U.S. patent application number 11/604911 was filed with the patent office on 2007-12-27 for cholesterol transport gene.
Invention is credited to Alan D. Attie, Angela R. Brooks-Wilson, Mark Cook, Mark P. Gray-Keller, Michael R. Hayden, Simon Pimstone.
Application Number | 20070298420 11/604911 |
Document ID | / |
Family ID | 26859070 |
Filed Date | 2007-12-27 |
United States Patent
Application |
20070298420 |
Kind Code |
A1 |
Attie; Alan D. ; et
al. |
December 27, 2007 |
Cholesterol transport gene
Abstract
Methods and compounds are disclosed for lowering serum LDL
levels or serum cholesterol levels, or for reducing the transport
of cholesterol from the gut to the blood or the lymph, based on the
observation that a gene known as ABC1 is necessary in order for
cholesterol to be transported from the intestinal lumen into the
bloodstream. A mutant chicken phenotype, known as the WHAM chicken,
characterized by low levels of serum LDL and reduced transport of
cholesterol, facilitated the discovery of this function of the ABC1
gene. Techniques which act to inhibit ABC1 activity in the cells of
the intestinal wall will result in lower serum cholesterol.
Inventors: |
Attie; Alan D.; (Madison,
WI) ; Cook; Mark; (Madison, WI) ; Gray-Keller;
Mark P.; (Middleton, WI) ; Hayden; Michael R.;
(Vancouver, CA) ; Pimstone; Simon; (Vancouver,
CA) ; Brooks-Wilson; Angela R.; (Vancouver,
CA) |
Correspondence
Address: |
QUARLES & BRADY LLP
33 E. MAIN ST, SUITE 900
P.O. BOX 2113
MADISON
WI
53701-2113
US
|
Family ID: |
26859070 |
Appl. No.: |
11/604911 |
Filed: |
November 28, 2006 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
09704272 |
Nov 1, 2000 |
7166584 |
|
|
11604911 |
Nov 28, 2006 |
|
|
|
60162803 |
Nov 1, 1999 |
|
|
|
60215564 |
Jun 30, 2000 |
|
|
|
Current U.S.
Class: |
435/6.18 ;
435/29; 436/501 |
Current CPC
Class: |
G01N 33/5008 20130101;
A61P 3/06 20180101; C12Q 2600/158 20130101; G01N 2800/044 20130101;
G01N 33/92 20130101; C12Q 1/6883 20130101; G01N 2500/04 20130101;
C12Q 2600/136 20130101; A61K 49/0008 20130101; A61K 31/64 20130101;
G01N 33/566 20130101; G01N 2500/00 20130101 |
Class at
Publication: |
435/006 ;
435/029; 436/501 |
International
Class: |
C12Q 1/68 20060101
C12Q001/68; C12Q 1/02 20060101 C12Q001/02; G01N 33/566 20060101
G01N033/566 |
Claims
1.-7. (canceled)
8. A method for identifying drugs that can lower serum cholesterol
levels comprising assaying the drug to test if it can bind to an
ABC1 protein.
9.-11. (canceled)
12. A screening assay for determining whether a candidate compound
is useful for reducing transport of cholesterol from the gut to the
blood or lymph, or for lowering LDL or serum cholesterol levels
comprising (a) providing an assay system having a measurable ABC1
biological activity; (b) contacting the assay with the candidate
compound; and (c) measuring ABC1 biological activity, wherein
modulation of ABC1 biological activity, relative to an assay not
contacted with the candidate compound, indicates that the candidate
compound is useful for the treatment of said disease or
condition.
13. The screening assay of claim 12 wherein the assay system is a
cell based system
14. The screening assay of claim 12 wherein the assay system is a
cell free system.
15. (canceled)
16. A screening assay for determining whether a candidate compound
has the ability to reduce transport of cholesterol from the gut to
the blood or lymph, or to lower LDL or serum cholesterol levels,
said screening assay comprises the steps of: (a) providing a cell
expressing an ABC1 gene or a fragment thereof; (b) contacting said
cell with said candidate compound; and (c) measuring ABC1 activity
of said cell, wherein altered ABC1 activity, relative to a cell not
contacted with said compound, indicates that said candidate
compound has said ability.
17.-21. (canceled)
Description
CROSS REFERENCE TO RELATED APPLICATION
[0001] This application claims the benefit of U.S. Provisional
patent applications Ser. No. 60/162,803 filed Nov. 1, 1999 and Ser.
No. 60/215,564 filed Jun. 20, 2000.
BACKGROUND OF THE INVENTION
[0002] Cholesterol is one of the most intensely studied of
molecules that circulate in the human bloodstream. Cholesterol is a
lipid that is a major component of cell membranes and also is the
precursor of steroid hormones and the bile acids. Two sources of
cholesterol are available to cells. Endogenous cholesterol is
synthesized in the liver and other cells and transported through
the bloodstream to other cells. Since cholesterol is highly apolar,
it is transported through the bloodstream in the form of
lipoproteins consisting essentially of a core of apolar molecules
such as cholesterol surrounded by an envelope of polar lipids,
primarily phospholipids. Alternatively, exogenous cholesterol may
be absorbed from the gut. Exogenous cholesterol is transported from
the lumen of the gut into the blood or lymph for distribution via
lipoprotein particles to other cells of the body.
[0003] For the diagnostic purposes related to human health, the
lipoproteins are classified into several categories based on the
density of the lipoprotein particles. The two categories most
discussed in connection with human health are the low-density
lipoproteins (LDL) and the high-density lipoproteins (HDL). For
many people, HDL is known as the "good cholesterol" since it has a
somewhat protective effect on the tendency of LDL to contribute
toward coronary artery disease and related cardiovascular
conditions such as stroke. Studies have shown an inverse
relationship between levels of serum HDL and the occurrence of
coronary artery disease, resulting in HDL levels being graded as a
strong risk factor for cardiovascular disease prediction.
Accordingly, a low level of HDL cholesterol, referred to as
hypoalphalipoproteinemia, is a blood abnormality that correlates
with increased risk of cardiovascular disease.
[0004] One rare form of genetic HDL deficiency is known as Tangier
disease. Patients with the homozygous form of this disease have an
almost total absence of serum HDL cholesterol. The disease is an
autosomal recessive trait, and patients with the disease accumulate
cholesterol esters in several tissues, resulting in characteristic
physical features including enlarged orange or yellow tonsils,
hepatosplenomegaly, peripheral neuropathy, and cholesterol
deposition in the rectal mucosa. The symptoms of the disease appear
to be attributable to a deficiency in cholesterol and/or
phospholipid transport across cell membranes, principally out of
cells that manufacture or store excess cholesterol. The orange
tonsils are, for example, caused by the accumulation of cholesterol
esters and related carotenoids in macrophages. It has now been
established that Tangier Disease is a monogenic disorder caused by
a mutation in the ABC1 gene (Brooks-Wilson, A. et al. 1999,
"Mutations in ABC1 in Tangier disease and familial high-density
lipoprotein deficiency." Nat. Genet. 22:336-345; Bodzioch, M. et
al. 1999, "The gene encoding ATP-binding cassette transporter 1 is
mutated in Tangier Disease." Nat. Genet. 22:347-351; Rust, S., et
al. 1999, "Tangier Disease is caused by mutations in the gene
encoding ATP-binding cassette transporter 1." Nat. Genet.
22:352-355). Other patients exhibit a more common form of genetic
HDL deficiency which results in low plasma HDL and premature
cardiovascular disease, but an absence of the severe symptoms
associated with Tangier disease. A large sub-group of patients with
low HDL have an inherited form of this disease, familial
hypoalphalipoproteinemia (FHA). It has been found that many of
these patients are heterozygotes for mutations in ABC1.
(Brooks-Wilson, A. et al. 1999, supra). Thus, ABC1 in its
homozygous form causes Tangier disease and in its heterozygous form
causes FHA.
[0005] An animal model for low HDL conditions exists in the form of
the Wisconsin Hypo-Alpha Mutant (WHAM) chicken. This single gene
mutation arose naturally and was identified because of the white
skin phenotype and a closed flock of the chickens has been
maintained as an animal model for low HDL disease. (Poernama et al.
Jour. Lipid Res. 31:955-963 (1990)). The effect of this mutation on
diet-induced atherosclerosis has been investigated, and it has been
found that WHAM chickens are highly deficient in their ability to
transport cholesterol from the gut into the blood. (Poernama et al.
Arteriosclerosis and Thrombosis 12:2:601-607 (1992)). Some efforts
have been made to identify the genetic element responsible for the
mutation in the WHAM chickens (Schreyer et al. Arteriosclerosis and
Thrombosis 14:12:2053-2059 (1994)), but prior to the instant
invention, these efforts have not been successful.
[0006] It is highly desirable to identify and develop compounds and
therapeutic agents which are useful for reducing cholesterol
transport from the gut to the blood or lymph and for the regulation
and treatment of cardiovascular disorders (such as high LDL or
serum cholesterol levels), obesity, elevated body-weight index and
other disorders relating to lipid metabolism.
SUMMARY OF THE INVENTION
[0007] The present invention is summarized in that a method is
described for the lowering of levels of LDL cholesterol in an
individual comprising administering to the individual an agent
which modulates the activity of the ABC1 protein in the intestinal
cells of the individual.
[0008] The present invention is further summarized in that a method
is described for reducing cholesterol transport from the gut into
the blood or lymph comprising administering a modulator of the ABC1
protein. In a preferred embodiment, the modulator is an inhibitor
of ABC1 activity, and it is administered orally.
[0009] The present invention is also summarized in that a method
for screening drug candidates for lowering serum LDL levels or for
reducing cholesterol transport from the gut into the blood or lymph
includes the steps of screening compounds for the effect of
modulating ABC1 protein activity. In a preferred embodiment, the
modulator is an inhibitor of ABC1 activity. In a further
embodiment, successful candidates are further screened for the
effect of not stimulating insulin production. Successful drug
candidates may optionally be further modified by combinatorial
chemistry to generate preferred therapeutic agents.
[0010] Compositions of the invention include compounds which are
useful for reducing cholesterol transport from the gut to the blood
or lymph and for the regulation and treatment of cardiovascular
disorders (such as high LDL or serum cholesterol levels), obesity,
elevated body-weight index and other disorders relating to lipid
metabolism which are identified using the screening assays of the
invention.
[0011] Other objects, advantages and features of the present
invention will become apparent from the following
specification.
BRIEF DESCRIPTION OF THE DRAWING FIGURES
[0012] FIG. 1 is a graphical illustration of the relationship
between the human ABC1 gene and the mutation responsible for the
phenotype of the WHAM chickens.
[0013] FIG. 2 is a graphical representation of some of the data
from an example below.
[0014] FIG. 3 is an electro-micrograph of the intestinal wall
demonstrating accumulation of giant lipid droplets in WHAM chickens
but not control chickens. The lipids are not found in columnar
epithelial cells, but in deeper underlying cells of the lamina
propria.
[0015] FIG. 4 is a graphical representation of data which
demonstrates the response to dietary cholesterol in normal and WHAM
chickens
DETAILED DESCRIPTION OF THE INVENTION
[0016] The insights that gave rise to the present invention derive
from several sources. One is the recent identification by several
of the inventors of the specific human gene responsible for Tangier
disease. That gene was identified to be a gene known as ABC1, a
gene that is part of the ATP-binding cassette superfamily of genes.
Deficiencies in the function of this gene are associated with
decreased transport of cholesterol out of cells that synthesize
excess cholesterol. The second insight was the understanding that
the genetic mutation in the WHAM chickens is, in fact, a mutation
in the same ABC1 gene or a related gene. This insight establishes
for the first time that the ABC1 protein may be critical for
cholesterol absorption. Because the mechanism of action of the
mutant gene in the WHAM chickens had been previously understood to
be a deficiency in absorption of isoprenoids and sterols from the
lumen of the digestive tract, this observation suggested to the
inventors that the same ABC1 gene may be necessary for cholesterol
transport from the digestive tract to the blood stream. The
combination of these two observations had led to the understanding,
first expressed here, that lowered serum cholesterol levels, and in
particular, lower levels of LDL, of "bad" cholesterol, can be
achieved by blocking the transport action of the ABC1 in
facilitating the transport of cholesterol from the intestinal lumen
through the intestinal wall cells into the blood stream. Since it
is revealed here that the ABC1 gene is a necessary component in the
transport of isoprenoids and sterols from the gut into the blood
stream, as revealed in particular by the inability of WHAM chickens
to uptake these compounds from their diets, it also becomes clear
that uptake of these compounds in healthy individuals from the
intestines can also be inhibited by blocking the action of
otherwise functional copies of this transport protein. Since
cholesterol in the intestinal tract is either secreted by the liver
into the bile and thus into the intestinal tract, or derives from
exogenous sources, blocking the absorption of cholesterol from the
gut into the blood stream through the intestinal wall will result
in lowering the total level of cholesterol in the plasma of the
individual.
[0017] The ABC1 protein is a cross-membrane transport protein. In
cells throughout the body, the protein transports cholesterol from
the cytosol into the blood stream. In the cells of the intestinal
wall, this transport protein performs a similar function.
Cholesterol is absorbed from the intestinal lumen into the cells
lining the intestinal wall and is then transported into the blood
stream. In the absence of an effective ABC1 protein, the
cholesterol can not be transported into the blood or lymph and can
go no further. Thus, in ABC1 deficient individuals, cholesterol
accumulates in the wall of the intestines. In individuals with
normal ABC1 protein function, the ABC1 protein serves to transport
the cholesterol absorbed from the intestine from the cell into the
blood stream. Thus inhibiting the transport function of the ABC1
protein in intestinal wall cells prevents cholesterol entering the
gut from being transported into the blood stream.
[0018] This invention establishes for the first time the presence
of a two stage process for cholesterol absorption from the gut:
cholesterol first proceeds to cross the epithelial cells; and
secondly by an ABC1-dependent process cholesterol is transported
through the lamina propria into the blood or lymph. Thus an
important aspect of this invention is the identification of a layer
of cells beneath the columnar epithelium which are an essential
part of the cholesterol absorption/transport pathway. These cells
can be studied for other mechanisms or sites of activity for
compounds which lead to inhibition of cholesterol
absorption/transport from the gut to the blood.
[0019] This insight leads to other useful processes. Since the same
gene, ABC1, is responsible for transport of cholesterol,
phospholipids and other isoprenoids, including carotenoids, from
intestinal wall cells into the blood stream, assays for the ability
of a patient to transport of carotenoids from the gut into the
serum will also be diagnostic of that person's ability to similarly
transport cholesterol. Since mutations in ABC1 are a major cause of
FHA, the carotenoid absorption test might constitute a clinically
useful diagnostic procedure for identifying patients with ABC1
mutations and thus categorize patients for subsequent therapy.
[0020] The identification of a mutation in the ABC1 gene as the
cause for Tangier disease was first reported only recently. See
Brooks-Wilson et al. Nature Genetics 22:336-345 (1999), Bodzioch et
al. Nature Genetics 22:347-351 (1999), and Rust et al. Nature
Genetics 22:352-355, (1999), each of which is hereby incorporated
by reference. The ABC1 protein is a complex membrane protein with
twelve transmembrane domains, that is a part of the ABC gene
family, whose members include proteins implicated in the active
transport of substances across biological membranes. The papers
cited in this paragraph established the role of the ABC1
transporter gene as a necessary agent for the transport of
cholesterol out across the membrane of a cholesterol producing
cell. This document is the first report of the observation that the
ABC1 gene is also necessary for the transport of cholesterol from
the intestines to the blood stream and to teach a method to make
use of that knowledge for human health purposes.
[0021] The establishment of the role for the ABC1 transporter
protein in cholesterol uptake was made on the basis of the WHAM
chickens, following the identification of the ABC1 gene as the
causative agent for Tangier disease. It had been previously known
that the mutant gene responsible for the mutant phenotype in the
chickens mapped to the Z sex chromosome, in the Y locus and
proximal to the ID locus. Examination of the public mapping data
from the chicken genome mapping project showed a region of synteny
with a region of human chromosome 9 in which the human ABC1 gene is
present. In short, genetic mapping has demonstrated that genes from
syntenic loci are responsible for the mutation in the WHAM chickens
and in the Tangier patients. DNA sequence anlysis has identified
the mutation in the chicken ABC1 gene causitive of HDL deficiency.
In the WHAM chickens, however, the symptoms appear to also be the
result of deficiencies in uptake of substances (i.e. cholesterol
and carotenoids) from the digestive tract. In the WHAM chicken,
cholesterol ester accumulates in the wall of the intestine, but not
in the columnar epithelium, rather in the lamina propria. ABC1 mRNA
is present in this region in control chickens but is not seen in
the columnar epithelium. This establishes the utility of the WHAM
chickens as an animal model for the study of HDL and cholesterol
transport deficiency in humans, and also provides the basis for the
therapeutic and diagnostic strategies described in this
document.
[0022] The WHAM chicken has thus supplied the first genetic
evidence that vertebrates, like invertebrates, have an
extracellular lipoprotein assembly pathway. Since the WHAM chickens
are refractive to the effects of a high-cholesterol diet (see
Examples, below), the inventors concluded that ABC1 plays a role in
intestinal cholesterol transport.
[0023] The first and potentially most important strategy described
here is based on the fact that if ABC1 is necessary for the
transport of cholesterol from the intestines into the blood stream.
Blocking the action of the ABC1 gene or protein in the cells of the
intestinal wall from performing that transport activity results in
decreasing the transport of cholesterol into the serum. Cholesterol
normally enters the intestinal lumen from two sources, food eaten
by the individual and from cholesterol excreted from the liver into
the bile. If cholesterol transport is inhibited in the intestinal
wall cells by an ABC1 blocker, serum cholesterol levels will go
down, since the cholesterol secreted by the liver will not be
re-directed into the blood stream. On the other hand, if the
inhibition of cholesterol uptake is selectively performed only in
the cells of the intestinal wall, there should be no effect on the
levels of HDL in the individual's serum, since the normal transport
of cholesterol out of cholesterol producing cells will not be
affected. Since the site of ABC1 activity that is to be blocked is
in the cells of the intestinal wall, and blockage of ABC1 activity
elsewhere may not be desirable, it is envisioned that the most
convenient mode of delivery of the ABC1 blocker will be by oral
delivery.
[0024] It is envisioned that the transport activity of ABC1 can be
inhibited in many ways. One method would be to inhibit the
expression of endogenous ABC1 gene activity to reduce the abundance
of the ABC1 protein. An example of the implementation of this
method would be an antisense construct for the ABC1 gene delivered
(either in free form or by liposome or viral vector) through the
intestinal tract to the intestinal wall cells. Another method would
be to inhibit the activity of the protein by introducing a chemical
inhibitor of the activity of the protein. An example of the second
method would be the use of a drug containing a sulfonylurea
compound, an agent known to inhibit ABC1 protein activity. In
either case, the delivery methodology should be on capable of
delivering the inhibiting agent to the cells of the intestinal
lining.
[0025] For the modulation of the activity of ABC1 using genetic
techniques, it is necessary to introduce the genetic elements into
the cells of the intestinal epithelium. This can be done by using
liposomes of viral vectors carrying the genetic elements orally.
Such liposomes or viral vectors can achieve transfection of foreign
genetic constructs into the somatic cells with which they come in
contact as some frequency dependent on the efficiency of the
particular vector. There are several methods that can be used to
inhibit gene activity, but amongst those the best known is based on
the used of an antisense RNA construct. A genetic construct can be
made which encodes the coding region of at least a portion of the
coding region of the native ABC1 gene, in the antisense direction.
When such a construct is expressed in cells, the antisense RNA
produced interferes with normal gene expression activity in the
cells and the native levels of the targeted protein drop. Such an
antisense technique can be used to selectively target unwanted
cholesterol transport activity in the intestinal lining without
interfering with desired ABC1 activity throughout the rest of the
body. The sequence of the human ABC1 gene is appended hereto as SEQ
ID:NO: 1 to enable the implementation of this strategy.
[0026] The sulfonylurea drugs act to inhibit ABC1. For example, one
member of this drug family, glibenclamide, has been shown to
inhibit iodide transport in frog oocytes which are induced to
express ABC1. Becq et al. Jour. Biol. Chem. 272:5:2695-2699 (1997).
Sulfonylurea drugs are also currently used in the treatment of
diabetes to stimulate insulin secretion from islet cells in the
pancreas. It is preferred that the sulfonylurea drug be one that is
highly inhibitory of ABC1 activity but not one that stimulates
insulin production. In this way, the drug could interfere with
cholesterol uptake without unnecessarily stimulating insulin
production. It is specifically envisioned that the family of
sulfonylurea compounds can be screened to identify those members of
the group which retain the ability to inhibit the activity of ABC1
without stimulating the production of insulin. The outline of a
methodology for that screening process is described below.
[0027] Another use for the observation that the mutation in the
ABC1 gene in the cause for the phenotype in the WHAM chickens
arises from the observation that the WHAM chickens were originally
identified primarily because they cannot extract carotenoids from
their gut, leaving the animals deficient in carotene (as a result,
their serum is colorless instead of yellow and their skin is white
instead of yellow).
[0028] Also, with the insight into the intestinal transport
function of the ABC1 gene disclosed here, it becomes possible to
screen new drugs for cholesterol lowering function. Chemical
entities that will bind with high affinity to the extra-cellular
domains of the ABC1 protein, such as domains identified above, will
prove to have cholesterol lowering properties as long as they are
capable of passing through the stomach into the intestines without
deactivation or digestion. It is then possible to use the WHAM
chickens as a control to test drugs identified in this fashion,
since such drug should be ineffective in these chickens.
[0029] Another specifically envisioned class includes of inhibitors
of ABC1 is antibodies, polyclonal or monoclonal, which are directed
against the appropriate domains of the ABC1 transporter protein
which are located on the surface of the intestinal cells. For the
approach of using antibodies, it is preferred that the antibodies
be raised against the domains of the ABC1 protein which appear to
be exposed on the surfaces of those cells. Set forth in the
sequence listing at the end of this document is the complete DNA
sequence for the ABC1 gene and the amino acid sequence for the ABC1
transporter protein. The domains of the transported protein that
are located exposed on the surface of the epithelial cells in the
intestinal wall can be predicted based on computer analysis of this
sequence information. The putative external domains of the ABC1
transporter protein identified by this means are set forth in the
list following this paragraph. It is predicted that these regions
are essential for the transport function of the ABC1 protein and
that a protein or small molecule which binds to one of these
regions (or to any other essential region of the ABC1 protein) will
inhibit the transport activity of ABC1. To make antibodies against
these regions, peptides can be prepared that include the amino
acids sequences of these regions. These peptides can be used to
make polyclonal antibodies by immunizing animals and recovering
their serum. Monoclonal antibodies can be made as well. It is also
envisaged that antibodies can be made by injecting the peptides
into chickens and thus these chickens will produce eggs enriched in
the needed antibody as in Yokoyama et al. Am. J. Vet. Res.
54:6:876-872 (1993). The antibodies can be recovered from the egg
yolks and prepared separately, or the eggs themselves can be eaten
by a patient, to expose the antibody to the target, i.e. the
exposed domains of the ABC1 transporter protein. It is specifically
envisaged that the resulting antibodies may be ingested by the
individual being treated for introduction to the target site. It
has been previously demonstrated that antibodies may be introduced
into an individual's food source to have selected effects on
intestinal receptors, as is demonstrated by U.S. Pat. Nos.
5,814,361 and 5,725,873, the specifications of which are hereby
incorporated by reference. These patents disclose suitable methods
for the delivery of antibodies in the diet to individuals to block
an intestinal hormone. TABLE-US-00001 Predicted external domains of
ABC1 TM1-TM2 663 KEARLKETMRIMGLDNSI 608 TM3-TM4 740 FSRAN 744
TM5-TM6 795 ALFEEQGIGVQWDNLFESPVEEDGFN 820 TM7-TM8 1371
FGKYPSLELQPWMYNEQYTFVSNDAPEDTGTLELLN
ALTKDPGFGTRCMEGNPIPDTPCQAGEEEWTTAPVPQTIMD
LFQNGNWTMQNPSPACQCSSDKIKKMLPVCPPGAGGLPPPQ
RKQNTADILQDLTGRNISDYLVKTYVQIIAKSLKNKIWVNE
FRYGGFSLGVSNTQALPPSQEVNDAIKQMKKHLKLAKDSSA
DRFLNSLGRFMTGLDTRNNVKVWFNNKGWHAISSFLNVINN
AILRANLQKGENPSHYGITAFNHPLNLTKQQLSEVALMTTS VD 1654 TM9-TM10 1741
LLLLYGWSITPLMYPASFVFKIP 1763 TH11-TH12 1823
VKNQAMADALERFGENRFVSPLSWDLVGR 1851
[0030] ABC1 Nomenclature and Reported Nucleic Acid/Protein
Sequences
[0031] The ABC1 gene and protein referred to herein is also
sometimes referred to as ABCA1 or CERP (cholesterol-efflux
regulatory protein) in the scientific literature. The complete
ABCA1 cDNA, genomic DNA sequence, and predicted protein sequence
has been disclosed in PCT/IBOO/00532 and U.S. patent application
Ser No. 09/654,328, filed Sep. 1, 2000, incorporated herein by
reference. The human ABCA1 in the GeneBank has the following
accession numbers: AJ012376; AF165281; NM.sub.--005502; AF285167.
Corresponding ABCA1 genes and peptides from other organisms have
also been reported in GenBank.
[0032] Screening Assays for Modulators of ABC1 Activity
[0033] The invention provides screening assay methods for
identifying therapeutic compounds useful for treatments which
reduce exogenous cholesterol transport from the gut lumen to the
blood or lymph and for the regulation and treatment of
cardiovascular disorders (such as high LDL or serum cholesterol
levels), obesity, elevated body-weight index and other disorders
relating to lipid metabolism which can be used in human patients.
The screening assay methods of the invention simplify the
evaluation, identification and development of candidate compounds
and therapeutic agents for the treatment of such conditions and
disorders. In general, the screening methods provide a simplified
means for selecting natural product extracts or compounds of
interest from a large population, generally a compound library,
which are further evaluated and condensed to a few active and
selective materials useful for treatments of such conditions and
disorders (these treatments are sometimes referred to herein as the
"desired purposes of the invention"). Constituents of this pool are
then purified, evaluated, or modified by combinatorial chemistry in
order to identify preferred compounds for the desired purposes of
the invention.
[0034] Compounds that modulate ABC1 biological activity can be
identified by their effects on a known biological activity of ABC1,
including but not limited to cellular or microsomal scale assays of
efflux of phospholipid, cholesterol or other chemical species,
protein level assays of binding specificity, protein stability,
regulated catabolism, or its ability to bind proteins, lipids or
other factors, expression level or stability of ABC1 mRNA and
precursor RNAs, or, in short, by any activity that identifies a
biological effect, characteristic or feature of the ABC1
protein.
[0035] What follows is a general description of potential ABC1
screening assay. More detailed descriptions of certain of these
assays are set out in a separate section below.
[0036] In one example, the phosphorylation state or other
post-translational modification is monitored as a measure of ABC1
biological activity. ABC1 has ATP binding sites, and thus assays
may wholly or in part test the ability of ABC1 to bind ATP or to
exhibit ATPase activity. Drug screening assays could be based upon
assaying for the ability of the protein to form a channel, or upon
the ability to transport cholesterol or another molecule, or based
upon the ability of other proteins bound by or regulated by ABC1 to
form a channel. In addition to its role as a regulator of
cholesterol levels, ABC1 may also transports anions. Functional
assays could be based upon this property, and could employ drug
screening technology such as (but not limited to) the ability of
various dyes to change color in response to changes in specific ion
concentrations in such assays can be performed in vesicles such as
liposomes, or adapted to use whole cells.
[0037] Drug screening assays can also be based upon the ability of
ABC1 or other ABC transporters to interact with other proteins.
Such interacting proteins can be identified by a variety of methods
known in the art, including, for example, radioimmunoprecipitation,
co-immunoprecipitation, co-purification, and yeast two-hybrid
screening. Such interactions can be further assayed by means
including but not limited to fluorescence polarization or
scintillation proximity methods. Drug screens can also be based
upon functions of the ABC1 protein deduced upon X-ray
crystallography of the protein and comparison of its 3-D structure
to that of proteins with known functions. Such a crystal structure
has been determined for the prokaryotic ABC family member HisP,
histidine permease. Drug screens can be based upon a function or
feature apparent upon creation of a transgenic or knockout mouse,
or upon overexpression of the protein or protein fragment in
mammalian cells in vitro. Moreover, expression of mammalian (e.g.,
human) ABC1 in yeast or C. elegans allows for screening of
candidate compounds in wild-type and mutant backgrounds, as well as
screens for mutations that enhance or suppress an ABC1-dependent
phenotype. Modifier screens can also be performed in ABC1
transgenic or knock-out mice.
[0038] Additionally, drug screening assays can also be based upon
ABC1 functions deduced upon antisense interference with the gene
function. Intracellular localization of ABC1, or effects which
occur upon a change in intracellular localization of the protein,
can also be used as an assay for drug screening. Immunocytochemical
methods will be used to determine the exact location of the ABC1
protein.
[0039] Human and rodent ABC1 protein can be used as an antigen to
raise antibodies, including monoclonal antibodies. Such antibodies
will be useful for a wide variety of purposes, including but not
limited to functional studies and the development of drug screening
assays and diagnostics. Monitoring the influence of agents (e.g.,
drugs, compounds) on the expression or biological activity of ABC1
can be applied not only in basic drug screening, but also in
clinical trials. For example, the effectiveness of an agent
determined by a screening assay as described herein to decrease
ABC1 gene expression, protein levels, or biological activity can be
monitored in clinical trails of subjects exhibiting altered ABC1
gene expression, protein levels, or biological activity.
Alternatively, the effectiveness of an agent determined by a
screening assay to modulate ABC1 gene expression, protein levels,
or biological activity can be monitored in clinical trails of
subjects exhibiting decreased altered gene expression, protein
levels, or biological activity. In such clinical trials, the
expression or activity of ABC1 and, preferably, other genes that
have been implicated in, for example, cardiovascular disease can be
used to ascertain the effectiveness of a particular drug.
[0040] For example, and not by way of limitation, genes, including
ABC1, that are modulated in cells by treatment with an agent (e.g.,
compound, drug or small molecule) that modulates ABC1 biological
activity (e.g., identified in a screening assay as described
herein) can be identified. Thus, to study the effect of agents on
reducing cholesterol transport from the gut to the blood or lymph,
or for reducing LDL or serum cholesterol levels, for example, in a
clinical trial, cells can be isolated and RNA prepared and analyzed
for the levels of expression of ABC1 and other genes implicated in
the disorder. The levels of gene expression can be quantified by
Northern blot analysis or RT-PCR, or, alternatively, by measuring
the amount of protein produced, by one of a number of methods known
in the art, or by measuring the levels of biological activity of
ABC1 or other genes. In this way, the gene expression can serve as
a marker, indicative of the physiological response of the cells to
the agent. Accordingly, this response state may be determined
before, and at various points during, treatment of the individual
with the agent.
[0041] In a preferred embodiment, the present invention provides a
method for monitoring the effectiveness of treatment of a subject
with an agent (e.g., an agonist, antagonist, peptidomimetic,
protein, peptide, nucleic acid, small molecule, or other drug
candidate identified by the screening assays described herein)
including the steps of (i) obtaining a pre-administration sample
from a subject prior to administration of the agent; (ii) detecting
the level of expression of an ABC1 protein, mRNA, or genomic DNA in
the preadministration sample; (iii) obtaining one or more
post-administration samples from the subject; (iv) detecting the
level of expression or activity of the ABC1 protein, mRNA, or
genomic DNA in the post-administration samples; (v) comparing the
level of expression or activity of the ABC1 protein, mRNA, or
genomic DNA in the pre-administration sample with the ABC1 protein,
mRNA, or genomic DNA in the post administration sample or samples;
and (vi) altering the administration of the agent to the subject
accordingly. For example, administration of the agent may be
desirable to decrease the expression or activity of ABC1.
[0042] The ABC1 gene or a fragment thereof can be used as a tool to
express the protein in an appropriate cell in vitro or in vivo
(gene therapy), or can be cloned into expression vectors which can
be used to produce large enough amounts of ABC1 protein to use in
in vitro assays for drug screening. Expression systems which may be
employed include baculovirus, herpes virus, adenovirus,
adeno-associated virus, bacterial systems, and eucaryotic systems
such as CHO cells. Naked DNA and DNA-liposome complexes can also be
used.
[0043] Assays of ABC1 activity includes binding to intracellular
interacting proteins; interaction with a protein that modulates
ABC1 activity; interaction with HDL particles or constituents;
interaction with other proteins which facilitate interaction with
HDL or its constituents; and measurement of cholesterol efflux.
Furthermore, assays may be based upon the molecular dynamics of
macromolecules, metabolites and ions by means of
fluorescent-protein biosensors.
[0044] Alternatively, the effect of candidate modulators on
expression or activity may be measured at the level of ABC1 protein
production using the same general approach in combination with
standard immunological detection techniques, such as Western
blotting or immunoprecipitation with an ABC1-specific antibody.
Again, useful modulators are identified as those which produce a
change in ABC1 polypeptide production. Agonists may also affect
ABC1 activity without any effect on expression level.
[0045] Agonists, antagonists, or mimetics found to be effective at
modulating the level of cellular ABC1 expression or activity may be
confirmed as useful in animal models (for example, mice, pigs,
rabbits, or chickens).
[0046] A compound that promotes a decrease in ABC1 expression or
activity is considered particularly useful in the invention; such a
molecule may be used, for example, as a therapeutic to decrease the
level or activity of native, cellular ABC1 and thereby reduce
cholesterol transport from the gut to the blood or lymph, or reduce
LDL or serum cholesterol levels in an animal (for example, a
human).
[0047] One method for decreasing ABC biological activity is to
decrease the stabilization of the ABC protein or to prevent its
degradation.
[0048] In one example, cells expressing an ABC1 polypeptide having
a mutation are transiently metabolically labeled during translation
and the half-life of the ABC1 polypeptide is determined using
standard techniques. Mutations that decrease the half-life of an
ABC1 polypeptide are ones that decrease ABC1 protein stability.
[0049] The Cholesterol Efflux Assay as a Drug Screen
[0050] A cholesterol efflux assay measures the ability of cells to
transfer cholesterol to an extracellular acceptor molecule and is
dependent on ABC1 function. A standard cholesterol efflux assay is
set out in Marcil et al., Arterioscler. Thromb. Vasc. Biol.
19:159-169, 1999, incorporated by reference herein for all
purposes. Prior to this invention, this assay has not been used to
identify compounds useful for reducing cholesterol transport from
the gut to the blood or lymph, or for reducing LDL or serum
cholesterol levels.
[0051] In this procedure, cells are loaded with radiolabeled
cholesterol by any of several biochemical pathways. Cholesterol
efflux of cells is measured after incubation for various times
(typically 0 to 24 hours) in the presence of HDL3 or purified
ApoAI. Cholesterol efflux is determined as the percentage of total
cholesterol in the culture medium after various times of
incubation. Increased ABC1 expression levels and/or biological
activity are associated with increased efflux while decreased
levels of ABC1 expression and/or biological activity are associated
with decreased cholesterol efflux.
[0052] This assay can be readily adapted to the format used for
drug screening, which may consist of a multi-well (e.g., 96-well)
format. Modification of the assay to optimize it for drug screening
would include scaling down and streamlining the procedure,
modifying the labeling method, using a different cholesterol
acceptor, altering the incubation time, and changing the method of
calculating cholesterol efflux. In all these cases, the cholesterol
efflux assay remains conceptually the same, though experimental
modifications may be made.
[0053] For high throughput, fluorescent lipids can be used to
measure ABC1-catalyzed lipid efflux. For phospholipids, a
fluorescent precursor, C6-NBD-phosphatidic acid, can be used. This
lipid is taken up by cells and dephosphorylated by phosphatidic
acid phosphohydrolase. The product, NBD-diglyceride, is then a
precursor for synthesis of glycerophospholipids like
phosphatidylcholine. The efflux of NBD-phosphatidylcholine can be
monitored by detecting fluorescence resonance energy transfer
(FRET) of the NBD to a suitable acceptor in the cell culture
medium. This acceptor can be rhodamine-labeled
phosphatidylethanolamine, a phospholipid that is not readily taken
up by cells. The use of short-chain precursors obviates the
requirement for the phospholipid transfer protein in the media. For
cholesterol, NBD-cholesterol ester can be reconstituted into LDL.
The LDL can efficiently deliver this lipid to cells via the LDL
receptor pathway. The NBD-cholesterol esters are hydrolyzed in the
lysosomes, resulting in NBD-cholesterol that can now be transported
back to the plasma membrane and efflux from the cell. The efflux
can be monitored by the aforementioned FRET assay in which NBD
transfers its fluorescence resonance energy to the
rhodamine-phosphatidylethanoline acceptor.
[0054] Protein-Based Assays
[0055] ABC1 polypeptide (purified or unpurified) can be used in an
assay to determine its ability to bind another protein (including,
but not limited to, proteins found to specifically interact with
ABC1). The effect of a compound on that binding is then determined.
Useful ABC1 proteins include wild-type and mutant ABC1 proteins or
protein fragments, in a recombinant form or endogenously
expressed.
[0056] Protein Interaction Assays
[0057] ABC1 protein (or a polypeptide fragment thereof or an
epitope-tagged form or fragment thereof) is harvested from a
suitable source (e.g., from a prokaryotic expression system,
eukaryotic cells, a cell-free system, or by immunoprecipitation
from ABC1-expressing cells). The ABC1 polypeptide is then bound to
a suitable support (e.g., nitrocellulose or an antibody or a metal
agarose column in the case of, for example, a his-tagged form of
ABC1). Binding to the support is preferably done under conditions
that allow proteins associated with ABC1 polypeptide to remain
associated with it. Such conditions may include use of buffers that
minimize interference with protein-protein interactions. The
binding step can be done in the presence and absence of compounds
being tested for their ability to interfere with interactions
between ABC1 and other molecules. If desired, other proteins (e.g.,
a cell lysate) are added, and allowed time to associate with the
ABC polypeptide. The immobilized ABC1 polypeptide is then washed to
remove proteins or other cell constituents that may be
non-specifically associated with it the polypeptide or the support.
The immobilized ABC1 polypeptide is then dissociated from its
support, and so that proteins bound to it are released (for
example, by heating), or, alternatively, associated proteins are
released from ABC1 without releasing the ABC1 polypeptide from the
support. The released proteins and other cell constituents can be
analyzed, for example, by SDS-PAGE gel electrophoresis, Western
blotting and detection with specific antibodies, phosphoamino acid
analysis, protease digestion, protein sequencing, or isoelectric
focusing. Normal and mutant forms of ABC1 can be employed in these
assays to gain additional information about which part of ABC1 a
given factor is binding to. In addition, when incompletely purified
polypeptide is employed, comparison of the normal and mutant forms
of the protein can be used to help distinguish true binding
proteins.
[0058] The foregoing assay can be performed using a purified or
semipurified protein or other molecule that is known to interact
with ABC1. This assay may include the following steps.
[0059] 1. Harvest ABC1 protein and couple a suitable fluorescent
label to it;
[0060] 2. Label an interacting protein (or other molecule) with a
second, different fluorescent label. Use dyes that will produce
different quenching patterns when they are in close proximity to
each other vs. when they are physically separate (i.e., dyes that
quench each other when they are close together but fluoresce when
they are not in close proximity);
[0061] 3. Expose the interacting molecule to the immobilized ABC1
in the presence or absence of a compound being tested for its
ability to interfere with an interaction between the two; and
[0062] 4. Collect fluorescent readout data.
[0063] Another possible assay is the Fluorescent Resonance Energy
Transfer (FRET) assay. This assay can be performed as follows.
[0064] 1. Provide ABC1 protein or a suitable polypeptide fragment
thereof and couple a suitable FRET donor (e.g.,
nitro-benzoxadiazole (NBD)) to it;
[0065] 2. Label an interacting protein (or other molecule) with a
FRET acceptor (e.g., rhodamine);
[0066] 3. Expose the acceptor-labeled interacting molecule to the
donor-labeled ABC1 in the presence or absence of a compound being
tested for its ability to interfere with an interaction between the
two; and
[0067] 4. Measure fluorescence resonance energy transfer.
[0068] Quenching and FRET assays are related. Either one can be
applied in a given case, depending on which pair of fluorophores is
used in the assay.
[0069] Membrane Permeability Assay
[0070] The ABC1 protein can also be tested for its effects on
membrane permeability. For example, beyond its putative ability to
translocate lipids, ABC1 might affect the permeability of membranes
to ions. Other related membrane proteins, most notably the cystic
fibrosis transmembrane conductance regulator and the sulfonylurea
receptor, are associated with and regulate ion channels.
[0071] ABC1 or a fragment of ABC1 is incorporated into a synthetic
vesicle, or, alternatively, is expressed in a cell and vesicles or
other cell sub-structures containing ABC1 are isolated. The
ABC1-containing vesicles or cells are loaded with a reporter
molecule (such as a fluorescent ion indicator whose fluorescent
properties change when it binds a particular ion) that can detect
ions (to observe outward movement), or alternatively, the external
medium is loaded with such a molecule (to observe inward movement).
A molecule which exhibits differential properties when it is inside
the vesicle compared to when it is outside the vesicle is
preferred. For example, a molecule that has quenching properties
when it is at high concentration but not when it is at another low
concentration would be suitable. The movement of the charged
molecule (either its ability to move or the kinetics of its
movement) in the presence or absence of a compound being tested for
its ability to affect this process can be determined.
[0072] In another assay, membrane permeability is determined
electro-physiologically by measuring ionic influx or efflux
mediated by or modulated by ABC1 by standard electrophysiological
techniques. A suitable control (e.g., TD cells or a cell line with
very low endogenous ABC1 expression) can be used as a control in
the assay to determine if the effect observed is specific to cells
expressing ABC1.
[0073] In still another assay, uptake of radioactive isotopes into
or out of a vesicle can be measured. The vesicles are separated
from the extravesicular medium and the radioactivity in the
vesicles and in the medium is quantitated and compared.
[0074] Nucleic Acid-Based Assays
[0075] ABC1 nucleic acid may be used in an assay based on the
binding of factors necessary for ABC1 gene transcription. The
association between the ABC1 DNA and the binding factor may be
assessed by means of any system that discriminates between
protein-bound and non-protein-bound DNA (e.g., a gel retardation
assay). The effect of a compound on the binding of a factor to ABC1
DNA is assessed by means of such an assay. In addition to in vitro
binding assays, in vivo assays in which the regulatory regions of
the ABC1 gene are linked to reporter genes can also be
performed.
[0076] Assays Measuring Stability of ABC1 Protein or mRNA
[0077] A cell-based or cell-free system can be used to screen for
compounds based on their effect on the half-life of ABC1 mRNA or
ABC1 protein. The assay may employ labeled mRNA or protein.
Alternatively, ABC1 mRNA may be detected by means of specifically
hybridizing probes or a quantitative PCR assay. Protein can be
quantitated, for example, by fluorescent antibody-based
methods.
[0078] In Vitro mRNA Stability Assay
[0079] 1. Isolate or produce, by in vitro transcription, a suitable
quantity of ABC1 mRNA;
[0080] 2. Label the ABC1 mRNA;
[0081] 3. Expose aliquots of the mRNA to a cell lysate in the
presence or absence of a compound being tested for its ability to
modulate ABC1 mRNA stability;
[0082] 4. Assess intactness of the remaining mRNA at suitable time
points.
[0083] In Vitro Protein Stability Assay
[0084] 1. Express a suitable amount of ABC1 protein;
[0085] 2. Label the protein;
[0086] 3. Expose aliquots of the labeled protein to a cell lysate
in the presence or absence of a compound being tested for its
ability to modulate ABC1 protein stability;
[0087] 4. Assess intactness of the remaining protein at suitable
time points
[0088] In Vivo mRNA or Protein Stability Assay
[0089] 1. Incubate cells expressing ABC1 mRNA or protein with a
tracer (radiolabeled ribonucleotide or radiolabeled amino acid,
respectively) for a very brief time period (e.g., five minutes) in
the presence or absence of a compound being tested for its effect
on mRNA or protein stability;
[0090] 2. Incubate with unlabeled ribonucleotide or amino acid;
and
[0091] 3. Quantitate the ABC1 mRNA or protein radioactivity at time
intervals beginning with the start of step 2 and extending to the
time when the radioactivity in ABC1 mRNA or protein has declined by
approximately 80%. It is preferable to separate the intact or
mostly intact mRNA or protein from its radioactive breakdown
products by a means such as gel electrophoresis in order to
quantitate the mRNA or protein.
[0092] Assays Measuring Inhibition of Dominant Negative
Activity
[0093] Mutant ABC1 polypeptides are likely to have dominant
negative activity (i.e., activity that interferes with wild-type
ABC1 function). An assay for a compound that can interfere with
such a mutant may be based on any method of quantitating normal
ABC1 activity in the presence of the mutant. For example, normal
ABC1 facilitates cholesterol efflux, and a dominant negative mutant
would interfere with this effect. The ability of a compound to
counteract the effect of a dominant negative mutant may be based on
cellular cholesterol efflux, or on any other normal activity of the
wild-type ABC1 that was inhibitable by the mutant.
[0094] Assays Measuring Phosphorylation
[0095] The effect of a compound on ABC1 phosphorylation can be
assayed by methods that quantitate phosphates on proteins or that
assess the phosphorylation state of a specific residue of a ABC1.
Such methods include but are not limited to .sup.32P labelling and
immunoprecipitation, detection with antiphosphoamino acid
antibodies (e.g., antiphosphoserine antibodies), phosphoamino acid
analysis on 2-dimensional TLC plates, and protease digestion
fingerprinting of proteins followed by detection of
.sup.32P-labeled fragments.
[0096] Assays Measuring Other Post-Translational Modifications
[0097] The effect of a compound on the post-translational
modification of ABC1 is based on any method capable of quantitating
that particular modification. For example, effects of compounds on
glycosylation may be assayed by treating ABC1 with glycosylase and
quantitating the amount and nature of carbohydrate released.
[0098] Assays Measuring ATP Binding
[0099] The ability of ABC1 to bind ATP provides another assay to
screen for compounds that affect ABC1. ATP binding can be
quantitated as follows.
[0100] 1. Provide ABC1 protein at an appropriate level of purity
and reconsititute it in a lipid vesicle;
[0101] 2. Expose the vesicle to a labeled but non-hydrolyzable ATP
analog (such as gamma .sup.35S-ATP) in the presence or absence of
compounds being tested for their effect on ATP binding. Note that
azido-ATP analogs can be used to allow covalent attachment of the
azido-ATP to protein (by means of U.V. light), and permit easier
quantitation of the amount of ATP bound to the protein.
[0102] 3. Quantitate the amount of ATP analog associated with
ABC1
[0103] Assays Measuring ATPase Activity
[0104] Quantitation of the ATPase activity of ABC1 can also be
assayed for the effect of compounds on ABC1. This is preferably
performed in a cell-free assay so as to separate ABC1 from the many
other ATPases in the cell. An ATPase assay may be performed in the
presence or absence of membranes, and with or without integration
of ABC1 protein into a membrane. If performed in a vesicle-based
assay, the ATP hydrolysis products produced or the ATP hydrolyzed
may be measured within or outside of the vesicles, or both. Such an
assay may be based on disappearance of ATP or appearance of ATP
hydrolysis products. For high-throughput screening, a coupled
ATPase assay is preferable. For example, a reaction mixture
containing pyruvate kinase and lactate dehydrogenase can be used.
The mixture includes phosphoenolpyruvate (PEP), nicotinamide
adenine dinucleotide (NAD+), and ATP. The ATPase activity of ABC1
generates ADP from ATP. The ADP is then converted back to ATP as
part of the pyruvate kinase reaction. The product, pyruvate, is
then converted to lactate. The latter reaction generates a colored
quinone (NADH) from a colorless substrate (NAD+), and the entire
reaction can be monitored by detection of the color change upon
formation of NADH. Since ADP is limiting for the pyruvate kinase
reaction, this coupled system precisely monitors the ATPase
activity of ABC1.
[0105] Animal Model Systems
[0106] Compounds identified as having activity in any of the
above-described assays are subsequently screened in any available
animal model system, including, but not limited to, pigs, rabbits,
and WHAM chickens. Test compounds are administered to these animals
according to standard methods. Test compounds may also be tested in
mice bearing mutations in the ABC1 gene. Additionally, compounds
may be screened for their ability to enhance an interaction between
ABC1 and any HDL particle constituent such as ApoAI, ApoAII, or
ApoE.
[0107] Knock-Out Mouse Model
[0108] An animal, such as a mouse, that has had one or both ABC1
alleles inactivated (e.g., by homologous recombination) is a
preferred animal model for screening for compounds that reduce
exogenous cholesterol transport from the gut lumen to the blood or
lymph and for the regulation and treatment of cardiovascular
disorders (such as high LDL or serum cholesterol levels), obesity,
elevated body-weight index and other disorders relating to lipid
metabolism. Such an animal can be produced using standard
techniques. In addition to the initial screening of test compounds,
the animals having mutant ABC1 genes are useful for further testing
of efficacy and safety of drugs or agents first identified using
one of the other screening methods described herein. Cells taken
from the animal and placed in culture can also be exposed to test
compounds.
[0109] WHAM Chickens: an Animal Model for Low HDL Cholesterol
[0110] Wisconsin Hypo-Alpha Mutant (WHAM) chickens arose by
spontaneous mutation in a closed flock. Mutant chickens came to
attention through their a Z-linked white shank and white beak
phenotype referred to as `recessive white skin` (McGibbon, 1981)
and were subsequently found to have a profound deficiency of HDL
(Poemama et al., 1990).
[0111] This chicken low HDL locus (Y) is Z-linked, or sex-linked.
(In birds, females are ZW and males are ZZ). Genetic mapping placed
the Y locus on the long arm of the Z chromosome (Bitgood, 1985),
proximal to the ID locus (Bitgood, 1988). Examination of current
public mapping data for the chicken genome mapping project,
ChickMap (maintained by the Roslin Institute;
http://www.ri.bbsrc.ac.uk/chickmap/ChickMapHomePage.html) showed
that a region of synteny with human chromosome 9 lies on the long
arm of the chicken Z chromosome (Zq) proximal to the ID locus.
Evidence for this region of synteny is the location of the chicken
aldolase B locus (ALDOB) within this region. The human ALDOB locus
maps to chromosome 9q22.3 (The Genome Database,
http://gdbwww.gdb.org/), not far from the location of human ABC1.
This comparison of maps showed that the chicken Zq region near
chicken ALDOB and the human 9q region near human ALDOB represent a
region of synteny between human and chicken.
[0112] We predicted that ABC1 is mutated in WHAM chickens. In
support of this, we have identified an E to K mutation at a
position that corresponds to amino acid 89 of human ABC1. This
non-conservative substitution is at a position that is conserved
among human, mouse, and chicken, indicating that it is in a region
of the protein likely to be of functional importance.
[0113] Discovery of the WHAM mutation in the amino-terminal portion
of the ABC1 protein also establishes the importance of the
amino-terminal region. This region may be critical because of
association with other proteins required to carry out cholesterol
efflux or related tasks. It may be an important regulatory region
(there is a phosphorylation site for casein kinase near the mutated
residue), or it may help to dictate a precise topological
relationship with cellular membranes (the N-terminal 60 amino acid
region contains a putative membrane-spanning or membrane-associated
segment).
[0114] The amino-terminal region of the protein (up to the first
6-TM region at approximately amino acid 639) is an ideal tool for
screening factors that affect ABC1 activity. It can be expressed as
a truncated protein in ABC1 wild type cells in order to test for
interference of the normal ABC1 function by the truncated protein.
If the fragment acts in a dominant negative way, it could be used
in immunoprecipitations to identify proteins that it may be
competing away from the normal endogenous protein.
[0115] The C-terminus also lends itself to such experiments, as do
the intracellular portions of the molecule, expressed as fragments
or tagged or fusion proteins, in the absence of transmembrane
regions.
[0116] Since it is possible that there are several genes in the
human genome which affect cholesterol efflux, it is important to
establish that any animal model to be used for a human genetic
disease represents the homologous locus in that animal, and not a
different locus with a similar function. The evidence above
establishes that the chicken Y locus and the human chromosome 9 low
HDL locus are homologous. WHAM chickens are therefore an important
animal model for the identification of drugs that modulate
cholesterol efflux, and as such are useful for reducing cholesterol
transport from the gut lumen to the blood or lymph and for the
regulation and treatment of cardiovascular disorders (such as high
LDL or serum cholesterol levels), obesity, elevated body-weight
index and other disorders relating to lipid metabolism.
[0117] Compounds of the Invention
[0118] In general, novel compounds and therapeutic agents for
reducing cholesterol transport from the gut lumen to the blood or
lymph and for the regulation and treatment of cardiovascular
disorders (such as high LDL or serum cholesterol levels), obesity,
elevated body-weight index and other disorders relating to lipid
metabolism are identified from large libraries of both natural
product or synthetic (or semi-synthetic) extracts or chemical
libraries according to methods known in the art. Those skilled in
the field or drug discovery and development will understand that
the precise source of test extracts or compounds is not critical to
the screening procedure(s) of the invention. Accordingly, virtually
any number of chemical extracts or compounds can be screened using
the exemplary methods described herein. Examples of such extracts
or compounds include, but are not limited to, plant-, fungal-,
prokaryotic- or animal-based extracts, fermentation broths, and
synthetic compounds, as well as modification of existing compounds.
Numerous methods are also available for generating random or
directed synthesis (e.g., semi-synthesis or total synthesis) of any
number of chemical compounds, including, but not limited to,
saccharide-, lipid-, peptide-, and nucleic acid-based compounds.
Synthetic compound libraries are commercially available from
Brandon Associates (Merrimack, N.H.) and Aldrich Chemical
(Milwaukee, Wis.). Alternatively, libraries of natural compounds in
the form of bacterial, fungal, plant, and animal extracts are
commercially available from a number of sources, including Biotics
(Sussex, UK), Xenova (Slough, UK), Harbor Branch Oceangraphics
Institute (Ft. Pierce, Fla.), and PharmaMar, U.S.A. (Cambridge,
Mass.). In addition, natural and synthetically produced libraries
are produced, if desired, according to methods known in the art,
e.g., by standard extraction and fractionation methods.
Furthermore, if desired, any library or compound is readily
modified using standard chemical, physical, or biochemical
methods.
[0119] Typically, a screening assay, such as a high throughput
screening assay, will identify several or even many compounds which
modulate the activity of the assay protein. The compound identified
by the screening assay may be further modified before it is used in
humans as the therapeutic agent. Typically, combinatorial chemistry
is performed on the modulator, to identify possible variants that
have improved absorption, biodistribution, metabolism and/or
excretion, or other important therapeutic aspects. The essential
invariant is that the improved compounds share a particular active
group or groups which are necessary for the desired modulation of
the target protein. Many combinatorial chemistry techniques are
well known in the art. Each one adds or deletes one or more
constituent moieties of the compound to generate a modified analog,
which analog is again assayed to identify compounds of the
invention. Thus, as used in this invention, therapeutic compounds
identified using an ABC1 screening assay of the invention include
actual compounds so identified, and any analogs or combinatorial
modifications made to a compound which is so identified which are
useful for treatment of the disorders claimed herein.
[0120] In addition, those skilled in the art of drug discovery and
development readily understand that methods for dereplication
(e.g., taxonomic dereplication, biological dereplication, and
chemical dereplication, or any combination thereof) or the
elimination of replicates or repeats of materials already known for
their abilities in reducing cholesterol transport from the gut
lumen to the blood or lymph and for the regulation and treatment of
cardiovascular disorders (such as high LDL or serum cholesterol
levels), obesity, elevated body-weight index and other disorders
relating to lipid metabolism should be employed whenever
possible.
[0121] When a crude extract is found to be capable of reducing
cholesterol transport from the gut lumen to the blood or lymph and
for the regulation and treatment of cardiovascular disorders (such
as high LDL or serum cholesterol levels), obesity, elevated
body-weight index and other disorders relating to lipid metabolism,
further fractionation of the positive lead extract is necessary to
isolate chemical constituent responsible for the observed effect.
Thus, the goal of the extraction, fractionation, and purification
process is the careful characterization and identification of a
chemical entity within the crude extract having these desired
activities. The same in vivo and in vitro assays described herein
for the detection of activities in mixtures of compounds can be
used to purify the active component and to test derivatives
thereof. Methods of fractionation and purification of such
heterogeneous extracts are known in the art. If desired, compounds
shown to be useful agents for the treatment of pathogenicity are
chemically modified according to methods known in the art.
Compounds identified as being of therapeutic value are subsequently
analyzed using any standard animal model for the desired disease or
condition known in the art.
[0122] It is understood that compounds that indirectly modulate
ABC1 activity, for example by modulation of proteins that modulate
or are modulated by ABC1, may also be useful compounds for the
desired purposes of the invention. Such compositions which are
identified using the screening assays of this invention are also
claimed.
[0123] Because one of the objects of the invention is to inhibit
cholesterol transport in the gut but to not inhibit the assembly of
HDL particles in peripheral tissues, certain features of preferred
compositions of the invention can be identified. In particular,
compositions which act locally in the gut or intestinal wall, but
which do not circulate widely in the body are preferred. This
object may be achieved with compounds which either are incapable of
being transported by the blood or lymph or other extra-cellular
fluid or particle. This object may also be achieved by obtaining
compounds with limited in vivo stability (i.e. short half life upon
oral administration) or which are subject to rapid metabolism to
inert analogs after absorption by the intestinal wall.
[0124] As described previously, analogs of sulfonylureas are likely
candidate compounds. However, sulfonylureas that are routinely used
by diabetics are not useful in the invention to the extent that
they cause the undesirable side-effect--in non-diabetic
patients--of increased insulin secretion by the pancreas.
Therefore, preferred compounds of the invention are inhibitors of
ABC1 that either do not disperse significantly beyond the gut; do
not cause unacceptable inhibition of ABC1 in peripheral tissues;
and do not cause unacceptable side-effects.
[0125] Therapy Using Compositions of the Invention
[0126] Compositions of the invention, including but not limited to
compounds that modulate biological activity or expression of ABC1
identified using any of the methods disclosed herein, or any
preferred analogs of such compositions, may be administered with a
pharmaceutically-acceptable diluent, carrier, or excipient, in unit
dosage form. Conventional pharmaceutical practice may be employed
to provide suitable formulations or compositions to administer such
compositions to patients. Although oral administration is
preferred, any appropriate route of administration may be employed,
for example, intravenous, perenteral, subcutaneous, intramuscular,
intracranial, intraorbital, ophthalmic, intraventricular,
intracapsular, intraspinal, intracisternal, intraperitoneal,
intranasal, or aerosol administration. Therapeutic formulations may
be in the form of liquid solutions or suspension; for oral
administration, formulations may be in the form of tablets or
capsules; and for intranasal formulations, in the form of powders,
nasal drops, or aerosols.
[0127] Methods well known in the art for making formulations are
found in, for example, Remington: The Science and Practice of
Pharmacy, (19th ed.) ed. A. R. Gennaro A R., 1995, Mack Publishing
Company, Easton, Pa. Formulations for parenteral administration
may, for example, contain excipients, sterile water, or saline,
polyalkylene glycols such as polyethylene glycol, oils of vegetable
origin, or hydrogenated napthalenes. Biocompatible, biodegradable
lactide polymer, lactide/glycolide copolymer, or
polyoxyethylene-polyoxypropylene copolymers may be used to control
the release of the compounds. Other potentially useful parenteral
delivery systems for agonists of the invention include
ethylenevinyl acetate copolymer particles, osmotic pumps,
implantable infusion systems, and liposomes. Formulations for
inhalation may contain excipients, or example, lactose, or may be
aqueous solutions containing, for example, polyoxyethylene-9-lauryl
ether, glycocholate and deoxycholate, or may be oily solutions for
administration in the form of nasal drops, or as a gel.
[0128] A preferred embodiment for use of the compositions of the
invention is for combination therapy employing a therapeutic agent
of the invention which modulates or inhibits ABC1 activity in the
gut in combination, simultaneous or sequential, with another agent
which inhibits endogenous cholesterol synthesis, such as but not
limited to a "statin" or HMGCoA reductase inhibitor, etc. This
combination therapy is preferred in instances where inhibition of
both exogenous cholesterol uptake from the gut and inhibition of
endogenous cholesterol synthesis are desired. Therapeutic agents
employed in this combination therapy are preferably oral compounds.
In a preferred embodiment, the ABC1 inhibitor does not disperse
beyond the lamina propria of the gut (i.e. it stays largely in the
gut), whereas the inhibitor of endogenous cholesterol synthesis
circulates to sites of endogenous cholesterol synthesis in the
body.
EXAMPLES
WHAM Chickens
[0129] The Wisconsin Mutant Hypoalpha (WHAM) chickens were
discovered in 1981 in a flock of chickens maintained by the
University of Wisconsin. The WHAM chickens have white skin and
white beaks and have colorless rather than yellow serum, all due to
the absence of carotenoids. The trait is inherited as a recessive
sex-linked mutation on the Z-chromosome. These animals also have a
severe deficiency of high density lipoprotein (HDL). Metabolic
studies led to some degree of understanding of the defect in HDL
metabolism. When .sup.125I-labeled HDL particles were injected into
WHAM chickens, their disappearance from the circulation was only
moderately increase relative to normal chickens. However, when
lipid-free .sup.125I-apo-A1 was injected, it was removed from the
circulation four-fold more rapidly in WHAM chickens compared to
normal chickens, by the kidneys. Because apo-A1 synthesis and
secretion is normal in the WHAM chickens, another factor had to
affect the stability of apo-A1. Analysis of the serum phospholipids
showed a 70% reduction, implying that the primary defect is in
phospholipid efflux and demonstrated than an extracellular event is
required for the formation of stable HDL particles.
[0130] The lipoprotein profiles of WHAM chicken and Tangier patient
plasma show a similarly pronounced loss of HDL. IN addition, both
plasma were found to show a decrease in plasma phospholipid levels.
Two-dimensional thin-layer chromatography showed that the most
pronounced phospholipid deficiency was in phosphotidylcholine and
sphingomyelin.
[0131] A genetic study of the WHAM chicken genetic revealed that
the location to which the mutant gene mapped adjacent to genes
which in turn are adjacent to ABC1 on the human genome on
chromosome 9. Shown in FIG. 1 is a map comparing the synteny
between the WHAM mutation and the human ABC1 gene. Markers mapped
genetically or physically are indicated by dashed arrows. Genes
mapped only cytogenetically are positioned relative to other
markers with the cytogenetic location in brackets. To investigate
the gene comparison, the coding region of the ABC1 genes from
humans and the WHAM chickens were compared. The human and chicken
genes are 78% identical at the nucleotide level and 85% identical
(with 92% homology) at the amino acid level. The sequence of the
normal and the WHAM chickens were identical with the exception of a
G to an A transition in the WHAM DNA at nucleotide 265,
corresponding to a glutamic acid to lysine substitution at amino
acid position 89. Studies of the DNA of WHAM chickens, conducted by
RFLP analysis, revealed that the mutation segregates with the
phenotype of HDL deficiency.
[0132] Referring specifically again to FIG. 1, the WHAM mutation
maps to a Z chromosome region syntenic to the 9q31.1 location of
human ABC1. To the left is the chicken Z chromosome combined
genetic and cytogenetic map. To the right is a combined human
genetic and cytogenetic map. Positions of markers mapped
genetically or physically are indicated by dashed arrows. Genes
mapped only cytogenetically are positioned relative to other
markers with the cytogenetic location in brackets. WHAM was
genetically mapped relative to ID and B [the relative distances and
the calculated WHAM-B distance are indicated, (1,2).]
[0133] At (B) in FIG. 1, the illustration conveys that the WHAM
chicken ABC1 gene has a single amino acid substitution (E89K)
relative to normal White Leghorn chicken. Total liver RNA from WHAM
and normal male chickens was subjected to standard RT-PCR and
sequencing methods (left panel) using primers corresponding to the
cDNA sequences most conserved between human and mouse ABC1. The
open reading frame (corresponding to amino acids 27 to 2261) was
sequenced, revealed a single homozygous G to A transition in WHAM
cDNA at position 265. (Numbering of nucleotides and amino acids is
according to the new, longer open reading frame of human ABC1). The
same alteration was observed in PCR product of chicken genomic DNA
(right panel).
[0134] As also shown in FIG. 1, RFLP analysis confirmed the
presence of the WHAM mutation in genomic DNA. Genomic DNA from
normal and mutant homozygous male and hemizygous female chickens
was amplified using PCR primers forward: TABLE-US-00002 forward:
5'-GTCACTTCCCAAACAAAGCTA-3' SEQ ID No. reverse:
5'-ATGGACGCATTGAAGTTTCC-3' SEQ ID No.
flanking the WHAM mutation, then the PCR products digested with
HinfI. The WHAM alteration destroys a HinfI site, resulting in a
142 bp uncut fragment rather than the 106 bp and 36 bp fragments of
normal chickens. The chicken sex chromosomes of each bird tested
are indicated below the photo; male chickens are ZZ, female
chickens are ZW.
[0135] The glutamate residue at the position of the non
conservative E89K substitution is conserved between human
(CAA10005), mouse (CAA53530), Takifugu rubripes (`fugu`), and
chicken. The WHAM mutation is thus predicted to have a deleterious
effect on activity of the ABC1 protein. The fugu amino acid
sequence was predicted from nucleotide sequence of a cosmid
containing the fugu ABC1 gene. Bitgood J J. 1985, "Additional
linkage relationships within the Z chromosome of the chicken,"
Poultry Science 64: 2234-8 Bitgood J J. 1988, "Linear relationship
of the loci for barring, dermal melanin inhibitor, and recessive
white skin on the chicken Z chromosome," Poultry Sci. 67:
530-3.
[0136] Dietary Cholesterol and WHAM Chickens
[0137] FIG. 2 illustrates the results of time courses of plasma
cholesterol in control and WHAM chickens on a cholesterol-free or
high-cholesterol diet. The basal diet (ad libitum) was
acorn-soy-based diet to which 12.4% (by weight) lard was added. By
calculation, the diet contained 14% fat by weight or 37% as total
calories. The two dietary treatments consisted of the basal
(cholesterol-free) diet and the basal plus 4% cholesterol diet. The
diets were each fed to two groups of chickens, each group
comprising 10 animals, for 28 weeks.
[0138] This example demonstrates the effect of inhibition of ABC1
(here demonstrated by an inactivating mutation in the gene, but
also obtainable by inhibitors of ABC1 identified by the screening
assays of the invention) on cholesterol absorption by the WHAM
chicken. Cholesterol transport from the lumen of the gut to the
blood or lymph is blocked or eliminated by inhibition of the ABC1
gene. In this case the genetic mutation is a surrogate for an
antagonist of the ABC1 protein.
[0139] Cholesterol Retention
[0140] The WHAM chickens, like Tangier patients, show evidence of
cholesterol ester retention. Like Tangier patients, the WHAM
chickens have large non-osmiophilic drops in the cytoplasm of
splenic macrophages. In addition, electro-micrographs of the
intestinal wall of the chicken (control and WHAM), show very
specific accumulation of cholesterol in non-endothelial cells of
the lamina propria. See FIG. 3 which shows those cells. In FIG. 3,
cells of the intestinal wall, which are not columnar epithelium
cells, from the WHAM chickens contain giant lipid droplets. In FIG.
3, photograph (A) shows normal intestine showing the microvilli at
the apical surface. Spaces represent normal sites where chylomicron
particles are secreted. Image (B) shows higher magnification of
area shown in lower rectangle in (A). Image (C) is a higher
magnification of intestinal wall from upper rectangle in (A).
Photograph (D) shows the WHAM intestine showing apical surface, the
absence of spaces between the cells, and accumulation of vesicles.
Image (E) is a higher magnification of area in rectangle in (A).
Note the abundance of vesicles relative to the control section in
(B). Image (F) is a higher magnification of intestinal wall area
just above the top of (D). Lipid inclusions 1.5-2.0 .mu.m in
diameter. Bar=2.5 .mu.m in (A) and (D) and 0.6 .mu.m in all other
panels.
[0141] We conclude from this evidence that the WHAM chickens are
able to absorb cholesterol from the intestinal lumen but are unable
to transport that cholesterol out of the epithelial cells into the
blood stream. This explains the accumulation of cholesterol in
those cells.
[0142] Sulfonylurea Compounds
[0143] A drawback in the use of some sulfonylurea compounds is that
such compounds can have unwanted activity in stimulating insulin
secretion. Therefore, it is contemplated that a screening program
be conducted to identify and assess either sulfonylurea or other
compounds which have activity in inhibiting ABC1 but which do not
stimulate unwanted insulin production. It is envisioned that this
screen can be done by giving the compound orally to test animals. A
tracer of radioactively labeled cholesterol can then be given to
the animals. At various time points after administration (1, 2, 3,
4, 6, 8, 12, 16, 24, 36, and 48 hours), blood samples would be
taken and the amount of the isotope in cholesterol and cholesterol
ester of chylomicron particles would be sampled. The chylomicron
fraction would be obtained by centrifuging the plasma in an
ultracentrifuge (20,000 rpm in a 40.3 rotor for 20 minutes). The
chylomicrons float to the top and are removed by aspiration. The
area under the isotope amount versus time curve would then indicate
the amount of tracer that has entered into the bloodstream. When
divided by the amount initially administered in an oral dose, the
percent of cholesterol that traveled from the intestinal lumen all
the way into the bloodstream can be computed. Inhibitors of the
function of the ABC1 protein or gene activity will reduce this
amount. In in vivo assays, effects on insulin secretion can be
measured by standard blood assays known in the art, such as a
quantitative insulin radio-immunoassay.
[0144] In vitro screening assays for identifying unwanted activity
in stimulating insulin secretion are also standard and known in the
art. In a typical assay, islet cells are isolated from the pancreas
by a collagenase digest. Cells are cultured; then exposed to the
candidate substance. Insulin secretion by the cultured cells is
measured by a quantitative radio-immunoassay. Candidate compounds
which increase the level of insulin secretion are rejected as
having undesirable side effects for the desired uses of the
invention herein.
[0145] Inhibiting ABC1 Activity
[0146] ABC1 activity can be inhibited genetically or chemically. It
is known that sulfonylurea drugs inhibit ABC1 activity. Shown in
FIG. 4 is the results of a study demonstrating that effect. Mouse
macrophages (J774) were labeled with .sup.3H-cholesterol (2
.mu.Ci/ml) for 24 hours in 1% v/v fetal bovine serum. Following the
labeling, the cells were equilibrated with 0.2% de-fatted bovine
serum albumin in RPMI growth medium. Cholesterol efflux was
initiated with the addition of 20 .mu.g/ml of human
apolipoprotein-A1 in the presence of the indicated concentrations
of Glyburide, a sulfonylurea compound. After 24 hours, the medium
was collected, centrifuged, and an aliquot collected for
radioactivity determination by liquid scintillation counting.
[0147] This study demonstrates that the efficacy of a compound in
inhibiting ABC1 activity can be measured in a cellular assay. This
same assay can be used to test other compounds for ABC1 inhibitory
activity.
[0148] The preceding examples and specification are illustrations
of the invention which are non-limiting examples of the invention
more generally described by the claims below.
Sequence CWU 1
1
19 1 7862 DNA Homo sapiens 1 gtccctgctg tgagctctgg ccgctgcctt
ccagggctcc cgagccacac gctgggggtg 60 ctggctgagg gaacatggct
tgttggcctc agctgaggtt gctgctgtgg aagaacctca 120 ctttcagaag
aagacaaaca tgtcagctgc tgctggaagt ggcctggcct ctatttatct 180
tcctgatcct gatctctgtt cggctgagct acccacccta tgaacaacat gaatgccatt
240 ttccaaataa agccatgccc tctgcaggaa cacttccttg ggttcagggg
attatctgta 300 atgccaacaa cccctgtttc cgttacccga ctcctgggga
ggctcccgga gttgttggaa 360 actttaacaa atccattgtg gctcgcctgt
tctcagatgc tcggaggctt cttttataca 420 gccagaaaga caccagcatg
aaggacatgc gcaaagttct gagaacatta cagcagatca 480 agaaatccag
ctcaaacttg aagcttcaag atttcctggt ggacaatgaa accttctctg 540
ggttcctgta tcacaacctc tctctcccaa agtctactgt ggacaagatg ctgagggctg
600 atgtcattct ccacaaggta tttttgcaag gctaccagtt acatttgaca
agtctgtgca 660 atggatcaaa atcagaagag atgattcaac ttggtgacca
agaagtttct gagctttgtg 720 gcctaccaag ggagaaactg gctgcagcag
agcgagtact tcgttccaac atggacatcc 780 tgaagccaat cctgagaaca
ctaaactcta catctccctt cccgagcaag gagctggctg 840 aagccacaaa
aacattgctg catagtcttg ggactctggc ccaggagctg ttcagcatga 900
gaagctggag tgacatgcga caggaggtga tgtttctgac caatgtgaac agctccagct
960 cctccaccca aatctaccag gctgtgtctc gtattgtctg cgggcatccc
gagggagggg 1020 ggctgaagat caagtctctc aactggtatg aggacaacaa
ctacaaagcc ctctttggag 1080 gcaatggcac tgaggaagat gctgaaacct
tctatgacaa ctctacaact ccttactgca 1140 atgatttgat gaagaatttg
gagtctagtc ctctttcccg cattatctgg aaagctctga 1200 agccgctgct
cgttgggaag atcctgtata cacctgacac tccagccaca aggcaggtca 1260
tggctgaggt gaacaagacc ttccaggaac tggctgtgtt ccatgatctg gaaggcatgt
1320 gggaggaact cagccccaag atctggacct tcatggagaa cagccaagaa
atggaccttg 1380 tccggatgct gttggacagc agggacaatg accacttttg
ggaacagcag ttggatggct 1440 tagattggac agcccaagac atcgtggcgt
ttttggccaa gcacccagag gatgtccagt 1500 ccagtaatgg tttctgtgta
cacctggaga gaagctttca acgagactaa ccaggcaatc 1560 cggaccatat
ctcgcttcat ggagtgtgtc aacctgaaca agctagaacc catagcaaca 1620
gaagtctggc tcatcaacaa gtccatggag ctgctggatg agaggaagtt ctgggctggt
1680 attgtgttca ctggaattac tccaggcagc attgagctgc cccatcatgt
caagtacaag 1740 atccgaatgg acattgacaa tgtggagagg acaaataaaa
tcaaggatgg gtactgggac 1800 cctggtcctc gagctgaccc ctttgaggac
atgcggtacg tctggggggg cttcgcctac 1860 ttgcaggatg tggtggagca
ggcaatcatc agggtgctga cgggcaccga gaagaaaact 1920 ggtgtctata
tgcaacagat gccctatccc tgttacgttg atgacatctt tctgcgggtg 1980
atgagccggt caatgcccct cttcatgacg ctggcctgga tttactcagt ggctgtgatc
2040 atcaagggca tcgtgtatga gaaggaggca cggctgaaag agaccatgcg
gatcatgggc 2100 ctggacaaca gcatcctctg gtttagctgg ttcattagta
gcctcattcc tcttcttgtg 2160 agcgctggcc tgctagtggt catcctgaag
ttaggaaacc tgctgcccta cagtgatccc 2220 agcgtggtgt ttgtcttcct
gtccgtgttt gctgtggtga caatcctgca gtgcttcctg 2280 attagcacac
tcttctccag agccaacctg gcagcagcct gtggggggca tcatctactt 2340
cacgctgtac ctgccctacg tcctgtgtgt ggcatggcag gactacgtgg gcttcacact
2400 caagatcttc gctagcctgc tgtctcctgt ggcttttggg tttggctgtg
agtactttgc 2460 cctttttgag gagcagggca ttggagtgca gtgggacaac
ctgtttgaga gtcctgtgga 2520 ggaagatggc ttcaatctca ccacttcggt
ctccatgatg ctgtttgaca ccttcctcta 2580 tggggtgatg acctggtaca
ttgaggctgt ctttccaggc cagtacggaa ttcccaggcc 2640 ctggtatttt
ccttgcacca agtcctactg gtttggcgag gaaagtgatg agaagagcca 2700
ccctggttcc aaccagaaga gaatatcaga aatctgcatg gaggaggaac ccacccactt
2760 gaagctgggc gtgtccattc agaacctggt aaaagtctac cgagatggga
tgaaggtggc 2820 tgtcgatggc ctggcactga atttttatga gggccagatc
acctccttcc tgggccacaa 2880 tggagcgggg aagacgacca ccatgtcaat
cctgaccggg ttgttccccc cgacctcggg 2940 caccgcctac atcctgggaa
aagacattcg ctctgagatg agcaccatcc ggcagaacct 3000 gggggtctgt
ccccagcata acgtgctgtt tgacatgctg actgtcgaag aacacatctg 3060
gttctatgcc cgcttgaaag ggctctctga gaagcacgtg aaggcggaga tggagcagat
3120 ggccctggat gttggtttgc catcaagcaa gctgaaaagc aaaacaagcc
agctgtcagg 3180 tggaatgcag agaaagctat ctgtggcctt ggcctttgtc
gggggatcta aggttgtcat 3240 tctggatgaa cccacagctg gtgtggaccc
ttactcccgc aggggaatat gggagctgct 3300 gctgaaatac cgacaaggcc
gcaccattat tctctctaca caccacatgg atgaagcgga 3360 cgtcctgggg
gacaggattg ccatcatctc ccatgggaag ctgtgctgtg tgggctcctc 3420
cctgtttctg aagaaccagc tgggaacagg ctactacctg accttggtca agaaagatgt
3480 ggaatcctcc ctcagttcct gcagaaacag tagtagcact gtgtcatacc
tgaaaaagga 3540 ggacagtgtt tctcagagca gttctgatgc tggcctgggc
agcgaccatg agagtgacac 3600 gctgaccatc gatgtctctg ctatctccaa
cctcatcagg aagcatgtgt ctgaagcccg 3660 gctggtggaa gacatagggc
atgagctgac ctatgtgctg ccatatgaag ctgctaagga 3720 gggagccttt
gtggaactct ttcatgagat tgatgaccgg ctctcagacc tgggcatttc 3780
tagttatggc atctcagaga cgaccctgga agaaatattc ctcaaggtgg ccgaagagag
3840 tggggtggat gctgagacct cagatggtac cttgccagca agacgaaaca
ggcgggcctt 3900 cggggacaag cagagctgtc ttcgcccgtt cactgaagat
gatgctgctg atccaaatga 3960 ttctgacata gacccagaat ccagagagac
agacttgctc agtgggatgg atggcaaagg 4020 gtcctaccag gtgaaaggct
ggaaacttac acagcaacag tttgtggccc ttttgtggaa 4080 gagactgcta
attgccagac ggagtcggaa aggatttttt gctcagattg tcttgccagc 4140
tgtgtttgtc tgcattgccc ttgtgttcag cctgatcgtg ccaccctttg gcaagtaccc
4200 cagcctggaa cttcagccct ggatgtacaa cgaacagtac acatttgtca
gcaatgatgc 4260 tcctgaggac acgggaaccc tggaactctt aaacgccctc
accaaagacc ctggcttcgg 4320 gacccgctgt atggaaggaa acccaatccc
agacacgccc tgccaggcag gggaggaaga 4380 gtggaccact gccccagttc
cccagaccat catggacctc ttccagaatg ggaactggac 4440 aatgcagaac
ccttcacctg catgccagtg tagcagcgac aaaatcaaga agatgctgcc 4500
tgtgtgtccc ccaggggcag gggggctgcc tcctccacaa agaaaacaaa acactgcaga
4560 tatccttcag gacctgacag gaagaaacat ttcggattat ctggtgaaga
cgtatgtgca 4620 gatcatagcc aaaagcttaa agaacaagat ctgggtgaat
gagtttaggt atggcggctt 4680 ttccctgggt gtcagtaata ctcaagcact
tcctccgagt caagaagtta atgatgccat 4740 caaacaaatg aagaaacacc
taaagctggc caaggacagt tctgcagatc gatttctcaa 4800 cagcttggga
agatttatga caggactgga caccagaaat aatgtcaagg tgtggttcaa 4860
taacaagggc tggcatgcaa tcagctcttt cctgaatgtc atcaacaatg ccattctccg
4920 ggccaacctg caaaagggag agaaccctag ccattatgga attactgctt
tcaatcatcc 4980 cctgaatctc accaagcagc agctctcaga ggtggctctg
atgaccacat cagtggatgt 5040 ccttgtgtcc atctgtgtca tctttgcaat
gtccttcgtc ccagccagct ttgtcgtatt 5100 cctgatccag gagcgggtca
gcaaagcaaa acacctgcag ttcatcagtg gagtgaagcc 5160 tgtcatctac
tggctctcta attttgtctg ggatatgtgc aattacgttg tccctgccac 5220
actggtcatt atcatcttca tctgcttcca gcagaagtcc tatgtgtcct ccaccaatct
5280 gcctgtgcta gcccttctac ttttgctgta tgggtggtca atcacacctc
tcatgtaccc 5340 agcctccttt gtgttcaaga tccccagcac agcctatgtg
gtgctcacca gcgtgaacct 5400 cttcattggc attaatggca gcgtggccac
ctttgtgctg gagctgttca ccgacaataa 5460 gctgaataat atcaatgata
tcctgaagtc cgtgttcttg atcttcccac atttttgcct 5520 gggacgaggg
ctcatcgaca tggtgaaaaa ccaggcaatg gctgatgccc tggaaaggtt 5580
tggggagaat cgctttgtgt caccattatc ttgggacttg gtgggacgaa acctcttcgc
5640 catggccgtg gaaggggtgg tgttcttcct cattactgtt ctgatccagt
acagattctt 5700 catcaggccc agacctgtaa atgcaaagct atctcctctg
aatgatgaag atgaagatgt 5760 gaggcgggaa agacagagaa ttcttgatgg
tggaggccag aatgacatct tagaaatcaa 5820 ggagttgacg aagatatata
gaaggaagcg gaagcctgct gttgacagga tttgcgtggg 5880 cattcctcct
ggtgagtgct ttgggctcct gggagttaat ggggctggaa aatcatcaac 5940
tttcaagatg ttaacaggag ataccactgt taccagagga gatgctttcc ttaacaaaaa
6000 tagtatctta tcaaacatcc atgaagtaca tcagaacatg ggctactgcc
ctcagtttga 6060 tgccatcaca gagctgttga ctgggagaga acacgtggag
ttctttgccc ttttgagagg 6120 agtcccagag aaagaagttg gcaaggttgg
tgagtgggcg attcggaaac tgggcctcgt 6180 gaagtatgga gaaaaatatg
ctggtaacta tagtggaggc aacaaacgca agctctctac 6240 agccatggct
ttgatcggcg ggcctcctgt ggtgtttctg gatgaaccca ccacaggcat 6300
ggatcccaaa gcccggcggt tcttgtggaa ttgtgcccta agtgttgtca aggaggggag
6360 atcagtagtg cttacatctc atagtatgga agaatgtgaa gctctttgca
ctaggatggc 6420 aatcatggtc aatggaaggt tcaggtgcct tggcagtgtc
cagcatctaa aaaataggtt 6480 tggagatggt tatacaatag ttgtacgaat
agcagggtcc aacccggacc tgaagcctgt 6540 ccaggatttc tttggacttg
catttcctgg aagtgttcta aaagagaaac accggaacat 6600 gctacaatac
cagcttccat cttcattatc ttctctggcc aggatattca gcatcctctc 6660
ccagagcaaa aagcgactcc acatagaaga ctactctgtt tctcagacaa cacttgacca
6720 agtatttgtg aactttgcca aggaccaaag tgatgatgac cacttaaaag
acctctcatt 6780 acacaaaaac cagacagtag tggacgttgc agttctcaca
tcttttctac aggatgagaa 6840 agtgaaagaa agctatgtat gaagaatcct
gttcatacgg ggtggctgaa agtaaagagg 6900 aactagactt tcctttgcac
catgtgaagt gttgtggaga aaagagccag aagttgatgt 6960 gggaagaagt
aaactggata ctgtactgat actattcaat gcaatgcaat tcaatgcaat 7020
gaaaacaaaa ttccattaca ggggcagtgc ctttgtagcc tatgtcttgt atggctctca
7080 agtgaaagac ttgaatttag ttttttacct atacctatgt gaaactctat
tatggaaccc 7140 aatggacata tgggtttgaa ctcacacttt tttttttttt
tttgttcctg tgtattctca 7200 ttggggttgc aacaataatt catcaagtaa
tcatggccag cgattattga tcaaaatcaa 7260 aaggtaatgc acatcctcat
tcactaagcc atgccatgcc caggagactg gtttcccggt 7320 gacacatcca
ttgctggcaa tgagtgtgcc agagttatta gtgccaagtt tttcagaaag 7380
tttgaagcac catggtgtgt catgctcact tttgtgaaag ctgctctgct cagagtctat
7440 caacattgaa tatcagttga cagaatggtg ccatgcgtgg ctaacatcct
gctttgattc 7500 cctctgataa gctgttctgg tggcagtaac atgcaacaaa
aatgtgggtg tctccaggca 7560 cgggaaactt ggttccattg ttatattgtc
ctatgcttcg agccatgggt ctacagggtc 7620 atccttatga gactcttaaa
tatacttaga tcctggtaag aggcaaagaa tcaacagcca 7680 aactgctggg
gctgcaactg ctgaagccag ggcatgggat taaagagatt gtgcgttcaa 7740
acctagggaa gcctgtgccc atttgtcctg actgtctgct aacatggtac actgcatctc
7800 aagatgttta tctgacacaa gtgtattatt tctggctttt tgaattaatc
tagaaaatga 7860 aa 7862 2 2258 PRT Homo sapiens 2 Met Ala Cys Trp
Pro Gln Leu Arg Leu Leu Leu Trp Lys Asn Leu Thr 1 5 10 15 Phe Arg
Arg Arg Gln Thr Cys Gln Leu Leu Leu Glu Val Ala Trp Pro 20 25 30
Leu Phe Ile Phe Leu Ile Leu Ile Ser Val Arg Leu Ser Tyr Pro Pro 35
40 45 Tyr Glu Gln His Glu Cys His Phe Pro Asn Lys Ala Met Pro Ser
Ala 50 55 60 Gly Thr Leu Pro Trp Val Gln Gly Ile Ile Cys Asn Ala
Asn Asn Pro 65 70 75 80 Cys Phe Arg Tyr Pro Thr Pro Gly Glu Ala Pro
Gly Val Val Gly Asn 85 90 95 Phe Asn Lys Ser Ile Val Ala Arg Leu
Phe Ser Asp Ala Arg Arg Leu 100 105 110 Leu Leu Tyr Ser Gln Lys Asp
Thr Ser Met Lys Asp Met Arg Lys Val 115 120 125 Leu Arg Thr Leu Gln
Gln Ile Lys Lys Ser Ser Ser Asn Leu Lys Leu 130 135 140 Gln Asp Phe
Leu Val Asp Asn Glu Thr Phe Ser Gly Phe Leu Tyr His 145 150 155 160
Asn Leu Ser Leu Pro Lys Ser Thr Val Asp Lys Met Leu Arg Ala Asp 165
170 175 Val Ile Leu His Lys Val Phe Leu Gln Gly Tyr Gln Leu His Leu
Thr 180 185 190 Ser Leu Cys Asn Gly Ser Lys Ser Glu Glu Met Ile Gln
Leu Gly Asp 195 200 205 Gln Glu Val Ser Glu Leu Cys Gly Leu Pro Arg
Glu Lys Leu Ala Ala 210 215 220 Ala Glu Arg Val Leu Arg Ser Asn Met
Asp Ile Leu Lys Pro Ile Leu 225 230 235 240 Arg Thr Leu Asn Ser Thr
Ser Pro Phe Pro Ser Lys Glu Leu Ala Glu 245 250 255 Ala Thr Lys Thr
Leu Leu His Ser Leu Gly Thr Leu Ala Gln Glu Leu 260 265 270 Phe Ser
Met Arg Ser Trp Ser Asp Met Arg Gln Glu Val Met Phe Leu 275 280 285
Thr Asn Val Asn Ser Ser Ser Ser Ser Thr Gln Ile Tyr Gln Ala Val 290
295 300 Ser Arg Ile Val Cys Gly His Pro Glu Gly Gly Gly Leu Lys Ile
Lys 305 310 315 320 Ser Leu Asn Trp Tyr Glu Asp Asn Asn Tyr Lys Ala
Leu Phe Gly Gly 325 330 335 Asn Gly Thr Glu Glu Asp Ala Glu Thr Phe
Tyr Asp Asn Ser Thr Thr 340 345 350 Pro Tyr Cys Asn Asp Leu Met Lys
Asn Leu Glu Ser Ser Pro Leu Ser 355 360 365 Arg Ile Ile Trp Lys Ala
Leu Lys Pro Leu Leu Val Gly Lys Ile Leu 370 375 380 Tyr Thr Pro Asp
Thr Pro Ala Thr Arg Gln Val Met Ala Glu Val Asn 385 390 395 400 Lys
Thr Phe Gln Glu Leu Ala Val Phe His Asp Leu Glu Gly Met Trp 405 410
415 Glu Glu Leu Ser Pro Lys Ile Trp Thr Phe Met Glu Asn Ser Gln Glu
420 425 430 Met Asp Leu Val Arg Met Leu Leu Asp Ser Arg Asp Asn Asp
His Phe 435 440 445 Trp Glu Gln Gln Leu Asp Gly Leu Asp Trp Thr Ala
Gln Asp Ile Val 450 455 460 Ala Phe Leu Ala Lys His Pro Glu Asp Val
Gln Ser Ser Asn Gly Ser 465 470 475 480 Val Tyr Thr Trp Arg Glu Ala
Phe Asn Glu Thr Asn Gln Ala Ile Arg 485 490 495 Thr Ile Ser Arg Phe
Met Glu Cys Val Asn Leu Asn Lys Leu Glu Pro 500 505 510 Ile Ala Thr
Glu Val Trp Leu Ile Asn Lys Ser Met Glu Leu Leu Asp 515 520 525 Glu
Arg Lys Phe Trp Ala Gly Ile Val Phe Thr Gly Ile Thr Pro Gly 530 535
540 Ser Ile Glu Leu Pro His His Val Lys Tyr Lys Ile Arg Met Asp Ile
545 550 555 560 Asp Asn Val Glu Arg Thr Asn Lys Ile Lys Asp Gly Tyr
Trp Asp Pro 565 570 575 Gly Pro Arg Ala Asp Pro Phe Glu Asp Met Arg
Tyr Val Trp Gly Gly 580 585 590 Phe Ala Tyr Leu Gln Asp Val Val Glu
Gln Ala Ile Ile Arg Val Leu 595 600 605 Thr Gly Thr Glu Lys Lys Thr
Gly Val Tyr Met Gln Gln Met Pro Tyr 610 615 620 Pro Cys Tyr Val Asp
Asp Ile Phe Leu Arg Val Met Ser Arg Ser Met 625 630 635 640 Pro Leu
Phe Met Thr Leu Ala Trp Ile Tyr Ser Val Ala Val Ile Ile 645 650 655
Lys Gly Ile Val Tyr Glu Lys Glu Ala Arg Leu Lys Glu Thr Met Arg 660
665 670 Ile Met Gly Leu Asp Asn Ser Ile Leu Trp Phe Ser Trp Phe Ile
Ser 675 680 685 Ser Leu Ile Pro Leu Leu Val Ser Ala Gly Leu Leu Val
Val Ile Leu 690 695 700 Lys Leu Gly Asn Leu Leu Pro Tyr Ser Asp Pro
Ser Val Val Phe Val 705 710 715 720 Phe Leu Ser Val Phe Ala Val Val
Thr Ile Leu Gln Cys Phe Leu Ile 725 730 735 Ser Thr Leu Phe Ser Arg
Ala Asn Leu Ala Ala Ala Cys Gly Gly Ile 740 745 750 Ile Tyr Phe Thr
Leu Tyr Leu Pro Tyr Val Ala Trp Gln Asp Tyr Val 755 760 765 Gly Phe
Thr Leu Lys Ile Phe Ala Ser Leu Leu Ser Pro Val Ala Phe 770 775 780
Gly Phe Gly Cys Glu Tyr Phe Ala Leu Phe Glu Glu Gln Gly Ile Gly 785
790 795 800 Val Gln Trp Asp Asn Leu Phe Glu Ser Pro Val Glu Glu Asp
Gly Phe 805 810 815 Asn Leu Thr Thr Ser Val Ser Met Met Leu Phe Asp
Thr Phe Leu Tyr 820 825 830 Gly Val Met Thr Trp Tyr Ile Glu Ala Val
Phe Pro Gly Gln Tyr Gly 835 840 845 Ile Pro Arg Pro Trp Tyr Phe Pro
Cys Thr Lys Ser Tyr Trp Phe Gly 850 855 860 Glu Glu Ser Asp Glu Lys
Ser His Pro Gly Ser Asn Gln Lys Arg Ile 865 870 875 880 Ser Glu Ile
Cys Met Glu Glu Glu Pro Thr His Leu Lys Leu Gly Val 885 890 895 Ser
Ile Gln Asn Leu Val Lys Val Tyr Arg Asp Gly Met Lys Val Ala 900 905
910 Val Asp Gly Leu Ala Leu Asn Phe Tyr Glu Gly Gln Ile Thr Ser Phe
915 920 925 Leu Gly His Asn Gly Ala Gly Lys Thr Thr Thr Met Ser Ile
Leu Thr 930 935 940 Gly Leu Phe Pro Pro Thr Ser Gly Thr Ala Tyr Ile
Leu Gly Lys Asp 945 950 955 960 Ile Arg Ser Glu Met Ser Thr Ile Arg
Gln Asn Leu Gly Val Cys Pro 965 970 975 Gln His Asn Val Leu Phe Asp
Met Leu Thr Val Glu Glu His Ile Trp 980 985 990 Phe Tyr Ala Arg Leu
Lys Gly Leu Ser Glu Lys His Val Lys Ala Glu 995 1000 1005 Met Glu
Gln Met Ala Leu Asp Val Gly Leu Pro Ser Ser Lys Leu Lys 1010 1015
1020 Ser Lys Thr Ser Gln Leu Ser Gly Gly Met Gln Arg Lys Leu Ser
Val 1025 1030 1035 1040 Ala Leu Ala Phe Val Gly Gly Ser Lys Val Val
Ile Leu Asp Glu Pro 1045 1050 1055 Thr Ala Gly Val Asp Pro Tyr Ser
Arg Arg Gly Ile Trp Glu Leu Leu 1060 1065 1070 Leu Lys Tyr Arg Gln
Gly Arg Thr Ile Ile Leu Ser Thr His His Met 1075 1080 1085 Asp Glu
Ala Asp Val Leu Gly Asp Arg Ile Ala Ile Ile Ser His Gly 1090 1095
1100 Lys Leu Cys Cys Val Gly Ser Ser Leu Phe Leu Lys Asn Gln Leu
Gly 1105 1110 1115 1120 Thr Gly Thr Thr Leu Thr Leu Val Lys Lys Asp
Val Glu Ser Ser Leu 1125 1130 1135 Ser Ser Cys Arg Asn Ser Ser Ser
Thr Val Ser Tyr Leu Lys Lys Glu 1140 1145
1150 Asp Ser Val Ser Gln Ser Ser Ser Asp Ala Gly Leu Gly Ser Asp
His 1155 1160 1165 Glu Ser Asp Thr Leu Thr Ile Asp Val Ser Ala Ile
Ser Asn Leu Ile 1170 1175 1180 Arg Lys His Val Ser Glu Ala Arg Leu
Val Glu Asp Ile Gly His Glu 1185 1190 1195 1200 Leu Thr Tyr Val Leu
Pro Tyr Glu Ala Ala Lys Glu Gly Ala Phe Val 1205 1210 1215 Glu Leu
Phe His Glu Ile Asp Asp Arg Leu Ser Asp Leu Gly Ile Ser 1220 1225
1230 Ser Tyr Gly Ile Ser Glu Thr Thr Leu Glu Glu Ile Phe Leu Lys
Val 1235 1240 1245 Ala Glu Glu Ser Gly Val Asp Ala Glu Thr Ser Asp
Gly Thr Leu Pro 1250 1255 1260 Ala Arg Arg Asn Arg Arg Ala Phe Gly
Asp Lys Gln Ser Cys Leu Arg 1265 1270 1275 1280 Pro Phe Thr Glu Asp
Asp Ala Ala Asp Pro Asn Asp Ser Asp Ile Asp 1285 1290 1295 Pro Glu
Ser Arg Glu Thr Asp Leu Leu Ser Gly Met Asp Gly Lys Gly 1300 1305
1310 Ser Tyr Gln Val Lys Gly Trp Lys Leu Thr Gln Gln Gln Phe Val
Ala 1315 1320 1325 Leu Leu Trp Lys Arg Leu Leu Ile Ala Arg Arg Ser
Arg Lys Gly Phe 1330 1335 1340 Phe Ala Gln Ile Val Leu Pro Ala Val
Phe Val Cys Ile Ala Leu Val 1345 1350 1355 1360 Phe Ser Leu Ile Val
Pro Pro Phe Gly Lys Tyr Pro Ser Leu Glu Leu 1365 1370 1375 Gln Pro
Trp Met Tyr Asn Glu Gln Tyr Thr Phe Val Ser Asn Asp Ala 1380 1385
1390 Pro Glu Asp Thr Gly Thr Leu Glu Leu Leu Asn Ala Leu Thr Lys
Asp 1395 1400 1405 Pro Gly Phe Gly Thr Arg Cys Met Glu Gly Asn Pro
Ile Pro Asp Thr 1410 1415 1420 Pro Cys Gln Ala Gly Glu Glu Glu Trp
Thr Thr Ala Pro Val Pro Gln 1425 1430 1435 1440 Thr Ile Met Asp Leu
Phe Gln Asn Gly Asn Trp Thr Met Gln Asn Pro 1445 1450 1455 Ser Pro
Ala Cys Gln Cys Ser Ser Asp Lys Ile Lys Lys Met Leu Pro 1460 1465
1470 Val Cys Pro Pro Gly Ala Gly Gly Leu Pro Pro Pro Gln Arg Lys
Gln 1475 1480 1485 Asn Thr Ala Asp Ile Leu Gln Asp Leu Thr Gly Arg
Asn Ile Ser Asp 1490 1495 1500 Tyr Leu Val Lys Thr Tyr Val Gln Ile
Ile Ala Lys Ser Leu Lys Asn 1505 1510 1515 1520 Lys Ile Trp Val Asn
Glu Phe Arg Tyr Gly Gly Phe Ser Leu Gly Val 1525 1530 1535 Ser Asn
Thr Trp Ala Leu Pro Pro Ser Gln Glu Val Asn Asp Ala Ile 1540 1545
1550 Lys Gln Met Lys Lys His Leu Lys Leu Ala Lys Asp Ser Ser Ala
Asp 1555 1560 1565 Arg Phe Leu Asn Ser Leu Gly Arg Phe Met Thr Gly
Leu Asp Thr Arg 1570 1575 1580 Asn Asn Val Lys Val Trp Phe Asn Asn
Lys Gly Trp His Ala Ile Ser 1585 1590 1595 1600 Ser Phe Leu Asn Val
Ile Asn Asn Ala Ile Leu Arg Ala Asn Leu Gln 1605 1610 1615 Lys Gly
Glu Asn Pro Ser His Trp Gly Ile Thr Ala Phe Asn His Pro 1620 1625
1630 Leu Asn Leu Thr Lys Gln Gln Leu Ser Glu Val Ala Leu Met Thr
Thr 1635 1640 1645 Ser Val Asp Val Leu Val Ser Ile Cys Val Ile Phe
Ala Met Ser Phe 1650 1655 1660 Val Pro Ala Ser Phe Val Val Phe Leu
Ile Gln Glu Arg Val Ser Lys 1665 1670 1675 1680 Ala Lys His Leu Gln
Phe Ile Ser Gly Val Lys Pro Val Ile Tyr Trp 1685 1690 1695 Leu Ser
Asn Phe Val Trp Asp Met Cys Asn Tyr Val Val Pro Ala Thr 1700 1705
1710 Leu Val Ile Ile Ile Phe Ile Cys Phe Gln Gln Lys Ser Tyr Val
Ser 1715 1720 1725 Ser Thr Asn Leu Pro Val Leu Ala Leu Leu Leu Leu
Leu Tyr Gly Trp 1730 1735 1740 Ser Ile Thr Pro Leu Met Tyr Pro Ala
Ser Phe Val Phe Lys Ile Pro 1745 1750 1755 1760 Ser Thr Ala Tyr Val
Val Leu Thr Ser Val Asn Leu Phe Ile Gly Ile 1765 1770 1775 Asn Gly
Ser Val Ala Thr Phe Val Leu Glu Leu Phe Thr Asp Asn Lys 1780 1785
1790 Leu Asn Asn Ile Asn Asp Ile Leu Lys Ser Val Phe Leu Ile Phe
Pro 1795 1800 1805 His Phe Cys Leu Gly Arg Gly Leu Ile Asp Met Val
Lys Asn Gln Ala 1810 1815 1820 Met Ala Asp Ala Leu Glu Arg Phe Gly
Glu Asn Arg Phe Val Ser Pro 1825 1830 1835 1840 Leu Ser Trp Asp Leu
Val Gly Arg Asn Leu Phe Ala Met Ala Val Glu 1845 1850 1855 Gly Val
Val Phe Phe Leu Ile Thr Val Leu Ile Gln Tyr Arg Phe Phe 1860 1865
1870 Ile Arg Pro Arg Pro Val Asn Ala Lys Leu Ser Pro Leu Asn Asp
Glu 1875 1880 1885 Asp Glu Asp Val Arg Arg Glu Arg Gln Arg Ile Leu
Asp Gly Gly Gly 1890 1895 1900 Gln Asn Asp Ile Leu Glu Ile Lys Glu
Leu Thr Lys Ile Tyr Arg Arg 1905 1910 1915 1920 Lys Arg Lys Pro Ala
Val Asp Arg Ile Cys Val Gly Ile Pro Pro Gly 1925 1930 1935 Glu Cys
Phe Gly Leu Leu Gly Val Asn Gly Ala Gly Lys Ser Ser Thr 1940 1945
1950 Phe Lys Met Leu Thr Gly Asp Thr Thr Val Thr Arg Gly Asp Ala
Phe 1955 1960 1965 Leu Asn Lys Asn Ser Ile Leu Ser Asn Ile His Glu
Val His Gln Asn 1970 1975 1980 Met Gly Tyr Cys Pro Gln Phe Asp Ala
Ile Thr Glu Leu Leu Thr Gly 1985 1990 1995 2000 Arg Glu His Val Glu
Phe Phe Ala Leu Leu Arg Gly Val Pro Glu Lys 2005 2010 2015 Glu Val
Gly Lys Val Gly Glu Trp Ala Ile Arg Lys Leu Gly Leu Val 2020 2025
2030 Lys Tyr Gly Glu Lys Tyr Ala Gly Asn Tyr Ser Gly Gly Asn Lys
Arg 2035 2040 2045 Lys Leu Ser Thr Ala Met Ala Leu Ile Gly Gly Pro
Pro Val Val Phe 2050 2055 2060 Leu Asp Glu Pro Thr Thr Gly Met Asp
Pro Lys Ala Arg Arg Phe Leu 2065 2070 2075 2080 Trp Asn Cys Ala Leu
Ser Val Val Lys Glu Gly Arg Ser Val Val Leu 2085 2090 2095 Thr Ser
His Ser Met Glu Glu Cys Glu Ala Leu Cys Thr Arg Met Ala 2100 2105
2110 Ile Met Val Asn Gly Arg Phe Arg Cys Leu Gly Ser Val Gln His
Leu 2115 2120 2125 Lys Asn Arg Phe Gly Asp Gly Tyr Thr Ile Val Val
Arg Ile Ala Gly 2130 2135 2140 Ser Asn Pro Asp Leu Lys Pro Val Gln
Asp Phe Phe Gly Leu Ala Phe 2145 2150 2155 2160 Pro Gly Ser Val Leu
Lys Glu Lys His Arg Asn Met Leu Gln Tyr Gln 2165 2170 2175 Leu Pro
Ser Ser Leu Ser Ser Leu Ala Arg Ile Phe Ser Ile Leu Ser 2180 2185
2190 Gln Ser Lys Lys Arg Leu His Ile Glu Asp Tyr Ser Val Ser Gln
Thr 2195 2200 2205 Thr Leu Asp Gln Val Phe Val Asn Phe Ala Lys Asp
Gln Ser Asp Asp 2210 2215 2220 Asp His Leu Lys Asp Leu Ser Leu His
Lys Asn Gln Thr Val Val Asp 2225 2230 2235 2240 Val Ala Val Leu Thr
Ser Phe Leu Gln Asp Glu Lys Val Lys Glu Ser 2245 2250 2255 Tyr Val
3 18 PRT Homo sapiens 3 Lys Glu Ala Arg Leu Lys Glu Thr Met Arg Ile
Met Gly Leu Asp Asn 1 5 10 15 Ser Ile 4 5 PRT Homo sapiens 4 Phe
Ser Arg Ala Asn 1 5 5 26 PRT Homo sapiens 5 Ala Leu Phe Glu Glu Gln
Gly Ile Gly Val Gln Trp Asp Asn Leu Phe 1 5 10 15 Glu Ser Pro Val
Glu Glu Asp Gly Phe Asn 20 25 6 284 PRT Homo sapiens 6 Phe Gly Lys
Tyr Pro Ser Leu Glu Leu Gln Pro Trp Met Tyr Asn Glu 1 5 10 15 Gln
Tyr Thr Phe Val Ser Asn Asp Ala Pro Glu Asp Thr Gly Thr Leu 20 25
30 Glu Leu Leu Asn Ala Leu Thr Lys Asp Pro Gly Phe Gly Thr Arg Cys
35 40 45 Met Glu Gly Asn Pro Ile Pro Asp Thr Pro Cys Gln Ala Gly
Glu Glu 50 55 60 Glu Trp Thr Thr Ala Pro Val Pro Gln Thr Ile Met
Asp Leu Phe Gln 65 70 75 80 Asn Gly Asn Trp Thr Met Gln Asn Pro Ser
Pro Ala Cys Gln Cys Ser 85 90 95 Ser Asp Lys Ile Lys Lys Met Leu
Pro Val Cys Pro Pro Gly Ala Gly 100 105 110 Gly Leu Pro Pro Pro Gln
Arg Lys Gln Asn Thr Ala Asp Ile Leu Gln 115 120 125 Asp Leu Thr Gly
Arg Asn Ile Ser Asp Tyr Leu Val Lys Thr Tyr Val 130 135 140 Gln Ile
Ile Ala Lys Ser Leu Lys Asn Lys Ile Trp Val Asn Glu Phe 145 150 155
160 Arg Tyr Gly Gly Phe Ser Leu Gly Val Ser Asn Thr Gln Ala Leu Pro
165 170 175 Pro Ser Gln Glu Val Asn Asp Ala Ile Lys Gln Met Lys Lys
His Leu 180 185 190 Lys Leu Ala Lys Asp Ser Ser Ala Asp Arg Phe Leu
Asn Ser Leu Gly 195 200 205 Arg Phe Met Thr Gly Leu Asp Thr Arg Asn
Asn Val Lys Val Trp Phe 210 215 220 Asn Asn Lys Gly Trp His Ala Ile
Ser Ser Phe Leu Asn Val Ile Asn 225 230 235 240 Asn Ala Ile Leu Arg
Ala Asn Leu Gln Lys Gly Glu Asn Pro Ser His 245 250 255 Tyr Gly Ile
Thr Ala Phe Asn His Pro Leu Asn Leu Thr Lys Gln Gln 260 265 270 Leu
Ser Glu Val Ala Leu Met Thr Thr Ser Val Asp 275 280 7 23 PRT Homo
sapiens 7 Leu Leu Leu Leu Tyr Gly Trp Ser Ile Thr Pro Leu Met Tyr
Pro Ala 1 5 10 15 Ser Phe Val Phe Lys Ile Pro 20 8 29 PRT Homo
sapiens 8 Val Lys Asn Gln Ala Met Ala Asp Ala Leu Glu Arg Phe Gly
Glu Asn 1 5 10 15 Arg Phe Val Ser Pro Leu Ser Trp Asp Leu Val Gly
Arg 20 25 9 21 DNA Artificial Sequence Description of Artificial
SequencePCR Primer 9 gtcacttccc aaacaaagct a 21 10 20 DNA
Artificial Sequence Description of Artificial SequencePCR Primer 10
atggacgcat tgaagtttcc 20 11 15 DNA chicken 11 accaggggaa tctcc 15
12 15 DNA chicken 12 accagggaaa tctcc 15 13 15 PRT Homo sapiens 13
Arg Tyr Pro Thr Pro Gly Glu Ala Pro Gly Val Val Gly Asn Phe 1 5 10
15 14 15 PRT mouse 14 Arg Tyr Pro Thr Pro Gly Glu Ala Pro Gly Val
Val Gly Asn Phe 1 5 10 15 15 15 PRT Takifugu Rubripes 15 Ser His
Pro Thr Leu Gly Glu Thr Pro Gly Gln Val Asn Asn Phe 1 5 10 15 16 15
PRT chicken 16 Arg Tyr Pro Thr Pro Gly Glu Ser Pro Gly Ile Val Gly
Asn Phe 1 5 10 15 17 15 PRT chicken 17 Arg Tyr Pro Thr Pro Gly Lys
Ser Pro Gly Ile Val Gly Asn Phe 1 5 10 15 18 45 DNA chicken 18
cgctacccaa caccagggga atctcctggt attgttggaa acttc 45 19 45 DNA
chicken 19 cgctacccaa caccagggaa atctcctggt attgttggaa acttc 45
* * * * *
References