti-4CN colourmetric
detection (Biorad: 170-8235) (1.4 ml Opt-4CN diluent, 12.6 ml
H.sub.2O, 0.28 ml Opti-4CN substrate). The membranes were coloured
for 30 minutes and then washed in H.sub.2O for 15 minutes. The
membranes were dried at room temperature, and scanned images were
aligned with an image of the coomassie stained gel (FIG. 116).
Results
[0316] It can be seen from FIG. 116 that both disulphide TCRs are
formed as a heterodimer that is stable in the SDS gel. They both
break into the .alpha. and .beta. chains upon reduction. The insect
disulphide TCR heterodimer has a slightly higher molecular weight
that the bacterially produced version, presumably because of the
glycosylation from the insect cells. It can be seen that in this
instance the insect cells are producing .alpha. chain in excess,
and free .alpha. chain can be seen in the non-reduced lane of the
anti-.alpha. western blot.
[0317] These data clearly demonstrate that the baculovirus
expression system described above provides a viable alternative to
prokaryotic expression of soluble TCRs containing novel disulphide
bonds.
Sequence CWU 1
1
183120PRTHomo sapiens 1Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr Val
Leu Asp Met Arg Ser1 5 10 15Met Asp Phe Lys 20220PRTHomo sapiens
2Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr Val Leu Asp1 5
10 15Met Arg Ser Met 20320PRTHomo sapiens 3Asp Ile Gln Asn Pro Asp
Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys1 5 10 15Ser Ser Asp Lys
20420PRTHomo sapiens 4Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys
Ser Ser Asp Lys Ser1 5 10 15Val Cys Leu Phe 20520PRTHomo sapiens
5Asn Gly Lys Glu Val His Ser Gly Val Ser Thr Asp Pro Gln Pro Leu1 5
10 15Lys Glu Gln Pro 20620PRTHomo sapiens 6Ala Leu Asn Asp Ser Arg
Tyr Ala Leu Ser Ser Arg Leu Arg Val Ser1 5 10 15Ala Thr Phe Trp
20720PRTHomo sapiens 7Pro Pro Glu Val Ala Val Phe Glu Pro Ser Glu
Ala Glu Ile Ser His1 5 10 15Thr Gln Lys Ala 20820PRTHomo sapiens
8Lys Glu Val His Ser Gly Val Ser Thr Asp Pro Gln Pro Leu Lys Glu1 5
10 15Gln Pro Ala Leu 20920PRTHomo sapiens 9Val Phe Pro Pro Glu Val
Ala Val Phe Glu Pro Ser Glu Ala Glu Ile1 5 10 15Ser His Thr Gln
201091PRTMus musculus 10Pro Tyr Ile Gln Asn Pro Glu Pro Ala Val Tyr
Gln Leu Lys Asp Pro1 5 10 15Arg Ser Gln Asp Ser Thr Leu Cys Leu Phe
Thr Asp Phe Asp Ser Gln 20 25 30Ile Asn Val Pro Lys Thr Met Glu Ser
Gly Thr Phe Ile Thr Asp Lys 35 40 45Thr Val Leu Asp Met Lys Ala Met
Asp Ser Lys Ser Asn Gly Ala Ile 50 55 60Ala Trp Ser Asn Gln Thr Ser
Phe Thr Cys Gln Asp Ile Phe Lys Glu65 70 75 80Thr Asn Ala Thr Tyr
Pro Ser Ser Asp Val Pro 85 9011126PRTMus musculus 11Glu Asp Leu Arg
Asn Val Thr Pro Pro Lys Val Ser Leu Phe Glu Pro1 5 10 15Ser Lys Ala
Glu Ile Ala Asn Lys Gln Lys Ala Thr Leu Val Cys Leu 20 25 30Ala Arg
Gly Phe Phe Pro Asp His Val Glu Leu Ser Trp Trp Val Asn 35 40 45Gly
Arg Glu Val His Ser Gly Val Ser Thr Asp Pro Gln Ala Tyr Lys 50 55
60Glu Ser Asn Tyr Ser Tyr Cys Leu Ser Ser Arg Leu Arg Val Ser Ala65
70 75 80Thr Phe Trp His Asn Pro Arg Asn His Phe Arg Cys Gln Val Gln
Phe 85 90 95His Gly Leu Ser Glu Glu Asp Lys Trp Pro Glu Gly Ser Pro
Lys Pro 100 105 110Val Thr Gln Asn Ile Ser Ala Glu Ala Trp Gly Arg
Ala Asp 115 120 1251220PRTMus musculus 12Glu Ser Gly Thr Phe Ile
Thr Asp Lys Thr Val Leu Asp Met Lys Ala1 5 10 15Met Asp Ser Lys
201320PRTMus musculus 13Lys Thr Met Glu Ser Gly Thr Phe Ile Thr Asp
Lys Thr Val Leu Asp1 5 10 15Met Lys Ala Met 201420PRTMus musculus
14Tyr Ile Gln Asn Pro Glu Pro Ala Val Tyr Gln Leu Lys Asp Pro Arg1
5 10 15Ser Gln Asp Ser 201520PRTMus musculus 15Ala Val Tyr Gln Leu
Lys Asp Pro Arg Ser Gln Asp Ser Thr Leu Cys1 5 10 15Leu Phe Thr Asp
201620PRTMus musculus 16Asn Gly Arg Glu Val His Ser Gly Val Ser Thr
Asp Pro Gln Ala Tyr1 5 10 15Lys Glu Ser Asn 201720PRTMus musculus
17Lys Glu Ser Asn Tyr Ser Tyr Cys Leu Ser Ser Arg Leu Arg Val Ser1
5 10 15Ala Thr Phe Trp 201820PRTMus musculus 18Pro Pro Lys Val Ser
Leu Phe Glu Pro Ser Lys Ala Glu Ile Ala Asn1 5 10 15Lys Gln Lys Ala
201920PRTMus musculus 19Arg Glu Val His Ser Gly Val Ser Thr Asp Pro
Gln Ala Tyr Lys Glu1 5 10 15Ser Asn Tyr Ser 202020PRTMus musculus
20Val Thr Pro Pro Lys Val Ser Leu Phe Glu Pro Ser Lys Ala Glu Ile1
5 10 15Ala Asn Lys Gln 202124DNAArtificial Sequenceprimer
21cacagacaaa tgtgtgctag acat 242224DNAArtificial Sequenceprimer
22atgtctagca cacatttgtc tgtg 242321DNAArtificial Sequenceprimer
23cagtggggtc tgcacagacc c 212421DNAArtificial Sequenceprimer
24gggtctgtgc agaccccact g 212528DNAArtificial Sequenceprimer
25atatccagaa cccggatcct gccgtgta 282629DNAArtificial Sequenceprimer
26tacacggcag gaatccgggt tctggatat 292730DNAArtificial
Sequenceprimer 27ggagatatac atatgcaact actagaacaa
302829DNAArtificial Sequenceprimer 28tacacggcag gatccgggtt
ctggatatt 292930DNAArtificial Sequenceprimer 29ggagatatac
atatggtgga tggtggaatc 303034DNAArtificial Sequenceprimer
30cccaagctta gtctgctcta ccccaggcct cggc 343130DNAArtificial
Sequenceprimer 31ggagatatac atatgcagga ggtgacacag
303229DNAArtificial Sequenceprimer 32tacacggcag gatccgggtt
ctggatatt 293330DNAArtificial Sequenceprimer 33ggagatatac
atatgggtgt cactcagacc 303434DNAArtificial Sequenceprimer
34cccaagctta gtctgctcta ccccaggcct cggc 343530DNAArtificial
Sequenceprimer 35ggagatatac atatgcagga ggtgacacag
303637DNAArtificial Sequenceprimer 36cccaagctta acaggaactt
tctgggctgg ggaagaa 373730DNAArtificial Sequenceprimer 37ggagatatac
atatgggtgt cactcagacc 303837DNAArtificial Sequenceprimer
38cccaagctta acagtctgct ctaccccagg cctcggc 373939DNAArtificial
Sequenceprimer 39gggaagctta catatgaagg aggtggagca gaattctgg
394029DNAArtificial Sequenceprimer 40tacacggcag gatccgggtt
ctggatatt 294140DNAArtificial Sequenceprimer 41ttggaattca
catatgggcg tcatgcagaa cccaagacac 404234DNAArtificial Sequenceprimer
42cccaagctta gtctgctcta ccccaggcct cggc 344324DNAArtificial
Sequenceprimer 43cacagacaaa tgtgtgctag acat 244424DNAArtificial
Sequenceprimer 44atgtctagca cacatttgtc tgtg 244523DNAArtificial
Sequenceprimer 45ccctgccgtg tgccagctga gag 234623DNAArtificial
Sequenceprimer 46ctctcagctg gcacacggca ggg 234728DNAArtificial
Sequenceprimer 47ccgtgtacca gtgcagagac tctaaatc 284828DNAArtificial
Sequenceprimer 48gatttagagt ctctgcactg gtacacgg 284927DNAArtificial
Sequenceprimer 49cagctgagag actgtaaatc cagtgac 275027DNAArtificial
Sequenceprimer 50gtcactggat ttacagtctc tcagctg 275127DNAArtificial
Sequenceprimer 51cagtgacaag tcttgctgcc tattcac 275227DNAArtificial
Sequenceprimer 52gtgaataggc agcaagactt gtcactg 275328DNAArtificial
Sequenceprimer 53gattctgatg tgtgtatcac agacaaat 285428DNAArtificial
Sequenceprimer 54atttgtctgt gatacacaca tcagaatc 285530DNAArtificial
Sequenceprimer 55ctgatgtgta tatctgtgac aaaactgtgc
305630DNAArtificial Sequenceprimer 56gcacagtttt gtcacagata
tacacatcag 305728DNAArtificial Sequenceprimer 57agacaaaact
gtgtgtgaca tgaggtct 285828DNAArtificial Sequenceprimer 58agacctcatg
tcacacacag ttttgtct 285927DNAArtificial Sequenceprimer 59actgtgctag
actgtaggtc tatggac 276027DNAArtificial Sequenceprimer 60gtccatagac
ctacagtcta gcacagt 276125DNAArtificial Sequenceprimer 61cttcaagagc
aactgtgctg tggcc 256225DNAArtificial Sequenceprimer 62ggccacagca
cagttgctct tgaag 256321DNAArtificial Sequenceprimer 63cagtggggtc
tgcacagacc c 216421DNAArtificial Sequenceprimer 64gggtctgtgc
agaccccact g 216527DNAArtificial Sequenceprimer 65ccgaggtcgc
ttgttttgag ccatcag 276627DNAArtificial Sequenceprimer 66ctgatggctc
aaaacaagcg acctcgg 276724DNAArtificial Sequenceprimer 67ggtcgctgtg
tgtgagccat caga 246824DNAArtificial Sequenceprimer 68tctgatggct
cacacacagc gacc 246927DNAArtificial Sequenceprimer 69gtgtttgagc
catgtgaagc agagatc 277027DNAArtificial Sequenceprimer 70gatctctgct
tcacatggct caaacac 277127DNAArtificial Sequenceprimer 71gaggtgcaca
gttgtgtcag cacagac 277227DNAArtificial Sequenceprimer 72gtctgtgctg
acacaactgt gcacctc 277323DNAArtificial Sequenceprimer 73gggtcagcac
atgcccgcag ccc 237423DNAArtificial Sequenceprimer 74gggctgcggg
catgtgctga ccc 237523DNAArtificial Sequenceprimer 75cccgcagccc
tgcaaggagc agc 237623DNAArtificial Sequenceprimer 76gctgctcctt
gcagggctgc ggg 237723DNAArtificial Sequenceprimer 77agatacgctc
tgtgcagccg cct 237823DNAArtificial Sequenceprimer 78aggcggctgc
acagagcgta tct 237923DNAArtificial Sequenceprimer 79ctctgagcag
ctgcctgagg gtc 238023DNAArtificial Sequenceprimer 80gaccctcagg
cagctgctca gag 238121DNAArtificial Sequenceprimer 81gctgtgtttt
gtccatcaga a 218221DNAArtificial Sequenceprimer 82ttctgatgga
caaaacacag c 218330DNAArtificial Sequenceprimer 83ggagatatac
atatgggtgt cactcagaac 308459DNAArtificial Sequenceprimer
84ccaccggatc cgtctgctct accccaggcg gagatataca tatgaacgct ggtgtcact
598528DNAArtificial Sequenceprimer 85ccttgttcag gtcctctgtg accgtgag
288628DNAArtificial Sequenceprimer 86ctcacggtca cagaggacct gaacaagg
288734DNAArtificial Sequenceprimer 87cccaagctta gtctgctcta
ccccaggcct cggc 348827DNAArtificial Sequenceprimer 88tgactccaga
tactgtctga gcagccg 278927DNAArtificial Sequenceprimer 89cggctgctca
gacagtatct ggagtca 279027DNAArtificial Sequenceprimer 90tgactccaga
tactctctga gcagccg 279127DNAArtificial Sequenceprimer 91cggctgctca
gagagtatct ggagtca 279232DNAArtificial Sequenceprimer 92tctgaattca
tgagatttcc ttcaattttt ac 329331DNAArtificial Sequenceprimer
93tcacctcctg ggcttcagcc tctcttttat c 319432DNAArtificial
Sequenceprimer 94tctgaattca tgagatttcc ttcaattttt ac
329531DNAArtificial Sequenceprimer 95gtgtctcgag ttagtctgct
ctaccccagg c 319630DNAArtificial Sequenceprimer 96ggctgaagcc
caggaggtga cacagattcc 309732DNAArtificial Sequenceprimer
97ctcctctcga gttaggaact ttctgggctg gg 329832DNAArtificial
Sequenceprimer 98ggctgaagcc ggcgtcactc agaccccaaa at
329931DNAArtificial Sequenceprimer 99gtgtctcgag ttagtctgct
ctaccccagg c 3110040DNAArtificial Sequenceprimer 100gtagtccgga
gacaccggac agaaggaagt ggagcagaac 4010130DNAArtificial
Sequenceprimer 101gtaggtcgac taggaacttt ctgggctggg
3010238DNAArtificial Sequenceprimer 102gtagtccgga gacaccggaa
acgctggtgt cactcaga 3810329DNAArtificial Sequenceprimer
103gtaggtcgac tagtctgctc taccccagg 2910421DNAArtificial
Sequenceprimer 104gaaattatgc atttgaggat g 2110520DNAArtificial
Sequenceprimer 105attaggcctc tagagatccg 201069PRTArtificial
SequenceHLA-A2 NYESO peptide 106Ser Leu Leu Met Trp Ile Thr Gln
Cys1 5107621DNAHomo sapiens 107atgcagaagg aagtggagca gaactctgga
cccctcagtg ttccagaggg agccattgcc 60tctctcaact gcacttacag tgaccgaggt
tcccagtcct tcttctggta cagacaatat 120tctgggaaaa gccctgagtt
gataatgtcc atatactcca atggtgacaa agaagatgga 180aggtttacag
cacagctcaa taaagccagc cagtatgttt ctctgctcat cagagactcc
240cagcccagtg attcagccac ctacctctgt gccgttacaa ctgacagctg
ggggaaattg 300cagtttggag cagggaccca ggttgtggtc accccagata
tccagaaccc tgaccctgcc 360gtgtaccagc tgagagactc taaatccagt
gacaagtctg tctgcctatt caccgatttt 420gattctcaaa caaatgtgtc
acaaagtaag gattctgatg tgtatatcac agacaaatgt 480gtgctagaca
tgaggtctat ggacttcaag agcaacagtg ctgtggcctg gagcaacaaa
540tctgactttg catgtgcaaa cgccttcaac aacagcatta ttccagaaga
caccttcttc 600cccagcccag aaagttccta a 621108741DNAHomo sapiens
108atgaacgctg gtgtcactca gaccccaaaa ttccaggtcc tgaagacagg
acagagcatg 60acactgcagt gtgcccagga tatgaaccat gaatacatgt cctggtatcg
acaagaccca 120ggcatggggc tgaggctgat tcattactca gttggtgctg
gtatcactga ccaaggagaa 180gtccccaatg gctacaatgt ctccagatca
accacagagg atttcccgct caggctgctg 240tcggctgctc cctcccagac
atctgtgtac ttctgtgcca gcaggccggg actagcggga 300gggcgaccag
agcagtactt cgggccgggc accaggctca cggtcacaga ggacctgaaa
360aacgtgttcc cacccgaggt cgctgtgttt gagccatcag aagcagagat
ctcccacacc 420caaaaggcca cactggtgtg cctggccaca ggcttctacc
ccgaccacgt ggagctgagc 480tggtgggtga atgggaagga ggtgcacagt
ggggtctgca cagacccgca gcccctcaag 540gagcagcccg ccctcaatga
ctccagatac gctctgagca gccgcctgag ggtctcggcc 600accttctggc
aggacccccg caaccacttc cgctgtcaag tccagttcta cgggctctcg
660gagaatgacg agtggaccca ggatagggcc aaacccgtca cccagatcgt
cagcgccgag 720gcctggggta gagcagacta a 741109245PRTHomo sapiens
109Asn Ala Gly Val Thr Gln Thr Pro Lys Phe Gln Val Leu Lys Thr Gly1
5 10 15Gln Ser Met Thr Leu Gln Cys Ala Gln Asp Met Asn His Glu Tyr
Met 20 25 30Ser Trp Tyr Arg Gln Asp Pro Gly Met Gly Leu Arg Leu Ile
His Tyr 35 40 45Ser Val Gly Ala Gly Ile Thr Asp Gln Gly Glu Val Pro
Asn Gly Tyr 50 55 60Asn Val Ser Arg Ser Thr Thr Glu Asp Phe Pro Leu
Arg Leu Leu Ser65 70 75 80Ala Ala Pro Ser Gln Thr Ser Val Tyr Phe
Cys Ala Ser Arg Pro Gly 85 90 95Leu Ala Gly Gly Arg Pro Glu Gln Tyr
Phe Gly Pro Gly Thr Arg Leu 100 105 110Thr Val Thr Glu Asp Leu Lys
Asn Val Phe Pro Pro Glu Val Ala Val 115 120 125Phe Glu Pro Ser Glu
Ala Glu Ile Ser His Thr Gln Lys Ala Thr Leu 130 135 140Val Cys Leu
Ala Thr Gly Phe Tyr Pro Asp His Val Glu Leu Ser Trp145 150 155
160Trp Val Asn Gly Lys Glu Val His Ser Gly Val Cys Thr Asp Pro Gln
165 170 175Pro Leu Lys Glu Gln Pro Ala Leu Asn Asp Ser Arg Tyr Ala
Leu Ser 180 185 190Ser Arg Leu Arg Val Ser Ala Thr Phe Trp Gln Asp
Pro Arg Asn His 195 200 205Phe Arg Cys Gln Val Gln Phe Tyr Gly Leu
Ser Glu Asn Asp Glu Trp 210 215 220Thr Gln Asp Arg Ala Lys Pro Val
Thr Gln Ile Val Ser Ala Glu Ala225 230 235 240Trp Gly Arg Ala Asp
245110621DNAHomo sapiens 110atgcagaagg aagtggagca gaactctgga
cccctcagtg ttccagaggg agccattgcc 60tctctcaact gcacttacag tgaccgaggt
tcccagtcct tcttctggta cagacaatat 120tctgggaaaa gccctgagtt
gataatgtcc atatactcca atggtgacaa agaagatgga 180aggtttacag
cacagctcaa taaagccagc cagtatgttt ctctgctcat cagagactcc
240cagcccagtg attcagccac ctacctctgt gccgttacaa ctgacagctg
ggggaaattg 300cagtttggag cagggaccca ggttgtggtc accccagata
tccagaaccc ggatcctgcc 360gtgtaccagc tgagagactc taaatccagt
gacaagtctg tctgcctatt caccgatttt
420gattctcaaa caaatgtgtc acaaagtaag gattctgatg tgtatatcac
agacaaatgt 480gtgctagaca tgaggtctat ggacttcaag agcaacagtg
ctgtggcctg gagcaacaaa 540tctgactttg catgtgcaaa cgccttcaac
aacagcatta ttccagaaga caccttcttc 600cccagcccag aaagttccta a
621111615DNAHomo sapiens 111atgcaactac tagaacaaag tcctcagttt
ctaagcatcc aagagggaga aaatctcact 60gtgtactgca actcctcaag tgttttttcc
agcttacaat ggtacagaca ggagcctggg 120gaaggtcctg tcctcctggt
gacagtagtt acgggtggag aagtgaagaa gctgaagaga 180ctaacctttc
agtttggtga tgcaagaaag gacagttctc tccacatcac tgcggcccag
240cctggtgata caggcctcta cctctgtgca ggagcgggaa gccaaggaaa
tctcatcttt 300ggaaaaggca ctaaactctc tgttaaacca aatatccaga
acccggatcc tgccgtgtac 360cagctgagag actctaaatc cagtgacaag
tctgtctgcc tattcaccga ttttgattct 420caaacaaatg tgtcacaaag
taaggattct gatgtgtata tcacagacaa atgtgtgcta 480gacatgaggt
ctatggactt caagagcaac agtgctgtgg cctggagcaa caaatctgac
540tttgcatgtg caaacgcctt caacaacagc attattccag aagacacctt
cttccccagc 600ccagaaagtt cctaa 615112735DNAHomo sapiens
112atggtggatg gtggaatcac tcagtcccca aagtacctgt tcagaaagga
aggacagaat 60gtgaccctga gttgtgaaca gaatttgaac cacgatgcca tgtactggta
ccgacaggac 120ccagggcaag ggctgagatt gatctactac tcacagatag
taaatgactt tcagaaagga 180gatatagctg aagggtacag cgtctctcgg
gagaagaagg aatcctttcc tctcactgtg 240acatcggccc aaaagaaccc
gacagctttc tatctctgtg ccagtagttc gaggagctcc 300tacgagcagt
acttcgggcc gggcaccagg ctcacggtca cagaggacct gaaaaacgtg
360ttcccacccg aggtcgctgt gtttgagcca tcagaagcag agatctccca
cacccaaaag 420gccacactgg tgtgcctggc cacaggcttc taccccgacc
acgtggagct gagctggtgg 480gtgaatggga aggaggtgca cagtggggtc
tgcacagacc cgcagcccct caaggagcag 540cccgccctca atgactccag
atacagcctg agcagccgcc tgagggtctc ggccaccttc 600tggcagaacc
cccgcaacca cttccgctgt caagtccagt tctacgggct ctcggagaat
660gacgagtgga cccaggatag ggccaaacct gtcacccaga ttgtcagcgc
cgaggcctgg 720ggtagagcag actaa 735113204PRTHomo sapiens 113Met Gln
Leu Leu Glu Gln Ser Pro Gln Phe Leu Ser Ile Gln Glu Gly1 5 10 15Glu
Asn Leu Thr Val Tyr Cys Asn Ser Ser Ser Val Phe Ser Ser Leu 20 25
30Gln Trp Tyr Arg Gln Glu Pro Gly Glu Gly Pro Val Leu Leu Val Thr
35 40 45Val Val Thr Gly Gly Glu Val Lys Lys Leu Lys Arg Leu Thr Phe
Gln 50 55 60Phe Gly Asp Ala Arg Lys Asp Ser Ser Leu His Ile Thr Ala
Ala Gln65 70 75 80Pro Gly Asp Thr Gly Leu Tyr Leu Cys Ala Gly Ala
Gly Ser Gln Gly 85 90 95Asn Leu Ile Phe Gly Lys Gly Thr Lys Leu Ser
Val Lys Pro Asn Ile 100 105 110Gln Asn Pro Asp Pro Ala Val Tyr Gln
Leu Arg Asp Ser Lys Ser Ser 115 120 125Asp Lys Ser Val Cys Leu Phe
Thr Asp Phe Asp Ser Gln Thr Asn Val 130 135 140Ser Gln Ser Lys Asp
Ser Asp Val Tyr Ile Thr Asp Lys Cys Val Leu145 150 155 160Asp Met
Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val Ala Trp Ser 165 170
175Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser Ile Ile
180 185 190Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser 195
200114244PRTHomo sapiens 114Met Val Asp Gly Gly Ile Thr Gln Ser Pro
Lys Tyr Leu Phe Arg Lys1 5 10 15Glu Gly Gln Asn Val Thr Leu Ser Cys
Glu Gln Asn Leu Asn His Asp 20 25 30Ala Met Tyr Trp Tyr Arg Gln Asp
Pro Gly Gln Gly Leu Arg Leu Ile 35 40 45Tyr Tyr Ser Gln Ile Val Asn
Asp Phe Gln Lys Gly Asp Ile Ala Glu 50 55 60Gly Tyr Ser Val Ser Arg
Glu Lys Lys Glu Ser Phe Pro Leu Thr Val65 70 75 80Thr Ser Ala Gln
Lys Asn Pro Thr Ala Phe Tyr Leu Cys Ala Ser Ser 85 90 95Ser Arg Ser
Ser Tyr Glu Gln Tyr Phe Gly Pro Gly Thr Arg Leu Thr 100 105 110Val
Thr Glu Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala Val Phe 115 120
125Glu Pro Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr Leu Val
130 135 140Cys Leu Ala Thr Gly Phe Tyr Pro Asp His Val Glu Leu Ser
Trp Trp145 150 155 160Val Asn Gly Lys Glu Val His Ser Gly Val Cys
Thr Asp Pro Gln Pro 165 170 175Leu Lys Glu Gln Pro Ala Leu Asn Asp
Ser Arg Tyr Ser Leu Ser Ser 180 185 190Arg Leu Arg Val Ser Ala Thr
Phe Trp Gln Asn Pro Arg Asn His Phe 195 200 205Arg Cys Gln Val Gln
Phe Tyr Gly Leu Ser Glu Asn Asp Glu Trp Thr 210 215 220Gln Asp Arg
Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu Ala Trp225 230 235
240Gly Arg Ala Asp115627DNAHomo sapiens 115atgcaggagg ygacacagat
tcctgcagct ctgagtgtcc cagaaggaga aaacttggtt 60ctcaactgca gtttcactga
tagcgctatt tacaacctcc agtggtttag gcaggaccct 120gggaaaggtc
tcacatctct gttgcttatt cagtcaagtc agagagagca aacaagtgga
180agacttaatg cctcgctgga taaatcatca ggacgtagta ctttatacat
tgcagcttct 240cagcctggtg actcagccac ctacctctgt gctgtgaggc
ccacatcagg aggaagctac 300atacctacat ttggaagagg aaccagcctt
attgttcatc cgtatatcca gaaccctgac 360cctgccgtgt accagctgag
agactctaaa tccagtgaca agtctgtctg cctattcacc 420gattttgatt
ctcaaacaaa tgtgtcacaa agtaaggatt ctgatgtgta tatcacagac
480aaatgtgtgc tagacatgag gtctatggac ttcaagagca acagtgctgt
ggcctggagc 540aacaaatctg actttgcatg tgcaaacgcc ttcaacaaca
gcattattcc agaagacacc 600ttcttcccca gcccagaaag ttcctaa
627116729DNAHomo sapiens 116atgggtgtca ctcagacccc aaaattccag
gtcctgaaga caggacagag catgacactg 60cagtgtgccc aggatatgaa ccatgaatac
atgtcctggt atcgacaaga cccaggcatg 120gggctgaggc tgattcatta
ctcagttggt gctggtatca ctgaccaagg agaagtcccc 180aatggctaca
atgtctccag atcaaccaca gaggatttcc cgctcaggct gctgtcggct
240gctccctccc agacatctgt gtacttctgt gccagcagtt acgtcgggaa
caccggggag 300ctgttttttg gagaaggctc taggctgacc gtactggagg
acctgaaaaa cgtgttccca 360cccgaggtcg ctgtgtttga gccatcagaa
gcagagatct cccacaccca aaaggccaca 420ctggtgtgcc tggccacagg
cttctacccc gaccacgtgg agctgagctg gtgggtgaat 480gggaaggagg
tgcacagtgg ggtctgcaca gacccgcagc ccctcaagga gcagcccgcc
540ctcaatgact ccagatacgc tctgagcagc cgcctgaggg tctcggccac
cttctggcag 600gacccccgca accacttccg ctgtcaagtc cagttctacg
ggctctcgga gaatgacgag 660tggacccagg atagggccaa acccgtcacc
cagatcgtca gcgccgaggc ctggggtaga 720gcagactaa 729117208PRTHomo
sapiensmisc_feature(4)..(4)X is any amino acid 117Met Gln Glu Xaa
Thr Gln Ile Pro Ala Ala Leu Ser Val Pro Glu Gly1 5 10 15Glu Asn Leu
Val Leu Asn Cys Ser Phe Thr Asp Ser Ala Ile Tyr Asn 20 25 30Leu Gln
Trp Phe Arg Gln Asp Pro Gly Lys Gly Leu Thr Ser Leu Leu 35 40 45Leu
Ile Gln Ser Ser Gln Arg Glu Gln Thr Ser Gly Arg Leu Asn Ala 50 55
60Ser Leu Asp Lys Ser Ser Gly Arg Ser Thr Leu Tyr Ile Ala Ala Ser65
70 75 80Gln Pro Gly Asp Ser Ala Thr Tyr Leu Cys Ala Val Arg Pro Thr
Ser 85 90 95Gly Gly Ser Tyr Ile Pro Thr Phe Gly Arg Gly Thr Ser Leu
Ile Val 100 105 110His Pro Tyr Ile Gln Asn Pro Asp Pro Ala Val Tyr
Gln Leu Arg Asp 115 120 125Ser Lys Ser Ser Asp Lys Ser Val Cys Leu
Phe Thr Asp Phe Asp Ser 130 135 140Gln Thr Asn Val Ser Gln Ser Lys
Asp Ser Asp Val Tyr Ile Thr Asp145 150 155 160Lys Cys Val Leu Asp
Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala 165 170 175Val Ala Trp
Ser Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn 180 185 190Asn
Ser Ile Ile Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser 195 200
205118244PRTHomo sapiens 118Met Gly Val Thr Gln Thr Pro Lys Phe Gln
Val Leu Lys Thr Gly Gln1 5 10 15Ser Met Thr Leu Gln Cys Ala Gln Asp
Met Asn His Glu Tyr Met Ser 20 25 30Trp Tyr Arg Gln Asp Pro Gly Met
Glu Thr Gly Leu Arg Leu Ile His 35 40 45Tyr Ser Val Gly Ala Gly Ile
Thr Asp Gln Gly Glu Val Pro Asn Gly 50 55 60Tyr Asn Val Ser Arg Ser
Thr Thr Glu Asp Phe Pro Leu Arg Leu Leu65 70 75 80Ser Ala Ala Pro
Ser Gln Thr Ser Val Tyr Phe Cys Ala Ser Ser Tyr 85 90 95Val Gly Asn
Thr Gly Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu Thr 100 105 110Val
Leu Glu Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala Val Phe 115 120
125Glu Pro Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr Leu Val
130 135 140Cys Leu Ala Thr Gly Phe Tyr Pro Asp His Val Glu Leu Ser
Trp Trp145 150 155 160Val Asn Gly Lys Glu Val His Ser Gly Val Cys
Thr Asp Pro Gln Pro 165 170 175Leu Lys Glu Gln Pro Ala Leu Asn Asp
Ser Arg Tyr Ala Leu Ser Ser 180 185 190Arg Leu Arg Val Ser Ala Thr
Phe Trp Gln Asp Pro Arg Asn His Phe 195 200 205Arg Cys Gln Val Gln
Phe Tyr Gly Leu Ser Glu Asn Asp Glu Trp Thr 210 215 220Gln Asp Arg
Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu Ala Trp225 230 235
240Gly Arg Ala Asp 119630DNAHomo sapiens 119atgcaggagg ygacacagat
tcctgcagct ctgagtgtcc cagaaggaga aaacttggtt 60ctcaactgca gtttcactga
tagcgctatt tacaacctcc agtggtttag gcaggaccct 120gggaaaggtc
tcacatctct gttgcttatt cagtcaagtc agagagagca aacaagtgga
180agacttaatg cctcgctgga taaatcatca ggacgtagta ctttatacat
tgcagcttct 240cagcctggtg actcagccac ctacctctgt gctgtgaggc
ccacatcagg aggaagctac 300atacctacat ttggaagagg aaccagcctt
attgttcatc cgtatatcca gaaccctgac 360cctgccgtgt accagctgag
agactctaaa tccagtgaca agtctgtctg cctattcacc 420gattttgatt
ctcaaacaaa tgtgtcacaa agtaaggatt ctgatgtgta tatcacagac
480aaatgtgtgc tagacatgag gtctatggac ttcaagagca acagtgctgt
ggcctggagc 540aacaaatctg actttgcatg tgcaaacgcc ttcaacaaca
gcattattcc agaagacacc 600ttcttcccca gcccagaaag ttcctgttaa
630120732DNAHomo sapiens 120atgggtgtca ctcagacccc aaaattccag
gtcctgaaga caggacagag catgacactg 60cagtgtgccc aggatatgaa ccatgaatac
atgtcctggt atcgacaaga cccaggcatg 120gggctgaggc tgattcatta
ctcagttggt gctggtatca ctgaccaagg agaagtcccc 180aatggctaca
atgtctccag atcaaccaca gaggatttcc cgctcaggct gctgtcggct
240gctccctccc agacatctgt gtacttctgt gccagcagtt acgtcgggaa
caccggggag 300ctgttttttg gagaaggctc taggctgacc gtactggagg
acctgaaaaa cgtgttccca 360cccgaggtcg ctgtgtttga gccatcagaa
gcagagatct cccacaccca aaaggccaca 420ctggtgtgcc tggccacagg
cttctacccc gaccacgtgg agctgagctg gtgggtgaat 480gggaaggagg
tgcacagtgg ggtctgcaca gacccgcagc ccctcaagga gcagcccgcc
540ctcaatgact ccagatacgc tctgagcagc cgcctgaggg tctcggccac
cttctggcag 600gacccccgca accacttccg ctgtcaagtc cagttctacg
ggctctcgga gaatgacgag 660tggacccagg atagggccaa acccgtcacc
cagatcgtca gcgccgaggc ctggggtaga 720gcagactgtt aa 732121209PRTHomo
sapiensmisc_feature(4)..(4)X is any amino acid 121Met Gln Glu Xaa
Thr Gln Ile Pro Ala Ala Leu Ser Val Pro Glu Gly1 5 10 15Glu Asn Leu
Val Leu Asn Cys Ser Phe Thr Asp Ser Ala Ile Tyr Asn 20 25 30Leu Gln
Trp Phe Arg Gln Asp Pro Gly Lys Gly Leu Thr Ser Leu Leu 35 40 45Leu
Ile Gln Ser Ser Gln Arg Glu Gln Thr Ser Gly Arg Leu Asn Ala 50 55
60Ser Leu Asp Lys Ser Ser Gly Arg Ser Thr Leu Tyr Ile Ala Ala Ser65
70 75 80Gln Pro Gly Asp Ser Ala Thr Tyr Leu Cys Ala Val Arg Pro Thr
Ser 85 90 95Gly Gly Ser Tyr Ile Pro Thr Phe Gly Arg Gly Thr Ser Leu
Ile Val 100 105 110His Pro Tyr Ile Gln Asn Pro Asp Pro Ala Val Tyr
Gln Leu Arg Asp 115 120 125Ser Lys Ser Ser Asp Lys Ser Val Cys Leu
Phe Thr Asp Phe Asp Ser 130 135 140Gln Thr Asn Val Ser Gln Ser Lys
Asp Ser Asp Val Tyr Ile Thr Asp145 150 155 160Lys Cys Val Leu Asp
Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala 165 170 175Val Ala Trp
Ser Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn 180 185 190Asn
Ser Ile Ile Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser 195 200
205Cys122243PRTHomo sapiens 122Met Gly Val Thr Gln Thr Pro Lys Phe
Gln Val Leu Lys Thr Gly Gln1 5 10 15Ser Met Thr Leu Gln Cys Ala Gln
Asp Met Asn His Glu Tyr Met Ser 20 25 30Trp Tyr Arg Gln Asp Pro Gly
Met Gly Leu Arg Leu Ile His Tyr Ser 35 40 45Val Gly Ala Gly Ile Thr
Asp Gln Gly Glu Val Pro Asn Gly Tyr Asn 50 55 60Val Ser Arg Ser Thr
Thr Glu Asp Phe Pro Leu Arg Leu Leu Ser Ala65 70 75 80Ala Pro Ser
Gln Thr Ser Val Tyr Phe Cys Ala Ser Ser Tyr Val Gly 85 90 95Asn Thr
Gly Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu Thr Val Leu 100 105
110Glu Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala Val Phe Glu Pro
115 120 125Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr Leu Val
Cys Leu 130 135 140Ala Thr Gly Phe Tyr Pro Asp His Val Glu Leu Ser
Trp Trp Val Asn145 150 155 160Gly Lys Glu Val His Ser Gly Val Cys
Thr Asp Pro Gln Pro Leu Lys 165 170 175Glu Gln Pro Ala Leu Asn Asp
Ser Arg Tyr Ala Leu Ser Ser Arg Leu 180 185 190Arg Val Ser Ala Thr
Phe Trp Gln Asp Pro Arg Asn His Phe Arg Cys 195 200 205Gln Val Gln
Phe Tyr Gly Leu Ser Glu Asn Asp Glu Trp Thr Gln Asp 210 215 220Arg
Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu Ala Trp Gly Arg225 230
235 240Ala Asp Cys 123624DNAHomo sapiens 123atgaaggagg tggagcagaa
ttctggaccc ctcagtgttc cagagggagc cattgcctct 60ctcaactgca cttacagtga
ccgaggttcc cagtccttct tctggtacag acaatattct 120gggaaaagcc
ctgagttgat aatgttcata tactccaatg gtgacaaaga agatggaagg
180tttacagcac agctcaataa agccagccag tatgtttctc tgctcatcag
agactcccag 240cccagtgatt cagccaccta cctctgtgcc gtgaaggggg
ggtctggggg ttaccagaaa 300gttacctttg gaactggaac aaagctccaa
gtcatcccaa atatccagaa cccggatcct 360gccgtgtacc agctgagaga
ctctaaatcc agtgacaagt ctgtctgcct attcaccgat 420tttgattctc
aaacaaatgt gtcacaaagt aaggattctg atgtgtatat cacagacaaa
480tgtgtgctag acatgaggtc tatggacttc aagagcaaca gtgctgtggc
ctggagcaac 540aaatctgact ttgcatgtgc aaacgccttc aacaacagca
ttattccaga agacaccttc 600ttccccagcc cagaaagttc ctaa
624124735DNAHomo sapiens 124atgggcgtca tgcagaaccc aagacacctg
gtcaggagga ggggacagga ggcaagactg 60agatgcagcc caatgaaagg acacagtcat
gtttactggt atcggcagct cccagaggaa 120ggtctgaaat tcatggttta
tctccagaaa gaaaatatca tagatgagtc aggaatgcca 180aaggaacgat
tttctgctga atttcccaaa gagggcccca gcatcctgag gatccagcag
240gtagtgcgag gagattcggc agcttatttc tgtgccagct caccacagac
agggggcaca 300gatacgcagt attttggccc aggcacccgg ctgacagtgc
tcgaggacct gaaaaacgtg 360ttcccacccg aggtcgctgt gtttgagcca
tcagaagcag agatctccca cacccaaaag 420gccacactgg tgtgcctggc
cacaggcttc taccccgacc acgtggagct gagctggtgg 480gtgaatggga
aggaggtgca cagtggggtc tgcacagacc cgcagcccct caaggagcag
540cccgccctca atgactccag atacgctctg agcagccgcc tgagggtctc
ggccaccttc 600tggcaggacc cccgcaacca cttccgctgt caagtccagt
tctacgggct ctcggagaat 660gacgagtgga cccaggatag ggccaaaccc
gtcacccaga tcgtcagcgc cgaggcctgg 720ggtagagcag actaa
735125207PRTHomo sapiens 125Met Lys Glu Val Glu Gln Asn Ser Gly Pro
Leu Ser Val Pro Glu Gly1 5 10 15Ala Ile Ala Ser Leu Asn Cys Thr Tyr
Ser Asp Arg Gly Ser Gln Ser 20 25 30Phe Phe Trp Tyr Arg Gln Tyr Ser
Gly Lys Ser Pro Glu Leu Ile Met 35 40 45Phe Ile Tyr Ser Asn Gly Asp
Lys Glu Asp Gly Arg Phe Thr Ala Gln 50 55 60Leu Asn Lys Ala Ser Gln
Tyr Val Ser Leu Leu Ile Arg Asp Ser Gln65 70 75
80Pro Ser Asp Ser Ala Thr Tyr Leu Cys Ala Val Lys Gly Gly Ser Gly
85 90 95Gly Tyr Gln Lys Val Thr Phe Gly Thr Gly Thr Lys Leu Gln Val
Ile 100 105 110Pro Asn Ile Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu
Arg Asp Ser 115 120 125Lys Ser Ser Asp Lys Ser Val Cys Leu Phe Thr
Asp Phe Asp Ser Gln 130 135 140Thr Asn Val Ser Gln Ser Lys Asp Ser
Asp Val Tyr Ile Thr Asp Lys145 150 155 160Cys Val Leu Asp Met Arg
Ser Met Asp Phe Lys Ser Asn Ser Ala Val 165 170 175Ala Trp Ser Asn
Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn 180 185 190Ser Ile
Ile Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser 195 200
205126244PRTHomo sapiens 126Met Gly Val Met Gln Asn Pro Arg His Leu
Val Arg Arg Arg Gly Gln1 5 10 15Glu Ala Arg Leu Arg Cys Ser Pro Met
Lys Gly His Ser His Val Tyr 20 25 30Trp Tyr Arg Gln Leu Pro Glu Glu
Gly Leu Lys Phe Met Val Tyr Leu 35 40 45Gln Lys Glu Asn Ile Ile Asp
Glu Ser Gly Met Pro Lys Glu Arg Phe 50 55 60Ser Ala Glu Phe Pro Lys
Glu Gly Pro Ser Ile Leu Arg Ile Gln Gln65 70 75 80Val Val Arg Gly
Asp Ser Ala Ala Tyr Phe Cys Ala Ser Ser Pro Gln 85 90 95Thr Gly Gly
Thr Asp Thr Gln Tyr Phe Gly Pro Gly Thr Arg Leu Thr 100 105 110Val
Leu Glu Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala Val Phe 115 120
125Glu Pro Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr Leu Val
130 135 140Cys Leu Ala Thr Gly Phe Tyr Pro Asp His Val Glu Leu Ser
Trp Trp145 150 155 160Val Asn Gly Lys Glu Val His Ser Gly Val Cys
Thr Asp Pro Gln Pro 165 170 175Leu Lys Glu Gln Pro Ala Leu Asn Asp
Ser Arg Tyr Ala Leu Ser Ser 180 185 190Arg Leu Arg Val Ser Ala Thr
Phe Trp Gln Asp Pro Arg Asn His Phe 195 200 205Arg Cys Gln Val Gln
Phe Tyr Gly Leu Ser Glu Asn Asp Glu Trp Thr 210 215 220Gln Asp Arg
Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu Ala Trp225 230 235
240Gly Arg Ala Asp 127621DNAHomo sapiens 127atgcagaagg aagtggagca
gaactctgga cccctcagtg ttccagaggg agccattgcc 60tctctcaact gcacttacag
tgaccgaggt tcccagtcct tcttctggta cagacaatat 120tctgggaaaa
gccctgagtt gataatgtcc atatactcca atggtgacaa agaagatgga
180aggtttacag cacagctcaa taaagccagc cagtatgttt ctctgctcat
cagagactcc 240cagcccagtg attcagccac ctacctctgt gccgttacaa
ctgacagctg ggggaaattg 300cagtttggag cagggaccca ggttgtggtc
accccagata tccagaaccc tgaccctgcc 360gtgtaccagc tgagagactc
taaatccagt gacaagtctg tctgcctatt caccgatttt 420gattctcaaa
caaatgtgtc acaaagtaag gattctgatg tgtatatcac agacaaatgt
480gtgctagaca tgaggtctat ggacttcaag agcaacagtg ctgtggcctg
gagcaacaaa 540tctgactttg catgtgcaaa cgccttcaac aacagcatta
ttccagaaga caccttcttc 600cccagcccag aaagttccta a 621128206PRTHomo
sapiens 128Met Gln Lys Glu Val Glu Gln Asn Ser Gly Pro Leu Ser Val
Pro Glu1 5 10 15Gly Ala Ile Ala Ser Leu Asn Cys Thr Tyr Ser Asp Arg
Gly Ser Gln 20 25 30Ser Phe Phe Trp Tyr Arg Gln Tyr Ser Gly Lys Ser
Pro Glu Leu Ile 35 40 45Met Ser Ile Tyr Ser Asn Gly Asp Lys Glu Asp
Gly Arg Phe Thr Ala 50 55 60Gln Leu Asn Lys Ala Ser Gln Tyr Val Ser
Leu Leu Ile Arg Asp Ser65 70 75 80Gln Pro Ser Asp Ser Ala Thr Tyr
Leu Cys Ala Val Thr Thr Asp Ser 85 90 95Trp Gly Lys Leu Gln Phe Gly
Ala Gly Thr Gln Val Val Val Thr Pro 100 105 110Asp Ile Gln Asn Pro
Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys 115 120 125Ser Ser Asp
Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr 130 135 140Asn
Val Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Cys145 150
155 160Val Leu Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val
Ala 165 170 175Trp Ser Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe
Asn Asn Ser 180 185 190Ile Ile Pro Glu Asp Thr Phe Phe Pro Ser Pro
Glu Ser Ser 195 200 205129621DNAHomo sapiens 129atgcagaagg
aagtggagca gaactctgga cccctcagtg ttccagaggg agccattgcc 60tctctcaact
gcacttacag tgaccgaggt tcccagtcct tcttctggta cagacaatat
120tctgggaaaa gccctgagtt gataatgtcc atatactcca atggtgacaa
agaagatgga 180aggtttacag cacagctcaa taaagccagc cagtatgttt
ctctgctcat cagagactcc 240cagcccagtg attcagccac ctacctctgt
gccgttacaa ctgacagctg ggggaaattg 300cagtttggag cagggaccca
ggttgtggtc accccagata tccagaaccc tgaccctgcc 360gtgtaccagc
tgagagactc taaatccagt gacaagtctg tctgcctatt caccgatttt
420gattctcaaa caaatgtgtc acaaagtaag gattctgatg tgtatatctg
tgacaaaact 480gtgctagaca tgaggtctat ggacttcaag agcaacagtg
ctgtggcctg gagcaacaaa 540tctgactttg catgtgcaaa cgccttcaac
aacagcatta ttccagaaga caccttcttc 600cccagcccag aaagttccta a
621130206PRTHomo sapiens 130Met Gln Lys Glu Val Glu Gln Asn Ser Gly
Pro Leu Ser Val Pro Glu1 5 10 15Gly Ala Ile Ala Ser Leu Asn Cys Thr
Tyr Ser Asp Arg Gly Ser Gln 20 25 30Ser Phe Phe Trp Tyr Arg Gln Tyr
Ser Gly Lys Ser Pro Glu Leu Ile 35 40 45Met Ser Ile Tyr Ser Asn Gly
Asp Lys Glu Asp Gly Arg Phe Thr Ala 50 55 60Gln Leu Asn Lys Ala Ser
Gln Tyr Val Ser Leu Leu Ile Arg Asp Ser65 70 75 80Gln Pro Ser Asp
Ser Ala Thr Tyr Leu Cys Ala Val Thr Thr Asp Ser 85 90 95Trp Gly Lys
Leu Gln Phe Gly Ala Gly Thr Gln Val Val Val Thr Pro 100 105 110Asp
Ile Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys 115 120
125Ser Ser Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr
130 135 140Asn Val Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Cys Asp
Lys Thr145 150 155 160Val Leu Asp Met Arg Ser Met Asp Phe Lys Ser
Asn Ser Ala Val Ala 165 170 175Trp Ser Asn Lys Ser Asp Phe Ala Cys
Ala Asn Ala Phe Asn Asn Ser 180 185 190Ile Ile Pro Glu Asp Thr Phe
Phe Pro Ser Pro Glu Ser Ser 195 200 205131621DNAHomo sapiens
131atgcagaagg aagtggagca gaactctgga cccctcagtg ttccagaggg
agccattgcc 60tctctcaact gcacttacag tgaccgaggt tcccagtcct tcttctggta
cagacaatat 120tctgggaaaa gccctgagtt gataatgtcc atatactcca
atggtgacaa agaagatgga 180aggtttacag cacagctcaa taaagccagc
cagtatgttt ctctgctcat cagagactcc 240cagcccagtg attcagccac
ctacctctgt gccgttacaa ctgacagctg ggggaaattg 300cagtttggag
cagggaccca ggttgtggtc accccagata tccagaaccc tgaccctgcc
360gtgtaccagc tgagagactc taaatccagt gacaagtctg tctgcctatt
caccgatttt 420gattctcaaa caaatgtgtc acaaagtaag gattctgatg
tgtatatcac agacaaaact 480gtgctagaca tgaggtctat ggacttcaag
agcaactgtg ctgtggcctg gagcaacaaa 540tctgactttg catgtgcaaa
cgccttcaac aacagcatta ttccagaaga caccttcttc 600cccagcccag
aaagttccta a 621132206PRTHomo sapiens 132Met Gln Lys Glu Val Glu
Gln Asn Ser Gly Pro Leu Ser Val Pro Glu1 5 10 15Gly Ala Ile Ala Ser
Leu Asn Cys Thr Tyr Ser Asp Arg Gly Ser Gln 20 25 30Ser Phe Phe Trp
Tyr Arg Gln Tyr Ser Gly Lys Ser Pro Glu Leu Ile 35 40 45Met Ser Ile
Tyr Ser Asn Gly Asp Lys Glu Asp Gly Arg Phe Thr Ala 50 55 60Gln Leu
Asn Lys Ala Ser Gln Tyr Val Ser Leu Leu Ile Arg Asp Ser65 70 75
80Gln Pro Ser Asp Ser Ala Thr Tyr Leu Cys Ala Val Thr Thr Asp Ser
85 90 95Trp Gly Lys Leu Gln Phe Gly Ala Gly Thr Gln Val Val Val Thr
Pro 100 105 110Asp Ile Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg
Asp Ser Lys 115 120 125Ser Ser Asp Lys Ser Val Cys Leu Phe Thr Asp
Phe Asp Ser Gln Thr 130 135 140Asn Val Ser Gln Ser Lys Asp Ser Asp
Val Tyr Ile Thr Asp Lys Thr145 150 155 160Val Leu Asp Met Arg Ser
Met Asp Phe Lys Ser Asn Cys Ala Val Ala 165 170 175Trp Ser Asn Lys
Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser 180 185 190Ile Ile
Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser 195 200
205133621DNAHomo sapiens 133atgcagaagg aagtggagca gaactctgga
cccctcagtg ttccagaggg agccattgcc 60tctctcaact gcacttacag tgaccgaggt
tcccagtcct tcttctggta cagacaatat 120tctgggaaaa gccctgagtt
gataatgtcc atatactcca atggtgacaa agaagatgga 180aggtttacag
cacagctcaa taaagccagc cagtatgttt ctctgctcat cagagactcc
240cagcccagtg attcagccac ctacctctgt gccgttacaa ctgacagctg
ggggaaattg 300cagtttggag cagggaccca ggttgtggtc accccagata
tccagaaccc tgaccctgcc 360gtgtaccagc tgagagactc taaatccagt
gacaagtctg tctgcctatt caccgatttt 420gattctcaaa caaatgtgtc
acaaagtaag gattctgatg tgtatatcac agacaaaact 480gtgtgtgaca
tgaggtctat ggacttcaag agcaacagtg ctgtggcctg gagcaacaaa
540tctgactttg catgtgcaaa cgccttcaac aacagcatta ttccagaaga
caccttcttc 600cccagcccag aaagttccta a 621134206PRTHomo sapiens
134Met Gln Lys Glu Val Glu Gln Asn Ser Gly Pro Leu Ser Val Pro Glu1
5 10 15Gly Ala Ile Ala Ser Leu Asn Cys Thr Tyr Ser Asp Arg Gly Ser
Gln 20 25 30Ser Phe Phe Trp Tyr Arg Gln Tyr Ser Gly Lys Ser Pro Glu
Leu Ile 35 40 45Met Ser Ile Tyr Ser Asn Gly Asp Lys Glu Asp Gly Arg
Phe Thr Ala 50 55 60Gln Leu Asn Lys Ala Ser Gln Tyr Val Ser Leu Leu
Ile Arg Asp Ser65 70 75 80Gln Pro Ser Asp Ser Ala Thr Tyr Leu Cys
Ala Val Thr Thr Asp Ser 85 90 95Trp Gly Lys Leu Gln Phe Gly Ala Gly
Thr Gln Val Val Val Thr Pro 100 105 110Asp Ile Gln Asn Pro Asp Pro
Ala Val Tyr Gln Leu Arg Asp Ser Lys 115 120 125Ser Ser Asp Lys Ser
Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr 130 135 140Asn Val Ser
Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr145 150 155
160Val Cys Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val Ala
165 170 175Trp Ser Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn
Asn Ser 180 185 190Ile Ile Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu
Ser Ser 195 200 205135621DNAHomo sapiens 135atgcagaagg aagtggagca
gaactctgga cccctcagtg ttccagaggg agccattgcc 60tctctcaact gcacttacag
tgaccgaggt tcccagtcct tcttctggta cagacaatat 120tctgggaaaa
gccctgagtt gataatgtcc atatactcca atggtgacaa agaagatgga
180aggtttacag cacagctcaa taaagccagc cagtatgttt ctctgctcat
cagagactcc 240cagcccagtg attcagccac ctacctctgt gccgttacaa
ctgacagctg ggggaaattg 300cagtttggag cagggaccca ggttgtggtc
accccagata tccagaaccc tgaccctgcc 360gtgtgccagc tgagagactc
taaatccagt gacaagtctg tctgcctatt caccgatttt 420gattctcaaa
caaatgtgtc acaaagtaag gattctgatg tgtatatcac agacaaaact
480gtgctagaca tgaggtctat ggacttcaag agcaacagtg ctgtggcctg
gagcaacaaa 540tctgactttg catgtgcaaa cgccttcaac aacagcatta
ttccagaaga caccttcttc 600cccagcccag aaagttccta a 621136206PRTHomo
sapiens 136Met Gln Lys Glu Val Glu Gln Asn Ser Gly Pro Leu Ser Val
Pro Glu1 5 10 15Gly Ala Ile Ala Ser Leu Asn Cys Thr Tyr Ser Asp Arg
Gly Ser Gln 20 25 30Ser Phe Phe Trp Tyr Arg Gln Tyr Ser Gly Lys Ser
Pro Glu Leu Ile 35 40 45Met Ser Ile Tyr Ser Asn Gly Asp Lys Glu Asp
Gly Arg Phe Thr Ala 50 55 60Gln Leu Asn Lys Ala Ser Gln Tyr Val Ser
Leu Leu Ile Arg Asp Ser65 70 75 80Gln Pro Ser Asp Ser Ala Thr Tyr
Leu Cys Ala Val Thr Thr Asp Ser 85 90 95Trp Gly Lys Leu Gln Phe Gly
Ala Gly Thr Gln Val Val Val Thr Pro 100 105 110Asp Ile Gln Asn Pro
Asp Pro Ala Val Cys Gln Leu Arg Asp Ser Lys 115 120 125Ser Ser Asp
Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr 130 135 140Asn
Val Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr145 150
155 160Val Leu Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val
Ala 165 170 175Trp Ser Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe
Asn Asn Ser 180 185 190Ile Ile Pro Glu Asp Thr Phe Phe Pro Ser Pro
Glu Ser Ser 195 200 205137621DNAHomo sapiens 137atgcagaagg
aagtggagca gaactctgga cccctcagtg ttccagaggg agccattgcc 60tctctcaact
gcacttacag tgaccgaggt tcccagtcct tcttctggta cagacaatat
120tctgggaaaa gccctgagtt gataatgtcc atatactcca atggtgacaa
agaagatgga 180aggtttacag cacagctcaa taaagccagc cagtatgttt
ctctgctcat cagagactcc 240cagcccagtg attcagccac ctacctctgt
gccgttacaa ctgacagctg ggggaaattg 300cagtttggag cagggaccca
ggttgtggtc accccagata tccagaaccc tgaccctgcc 360gtgtaccagc
tgagagactg taaatccagt gacaagtctg tctgcctatt caccgatttt
420gattctcaaa caaatgtgtc acaaagtaag gattctgatg tgtatatcac
agacaaaact 480gtgctagaca tgaggtctat ggacttcaag agcaacagtg
ctgtggcctg gagcaacaaa 540tctgactttg catgtgcaaa cgccttcaac
aacagcatta ttccagaaga caccttcttc 600cccagcccag aaagttccta a
621138206PRTHomo sapiens 138Met Gln Lys Glu Val Glu Gln Asn Ser Gly
Pro Leu Ser Val Pro Glu1 5 10 15Gly Ala Ile Ala Ser Leu Asn Cys Thr
Tyr Ser Asp Arg Gly Ser Gln 20 25 30Ser Phe Phe Trp Tyr Arg Gln Tyr
Ser Gly Lys Ser Pro Glu Leu Ile 35 40 45Met Ser Ile Tyr Ser Asn Gly
Asp Lys Glu Asp Gly Arg Phe Thr Ala 50 55 60Gln Leu Asn Lys Ala Ser
Gln Tyr Val Ser Leu Leu Ile Arg Asp Ser65 70 75 80Gln Pro Ser Asp
Ser Ala Thr Tyr Leu Cys Ala Val Thr Thr Asp Ser 85 90 95Trp Gly Lys
Leu Gln Phe Gly Ala Gly Thr Gln Val Val Val Thr Pro 100 105 110Asp
Ile Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Cys Lys 115 120
125Ser Ser Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr
130 135 140Asn Val Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp
Lys Thr145 150 155 160Val Leu Asp Met Arg Ser Met Asp Phe Lys Ser
Asn Ser Ala Val Ala 165 170 175Trp Ser Asn Lys Ser Asp Phe Ala Cys
Ala Asn Ala Phe Asn Asn Ser 180 185 190Ile Ile Pro Glu Asp Thr Phe
Phe Pro Ser Pro Glu Ser Ser 195 200 205139621DNAHomo sapiens
139atgcagaagg aagtggagca gaactctgga cccctcagtg ttccagaggg
agccattgcc 60tctctcaact gcacttacag tgaccgaggt tcccagtcct tcttctggta
cagacaatat 120tctgggaaaa gccctgagtt gataatgtcc atatactcca
atggtgacaa agaagatgga 180aggtttacag cacagctcaa taaagccagc
cagtatgttt ctctgctcat cagagactcc 240cagcccagtg attcagccac
ctacctctgt gccgttacaa ctgacagctg ggggaaattg 300cagtttggag
cagggaccca ggttgtggtc accccagata tccagaaccc tgaccctgcc
360gtgtaccagt gcagagactc taaatccagt gacaagtctg tctgcctatt
caccgatttt 420gattctcaaa caaatgtgtc acaaagtaag gattctgatg
tgtatatcac agacaaaact 480gtgctagaca tgaggtctat ggacttcaag
agcaacagtg ctgtggcctg gagcaacaaa 540tctgactttg catgtgcaaa
cgccttcaac aacagcatta ttccagaaga caccttcttc 600cccagcccag
aaagttccta a 621140206PRTHomo sapiens 140Met Gln Lys Glu Val Glu
Gln Asn Ser Gly Pro Leu Ser Val Pro Glu1 5 10 15Gly Ala Ile Ala Ser
Leu Asn Cys Thr Tyr Ser Asp Arg Gly Ser Gln 20 25 30Ser Phe Phe Trp
Tyr Arg Gln Tyr Ser Gly Lys Ser Pro Glu Leu Ile 35 40 45Met Ser Ile
Tyr Ser Asn Gly Asp Lys Glu Asp Gly Arg Phe Thr Ala 50 55
60Gln Leu Asn Lys Ala Ser Gln Tyr Val Ser Leu Leu Ile Arg Asp Ser65
70 75 80Gln Pro Ser Asp Ser Ala Thr Tyr Leu Cys Ala Val Thr Thr Asp
Ser 85 90 95Trp Gly Lys Leu Gln Phe Gly Ala Gly Thr Gln Val Val Val
Thr Pro 100 105 110Asp Ile Gln Asn Pro Asp Pro Ala Val Tyr Gln Cys
Arg Asp Ser Lys 115 120 125Ser Ser Asp Lys Ser Val Cys Leu Phe Thr
Asp Phe Asp Ser Gln Thr 130 135 140Asn Val Ser Gln Ser Lys Asp Ser
Asp Val Tyr Ile Thr Asp Lys Thr145 150 155 160Val Leu Asp Met Arg
Ser Met Asp Phe Lys Ser Asn Ser Ala Val Ala 165 170 175Trp Ser Asn
Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser 180 185 190Ile
Ile Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser 195 200
205141621DNAHomo sapiens 141atgcagaagg aagtggagca gaactctgga
cccctcagtg ttccagaggg agccattgcc 60tctctcaact gcacttacag tgaccgaggt
tcccagtcct tcttctggta cagacaatat 120tctgggaaaa gccctgagtt
gataatgtcc atatactcca atggtgacaa agaagatgga 180aggtttacag
cacagctcaa taaagccagc cagtatgttt ctctgctcat cagagactcc
240cagcccagtg attcagccac ctacctctgt gccgttacaa ctgacagctg
ggggaaattg 300cagtttggag cagggaccca ggttgtggtc accccagata
tccagaaccc tgaccctgcc 360gtgtaccagc tgagagactc taaatccagt
gacaagtctt gctgcctatt caccgatttt 420gattctcaaa caaatgtgtc
acaaagtaag gattctgatg tgtatatcac agacaaaact 480gtgctagaca
tgaggtctat ggacttcaag agcaacagtg ctgtggcctg gagcaacaaa
540tctgactttg catgtgcaaa cgccttcaac aacagcatta ttccagaaga
caccttcttc 600cccagcccag aaagttccta a 621142206PRTHomo sapiens
142Met Gln Lys Glu Val Glu Gln Asn Ser Gly Pro Leu Ser Val Pro Glu1
5 10 15Gly Ala Ile Ala Ser Leu Asn Cys Thr Tyr Ser Asp Arg Gly Ser
Gln 20 25 30Ser Phe Phe Trp Tyr Arg Gln Tyr Ser Gly Lys Ser Pro Glu
Leu Ile 35 40 45Met Ser Ile Tyr Ser Asn Gly Asp Lys Glu Asp Gly Arg
Phe Thr Ala 50 55 60Gln Leu Asn Lys Ala Ser Gln Tyr Val Ser Leu Leu
Ile Arg Asp Ser65 70 75 80Gln Pro Ser Asp Ser Ala Thr Tyr Leu Cys
Ala Val Thr Thr Asp Ser 85 90 95Trp Gly Lys Leu Gln Phe Gly Ala Gly
Thr Gln Val Val Val Thr Pro 100 105 110Asp Ile Gln Asn Pro Asp Pro
Ala Val Tyr Gln Leu Arg Asp Ser Lys 115 120 125Ser Ser Asp Lys Ser
Cys Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr 130 135 140Asn Val Ser
Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr145 150 155
160Val Leu Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val Ala
165 170 175Trp Ser Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn
Asn Ser 180 185 190Ile Ile Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu
Ser Ser 195 200 205143621DNAHomo sapiens 143atgcagaagg aagtggagca
gaactctgga cccctcagtg ttccagaggg agccattgcc 60tctctcaact gcacttacag
tgaccgaggt tcccagtcct tcttctggta cagacaatat 120tctgggaaaa
gccctgagtt gataatgtcc atatactcca atggtgacaa agaagatgga
180aggtttacag cacagctcaa taaagccagc cagtatgttt ctctgctcat
cagagactcc 240cagcccagtg attcagccac ctacctctgt gccgttacaa
ctgacagctg ggggaaattg 300cagtttggag cagggaccca ggttgtggtc
accccagata tccagaaccc tgaccctgcc 360gtgtaccagc tgagagactc
taaatccagt gacaagtctg tctgcctatt caccgatttt 420gattctcaaa
caaatgtgtc acaaagtaag gattctgatg tgtatatcac agacaaaact
480gtgctagact gtaggtctat ggacttcaag agcaacagtg ctgtggcctg
gagcaacaaa 540tctgactttg catgtgcaaa cgccttcaac aacagcatta
ttccagaaga caccttcttc 600cccagcccag aaagttccta a 621144206PRTHomo
sapiens 144Met Gln Lys Glu Val Glu Gln Asn Ser Gly Pro Leu Ser Val
Pro Glu1 5 10 15Gly Ala Ile Ala Ser Leu Asn Cys Thr Tyr Ser Asp Arg
Gly Ser Gln 20 25 30Ser Phe Phe Trp Tyr Arg Gln Tyr Ser Gly Lys Ser
Pro Glu Leu Ile 35 40 45Met Ser Ile Tyr Ser Asn Gly Asp Lys Glu Asp
Gly Arg Phe Thr Ala 50 55 60Gln Leu Asn Lys Ala Ser Gln Tyr Val Ser
Leu Leu Ile Arg Asp Ser65 70 75 80Gln Pro Ser Asp Ser Ala Thr Tyr
Leu Cys Ala Val Thr Thr Asp Ser 85 90 95Trp Gly Lys Leu Gln Phe Gly
Ala Gly Thr Gln Val Val Val Thr Pro 100 105 110Asp Ile Gln Asn Pro
Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys 115 120 125Ser Ser Asp
Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr 130 135 140Asn
Val Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr145 150
155 160Val Leu Asp Cys Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val
Ala 165 170 175Trp Ser Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe
Asn Asn Ser 180 185 190Ile Ile Pro Glu Asp Thr Phe Phe Pro Ser Pro
Glu Ser Ser 195 200 205145621DNAHomo sapiens 145atgcagaagg
aagtggagca gaactctgga cccctcagtg ttccagaggg agccattgcc 60tctctcaact
gcacttacag tgaccgaggt tcccagtcct tcttctggta cagacaatat
120tctgggaaaa gccctgagtt gataatgtcc atatactcca atggtgacaa
agaagatgga 180aggtttacag cacagctcaa taaagccagc cagtatgttt
ctctgctcat cagagactcc 240cagcccagtg attcagccac ctacctctgt
gccgttacaa ctgacagctg ggggaaattg 300cagtttggag cagggaccca
ggttgtggtc accccagata tccagaaccc tgaccctgcc 360gtgtaccagc
tgagagactc taaatccagt gacaagtctg tctgcctatt caccgatttt
420gattctcaaa caaatgtgtc acaaagtaag gattctgatg tgtgtatcac
agacaaaact 480gtgctagaca tgaggtctat ggacttcaag agcaacagtg
ctgtggcctg gagcaacaaa 540tctgactttg catgtgcaaa cgccttcaac
aacagcatta ttccagaaga caccttcttc 600cccagcccag aaagttccta a
621146206PRTHomo sapiens 146Met Gln Lys Glu Val Glu Gln Asn Ser Gly
Pro Leu Ser Val Pro Glu1 5 10 15Gly Ala Ile Ala Ser Leu Asn Cys Thr
Tyr Ser Asp Arg Gly Ser Gln 20 25 30Ser Phe Phe Trp Tyr Arg Gln Tyr
Ser Gly Lys Ser Pro Glu Leu Ile 35 40 45Met Ser Ile Tyr Ser Asn Gly
Asp Lys Glu Asp Gly Arg Phe Thr Ala 50 55 60Gln Leu Asn Lys Ala Ser
Gln Tyr Val Ser Leu Leu Ile Arg Asp Ser65 70 75 80Gln Pro Ser Asp
Ser Ala Thr Tyr Leu Cys Ala Val Thr Thr Asp Ser 85 90 95Trp Gly Lys
Leu Gln Phe Gly Ala Gly Thr Gln Val Val Val Thr Pro 100 105 110Asp
Ile Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys 115 120
125Ser Ser Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr
130 135 140Asn Val Ser Gln Ser Lys Asp Ser Asp Val Cys Ile Thr Asp
Lys Thr145 150 155 160Val Leu Asp Met Arg Ser Met Asp Phe Lys Ser
Asn Ser Ala Val Ala 165 170 175Trp Ser Asn Lys Ser Asp Phe Ala Cys
Ala Asn Ala Phe Asn Asn Ser 180 185 190Ile Ile Pro Glu Asp Thr Phe
Phe Pro Ser Pro Glu Ser Ser 195 200 205147741DNAHomo sapiens
147atgaacgctg gtgtcactca gaccccaaaa ttccaggtcc tgaagacagg
acagagcatg 60acactgcagt gtgcccagga tatgaaccat gaatacatgt cctggtatcg
acaagaccca 120ggcatggggc tgaggctgat tcattactca gttggtgctg
gtatcactga ccaaggagaa 180gtccccaatg gctacaatgt ctccagatca
accacagagg atttcccgct caggctgctg 240tcggctgctc cctcccagac
atctgtgtac ttctgtgcca gcaggccggg actagcggga 300gggcgaccag
agcagtactt cgggccgggc accaggctca cggtcacaga ggacctgaaa
360aacgtgttcc cacccgaggt cgctgtgttt gagccatcag aagcagagat
ctcccacacc 420caaaaggcca cactggtgtg cctggccaca ggcttctacc
ccgaccacgt ggagctgagc 480tggtgggtga atgggaagga ggtgcacagt
ggggtctgca cagacccgca gcccctcaag 540gagcagcccg ccctcaatga
ctccagatac gctctgagca gccgcctgag ggtctcggcc 600accttctggc
aggacccccg caaccacttc cgctgtcaag tccagttcta cgggctctcg
660gagaatgacg agtggaccca ggatagggcc aaacccgtca cccagatcgt
cagcgccgag 720gcctggggta gagcagacta a 741148246PRTHomo sapiens
148Met Asn Ala Gly Val Thr Gln Thr Pro Lys Phe Gln Val Leu Lys Thr1
5 10 15Gly Gln Ser Met Thr Leu Gln Cys Ala Gln Asp Met Asn His Glu
Tyr 20 25 30Met Ser Trp Tyr Arg Gln Asp Pro Gly Met Gly Leu Arg Leu
Ile His 35 40 45Tyr Ser Val Gly Ala Gly Ile Thr Asp Gln Gly Glu Val
Pro Asn Gly 50 55 60Tyr Asn Val Ser Arg Ser Thr Thr Glu Asp Phe Pro
Leu Arg Leu Leu65 70 75 80Ser Ala Ala Pro Ser Gln Thr Ser Val Tyr
Phe Cys Ala Ser Arg Pro 85 90 95Gly Leu Ala Gly Gly Arg Pro Glu Gln
Tyr Phe Gly Pro Gly Thr Arg 100 105 110Leu Thr Val Thr Glu Asp Leu
Lys Asn Val Phe Pro Pro Glu Val Ala 115 120 125Val Phe Glu Pro Ser
Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr 130 135 140Leu Val Cys
Leu Ala Thr Gly Phe Tyr Pro Asp His Val Glu Leu Ser145 150 155
160Trp Trp Val Asn Gly Lys Glu Val His Ser Gly Val Cys Thr Asp Pro
165 170 175Gln Pro Leu Lys Glu Gln Pro Ala Leu Asn Asp Ser Arg Tyr
Ala Leu 180 185 190Ser Ser Arg Leu Arg Val Ser Ala Thr Phe Trp Gln
Asp Pro Arg Asn 195 200 205His Phe Arg Cys Gln Val Gln Phe Tyr Gly
Leu Ser Glu Asn Asp Glu 210 215 220Trp Thr Gln Asp Arg Ala Lys Pro
Val Thr Gln Ile Val Ser Ala Glu225 230 235 240Ala Trp Gly Arg Ala
Asp 245149741DNAHomo sapiens 149atgaacgctg gtgtcactca gaccccaaaa
ttccaggtcc tgaagacagg acagagcatg 60acactgcagt gtgcccagga tatgaaccat
gaatacatgt cctggtatcg acaagaccca 120ggcatggggc tgaggctgat
tcattactca gttggtgctg gtatcactga ccaaggagaa 180gtccccaatg
gctacaatgt ctccagatca accacagagg atttcccgct caggctgctg
240tcggctgctc cctcccagac atctgtgtac ttctgtgcca gcaggccggg
actagcggga 300gggcgaccag agcagtactt cgggccgggc accaggctca
cggtcacaga ggacctgaaa 360aacgtgttcc cacccgaggt cgctgtgttt
gagccatcag aagcagagat ctcccacacc 420caaaaggcca cactggtgtg
cctggccaca ggcttctacc ccgaccacgt ggagctgagc 480tggtgggtga
atgggaagga ggtgcacagt ggggtcagca cagacccgca gcccctcaag
540gagcagcccg ccctcaatga ctccagatac gctctgtgta gccgcctgag
ggtctcggcc 600accttctggc aggacccccg caaccacttc cgctgtcaag
tccagttcta cgggctctcg 660gagaatgacg agtggaccca ggatagggcc
aaacccgtca cccagatcgt cagcgccgag 720gcctggggta gagcagacta a
741150246PRTHomo sapiens 150Met Asn Ala Gly Val Thr Gln Thr Pro Lys
Phe Gln Val Leu Lys Thr1 5 10 15Gly Gln Ser Met Thr Leu Gln Cys Ala
Gln Asp Met Asn His Glu Tyr 20 25 30Met Ser Trp Tyr Arg Gln Asp Pro
Gly Met Gly Leu Arg Leu Ile His 35 40 45Tyr Ser Val Gly Ala Gly Ile
Thr Asp Gln Gly Glu Val Pro Asn Gly 50 55 60Tyr Asn Val Ser Arg Ser
Thr Thr Glu Asp Phe Pro Leu Arg Leu Leu65 70 75 80Ser Ala Ala Pro
Ser Gln Thr Ser Val Tyr Phe Cys Ala Ser Arg Pro 85 90 95Gly Leu Ala
Gly Gly Arg Pro Glu Gln Tyr Phe Gly Pro Gly Thr Arg 100 105 110Leu
Thr Val Thr Glu Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala 115 120
125Val Phe Glu Pro Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr
130 135 140Leu Val Cys Leu Ala Thr Gly Phe Tyr Pro Asp His Val Glu
Leu Ser145 150 155 160Trp Trp Val Asn Gly Lys Glu Val His Ser Gly
Val Ser Thr Asp Pro 165 170 175Gln Pro Leu Lys Glu Gln Pro Ala Leu
Asn Asp Ser Arg Tyr Ala Leu 180 185 190Cys Ser Arg Leu Arg Val Ser
Ala Thr Phe Trp Gln Asp Pro Arg Asn 195 200 205His Phe Arg Cys Gln
Val Gln Phe Tyr Gly Leu Ser Glu Asn Asp Glu 210 215 220Trp Thr Gln
Asp Arg Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu225 230 235
240Ala Trp Gly Arg Ala Asp 245151741DNAHomo sapiens 151atgaacgctg
gtgtcactca gaccccaaaa ttccaggtcc tgaagacagg acagagcatg 60acactgcagt
gtgcccagga tatgaaccat gaatacatgt cctggtatcg acaagaccca
120ggcatggggc tgaggctgat tcattactca gttggtgctg gtatcactga
ccaaggagaa 180gtccccaatg gctacaatgt ctccagatca accacagagg
atttcccgct caggctgctg 240tcggctgctc cctcccagac atctgtgtac
ttctgtgcca gcaggccggg actagcggga 300gggcgaccag agcagtactt
cgggccgggc accaggctca cggtcacaga ggacctgaaa 360aacgtgttcc
cacccgaggt cgctgtgttt gagccatgtg aagcagagat ctcccacacc
420caaaaggcca cactggtgtg cctggccaca ggcttctacc ccgaccacgt
ggagctgagc 480tggtgggtga atgggaagga ggtgcacagt ggggtcagca
cagacccgca gcccctcaag 540gagcagcccg ccctcaatga ctccagatac
gctctgagca gccgcctgag ggtctcggcc 600accttctggc aggacccccg
caaccacttc cgctgtcaag tccagttcta cgggctctcg 660gagaatgacg
agtggaccca ggatagggcc aaacccgtca cccagatcgt cagcgccgag
720gcctggggta gagcagacta a 741152246PRTHomo sapiens 152Met Asn Ala
Gly Val Thr Gln Thr Pro Lys Phe Gln Val Leu Lys Thr1 5 10 15Gly Gln
Ser Met Thr Leu Gln Cys Ala Gln Asp Met Asn His Glu Tyr 20 25 30Met
Ser Trp Tyr Arg Gln Asp Pro Gly Met Gly Leu Arg Leu Ile His 35 40
45Tyr Ser Val Gly Ala Gly Ile Thr Asp Gln Gly Glu Val Pro Asn Gly
50 55 60Tyr Asn Val Ser Arg Ser Thr Thr Glu Asp Phe Pro Leu Arg Leu
Leu65 70 75 80Ser Ala Ala Pro Ser Gln Thr Ser Val Tyr Phe Cys Ala
Ser Arg Pro 85 90 95Gly Leu Ala Gly Gly Arg Pro Glu Gln Tyr Phe Gly
Pro Gly Thr Arg 100 105 110Leu Thr Val Thr Glu Asp Leu Lys Asn Val
Phe Pro Pro Glu Val Ala 115 120 125Val Phe Glu Pro Cys Glu Ala Glu
Ile Ser His Thr Gln Lys Ala Thr 130 135 140Leu Val Cys Leu Ala Thr
Gly Phe Tyr Pro Asp His Val Glu Leu Ser145 150 155 160Trp Trp Val
Asn Gly Lys Glu Val His Ser Gly Val Ser Thr Asp Pro 165 170 175Gln
Pro Leu Lys Glu Gln Pro Ala Leu Asn Asp Ser Arg Tyr Ala Leu 180 185
190Ser Ser Arg Leu Arg Val Ser Ala Thr Phe Trp Gln Asp Pro Arg Asn
195 200 205His Phe Arg Cys Gln Val Gln Phe Tyr Gly Leu Ser Glu Asn
Asp Glu 210 215 220Trp Thr Gln Asp Arg Ala Lys Pro Val Thr Gln Ile
Val Ser Ala Glu225 230 235 240Ala Trp Gly Arg Ala Asp
245153741DNAHomo sapiens 153atgaacgctg gtgtcactca gaccccaaaa
ttccaggtcc tgaagacagg acagagcatg 60acactgcagt gtgcccagga tatgaaccat
gaatacatgt cctggtatcg acaagaccca 120ggcatggggc tgaggctgat
tcattactca gttggtgctg gtatcactga ccaaggagaa 180gtccccaatg
gctacaatgt ctccagatca accacagagg atttcccgct caggctgctg
240tcggctgctc cctcccagac atctgtgtac ttctgtgcca gcaggccggg
actagcggga 300gggcgaccag agcagtactt cgggccgggc accaggctca
cggtcacaga ggacctgaaa 360aacgtgttcc cacccgaggt cgcttgtttt
gagccatcag aagcagagat ctcccacacc 420caaaaggcca cactggtgtg
cctggccaca ggcttctacc ccgaccacgt ggagctgagc 480tggtgggtga
atgggaagga ggtgcacagt ggggtcagca cagacccgca gcccctcaag
540gagcagcccg ccctcaatga ctccagatac gctctgagca gccgcctgag
ggtctcggcc 600accttctggc aggacccccg caaccacttc cgctgtcaag
tccagttcta cgggctctcg 660gagaatgacg agtggaccca ggatagggcc
aaacccgtca cccagatcgt cagcgccgag 720gcctggggta gagcagacta a
741154246PRTHomo sapiens 154Met Asn Ala Gly Val Thr Gln Thr Pro Lys
Phe Gln Val Leu Lys Thr1 5 10 15Gly Gln Ser Met Thr Leu Gln Cys Ala
Gln Asp Met Asn His Glu Tyr 20 25 30Met Ser Trp Tyr Arg Gln Asp Pro
Gly Met Gly Leu Arg Leu Ile His 35 40 45Tyr Ser Val Gly Ala Gly Ile
Thr Asp Gln Gly Glu Val Pro Asn Gly 50 55 60Tyr Asn Val Ser Arg Ser
Thr Thr Glu Asp Phe Pro Leu Arg Leu Leu65 70 75 80Ser Ala Ala Pro
Ser Gln Thr Ser Val Tyr Phe Cys Ala Ser Arg Pro 85 90
95Gly Leu Ala Gly Gly Arg Pro Glu Gln Tyr Phe Gly Pro Gly Thr Arg
100 105 110Leu Thr Val Thr Glu Asp Leu Lys Asn Val Phe Pro Pro Glu
Val Ala 115 120 125Cys Phe Glu Pro Ser Glu Ala Glu Ile Ser His Thr
Gln Lys Ala Thr 130 135 140Leu Val Cys Leu Ala Thr Gly Phe Tyr Pro
Asp His Val Glu Leu Ser145 150 155 160Trp Trp Val Asn Gly Lys Glu
Val His Ser Gly Val Ser Thr Asp Pro 165 170 175Gln Pro Leu Lys Glu
Gln Pro Ala Leu Asn Asp Ser Arg Tyr Ala Leu 180 185 190Ser Ser Arg
Leu Arg Val Ser Ala Thr Phe Trp Gln Asp Pro Arg Asn 195 200 205His
Phe Arg Cys Gln Val Gln Phe Tyr Gly Leu Ser Glu Asn Asp Glu 210 215
220Trp Thr Gln Asp Arg Ala Lys Pro Val Thr Gln Ile Val Ser Ala
Glu225 230 235 240Ala Trp Gly Arg Ala Asp 245155741DNAHomo sapiens
155atgaacgctg gtgtcactca gaccccaaaa ttccaggtcc tgaagacagg
acagagcatg 60acactgcagt gtgcccagga tatgaaccat gaatacatgt cctggtatcg
acaagaccca 120ggcatggggc tgaggctgat tcattactca gttggtgctg
gtatcactga ccaaggagaa 180gtccccaatg gctacaatgt ctccagatca
accacagagg atttcccgct caggctgctg 240tcggctgctc cctcccagac
atctgtgtac ttctgtgcca gcaggccggg actagcggga 300gggcgaccag
agcagtactt cgggccgggc accaggctca cggtcacaga ggacctgaaa
360aacgtgttcc cacccgaggt cgctgtgttt gagccatcag aagcagagat
ctcccacacc 420caaaaggcca cactggtgtg cctggccaca ggcttctacc
ccgaccacgt ggagctgagc 480tggtgggtga atgggaagga ggtgcacagt
ggggtcagca catgcccgca gcccctcaag 540gagcagcccg ccctcaatga
ctccagatac gctctgagca gccgcctgag ggtctcggcc 600accttctggc
aggacccccg caaccacttc cgctgtcaag tccagttcta cgggctctcg
660gagaatgacg agtggaccca ggatagggcc aaacccgtca cccagatcgt
cagcgccgag 720gcctggggta gagcagacta a 741156246PRTHomo sapiens
156Met Asn Ala Gly Val Thr Gln Thr Pro Lys Phe Gln Val Leu Lys Thr1
5 10 15Gly Gln Ser Met Thr Leu Gln Cys Ala Gln Asp Met Asn His Glu
Tyr 20 25 30Met Ser Trp Tyr Arg Gln Asp Pro Gly Met Gly Leu Arg Leu
Ile His 35 40 45Tyr Ser Val Gly Ala Gly Ile Thr Asp Gln Gly Glu Val
Pro Asn Gly 50 55 60Tyr Asn Val Ser Arg Ser Thr Thr Glu Asp Phe Pro
Leu Arg Leu Leu65 70 75 80Ser Ala Ala Pro Ser Gln Thr Ser Val Tyr
Phe Cys Ala Ser Arg Pro 85 90 95Gly Leu Ala Gly Gly Arg Pro Glu Gln
Tyr Phe Gly Pro Gly Thr Arg 100 105 110Leu Thr Val Thr Glu Asp Leu
Lys Asn Val Phe Pro Pro Glu Val Ala 115 120 125Val Phe Glu Pro Ser
Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr 130 135 140Leu Val Cys
Leu Ala Thr Gly Phe Tyr Pro Asp His Val Glu Leu Ser145 150 155
160Trp Trp Val Asn Gly Lys Glu Val His Ser Gly Val Ser Thr Cys Pro
165 170 175Gln Pro Leu Lys Glu Gln Pro Ala Leu Asn Asp Ser Arg Tyr
Ala Leu 180 185 190Ser Ser Arg Leu Arg Val Ser Ala Thr Phe Trp Gln
Asp Pro Arg Asn 195 200 205His Phe Arg Cys Gln Val Gln Phe Tyr Gly
Leu Ser Glu Asn Asp Glu 210 215 220Trp Thr Gln Asp Arg Ala Lys Pro
Val Thr Gln Ile Val Ser Ala Glu225 230 235 240Ala Trp Gly Arg Ala
Asp 245157741DNAHomo sapiens 157atgaacgctg gtgtcactca gaccccaaaa
ttccaggtcc tgaagacagg acagagcatg 60acactgcagt gtgcccagga tatgaaccat
gaatacatgt cctggtatcg acaagaccca 120ggcatggggc tgaggctgat
tcattactca gttggtgctg gtatcactga ccaaggagaa 180gtccccaatg
gctacaatgt ctccagatca accacagagg atttcccgct caggctgctg
240tcggctgctc cctcccagac atctgtgtac ttctgtgcca gcaggccggg
actagcggga 300gggcgaccag agcagtactt cgggccgggc accaggctca
cggtcacaga ggacctgaaa 360aacgtgttcc cacccgaggt cgctgtgttt
gagccatcag aagcagagat ctcccacacc 420caaaaggcca cactggtgtg
cctggccaca ggcttctacc ccgaccacgt ggagctgagc 480tggtgggtga
atgggaagga ggtgcacagt ggggtcagca cagacccgca gcccctcaag
540gagcagcccg ccctcaatga ctccagatac gctctgagca gctgcctgag
ggtctcggcc 600accttctggc aggacccccg caaccacttc cgctgtcaag
tccagttcta cgggctctcg 660gagaatgacg agtggaccca ggatagggcc
aaacccgtca cccagatcgt cagcgccgag 720gcctggggta gagcagacta a
741158246PRTHomo sapiens 158Met Asn Ala Gly Val Thr Gln Thr Pro Lys
Phe Gln Val Leu Lys Thr1 5 10 15Gly Gln Ser Met Thr Leu Gln Cys Ala
Gln Asp Met Asn His Glu Tyr 20 25 30Met Ser Trp Tyr Arg Gln Asp Pro
Gly Met Gly Leu Arg Leu Ile His 35 40 45Tyr Ser Val Gly Ala Gly Ile
Thr Asp Gln Gly Glu Val Pro Asn Gly 50 55 60Tyr Asn Val Ser Arg Ser
Thr Thr Glu Asp Phe Pro Leu Arg Leu Leu65 70 75 80Ser Ala Ala Pro
Ser Gln Thr Ser Val Tyr Phe Cys Ala Ser Arg Pro 85 90 95Gly Leu Ala
Gly Gly Arg Pro Glu Gln Tyr Phe Gly Pro Gly Thr Arg 100 105 110Leu
Thr Val Thr Glu Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala 115 120
125Val Phe Glu Pro Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr
130 135 140Leu Val Cys Leu Ala Thr Gly Phe Tyr Pro Asp His Val Glu
Leu Ser145 150 155 160Trp Trp Val Asn Gly Lys Glu Val His Ser Gly
Val Ser Thr Asp Pro 165 170 175Gln Pro Leu Lys Glu Gln Pro Ala Leu
Asn Asp Ser Arg Tyr Ala Leu 180 185 190Ser Ser Cys Leu Arg Val Ser
Ala Thr Phe Trp Gln Asp Pro Arg Asn 195 200 205His Phe Arg Cys Gln
Val Gln Phe Tyr Gly Leu Ser Glu Asn Asp Glu 210 215 220Trp Thr Gln
Asp Arg Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu225 230 235
240Ala Trp Gly Arg Ala Asp 245159741DNAHomo sapiens 159atgaacgctg
gtgtcactca gaccccaaaa ttccaggtcc tgaagacagg acagagcatg 60acactgcagt
gtgcccagga tatgaaccat gaatacatgt cctggtatcg acaagaccca
120ggcatggggc tgaggctgat tcattactca gttggtgctg gtatcactga
ccaaggagaa 180gtccccaatg gctacaatgt ctccagatca accacagagg
atttcccgct caggctgctg 240tcggctgctc cctcccagac atctgtgtac
ttctgtgcca gcaggccggg actagcggga 300gggcgaccag agcagtactt
cgggccgggc accaggctca cggtcacaga ggacctgaaa 360aacgtgttcc
cacccgaggt cgctgtgtgt gagccatcag aagcagagat ctcccacacc
420caaaaggcca cactggtgtg cctggccaca ggcttctacc ccgaccacgt
ggagctgagc 480tggtgggtga atgggaagga ggtgcacagt ggggtcagca
cagacccgca gcccctcaag 540gagcagcccg ccctcaatga ctccagatac
gctctgagca gccgcctgag ggtctcggcc 600accttctggc aggacccccg
caaccacttc cgctgtcaag tccagttcta cgggctctcg 660gagaatgacg
agtggaccca ggatagggcc aaacccgtca cccagatcgt cagcgccgag
720gcctggggta gagcagacta a 741160246PRTHomo sapiens 160Met Asn Ala
Gly Val Thr Gln Thr Pro Lys Phe Gln Val Leu Lys Thr1 5 10 15Gly Gln
Ser Met Thr Leu Gln Cys Ala Gln Asp Met Asn His Glu Tyr 20 25 30Met
Ser Trp Tyr Arg Gln Asp Pro Gly Met Gly Leu Arg Leu Ile His 35 40
45Tyr Ser Val Gly Ala Gly Ile Thr Asp Gln Gly Glu Val Pro Asn Gly
50 55 60Tyr Asn Val Ser Arg Ser Thr Thr Glu Asp Phe Pro Leu Arg Leu
Leu65 70 75 80Ser Ala Ala Pro Ser Gln Thr Ser Val Tyr Phe Cys Ala
Ser Arg Pro 85 90 95Gly Leu Ala Gly Gly Arg Pro Glu Gln Tyr Phe Gly
Pro Gly Thr Arg 100 105 110Leu Thr Val Thr Glu Asp Leu Lys Asn Val
Phe Pro Pro Glu Val Ala 115 120 125Val Cys Glu Pro Ser Glu Ala Glu
Ile Ser His Thr Gln Lys Ala Thr 130 135 140Leu Val Cys Leu Ala Thr
Gly Phe Tyr Pro Asp His Val Glu Leu Ser145 150 155 160Trp Trp Val
Asn Gly Lys Glu Val His Ser Gly Val Ser Thr Asp Pro 165 170 175Gln
Pro Leu Lys Glu Gln Pro Ala Leu Asn Asp Ser Arg Tyr Ala Leu 180 185
190Ser Ser Arg Leu Arg Val Ser Ala Thr Phe Trp Gln Asp Pro Arg Asn
195 200 205His Phe Arg Cys Gln Val Gln Phe Tyr Gly Leu Ser Glu Asn
Asp Glu 210 215 220Trp Thr Gln Asp Arg Ala Lys Pro Val Thr Gln Ile
Val Ser Ala Glu225 230 235 240Ala Trp Gly Arg Ala Asp
245161741DNAHomo sapiens 161atgaacgctg gtgtcactca gaccccaaaa
ttccaggtcc tgaagacagg acagagcatg 60acactgcagt gtgcccagga tatgaaccat
gaatacatgt cctggtatcg acaagaccca 120ggcatggggc tgaggctgat
tcattactca gttggtgctg gtatcactga ccaaggagaa 180gtccccaatg
gctacaatgt ctccagatca accacagagg atttcccgct caggctgctg
240tcggctgctc cctcccagac atctgtgtac ttctgtgcca gcaggccggg
actagcggga 300gggcgaccag agcagtactt cgggccgggc accaggctca
cggtcacaga ggacctgaaa 360aacgtgttcc cacccgaggt cgctgtgttt
gagccatcag aagcagagat ctcccacacc 420caaaaggcca cactggtgtg
cctggccaca ggcttctacc ccgaccacgt ggagctgagc 480tggtgggtga
atgggaagga ggtgcacagt tgtgtcagca cagacccgca gcccctcaag
540gagcagcccg ccctcaatga ctccagatac gctctgagca gccgcctgag
ggtctcggcc 600accttctggc aggacccccg caaccacttc cgctgtcaag
tccagttcta cgggctctcg 660gagaatgacg agtggaccca ggatagggcc
aaacccgtca cccagatcgt cagcgccgag 720gcctggggta gagcagacta a
741162246PRTHomo sapiens 162Met Asn Ala Gly Val Thr Gln Thr Pro Lys
Phe Gln Val Leu Lys Thr1 5 10 15Gly Gln Ser Met Thr Leu Gln Cys Ala
Gln Asp Met Asn His Glu Tyr 20 25 30Met Ser Trp Tyr Arg Gln Asp Pro
Gly Met Gly Leu Arg Leu Ile His 35 40 45Tyr Ser Val Gly Ala Gly Ile
Thr Asp Gln Gly Glu Val Pro Asn Gly 50 55 60Tyr Asn Val Ser Arg Ser
Thr Thr Glu Asp Phe Pro Leu Arg Leu Leu65 70 75 80Ser Ala Ala Pro
Ser Gln Thr Ser Val Tyr Phe Cys Ala Ser Arg Pro 85 90 95Gly Leu Ala
Gly Gly Arg Pro Glu Gln Tyr Phe Gly Pro Gly Thr Arg 100 105 110Leu
Thr Val Thr Glu Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala 115 120
125Val Phe Glu Pro Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr
130 135 140Leu Val Cys Leu Ala Thr Gly Phe Tyr Pro Asp His Val Glu
Leu Ser145 150 155 160Trp Trp Val Asn Gly Lys Glu Val His Ser Cys
Val Ser Thr Asp Pro 165 170 175Gln Pro Leu Lys Glu Gln Pro Ala Leu
Asn Asp Ser Arg Tyr Ala Leu 180 185 190Ser Ser Arg Leu Arg Val Ser
Ala Thr Phe Trp Gln Asp Pro Arg Asn 195 200 205His Phe Arg Cys Gln
Val Gln Phe Tyr Gly Leu Ser Glu Asn Asp Glu 210 215 220Trp Thr Gln
Asp Arg Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu225 230 235
240Ala Trp Gly Arg Ala Asp 245163741DNAHomo sapiens 163atgaacgctg
gtgtcactca gaccccaaaa ttccaggtcc tgaagacagg acagagcatg 60acactgcagt
gtgcccagga tatgaaccat gaatacatgt cctggtatcg acaagaccca
120ggcatggggc tgaggctgat tcattactca gttggtgctg gtatcactga
ccaaggagaa 180gtccccaatg gctacaatgt ctccagatca accacagagg
atttcccgct caggctgctg 240tcggctgctc cctcccagac atctgtgtac
ttctgtgcca gcaggccggg actagcggga 300gggcgaccag agcagtactt
cgggccgggc accaggctca cggtcacaga ggacctgaaa 360aacgtgttcc
cacccgaggt cgctgtgttt gagccatcag aagcagagat ctcccacacc
420caaaaggcca cactggtgtg cctggccaca ggcttctacc ccgaccacgt
ggagctgagc 480tggtgggtga atgggaagga ggtgcacagt ggggtcagca
cagacccgca gccctgcaag 540gagcagcccg ccctcaatga ctccagatac
gctctgagca gccgcctgag ggtctcggcc 600accttctggc aggacccccg
caaccacttc cgctgtcaag tccagttcta cgggctctcg 660gagaatgacg
agtggaccca ggatagggcc aaacccgtca cccagatcgt cagcgccgag
720gcctggggta gagcagacta a 741164246PRTHomo sapiens 164Met Asn Ala
Gly Val Thr Gln Thr Pro Lys Phe Gln Val Leu Lys Thr1 5 10 15Gly Gln
Ser Met Thr Leu Gln Cys Ala Gln Asp Met Asn His Glu Tyr 20 25 30Met
Ser Trp Tyr Arg Gln Asp Pro Gly Met Gly Leu Arg Leu Ile His 35 40
45Tyr Ser Val Gly Ala Gly Ile Thr Asp Gln Gly Glu Val Pro Asn Gly
50 55 60Tyr Asn Val Ser Arg Ser Thr Thr Glu Asp Phe Pro Leu Arg Leu
Leu65 70 75 80Ser Ala Ala Pro Ser Gln Thr Ser Val Tyr Phe Cys Ala
Ser Arg Pro 85 90 95Gly Leu Ala Gly Gly Arg Pro Glu Gln Tyr Phe Gly
Pro Gly Thr Arg 100 105 110Leu Thr Val Thr Glu Asp Leu Lys Asn Val
Phe Pro Pro Glu Val Ala 115 120 125Val Phe Glu Pro Ser Glu Ala Glu
Ile Ser His Thr Gln Lys Ala Thr 130 135 140Leu Val Cys Leu Ala Thr
Gly Phe Tyr Pro Asp His Val Glu Leu Ser145 150 155 160Trp Trp Val
Asn Gly Lys Glu Val His Ser Gly Val Ser Thr Asp Pro 165 170 175Gln
Pro Cys Lys Glu Gln Pro Ala Leu Asn Asp Ser Arg Tyr Ala Leu 180 185
190Ser Ser Arg Leu Arg Val Ser Ala Thr Phe Trp Gln Asp Pro Arg Asn
195 200 205His Phe Arg Cys Gln Val Gln Phe Tyr Gly Leu Ser Glu Asn
Asp Glu 210 215 220Trp Thr Gln Asp Arg Ala Lys Pro Val Thr Gln Ile
Val Ser Ala Glu225 230 235 240Ala Trp Gly Arg Ala Asp
245165741DNAHomo sapiens 165atgaacgctg gtgtcactca gaccccaaaa
ttccaggtcc tgaagacagg acagagcatg 60acactgcagt gtgcccagga tatgaaccat
gaatacatgt cctggtatcg acaagaccca 120ggcatggggc tgaggctgat
tcattactca gttggtgctg gtatcactga ccaaggagaa 180gtccccaatg
gctacaatgt ctccagatca accacagagg atttcccgct caggctgctg
240tcggctgctc cctcccagac atctgtgtac ttctgtgcca gcaggccggg
actagcggga 300gggcgaccag agcagtactt cgggccgggc accaggctca
cggtcacaga ggacctgaaa 360aacgtgttcc cacccgaggt cgctgtgttt
tgtccatcag aagcagagat ctcccacacc 420caaaaggcca cactggtgtg
cctggccaca ggcttctacc ccgaccacgt ggagctgagc 480tggtgggtga
atgggaagga ggtgcacagt ggggtcagca cagacccgca gcccctcaag
540gagcagcccg ccctcaatga ctccagatac gctctgagca gccgcctgag
ggtctcggcc 600accttctggc aggacccccg caaccacttc cgctgtcaag
tccagttcta cgggctctcg 660gagaatgacg agtggaccca ggatagggcc
aaacccgtca cccagatcgt cagcgccgag 720gcctggggta gagcagacta a
741166246PRTHomo sapiens 166Met Asn Ala Gly Val Thr Gln Thr Pro Lys
Phe Gln Val Leu Lys Thr1 5 10 15Gly Gln Ser Met Thr Leu Gln Cys Ala
Gln Asp Met Asn His Glu Tyr 20 25 30Met Ser Trp Tyr Arg Gln Asp Pro
Gly Met Gly Leu Arg Leu Ile His 35 40 45Tyr Ser Val Gly Ala Gly Ile
Thr Asp Gln Gly Glu Val Pro Asn Gly 50 55 60Tyr Asn Val Ser Arg Ser
Thr Thr Glu Asp Phe Pro Leu Arg Leu Leu65 70 75 80Ser Ala Ala Pro
Ser Gln Thr Ser Val Tyr Phe Cys Ala Ser Arg Pro 85 90 95Gly Leu Ala
Gly Gly Arg Pro Glu Gln Tyr Phe Gly Pro Gly Thr Arg 100 105 110Leu
Thr Val Thr Glu Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala 115 120
125Val Phe Cys Pro Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr
130 135 140Leu Val Cys Leu Ala Thr Gly Phe Tyr Pro Asp His Val Glu
Leu Ser145 150 155 160Trp Trp Val Asn Gly Lys Glu Val His Ser Gly
Val Ser Thr Asp Pro 165 170 175Gln Pro Leu Lys Glu Gln Pro Ala Leu
Asn Asp Ser Arg Tyr Ala Leu 180 185 190Ser Ser Arg Leu Arg Val Ser
Ala Thr Phe Trp Gln Asp Pro Arg Asn 195 200 205His Phe Arg Cys Gln
Val Gln Phe Tyr Gly Leu Ser Glu Asn Asp Glu 210 215 220Trp Thr Gln
Asp Arg Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu225 230 235
240Ala Trp Gly Arg Ala Asp 245167783DNAHomo sapiens 167atgggtgtca
ctcagacccc aaaattccag gtcctgaaga caggacagag catgacactg 60cagtgtgccc
aggatatgaa ccatgaatac atgtcctggt atcgacaaga cccaggcatg
120gggctgaggc tgattcatta ctcagttggt gctggtatca ctgaccaagg
agaagtcccc 180aatggctaca atgtctccag atcaaccaca gaggatttcc
cgctcaggct gctgtcggct 240gctccctccc agacatctgt gtacttctgt
gccagcagtt acgtcgggaa caccggggag 300ctgttttttg gagaaggctc
taggctgacc gtactggagg acctgaaaaa cgtgttccca 360cccgaggtcg
ctgtgtttga gccatcagaa gcagagatct cccacaccca aaaggccaca
420ctggtgtgcc tggccacagg cttctacccc gaccacgtgg agctgagctg
gtgggtgaat 480gggaaggagg tgcacagtgg ggtctgcaca gacccgcagc
ccctcaagga gcagcccgcc 540ctcaatgact ccagatacgc tctgagcagc
cgcctgaggg tctcggccac cttctggcag 600gacccccgca accacttccg
ctgtcaagtc cagttctacg ggctctcgga gaatgacgag 660tggacccagg
atagggccaa acccgtcacc cagatcgtca gcgccgaggc ctggggtaga
720gcagacggat ccggtggtgg tctgaacgat atttttgaag ctcagaaaat
cgaatggcat 780taa 783168260PRTHomo sapiens 168Met Gly Val Thr Gln
Thr Pro Lys Phe Gln Val Leu Lys Thr Gly Gln1 5 10 15Ser Met Thr Leu
Gln Cys Ala Gln Asp Met Asn His Glu Tyr Met Ser 20 25 30Trp Tyr Arg
Gln Asp Pro Gly Met Gly Leu Arg Leu Ile His Tyr Ser 35 40 45Val Gly
Ala Gly Ile Thr Asp Gln Gly Glu Val Pro Asn Gly Tyr Asn 50 55 60Val
Ser Arg Ser Thr Thr Glu Asp Phe Pro Leu Arg Leu Leu Ser Ala65 70 75
80Ala Pro Ser Gln Thr Ser Val Tyr Phe Cys Ala Ser Ser Tyr Val Gly
85 90 95Asn Thr Gly Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu Thr Val
Leu 100 105 110Glu Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala Val
Phe Glu Pro 115 120 125Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala
Thr Leu Val Cys Leu 130 135 140Ala Thr Gly Phe Tyr Pro Asp His Val
Glu Leu Ser Trp Trp Val Asn145 150 155 160Gly Lys Glu Val His Ser
Gly Val Cys Thr Asp Pro Gln Pro Leu Lys 165 170 175Glu Gln Pro Ala
Leu Asn Asp Ser Arg Tyr Ala Leu Ser Ser Arg Leu 180 185 190Arg Val
Ser Ala Thr Phe Trp Gln Asp Pro Arg Asn His Phe Arg Cys 195 200
205Gln Val Gln Phe Tyr Gly Leu Ser Glu Asn Asp Glu Trp Thr Gln Asp
210 215 220Arg Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu Ala Trp
Gly Arg225 230 235 240Ala Asp Gly Ser Gly Gly Gly Leu Asn Asp Ile
Phe Glu Ala Gln Lys 245 250 255Ile Glu Trp His 260169762DNAHomo
sapiens 169atgggtgtca ctcagacccc aaaattccag gtcctgaaga caggacagag
catgacactg 60cagtgtgccc aggatatgaa ccatgaatac atgtcctggt atcgacaaga
cccaggcatg 120gggctgaggc tgattcatta ctcagttggt gctggtatca
ctgaccaagg agaagtcccc 180aatggctaca atgtctccag atcaaccaca
gaggatttcc cgctcaggct gctgtcggct 240gctccctccc agacatctgt
gtacttctgt gccagcagtt acgtcgggaa caccggggag 300ctgttttttg
gagaaggctc taggctgacc gtactggagg acctgaaaaa cgtgttccca
360cccgaggtcg ctgtgtttga gccatcagaa gcagagatct cccacaccca
aaaggccaca 420ctggtgtgcc tggccacagg cttctacccc gaccacgtgg
agctgagctg gtgggtgaat 480gggaaggagg tgcacagtgg ggtctgcaca
gacccgcagc ccctcaagga gcagcccgcc 540ctcaatgact ccagatacgc
tctgagcagc cgcctgaggg tctcggccac cttctggcag 600gacccccgca
accacttccg ctgtcaagtc cagttctacg ggctctcgga gaatgacgag
660tggacccagg atagggccaa acccgtcacc cagatcgtca gcgccgaggc
ctggggtaga 720gcagacggat ccggtggtgg tcatcatcac catcatcact aa
762170253PRTHomo sapiens 170Met Gly Val Thr Gln Thr Pro Lys Phe Gln
Val Leu Lys Thr Gly Gln1 5 10 15Ser Met Thr Leu Gln Cys Ala Gln Asp
Met Asn His Glu Tyr Met Ser 20 25 30Trp Tyr Arg Gln Asp Pro Gly Met
Gly Leu Arg Leu Ile His Tyr Ser 35 40 45Val Gly Ala Gly Ile Thr Asp
Gln Gly Glu Val Pro Asn Gly Tyr Asn 50 55 60Val Ser Arg Ser Thr Thr
Glu Asp Phe Pro Leu Arg Leu Leu Ser Ala65 70 75 80Ala Pro Ser Gln
Thr Ser Val Tyr Phe Cys Ala Ser Ser Tyr Val Gly 85 90 95Asn Thr Gly
Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu Thr Val Leu 100 105 110Glu
Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala Val Phe Glu Pro 115 120
125Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr Leu Val Cys Leu
130 135 140Ala Thr Gly Phe Tyr Pro Asp His Val Glu Leu Ser Trp Trp
Val Asn145 150 155 160Gly Lys Glu Val His Ser Gly Val Cys Thr Asp
Pro Gln Pro Leu Lys 165 170 175Glu Gln Pro Ala Leu Asn Asp Ser Arg
Tyr Ala Leu Ser Ser Arg Leu 180 185 190Arg Val Ser Ala Thr Phe Trp
Gln Asp Pro Arg Asn His Phe Arg Cys 195 200 205Gln Val Gln Phe Tyr
Gly Leu Ser Glu Asn Asp Glu Trp Thr Gln Asp 210 215 220Arg Ala Lys
Pro Val Thr Gln Ile Val Ser Ala Glu Ala Trp Gly Arg225 230 235
240Ala Asp Gly Ser Gly Gly Gly His His His His His His 245
250171741DNAHomo sapiens 171atgaacgctg gtgtcactca gaccccaaaa
ttccaggtcc tgaagacagg acagagcatg 60acactgcagt gtgcccagga tatgaaccat
gaatacatgt cctggtatcg acaagaccca 120ggcatggggc tgaggctgat
tcattactca gttggtgctg gtatcactga ccaaggagaa 180gtccccaatg
gctacaatgt ctccagatca accacagagg atttcccgct caggctgctg
240tcggctgctc cctcccagac atctgtgtac ttctgtgcca gcaggccggg
actagcggga 300gggcgaccag agcagtactt cgggccgggc accaggctca
cggtcacaga ggacctgaac 360aaggtgttcc cacccgaggt cgctgtgttt
gagccatcag aagcagagat ctcccacacc 420caaaaggcca cactggtgtg
cctggccaca ggcttcttcc ccgaccacgt ggagctgagc 480tggtgggtga
atgggaagga ggtgcacagt ggggtctgca cagacccgca gcccctcaag
540gagcagcccg ccctcaatga ctccagatac tctctgagca gccgcctgag
ggtctcggcc 600accttctggc aggacccccg caaccacttc cgctgtcaag
tccagttcta cgggctctcg 660gagaatgacg agtggaccca ggatagggcc
aaacccgtca cccagatcgt cagcgccgag 720gcctggggta gagcagacta a
741172741DNAHomo sapiens 172atgaacgctg gtgtcactca gaccccaaaa
ttccaggtcc tgaagacagg acagagcatg 60acactgcagt gtgcccagga tatgaaccat
gaatacatgt cctggtatcg acaagaccca 120ggcatggggc tgaggctgat
tcattactca gttggtgctg gtatcactga ccaaggagaa 180gtccccaatg
gctacaatgt ctccagatca accacagagg atttcccgct caggctgctg
240tcggctgctc cctcccagac atctgtgtac ttctgtgcca gcaggccggg
actagcggga 300gggcgaccag agcagtactt cgggccgggc accaggctca
cggtcacaga ggacctgaaa 360aacgtgttcc cacccgaggt cgctgtgttt
gagccatcag aagcagagat ctcccacacc 420caaaaggcca cactggtgtg
cctggccaca ggcttctacc ccgaccacgt ggagctgagc 480tggtgggtga
atgggaagga ggtgcacagt ggggtctgca cagacccgca gcccctcaag
540gagcagcccg ccctcaatga ctccagatac tgtctgagca gccgcctgag
ggtctcggcc 600accttctggc aggacccccg caaccacttc cgctgtcaag
tccagttcta cgggctctcg 660gagaatgacg agtggaccca ggatagggcc
aaacccgtca cccagatcgt cagcgccgag 720gcctggggta gagcagacta a
741173741DNAHomo sapiens 173atgaacgctg gtgtcactca gaccccaaaa
ttccaggtcc tgaagacagg acagagcatg 60acactgcagt gtgcccagga tatgaaccat
gaatacatgt cctggtatcg acaagaccca 120ggcatggggc tgaggctgat
tcattactca gttggtgctg gtatcactga ccaaggagaa 180gtccccaatg
gctacaatgt ctccagatca accacagagg atttcccgct caggctgctg
240tcggctgctc cctcccagac atctgtgtac ttctgtgcca gcaggccggg
actagcggga 300gggcgaccag agcagtactt cgggccgggc accaggctca
cggtcacaga ggacctgaaa 360aacgtgttcc cacccgaggt cgctgtgttt
gagccatcag aagcagagat ctcccacacc 420caaaaggcca cactggtgtg
cctggccaca ggcttctacc ccgaccacgt ggagctgagc 480tggtgggtga
atgggaagga ggtgcacagt ggggtctgca cagacccgca gcccctcaag
540gagcagcccg ccctcaatga ctccagatac tctctgagca gccgcctgag
ggtctcggcc 600accttctggc aggacccccg caaccacttc cgctgtcaag
tccagttcta cgggctctcg 660gagaatgacg agtggaccca ggatagggcc
aaacccgtca cccagatcgt cagcgccgag 720gcctggggta gagcagacta a
7411746671DNAArtificial SequenceExpression vector pYX112
174gaattcacca tggatcctag ggcccacaag cttacgcgtc gacccgggta
tccgtatgat 60gtgcctgact acgcatgata tctcgagctc agctagctaa ctgaataagg
aacaatgaac 120gtttttcctt tctcttgttc ctagtattaa tgactgaccg
atacatccct tttttttttt 180gtctttgtct agctccagct tttgttccct
ttagtgaggg ttaattcaat tcactggccg 240tcgttttaca acgtcgtgac
tgggaaaacc ctggcgttac ccaacttaat cgccttgcag 300cacatccccc
tttcgccagc tggcgtaata gcgaagaggc ccgcaccgat cgcccttccc
360aacagttgcg cagcctgaat ggcgaatggc gcgacgcgcc ctgtagcggc
gcattaagcg 420cggcgggtgt ggtggttacg cgcagcgtga ccgctacact
tgccagcgcc ctagcgcccg 480ctcctttcgc tttcttccct tcctttctcg
ccacgttcgc cggctttccc cgtcaagctc 540taaatcgggg gctcccttta
gggttccgat ttagtggttt acggcacctc gaccccaaaa 600aacttgatta
gggtgatggt tcacgtagtg ggccatcgcc ctgatagacg gtttttcgcc
660ctttgacgtt ggagtccacg ttctttaata gtggactctt gttccaaact
ggaacaacac 720tcaaccctat ctcggtctat tcttttgatt tataagggat
tttgccgatt tcggcctatt 780ggttaaaaaa tgagctgatt taacaaaaat
ttaacgcgaa ttttaacaaa atattaacgt 840ttacaatttc ctgatgcggt
attttctcct tacgcatctg tgcggtattt cacaccgcat 900agggtaataa
ctgatataat taaattgaag ctctaatttg tgagtttagt atacatgcat
960ttacttataa tacagttttt tagttttgct ggccgcatct tctcaaatat
gcttcccagc 1020ctgcttttct gtaacgttca ccctgtacct tagcatccct
tccctttgca aatagtcctc 1080ttccaacaat aataatgtca gatcctgtag
agaccacatc atccacggtt ctatactgtt 1140gacccaatgc gtctcccttg
tcatctaaac ccacaccggg tgtcataatc aaccaatcgt 1200aaccttcatc
tcttccaccc atgtctcttt gagcaataaa gccgataaca aaatctttgt
1260cgctcttcgc aatgtcaaca gtacccttag tatattctcc agtagatagg
gagcccttgc 1320atgacaattc tgctaacatc aaaaggcctc taggttcctt
tgttacttct tctgccgcct 1380gcttcaaacc gctaacaata cctggcccca
gcacaccgtg tgcattcgta atgtctgccc 1440attctgctat tctgtataca
cccgcagagt actgcaattt gactgtatta ccaatgtcag 1500caaattttct
gtcttcgaag agtaaaaaat tgtacttggc ggataatgcc tttagcggct
1560taactgtgcc ctccatcgaa aaatcagtca atatatccac atgtgttttt
agtaaacaaa 1620ttttgggacc taatgcttca actaactcca gtaattcctt
ggtggtacga acatccaatg 1680aagcacacaa gtttgtttgc ttttcgtgca
tgatattaaa tagcttggca gcaacaggac 1740taggatgagt agcagcacgt
tccttatatg tagctttcga catgatttat cttcgtttcc 1800tgcaggtttt
tgttctgtgc agttgggtta agaatactgg gcaatttcat gtttcttcaa
1860cactacatat gcgtatatat accaatctaa gtctgtgctc cttccttcgt
tcttccttct 1920gttcggagat taccgaatca aaaaaatttc aaagaaaccg
aaatcaaaaa aaagaataaa 1980aaaaaaatga tgaattgaat tgaaaagctg
tggtatggtg cactctcagt acaatctgct 2040ctgatgccgc atagttaagc
cagccccgac acccgccaac acccgctgac gcgccctgac 2100gggcttgtct
gctcccggca tccgcttaca gacaagctgt gaccgtctcc gggagctgca
2160tgtgtcagag gttttcaccg tcatcaccga aacgcgcgag acgaaagggc
ctcgtgatac 2220gcctattttt ataggttaat gtcatgataa taatggtttc
ttaggacgga tcgcttgcct 2280gtaacttaca cgcgcctcgt atcttttaat
gatggaataa tttgggaatt tactctgtgt 2340ttatttattt ttatgttttg
tatttggatt ttagaaagta aataaagaag gtagaagagt 2400tacggaatga
agaaaaaaaa ataaacaaag gtttaaaaaa tttcaacaaa aagcgtactt
2460tacatatata tttattagac aagaaaagca gattaaatag atatacattc
gattaacgat 2520aagtaaaatg taaaatcaca ggattttcgt gtgtggtctt
ctacacagac aagatgaaac 2580aattcggcat taatacctga gagcaggaag
agcaagataa aaggtagtat ttgttggcga 2640tccccctaga gtcttttaca
tcttcggaaa acaaaaacta ttttttcttt aatttctttt 2700tttactttct
atttttaatt tatatattta tattaaaaaa tttaaattat aattattttt
2760atagcacgtg atgaaaagga cccaggtggc acttttcggg gaaatgtgcg
cggaacccct 2820atttgtttat ttttctaaat acattcaaat atgtatccgc
tcatgagaca ataaccgtga 2880taaatgcttc aataatattg aaaaaggaag
agtatgagta ttcaacattt ccgtgtcgcc 2940cttattccct tttttgcggc
attttgcctt cctgtttttg ctcacccaga aacgctggtg 3000aaagtaaaag
atgctgaaga tcagttgggt gcacgagtgg gttacatcga actggatctc
3060aacagcggta agatccttga gagttttcgc cccgaagaac gttttccaat
gatgagcact 3120tttaaagttc tgctatgtgg cgcggtatta tcccgtattg
acgccgggca agagcaactc 3180gctcgccgca tacactattc tcagaatgac
ttggttgagt actcaccagt cacagaaaag 3240catcttacgg atggcatgac
agtaagagaa ttatgcagtg ctgccataac catgagtgat 3300aacactgcgg
ccaacttact tctgacaacg atcggaggac cgaaggagct aaccgctttt
3360ttggacaaca tgggggatca tgtaactcgc cttgatcgtt gggaaccgga
gctgaatgaa 3420gccataccaa acgacgagcg tgacaccacg atgcctgtag
caatggcaac aacgttgcgc 3480aaactattaa ctggcgaact acttactcta
gcttcccggc aacaattaat agactggatg 3540gaggcggata aagttgcagg
accacttctg cgctcggccc ttccggctgg ctggtttatt 3600gctgataaat
ctggagccgg tgagcgtggg tctcgcggta tcattgcagc actggggcca
3660gatggtaagc cctcccgtat cgtagttatc tacacgacgg ggagtcaggc
aactatggat 3720gaacgaaata gacagatcgc tgagataggt gcctcactga
ttaagcattg gtaactgtca 3780gaccaagttt actcatatat actttagatt
gatttaaaac ttcattttta atttaaaagg 3840atctaggtga agatcctttt
tgataatctc atgaccaaaa tcccttaacg tgagttttcg 3900ttccactgag
cgtcagaccc cgtagaaaag atcaaaggat cttcttgaga tccttttttt
3960ctgcgcgtaa tctgctgctt gcaaacaaaa aaaccaccgc taccagcggt
ggtttgtttg 4020ccggatcaag agctaccaac tctttttccg aaggtaactg
gcttcagcag agcgcagata 4080ccaaatactg tccttctagt gtagccgtag
ttaggccacc acttcaagaa ctctgtagca 4140ccgcctacat acctcgctct
gctaatcctg ttaccagtgg ctgctgccag tggcgataag 4200tcgtgtctta
ccgggttgga ctcaagacga tagttaccgg ataaggcgca gcggtcgggc
4260tgaacggggg gttcgtgcac acagcccagc ttggagcgaa cgacctacac
cgaactgaga 4320tacctacagc gtgagctatg agaaagcgcc acgcttcccg
aagggagaaa ggcggacagg 4380tatccggtaa gcggcagggt cggaacagga
gagcgcacga gggagcttcc agggggaaac 4440gcctggtatc tttatagtcc
tgtcgggttt cgccacctct gacttgagcg tcgatttttg 4500tgatgctcgt
caggggggcg gagcctatgg aaaaacgcca gcaacgcggc ctttttacgg
4560ttcctggcct tttgctggcc ttttgctcac atgttctttc ctgcgttatc
ccctgattct 4620gtggataacc gtattaccgc ctttgagtga gctgataccg
gtcgccgcag ccgaacgacc 4680gagcgcagcg agtcagtgag cgaggaagcg
gaagagcgcc caatacgcaa accgcctctc 4740cccgcgcgtt ggccgattca
ttaatgcagc tggcacgaca ggtttcccga ctggaaagcg 4800ggcagtgagc
gcaacgcaat taatgtgagt tacctcactc attaggcacc ccaggcttta
4860cactttatgc ttccggctcc tatgttgtgt ggaattgtga gcggataaca
atttcacaca 4920ggaaacagct atgaccatga ttacgccaag ctcgaaatac
gactcactat agggcgaatt 4980gggtaccggg ccggccgtcg agcttgatgg
catcgtggtg tcacgctcgt cgtttggtat 5040ggcttcattc agctccggtt
cccaacgatc aaggcgagtt acatgatccc ccatgttgtg 5100aaaaaaagcg
gttagctctt cggtcctccg atcgttgtca gaagtaagtt ggccgcagtg
5160ttatcactca tggttatggc aggaactgca taattctctt actgtcatgc
catccgtaag 5220atgcttttct gtgactggtg tactcaacca agtcattctg
agaatagtgt atgcggcgac 5280cgagttgctc ttgcccggcg tcaacacggg
ataataccgc gccacatagc agaactttaa 5340aagtgctcat cattggaaaa
cgttcttcgg ggcgaaaact ctcaaggatc ttaccgctgt 5400tgagatccag
ttcgatgtaa cccactcgtg cacccaactg atcttcagca tcttttactt
5460tcaccagcgt ttctgggtga gcaaaaacag gaaggcaaaa tgccgcaaaa
aagggaataa 5520gggcgacacg gaaatgttga atactcatac tcttcctttt
tcaatattat tgaagcattt 5580atcagggtta ttgtctcatg agcgatacat
atttgaatgt atttagaaaa ataaacaaat 5640aggggttccg cgcacatttc
cccgaaaagt gccacctgac gtctaagaaa ccattattat 5700catgacatta
acctataaaa ataggcgtat cacgaggccc tttcgtcttc aagaattggg
5760gatctacgta tggtcattct tcttcagatt ccctcatgga gaagtgcggc
agatgtatat 5820gacagagtcg ccagtttcca agagacttta ttcaggcact
tccatgatag gcaagagaga 5880agacccagag atgttgttgt cctagttaca
catggtattt attccagagt attcctgatg 5940aaatggttta gatggacata
cgaagagttt gaatcgttta ccaatgttcc taacgggagc 6000gtaatggtga
tggaactgga cgaatccatc aatagatacg tcctgaggac cgtgctaccc
6060aaatggactg attgtgaggg agacctaact acatagtgtt taaagattac
ggatatttaa 6120cttacttaga ataatgccat ttttttgagt tataataatc
ctacgttagt gtgagcggga 6180tttaaactgt gaggacctca atacattcag
acacttctga cggtatcacc ctacttattc 6240ccttcgagat tatatctagg
aacccatcag gttggtggaa gattacccgt tctaagactt 6300ttcagcttcc
tctattgatg ttacactcgg acaccccttt tctggcatcc agtttttaat
6360cttcagtggc atgtgagatt ctccgaaatt aattaaagca atcacacaat
tctctcggat 6420accacctcgg ttgaaactga caggtggttt gttacgcatg
ctaatgcaaa ggagcctata 6480tacctttggc tcggctgctg taacagggaa
tataaagggc agcataattt aggagtttag 6540tgaacttgca acatttacta
ttttcccttc ttacgtaaat atttttcttt ttaattctaa 6600atcaatcttt
ttcaattttt tgtttgtatt cttttcttgc ttaaatctat aactacaaaa
6660aacacataca g 66711756683DNAArtificial SequenceExpression vector
pYX122 175gtgcctgact acgcatgata tctcgagctc agctagctaa ctgaataagg
aacaatgaac 60gtttttcctt tctcttgttc ctagtattaa tgactgaccg atacatccct
tttttttttt 120gtctttgtct agctccagct tttgttccct ttagtgaggg
ttaattcaat tcactggccg 180tcgttttaca acgtcgtgac tgggaaaacc
ctggcgttac ccaacttaat cgccttgcag 240cacatccccc tttcgccagc
tggcgtaata gcgaagaggc ccgcaccgat cgcccttccc 300aacagttgcg
cagcctgaat ggcgaatggc gcgacgcgcc ctgtagcggc gcattaagcg
360cggcgggtgt ggtggttacg cgcagcgtga ccgctacact tgccagcgcc
ctagcgcccg 420ctcctttcgc tttcttccct tcctttctcg ccacgttcgc
cggctttccc cgtcaagctc 480taaatcgggg gctcccttta gggttccgat
ttagtggttt acggcacctc gaccccaaaa 540aacttgatta gggtgatggt
tcacgtagtg ggccatcgcc ctgatagacg gtttttcgcc 600ctttgacgtt
ggagtccacg ttctttaata gtggactctt gttccaaact ggaacaacac
660tcaaccctat ctcggtctat tcttttgatt tataagggat tttgccgatt
tcggcctatt 720ggttaaaaaa tgagctgatt taacaaaaat ttaacgcgaa
ttttaacaaa atattaacgt 780ttacaatttc ctgatgcggt attttctcct
tacgcatctg tgcggtattt cacaccgcat 840agatccgtcg agttcaagag
aaaaaaaaag aaaaagcaaa aagaaaaaag gaaagcgcgc 900ctcgttcaga
atgacacgta tagaatgatg cattaccttg tcatcttcag tatcatactg
960ttcgtataca tacttactga cattcatagg tatacatata tacacatgta
tatatatcgt 1020atgctgcagc tttaaataat cggtgtcact acataagaac
acctttggtg gagggaacat 1080cgttggttcc attgggcgag gtggcttctc
ttatggcaac cgcaagagcc ttgaacgcac 1140tctcactacg gtgatgatca
ttcttgcctc gcagacaatc aacgtggagg gtaattctgc 1200ttgcctctgc
aaaactttca agaaaatgcg ggatcatctc gcaagagaga tctcctactt
1260tctccctttg caaaccaagt tcgacaactg cgtacggcct gttcgaaaga
tctaccaccg
1320ctctggaaag tgcctcatcc aaaggcgcaa atcctgatcc aaaccttttt
actccacgcg 1380ccagtagggc ctctttaaat gcttgaccga gagcaatccc
gcagtcttca gtggtgtgat 1440ggtcgtctat gtgtaagtca ccaatgcact
caacgattag cgaccagccg gaatgcttgg 1500ccagagcatg tatcatatgg
tccagaaacc ctatacctgt gtggacgtta atcacttgcg 1560attgtgtggc
ctgttctgct actggttctg cctctttttc tgggaagatc gagtgctcta
1620tcgctagggg accagccttt aaagagatcg caatctgaat cttggtttca
tttgtaatac 1680gctttactag ggctttctgc tctgtcatct ttgccttcgt
ttatcttgcc tgctcatttt 1740ttagtatatt cttcgaagaa atcacattac
tttatataat gtataattca ttatgtgata 1800atgccaatcg ctaagaaaaa
aaaagagtca tccgctaggg gaaaaaaaaa aatgaaaatc 1860attaccgagg
cataaaaaaa tatagagtgt actagaggag gccaagagta atagaaaaag
1920aaaattgcgg gaaaggactg tgttatgact tccctgacta atgccgtgtt
caaacgatac 1980ctggcagtga ctcctagcgc tcaccaagct cttaaaacgg
gaatttatgg tgcactctca 2040gtacaatctg ctctgatgcc gcatagttaa
gccagccccg acacccgcca acacccgctg 2100acgcgccctg acgggcttgt
ctgctcccgg catccgctta cagacaagct gtgaccgtct 2160ccgggagctg
catgtgtcag aggttttcac cgtcatcacc gaaacgcgcg agacgaaagg
2220gcctcgtgat acgcctattt ttataggtta atgtcatgat aataatggtt
tcttaggacg 2280gatcgcttgc ctgtaactta cacgcgcctc gtatctttta
atgatggaat aatttgggaa 2340tttactctgt gtttatttat ttttatgttt
tgtatttgga ttttagaaag taaataaaga 2400aggtagaaga gttacggaat
gaagaaaaaa aaataaacaa aggtttaaaa aatttcaaca 2460aaaagcgtac
tttacatata tatttattag acaagaaaag cagattaaat agatatacat
2520tcgattaacg ataagtaaaa tgtaaaatca caggattttc gtgtgtggtc
ttctacacag 2580acaagatgaa acaattcggc attaatacct gagagcagga
agagcaagat aaaaggtagt 2640atttgttggc gatcccccta gagtctttta
catcttcgga aaacaaaaac tattttttct 2700ttaatttctt tttttacttt
ctatttttaa tttatatatt tatattaaaa aatttaaatt 2760ataattattt
ttatagcacg tgatgaaaag gacccaggtg gcacttttcg gggaaatgtg
2820cgcggaaccc ctatttgttt atttttctaa atacattcaa atatgtatcc
gctcatgaga 2880caataaccgt gataaatgct tcaataatat tgaaaaagga
agagtatgag tattcaacat 2940ttccgtgtcg cccttattcc cttttttgcg
gcattttgcc ttcctgtttt tgctcaccca 3000gaaacgctgg tgaaagtaaa
agatgctgaa gatcagttgg gtgcacgagt gggttacatc 3060gaactggatc
tcaacagcgg taagatcctt gagagttttc gccccgaaga acgttttcca
3120atgatgagca cttttaaagt tctgctatgt ggcgcggtat tatcccgtat
tgacgccggg 3180caagagcaac tcggtcgccg catacactat tctcagaatg
acttggttga gtactcacca 3240gtcacagaaa agcatcttac ggatggcatg
acagtaagag aattatgcag tgctgccata 3300accatgagtg ataacactgc
ggccaactta cttctgacaa cgatcggagg accgaaggag 3360ctaaccgctt
ttttggacaa catgggggat catgtaactc gccttgatcg ttgggaaccg
3420gagctgaatg aagccatacc aaacgacgag cgtgacacca cgatgcctgt
agcaatggca 3480acaacgttgc gcaaactatt aactggcgaa ctacttactc
tagcttcccg gcaacaatta 3540atagactgga tggaggcgga taaagttgca
ggaccacttc tgcgctcggc ccttccggct 3600ggctggttta ttgctgataa
atctggagcc ggtgagcgtg ggtctcgcgg tatcattgca 3660gcactggggc
cagatggtaa gccctcccgt atcgtagtta tctacacgac ggggagtcag
3720gcaactatgg atgaacgaaa tagacagatc gctgagatag gtgcctcact
gattaagcat 3780tggtaactgt cagaccaagt ttactcatat atactttaga
ttgatttaaa acttcatttt 3840taatttaaaa ggatctaggt gaagatcctt
tttgataatc tcatgaccaa aatcccttaa 3900cgtgagtttt cgttccactg
agcgtcagac cccgtagaaa agatcaaagg atcttcttga 3960gatccttttt
ttctgcgcgt aatctgctgc ttgcaaacaa aaaaaccacc gctaccagcg
4020gtggtttgtt tgccggatca agagctacca actctttttc cgaaggtaac
tggcttcagc 4080agagcgcaga taccaaatac tgtccttcta gtgtagccgt
agttaggcca ccacttcaag 4140aactctgtag caccgcctac atacctcgct
ctgctaatcc tgttaccagt ggctgctgcc 4200agtggcgata agtcgtgtct
taccgggttg gactcaagac gatagttacc ggataaggcg 4260cagcggtcgg
gctgaacggg gggttcgtgc acacagccca gcttggagcg aacgacctac
4320accgaactga gatacctaca gcgtgagcta tgagaaagcg ccacgcttcc
cgaagggaga 4380aaggcggaca ggtatccggt aagcggcagg gtcggaacag
gagagcgcac gagggagctt 4440ccagggggaa acgcctggta tctttatagt
cctgtcgggt ttcgccacct ctgacttgag 4500cgtcgatttt tgtgatgctc
gtcagggggg cggagcctat ggaaaaacgc cagcaacgcg 4560gcctttttac
ggttcctggc cttttgctgg ccttttgctc acatgttctt tcctgcgtta
4620tcccctgatt ctgtggataa ccgtattacc gcctttgagt gagctgatac
cgctcgccgc 4680agccgaacga ccgagcgcag cgagtcagtg agcgaggaag
cggaagagcg cccaatacgc 4740aaaccgcctc tccccgcgcg ttggccgatt
cattaatgca gctggcacga caggtttccc 4800gactggaaag cgggcagtga
gcgcaacgca attaatgtga gttacctcac tcattaggca 4860ccccaggctt
tacactttat gcttccggct cctatgttgt gtggaattgt gagcggataa
4920caatttcaca caggaaacag ctatgaccat gattacgcca agctcgaaat
acgactcact 4980atagggcgaa ttgggtaccg ggccggccgt cgagcttgat
ggcatcgtgg tgtcacgctc 5040gtcgtttggt atggcttcat tcagctccgg
ttcccaacga tcaaggcgag ttacatgatc 5100ccccatgttg tgaaaaaaag
cggttagctc ttcggtcctc cgatcgttgt cagaagtaag 5160ttggccgcag
tgttatcact catggttatg gcaggaactg cataattctc ttactgtcat
5220gccatccgta agatgctttt ctgtgactgg tgtactcaac caagtcattc
tgagaatagt 5280gtatgcggcg accgagttgc tcttgcccgg cgtcaacacg
ggataatacc gcgccacata 5340gcagaacttt aaaagtgctc atcattggaa
aacgttcttc ggggcgaaaa ctctcaagga 5400tcttaccgct gttgagatcc
agttcgatgt aacccactcg tgcacccaac tgatcttcag 5460catcttttac
tttcaccagc gtttctgggt gagcaaaaac aggaaggcaa aatgccgcaa
5520aaaagggaat aagggcgaca cggaaatgtt gaatactcat actcttcctt
tttcaatatt 5580attgaagcat ttatcagggt tattgtctca tgagcgatac
atatttgaat gtatttagaa 5640aaataaacaa ataggggttc cgcgcacatt
tccccgaaaa gtgccacctg acgtctaaga 5700aaccattatt atcatgacat
taacctataa aaataggcgt atcacgaggc cctttcgtct 5760tcaagaattg
gggatctacg tatggtcatt cttcttcaga ttccctcatg gagaagtgcg
5820gcagatgtat atgacagagt cgccagtttc caagagactt tattcaggca
cttccatgat 5880aggcaagaga gaagacccag agatgttgtt gtcctagtta
cacatggtat ttattccaga 5940gtattcctga tgaaatggtt tagatggaca
tacgaagagt ttgaatcgtt taccaatgtt 6000cctaacggga gcgtaatggt
gatggaactg gacgaatcca tcaatagata cgtcctgagg 6060accgtgctac
ccaaatggac tgattgtgag ggagacctaa ctacatagtg tttaaagatt
6120acggatattt aacttactta gaataatgcc atttttttga gttataataa
tcctacgtta 6180gtgtgagcgg gatttaaact gtgaggacct caatacattc
agacacttct gacggtatca 6240ccctacttat tcccttcgag attatatcta
ggaacccatc aggttggtgg aagattaccc 6300gttctaagac ttttcagctt
cctctattga tgttacactc ggacacccct tttctggcat 6360ccagttttta
atcttcagtg gcatgtgaga ttctccgaaa ttaattaaag caatcacaca
6420attctctcgg ataccacctc ggttgaaact gacaggtggt ttgttacgca
tgctaatgca 6480aaggagccta tatacctttg gctcggctgc tgtaacaggg
aatataaagg gcagcataat 6540ttaggagttt agtgaacttg caacatttac
tattttccct tcttacgtaa atatttttct 6600ttttaattct aaatcaatct
ttttcaattt tttgtttgta ttcttttctt gcttaaatct 6660ataactacaa
aaaacacata cag 6683176296PRTHomo sapiens 176Met Arg Phe Pro Ser Ile
Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Ala Pro
Val Asn Thr Thr Thr Glu Asp Glu Thr Ala Gln 20 25 30Ile Pro Ala Glu
Ala Val Ile Gly Tyr Leu Asp Leu Glu Gly Asp Phe 35 40 45Asp Val Ala
Val Leu Pro Phe Ser Asn Ser Thr Asn Asn Gly Leu Leu 50 55 60Phe Ile
Asn Thr Thr Ile Ala Ser Ile Ala Ala Lys Glu Glu Gly Val65 70 75
80Ser Leu Asp Lys Arg Glu Ala Glu Ala Gln Glu Val Thr Gln Ile Pro
85 90 95Ala Ala Leu Ser Val Pro Glu Gly Glu Asn Leu Val Leu Asn Cys
Ser 100 105 110Phe Thr Asp Ser Ala Ile Tyr Asn Leu Gln Trp Phe Arg
Gln Asp Pro 115 120 125Gly Lys Gly Leu Thr Ser Leu Leu Leu Ile Gln
Ser Ser Gln Arg Glu 130 135 140Gln Thr Ser Gly Arg Leu Asn Ala Ser
Leu Asp Lys Ser Ser Gly Arg145 150 155 160Ser Thr Leu Tyr Ile Ala
Ala Ser Gln Pro Gly Asp Ser Ala Thr Tyr 165 170 175Leu Cys Ala Val
Arg Pro Thr Ser Gly Gly Ser Tyr Ile Pro Thr Phe 180 185 190Gly Arg
Gly Thr Ser Leu Ile Val His Pro Tyr Ile Gln Asn Pro Asp 195 200
205Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys Ser Ser Asp Lys Ser Val
210 215 220Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr Asn Val Ser Gln
Ser Lys225 230 235 240Asp Ser Asp Val Tyr Ile Thr Asp Lys Cys Val
Leu Asp Met Arg Ser 245 250 255Met Asp Phe Lys Ser Asn Ser Ala Val
Ala Trp Ser Asn Lys Ser Asp 260 265 270Phe Ala Cys Ala Asn Ala Phe
Asn Asn Ser Ile Ile Pro Glu Asp Thr 275 280 285Phe Phe Pro Ser Pro
Glu Ser Ser 290 295177903DNAHomo sapiens 177gaattcatga gatttccttc
aatttttact gcagttttat tcgcagcatc ctccgcatta 60gctgctccag tcaacactac
aacagaagat gaaacggcac aaattccggc tgaagctgtc 120atcggttact
tagatttaga aggggatttc gatgttgctg ttttgccatt ttccaacagc
180acaaataacg ggttattgtt tataaatact actattgcca gcattgctgc
taaagaagaa 240ggggtatctt tggataaaag agaggctgaa gcccaggagg
tgacacagat tcctgcagct 300ctgagtgtcc cagaaggaga aaacttggtt
ctcaactgca gtttcactga tagcgctatt 360tacaacctcc agtggtttag
gcaggaccct gggaaaggtc tcacatctct gttgcttatt 420cagtcaagtc
agagagagca aacaagtgga agacttaatg cctcgctgga taaatcatca
480ggacgtagta ctttatacat tgcagcttct cagcctggtg actcagccac
ctacctctgt 540gctgtgaggc ccacatcagg aggaagctac atacctacat
ttggaagagg aaccagcctt 600attgttcatc cgtatatcca gaacccggat
cctgccgtgt accagctgag agactctaaa 660tccagtgaca agtctgtctg
cctattcacc gattttgatt ctcaaacaaa tgtgtcacaa 720agtaaggatt
ctgatgtgta tatcacagac aaatgtgtgc tagacatgag gtctatggac
780ttcaagagca acagtgctgt ggcctggagc aacaaatctg actttgcatg
tgcaaacgcc 840ttcaacaaca gcattattcc agaagacacc ttcttcccca
gcccagaaag ttcctaactc 900gag 903178330PRTHomo sapiens 178Met Arg
Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala
Leu Ala Ala Pro Val Asn Thr Thr Thr Glu Asp Glu Thr Ala Gln 20 25
30Ile Pro Ala Glu Ala Val Ile Gly Tyr Leu Asp Leu Glu Gly Asp Phe
35 40 45Asp Val Ala Val Leu Pro Phe Ser Asn Ser Thr Asn Asn Gly Leu
Leu 50 55 60Phe Ile Asn Thr Thr Ile Ala Ser Ile Ala Ala Lys Glu Glu
Gly Val65 70 75 80Ser Leu Asp Lys Arg Glu Ala Glu Ala Gly Val Thr
Gln Thr Pro Lys 85 90 95Phe Gln Val Leu Lys Thr Gly Gln Ser Met Thr
Leu Gln Cys Ala Gln 100 105 110Asp Met Asn His Glu Tyr Met Ser Trp
Tyr Arg Gln Asp Pro Gly Met 115 120 125Gly Leu Arg Leu Ile His Tyr
Ser Val Gly Ala Gly Ile Thr Asp Gln 130 135 140Gly Glu Val Pro Asn
Gly Tyr Asn Val Ser Arg Ser Thr Thr Glu Asp145 150 155 160Phe Pro
Leu Arg Leu Leu Ser Ala Ala Pro Ser Gln Thr Ser Val Tyr 165 170
175Phe Cys Ala Ser Ser Tyr Val Gly Asn Thr Gly Glu Leu Phe Phe Gly
180 185 190Glu Gly Ser Arg Leu Thr Val Leu Glu Asp Leu Lys Asn Val
Phe Pro 195 200 205Pro Glu Val Ala Val Phe Glu Pro Ser Glu Ala Glu
Ile Ser His Thr 210 215 220Gln Lys Ala Thr Leu Val Cys Leu Ala Thr
Gly Phe Tyr Pro Asp His225 230 235 240Val Glu Leu Ser Trp Trp Val
Asn Gly Lys Glu Val His Ser Gly Val 245 250 255Cys Thr Asp Pro Gln
Pro Leu Lys Glu Gln Pro Ala Leu Asn Asp Ser 260 265 270Arg Tyr Ala
Leu Ser Ser Arg Leu Arg Val Ser Ala Thr Phe Trp Gln 275 280 285Asp
Pro Arg Asn His Phe Arg Cys Gln Val Gln Phe Tyr Gly Leu Ser 290 295
300Glu Asn Asp Glu Trp Thr Gln Asp Arg Ala Lys Pro Val Thr Gln
Ile305 310 315 320Val Ser Ala Glu Ala Trp Gly Arg Ala Asp 325
3301791005DNAHomo sapiens 179gaattcatga gatttccttc aatttttact
gcagttttat tcgcagcatc ctccgcatta 60gctgctccag tcaacactac aacagaagat
gaaacggcac aaattccggc tgaagctgtc 120atcggttact tagatttaga
aggggatttc gatgttgctg ttttgccatt ttccaacagc 180acaaataacg
ggttattgtt tataaatact actattgcca gcattgctgc taaagaagaa
240ggggtatctt tggataaaag agaggctgaa gccggcgtca ctcagacccc
aaaattccag 300gtcctgaaga caggacagag catgacactg cagtgtgccc
aggatatgaa ccatgaatac 360atgtcctggt atcgacaaga cccaggcatg
gggctgaggc tgattcatta ctcagttggt 420gctggtatca ctgaccaagg
agaagtcccc aatggctaca atgtctccag atcaaccaca 480gaggatttcc
cgctcaggct gctgtcggct gctccctccc agacatctgt gtacttctgt
540gccagcagtt acgtcgggaa caccggggag ctgttttttg gagaaggctc
taggctgacc 600gtactggagg acctgaaaaa cgtgttccca cccgaggtcg
ctgtgtttga gccatcagaa 660gcagagatct cccacaccca aaaggccaca
ctggtgtgcc tggccacagg cttctacccc 720gaccacgtgg agctgagctg
gtgggtgaat gggaaggagg tgcacagtgg ggtctgcaca 780gacccgcagc
ccctcaagga gcagcccgcc ctcaatgact ccagatacgc tctgagcagc
840cgcctgaggg tctcggccac cttctggcag gacccccgca accacttccg
ctgtcaagtc 900cagttctacg ggctctcgga gaatgacgag tggacccagg
atagggccaa acccgtcacc 960cagatcgtca gcgccgaggc ctggggtaga
gcagactaac tcgag 1005180317DNAArtificial SequencepEX172 Plasmid
180ggatccagca tggtgtgtct gaagctccct ggaggctcct gcatgacagc
gctgacagtg 60acactgatgg tgctgagctc cccactggct ttgtccggag acaccggtgg
cggatctcta 120gttccacgcg gtagtggagg cggtggttcc ggagacacgc
gttagtaggt cgacggaggc 180ggtgggggta gaatcgcccg gctggaggaa
aaagtgaaaa ccttgaaagc tcagaactcg 240gagctggcgt ccacggccaa
catgctcagg gaacaggtgg cacagcttaa acagaaagtc 300atgaactact aggatcc
317181884DNAHomo sapiens 181ggatccagca tggtgtgtct gaagctccct
ggaggctcct gcatgacagc gctgacagtg 60acactgatgg tgctgagctc cccactggct
ttgtccggag acaccggaga caccggacag 120aaggaagtgg agcagaactc
tggacccctc agtgttccag agggagccat tgcctctctc 180aactgcactt
acagtgaccg aggttcccag tccttcttct ggtacagaca atattctggg
240aaaagccctg agttgataat gtccatatac tccaatggtg acaaagaaga
tggaaggttt 300acagcacagc tcaataaagc cagccagtat gtttctctgc
tcatcagaga ctcccagccc 360agtgattcag ccacctacct ctgtgccgtt
acaactgaca gctgggggaa attgcagttt 420ggagcaggga cccaggttgt
ggtcacccca gatatccaga accctgaccc tgccgtgtac 480cagctgagag
actctaaatc cagtgacaag tctgtctgcc tattcaccga ttttgattct
540caaacaaatg tgtcacaaag taaggattct gatgtgtata tcacagacaa
atgtgtgcta 600gacatgaggt ctatggactt caagagcaac agtgctgtgg
cctggagcaa caaatctgac 660tttgcatgtg caaacgcctt caacaacagc
attattccag aagacacctt cttccccagc 720ccagaaagtt cctaagtcga
cggaggcggt gggggtagaa tcgcccggct ggaggaaaaa 780gtgaaaacct
tgaaagctca gaactcggag ctggcgtcca cggccaacat gctcagggaa
840caggtggcac agcttaaaca gaaagtcatg aactactagg atcc
8841821004DNAHomo sapiens 182ggatccagca tggtgtgtct gaagctccct
ggaggctcct gcatgacagc gctgacagtg 60acactgatgg tgctgagctc cccactggct
ttgtccggag acaccggaga caccggaaac 120gctggtgtca ctcagacccc
aaaattccag gtcctgaaga caggacagag catgacactg 180cagtgtgccc
aggatatgaa ccatgaatac atgtcctggt atcgacaaga cccaggcatg
240gggctgaggc tgattcatta ctcagttggt gctggtatca ctgaccaagg
agaagtcccc 300aatggctaca atgtctccag atcaaccaca gaggatttcc
cgctcaggct gctgtcggct 360gctccctccc agacatctgt gtacttctgt
gccagcaggc cgggactagc gggagggcga 420ccagagcagt acttcgggcc
gggcaccagg ctcacggtca cagaggacct gaaaaacgtg 480ttcccacccg
aggtcgctgt gtttgagcca tcagaagcag agatctccca cacccaaaag
540gccacactgg tgtgcctggc cacaggcttc taccccgacc acgtggagct
gagctggtgg 600gtgaatggga aggaggtgca cagtggggtc tgcacagacc
cgcagcccct caaggagcag 660cccgccctca atgactccag atacgctctg
agcagccgcc tgagggtctc ggccaccttc 720tggcaggacc cccgcaacca
cttccgctgt caagtccagt tctacgggct ctcggagaat 780gacgagtgga
cccaggatag ggccaaaccc gtcacccaga tcgtcagcgc cgaggcctgg
840ggtagagcag actaagtcga cggaggcggt gggggtagaa tcgcccggct
ggaggaaaaa 900gtgaaaacct tgaaagctca gaactcggag ctggcgtcca
cggccaacat gctcagggaa 960caggtggcac agcttaaaca gaaagtcatg
aactactagg atcc 1004183206PRTHomo sapiens 183Met Gln Lys Glu Val
Glu Gln Asn Ser Gly Pro Leu Ser Val Pro Glu1 5 10 15Gly Ala Ile Ala
Ser Leu Asn Cys Thr Tyr Ser Asp Arg Gly Ser Gln 20 25 30Ser Phe Phe
Trp Tyr Arg Gln Tyr Ser Gly Lys Ser Pro Glu Leu Ile 35 40 45Met Ser
Ile Tyr Ser Asn Gly Asp Lys Glu Asp Gly Arg Phe Thr Ala 50 55 60Gln
Leu Asn Lys Ala Ser Gln Tyr Val Ser Leu Leu Ile Arg Asp Ser65 70 75
80Gln Pro Ser Asp Ser Ala Thr Tyr Leu Cys Ala Val Thr Thr Asp Ser
85 90 95Trp Gly Lys Leu Gln Phe Gly Ala Gly Thr Gln Val Val Val Thr
Pro 100 105 110Asp Ile Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg
Asp Ser Lys 115 120 125Ser Ser Asp Lys Ser Val Cys Leu Phe Thr Asp
Phe Asp Ser Gln Thr 130 135 140Asn Val Ser Gln Ser Lys Asp Ser Asp
Val Tyr Ile Thr Asp Lys Cys145 150 155 160Val Leu Asp Met Arg Ser
Met Asp Phe Lys Ser Asn Ser Ala Val Ala 165 170 175Trp Ser Asn Lys
Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser 180 185 190Ile Ile
Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser 195 200 205
* * * * *
References