U.S. patent application number 11/655331 was filed with the patent office on 2007-06-07 for human hac3.
This patent application is currently assigned to ICAGEN, INCORPORATED. Invention is credited to Timothy J. Jegla.
Application Number | 20070128653 11/655331 |
Document ID | / |
Family ID | 22440040 |
Filed Date | 2007-06-07 |
United States Patent
Application |
20070128653 |
Kind Code |
A1 |
Jegla; Timothy J. |
June 7, 2007 |
Human HAC3
Abstract
The invention provides isolated nucleic acid and amino acid
sequences of hHAC3, antibodies to hHAC3, methods of detecting
hHAC3, and methods of screening for modulators
hyperpolarization-activated cation channels using biologically
active hHAC3. The invention further provides, in a computer system,
a method of screening for mutations of human HAC3 genes as well as
a method for identifying a three-dimensional structure of human
HAC3 polypeptides.
Inventors: |
Jegla; Timothy J.; (San
Diego, CA) |
Correspondence
Address: |
TOWNSEND AND TOWNSEND AND CREW, LLP
TWO EMBARCADERO CENTER
EIGHTH FLOOR
SAN FRANCISCO
CA
94111-3834
US
|
Assignee: |
ICAGEN, INCORPORATED
DURHAM
NC
|
Family ID: |
22440040 |
Appl. No.: |
11/655331 |
Filed: |
January 19, 2007 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
09767597 |
Jan 22, 2001 |
7169893 |
|
|
11655331 |
Jan 19, 2007 |
|
|
|
09548933 |
Apr 13, 2000 |
7153668 |
|
|
09767597 |
Jan 22, 2001 |
|
|
|
60129456 |
Apr 15, 1999 |
|
|
|
Current U.S.
Class: |
435/6.11 ;
435/320.1; 435/325; 435/6.16; 435/69.1; 435/7.1; 530/350; 536/23.5;
702/19 |
Current CPC
Class: |
C07K 14/705 20130101;
A61K 38/00 20130101; C07K 16/28 20130101 |
Class at
Publication: |
435/006 ;
530/350; 435/069.1; 435/320.1; 435/325; 435/007.1; 536/023.5;
702/019 |
International
Class: |
C12Q 1/68 20060101
C12Q001/68; G01N 33/53 20060101 G01N033/53; G06F 19/00 20060101
G06F019/00; G01N 33/48 20060101 G01N033/48; C07H 21/04 20060101
C07H021/04; C12P 21/06 20060101 C12P021/06; C07K 14/705 20060101
C07K014/705 |
Claims
1-19. (canceled)
20. An antibody that selectively binds to an isolated polypeptide
comprising an alpha subunit of a cation channel, the polypeptide:
(i) forming, with at least one additional HAC alpha subunit, a
cation channel having the characteristic of activation upon
hyperpolarization; and (ii) having an amino acid sequence that has
greater than about 96% identity to SEQ ID NO:1.
21. The antibody of claim 20, wherein the polypeptide has an amino
acid sequence of SEQ ID NO:1.
22-39. (canceled)
40. The antibody of claim 20, wherein the polypeptide comprises an
alpha subunit of a homomeric cation channel.
41. The antibody of claim 20, wherein the polypeptide comprises an
alpha subunit of a heteromeric cation channel.
42. The antibody of claim 20, wherein the antibody is a monoclonal
antibody.
Description
CROSS-REFERENCES TO RELATED APPLICATIONS
[0001] This application claims the benefit of U.S. Ser. No.
60/129,456, filed Apr. 15, 1999, herein incorporated by reference
in its entirety.
STATEMENT AS TO RIGHTS TO INVENTIONS MADE UNDER FEDERALLY SPONSORED
RESEARCH AND DEVELOPMENT
[0002] Not applicable.
FIELD OF THE INVENTION
[0003] The invention provides isolated nucleic acid and amino acid
sequences of hHAC3, antibodies to hHAC3, methods of detecting
hHAC3, and methods of screening for modulators
hyperpolarization-activated cation channels using biologically
active hHAC3. The invention further provides, in a computer system,
a method of screening for mutations of human HAC3 genes as well as
a method for identifying a three-dimensional structure of human
HAC3 polypeptides.
BACKGROUND OF THE INVENTION
A. General Background to Cation Channels
[0004] Cation channels are a diverse group of proteins that
regulate the flow of cations across cellular membranes. The
selectivity of a cation channel for particular cations typically
varies with the valency of the cations, as well as the specificity
of a given channel for a particular cation. Some cation channels
display almost no selectivity for cations with the same valence
(see, e.g., Saitow et al, Biochim Biophys Acta 1327(1):52-60
(1997)). Other channels are clearly selective for particular
cations but are permeable to other cations to varying degrees (see,
e.g., Park & MacKinnon, Biochemistry 34(41):13328-33 (1995) and
Gauss et al., Nature 393(6685):583-7 (1998)).
[0005] Cation channels are involved in a number of physiological
processes, including regulation of heartbeat, dilation of arteries,
release of insulin, excitability of nerve cells, transduction of
sensory stimuli, and regulation of renal electrolyte transport.
Cation channels are thus found in a wide variety of animal cells
such as nervous, muscular, glandular, immune, reproductive,
sensory, and epithelial tissue. These channels allow the flow of
various cations in and/or out of the cell under certain conditions.
For example, the inward flow of cations upon opening of these
channels makes the interior of the cell more positive, thus
depolarizing the cell. These channels are regulated, e.g., by
calcium sensitivity, voltage-gating, cyclic nucleotides or other
secondary messengers, extracellular ligands, and
ATP-sensitivity.
[0006] Certain classes of cation channels are formed by four alpha
subunits and can be homomeric (made of identical alpha subunits) or
heteromeric (made of two or more distinct types of alpha subunits).
Some cation channels may contain other structurally distinct
auxiliary, or beta, subunits. These subunits do not form potassium
channels themselves, but instead modify the functional properties
of channels formed by the alpha subunits. For example, the Kv beta
subunits are cytoplasmic and are known to increase the surface
expression of Kv channels and/or modify their inactivation kinetics
(Heinemann et al., J Phsyiol. (Lond); 493:625-633; 1996 and Shi et
al., Neuron 16(4):843-852, 1996). In another example, the KQT
family beta subunit, minK, primarily changes activation kinetics
(Sanguinetti et al., Nature 384:80-83, 1996).
B. Hyperpolarization-activated Cation Channels: HAC1 and HAC2.
[0007] Specialized cells in the heart and brain can create rhythmic
activity due in a large part to a depolarizing mixed
sodium/potassium current known as I.sub.h (see, e.g., Santoro et
al., Cell 93:717-729 (1998)). This pacemaker current is generated
by hypolarization activated channels that are present in the heart
(see, e.g., DiFrancesco, Ann. Rev Physiol. 55:455-72 (1993) and
brain (see, e.g., Papa, Ann. Rev. Physiol. 58:299-327 (1996). In
addition to contributing directly to rhythmic activity in the brain
and heart, these channels may contribute significantly to resting
membrane potentials in neurons and other cell types from a variety
of tissues.
[0008] Recently a family of hyperpolarization-activated channels,
given the acronym HAC, was isolated from mouse (see, Ludwig et al.,
Nature 393:587-91 (1998)). Ludwig et al. reported isolating three
different ion channels (mHAC1, mHAC2 and mHAC3). The mouse HAC
proteins are members of the voltage-gated cation channel super
family and also have a cyclic nucleotide binding domain capable of
binding cAMP and cGMP. Mouse HAC1 exhibits the general properties
of I.sub.h and may be responsible for pacemaker activity.
[0009] Another group also identified the same gene family, in this
instance identified by the acronym BCNG. For instance, the BCNG-1
(HAC2) ion channel was isolated from mouse cells and is expressed
in the brain (see, e.g., Santoro et al., Proc. Natl. Sci. USA
94:14815-20 (1997)). The human BCNG-2/HAC1 and BCNG-1/HAC2 have
also been cloned (see, e.g., Santoro et al., Cell 93:717-729
(1998)). Since then, several related mouse genes (e.g.,
BCNG-1/HAC2, partial BCNG2/HAC1, partial BCNG3/HAC4, and partial
BCNG4/HAC3) with expression in various tissues, including heart and
brain, have been isolated (see, e.g., Santoro et al., Cell
93:717-729 (1998)).
[0010] Phylogenetic analysis indicates that mHAC3 is more distantly
related to mHAC 1 or mHAC2 than are mHAC 1 and mHAC2 to each other.
Human HAC3 has not been previously isolated. Isolation of human
HAC3 is therefore desirable, to better understand the physiology of
HAC3 in humans and for the development of therapeutic and
diagnostic applications to diseases related to hHAC3 in humans.
SUMMARY OF THE INVENTION
[0011] The current invention provides the first isolation and
characterization of the human HAC3 cation channel, which has
neither been previously cloned nor identified. The present
invention provides both the nucleotide and amino acid sequence of
hHAC3, as well as methods of assaying for modulators of hHAC3,
antibodies to hHAC3, and methods of detecting hHAC3 nucleic acids
and proteins.
[0012] The present invention provides an isolated nucleic acid
encoding a polypeptide monomer comprising an alpha subunit of a
cation channel wherein the polypeptide monomer has two attributes.
First, the polypeptide monomer forms, with at least one additional
HAC alpha subunit, a cation channel having the characteristic of
activation upon hyperpolarization. Second, the polypeptide monomer
has an amino acid sequence that has greater than about 75% identity
to an N-terminal region (amino acids 1-50) of a human HAC3 amino
acid sequence (e.g., SEQ ID NO:1) or greater than about 90%
identity to amino acids 640-775 of a human HAC3 amino acid sequence
(e.g., SEQ ID NO:1).
[0013] In one embodiment of the invention, the nucleic acid encodes
SEQ ID NO:1. In another embodiment, the nucleic acid has a
nucleotide sequence of SEQ ID NO:2. In yet another embodiment, the
nucleic acid is a splice variant of SEQ ID NO:2.
[0014] In one embodiment of the invention includes a nucleic acid
that is amplified by primers that selectively hybridize under
stringent conditions to the same sequence as any two primers
selected from CAGCCATGGAGGCAGAGCAGCGGC (SEQ ID NO:3),
GGAGGAGATCTTTCACATGACATACGAC (SEQ ID NO:4),
AGTAGGATCCATCGGTGAGGCGTG (SEQ ID NO:5), and
TTACATGTTGGCAGAAAGCTGGAGACC (SEQ ID NO:6).
[0015] In one embodiment of the invention, the nucleic acid
selectively hybridizes under moderately stringent hybridization
conditions to the nucleotide of SEQ ID NO:2.
[0016] In one embodiment of the invention, the nucleic acid has a
nucleotide sequence that has greater than about 90% identity to SEQ
ID NO:2. In another embodiment, the nucleic acid encodes a
polypeptide having an amino acid sequence that has greater than
about 96% identity to SEQ ID NO:1.
[0017] The present invention also provides an isolated protein
monomer comprising an alpha subunit of a cation channel wherein the
polypeptide monomer 1) forms, with at least one additional HAC
alpha subunit, a cation channel having the characteristic of
activation upon hyperpolarization, and 2) has an amino acid
sequence that has greater than about 75% identity to an N-terminal
region (amino acids 1-50) or greater than about 90% identity to
amino acids 640-775 of a human HAC3 amino acid sequence.
[0018] In one embodiment of the invention, the polypeptide monomer
specifically binds to antibodies generated against SEQ ID NO:1.
[0019] In one embodiment, the isolated peptide monomer has an amino
acid sequence of SEQ ID NO:1. In different embodiments, the
isolated peptide monomer comprises either an alpha subunit of a
homomeric or a heteromeric cation channel. In another embodiment,
the isolated polypeptide monomer has a molecular weight between
about 84 kDa and about 95 kDa. In yet another embodiment, the
isolated polypeptide monomer has greater than about 96% identity to
SEQ ID NO:1.
[0020] One aspect of the invention includes an antibody that
selectively binds to a polypeptide monomer that 1) forms, with at
least one additional HAC alpha subunit, a cation channel having the
characteristic of activation upon hyperpolarization, and 2) has an
amino acid sequence that has greater than about 75% identity to an
N-terminal region (amino acids 1-50) or greater than about 90%
identity to amino acids 640-775 of a human HAC3 amino acid sequence
(e.g., SEQ ID NO:1).
[0021] The invention also provides for an expression vector
comprising a nucleic acid encoding a polypeptide monomer comprising
a subunit of a cation channel, wherein the cation channel (i) has
the characteristic of activation upon hyperpolarization; and (ii)
comprises a polypeptide monomer having an amino acid sequence that
has greater than about 96% amino acid sequence identity to a human
HAC3 amino acid sequence. In one embodiment, a host cell is
transfected with the expression vector.
[0022] The invention also provides a method for identifying a
compound that increases or decreases ion flux through a
hyperpolarization-activated cation channel. The method comprises
two steps. The first step comprises contacting the compound with a
HAC polypeptide monomer. The polypeptide monomer 1) forms, with at
least one additional HAC alpha subunit, a cation channel having the
characteristic of activation upon hyperpolarization, and 2) has an
amino acid sequence that has greater than about 75% identity to an
N-terminal region (amino acids 1-50) or greater than about 90%
identity to amino acids 640-775 of a human HAC3 amino acid sequence
(e.g., SEQ ID NO:1). The second step of the method comprises
determining the functional effect of the compound upon the cation
channel.
[0023] In one embodiment, the functional effect is a physical
effect or a functional effect. In another embodiment, the
polypeptide is expressed in a eukaryotic host cell or cell
membrane.
[0024] In one embodiment of the method, the functional effect is
determined by measuring ion flux, or changes in current, voltage,
ion concentrations, or yeast viability. In another embodiment, the
isolated polypeptide monomer is recombinant. The method provides
for a polypeptide monomer comprising an alpha subunit of either a
homomeric or a heteromeric cation channel. Finally, in one aspect
of the method, the polypeptide monomer has the amino acid sequence
of SEQ ID NO:1.
[0025] In another aspect, the present invention provides a method
of modulating ion flux through a human HAC channel, the method
comprising the step of contacting the human HAC channel with a
therapeutically effective amount of a compound identified as
described above
[0026] In another aspect, the present invention provides a method
for identifying a compound that increases or decreases ion flux
through a HAC potassium channel comprising a human HAC polypeptide,
the method comprising the steps of: (i) entering into a computer
system an amino acid sequence of at least 50 acids of a human HAC
polypeptide or at least 150 nucleotides of a nucleic acid encoding
the human HAC polypeptide, the human HAC polypeptide having an
amino acid sequence that has greater than about 75% identity to
amino acids 1-50 of SEQ ID NO:1 or greater than about 90% identity
to amino acids 640-775 of SEQ ID NO:1; (ii) generating a
three-dimensional structure of the polypeptide encoded by the amino
acid sequence; (iii) generating a three-dimensional structure of
the potassium channel comprising the human HAC polypeptide; (iv)
generating a three-dimensional structure of the compound; and (v)
comparing the three-dimensional structures of the polypeptide and
the compound to determine whether or not the compound binds to the
polypeptide.
[0027] The invention also provides for a method of detecting the
presence of HAC3 in a sample. The method comprises the steps of:
(i) isolating a biological sample; (ii) contacting the biological
sample with a human HAC3-specific reagent that selectively
associates with human HAC3; and, (iii) detecting the level of human
HAC3-specific reagent that selectively associates with the
sample.
[0028] In one embodiment, the human HAC3-specific reagent is
selected from the group consisting of: human HAC3 specific
antibodies, human HAC3 specific oligonucleotide primers, and human
HAC3 nucleic acid probes.
[0029] The invention further provides for a method of screening for
mutations of human HAC3 genes using a computer system. The method
comprises (i) entering into a computer system a first nucleic acid
sequence encoding an hyperpolarization-activated cation channel
polypeptide monomer having a nucleotide sequence of SEQ ID NO:2,
and conservatively modified versions thereof; (ii) comparing the
first nucleic acid sequence with a second nucleic acid sequence
having substantial identity to the first nucleic acid sequence; and
(iii) identifying nucleotide differences between the first and
second nucleic acid sequences. In one embodiment of this method,
the second nucleic acid sequence is associated with a disease
state. The invention further provides a computer readable substrate
comprising the first nucleic sequence as described in the
above-described method. In one embodiment of this composition, the
computer readable substrate further comprises the second nucleic
acid as described in the above-described method.
[0030] Finally, the invention also provides a method for
identifying a three-dimensional structure of human HAC3 polypeptide
monomers. The method comprises (i) entering into a computer system
an amino acid sequence of at least 60 amino acids of a polypeptide
monomer or at least 180 nucleotides of a gene encoding the
polypeptide monomer, the polypeptide monomer having an amino acid
sequence of SEQ ID NO:1, and conservatively modified versions
thereof; and (ii) generating a three-dimensional structure of the
polypeptide monomer encoded by the amino acid sequence.
[0031] In one embodiment of this method, the amino acid sequence is
a primary structure and the generating step includes the steps of
(i) forming a secondary structure from said primary structure using
energy terms determined by the primary structure; and (ii) forming
a tertiary structure from said secondary structure using energy
terms determined by said secondary structure. In another
embodiment, the generating step also includes the step of forming a
quaternary structure from the tertiary structure using anisotropic
terms encoded by the tertiary structure. In another aspect of the
method, the method also includes the step of identifying regions of
the three-dimensional structure of a human HAC3 cation channel
protein that bind to ligands and using the regions to identify
ligands that bind to the cation channel. A further aspect of the
invention includes a computer readable substrate comprising the
tree dimensional structure derived from the above-described
method.
BRIEF DESCRIPTION OF THE DRAWINGS
[0032] FIG. 1. Amino acid alignment of human Hac3 with human Hac1
and human Hac2. Identical residues are shaded. The numbers at the
left edge indicated amino acid position. Note that the human Hac2
is missing the amino terminus.
[0033] FIG. 2. Northern blot analysis of human Hac3. (A)
Traditional northern blot of Hac3. A transcript of approximately 4
Kb is abundant in brain and also present in heart. Larger
transcripts (approximately 5 Kb) are seen in brain, heart, liver
and kidney. (B) mRNA dot blot northern of Hac3. Expression is most
abundant in brain, but is widespread in peripheral tissues. Note
that mRNA dot blots are several times more sensitive for detection
of message than traditional northerns. Also note the wide
discrepancy between the high level of message detected on the dot
blot for small intestine and colon versus the lack of expression on
the traditional northern. These tissues often label more highly on
dot blots, and it is possible that this is an effect of poor mRNA
quality for these tissues.
[0034] FIG. 3. Hac3 currents expressed in Xenopus oocytes. (A) Hac3
currents were elicited with 3.2 second pulses ranging from -70 to
-160 mV in 10 mV increments from a holding potential of -30 mV.
Outward tail currents were measured at 0 mV. (B) Hac3 currents were
elicited by steps to -100 mV and tail currents were measured at
repolarization steps ranging from -50 to 0 mV in 10 mV increments.
The current reverses between -40 and -30 mV suggesting that Hac3
passes both sodium and potassium.
[0035] FIG. 4. Hac3 currents are blocked by Cesium. Hac3 currents
were elicited by steps from -30 mV to -140 mV. Tail currents were
measured at 0 mV. 2 mM Cs.sup.+ completely blocked the inward Hac3
current measured at -140 mV, but had less effect on the outward
tail current. This suggests that the Cs.sup.+ blocking site is in
the external mouth of the Hac3 pore.
DETAILED DESCRIPTION OF THE INVENTION
I. Introduction
[0036] The present invention provides for the first time a nucleic
acid encoding a human HAC3 alpha subunit, identified and cloned
from human tissue. This polypeptide monomer is a member of the HAC
family of potassium channel monomers and is most closely related to
the CNG channel .alpha.-subunits and the "eag" (ether a go-go)
subfamily of potassium channel monomers. Members of this family are
voltage-gated cation channels with six membrane-spanning segments
(S1-S6). These segments include a voltage sensing S4 segment and an
ion conducting pore between S5 and S6. Voltage-gated cation
channels have significant roles in maintaining the resting
potential and in controlling excitability of a cell.
[0037] The invention also provides methods of screening for
modulators of hyperpolarization-activated cation channels
comprising a hHAC3 alpha subunit. For example, such modulators may
alter the voltage-gating characteristic of hHAC. Hyperpolarization
activated channels, such as those comprising hHAC3, have a greater
probability of opening when the membrane comprising the channels is
hyperpolarized. Modulators of hyperpolarization-activated channel
activity may be useful for treating various pacemaker dysfunctions
such as familial sinus rhythm diseases, sick sinus syndrome
associated with atrial fibrillation, sinus tachycardias and
bradycardias as well as ventricular arrhythmias. The modulators are
also useful for treating other disorders involving abnormal ion
flux, e.g., memory and learning disorders, sleeping disorders,
bipolar disease, schizophrenia, CNS disorders such as migraines,
hearing and vision problems, seizures, and as neuroprotective
agents (e.g., to prevent stroke).
[0038] Furthermore, the invention provides assays for hHAC3
activity where hHAC3 acts as a direct or indirect reporter
molecule. Human HAC3 can have broad application as a reporter
molecule in assay and detection systems. For instance, hHAC3 can be
used as a reporter molecule to measure changes in potassium or
sodium concentration, membrane potential, current flow, ion flux,
transcription, signal transduction, receptor-ligand interactions,
second messenger concentrations, in vitro, in vivo, and ex vivo. In
one embodiment, hHAC3 can be used as an indicator of current flow
in a particular direction (e.g., outward or inward cation flow),
and in another embodiment, hHAC3 can be used as an indirect
reporter via attachment to a second reporter molecule such as green
fluorescent protein.
[0039] The invention provides for methods of detecting hHAC3
nucleic acid and protein expression, allowing investigation of the
channel diversity provided by hHAC3, as well as diagnosis of
disease caused by pacemaker activity dysfunction such as familial
sinus rhythm diseases, sick sinus syndrome associated with atrial
fibrillation, sinus tachycardias, bradycardias and ventricular
arrhythmias as well as abnormal ion flux, e.g., memory and learning
disorders, sleeping disorders, bipolar disease, schizophrenia, CNS
disorders such as migraines, hearing and vision problems,
seizures.
[0040] Finally, the invention provides for a method of screening
for mutations of hHAC3 genes or proteins. The invention includes,
but is not limited to, methods of screening for mutations in hHAC3
with the use of a computer. Similarly, the invention provides for
methods of identifying the three-dimensional structure of hHAC3, as
well as the resulting computer readable images or data that
comprise the three dimensional structure of hHAC3. Other methods
for screening for mutations of hHAC genes or proteins include high
density oligonucleotide arrays, PCR, immunoassays and the like.
[0041] Functionally, hHAC3 is an alpha subunit of a voltage-gated
cation channel that is activated upon hyperpolarization.
Voltage-gated channels are heteromeric or homomeric and typically
contain four alpha subunits or monomers, each with six
transmembrane domains. Heteromeric channels comprise one or more
hHAC3 alpha subunits along with additional alpha subunits from the
HAC family (e.g., HAC1 or HAC2). In addition, such channels may
comprise one or more auxiliary beta subunits. At its carboxy
terminus, hHAC3 also contains a sequence with similarity to cyclic
nucleotide binding proteins. Therefore, it is likely that hHAC3
channel activity can be modulated by cyclic nucleotides such as
cAMP or cGMP. The presence of hHAC3 in a cation channel may also
modulate the activity of the channel and thus enhance channel
diversity. Channel diversity is also enhanced with alternatively
spliced forms of hHAC3. The cation channels may also include an
auxiliary beta subunit that modulates channel activity and thus
enhances channel diversity.
[0042] Structurally, the nucleotide sequence of human HAC3 (SEQ ID
NO:2) encodes a polypeptide monomer of approximately 775 amino
acids with a predicted molecular weight of 85-94 kDa. Human HAC3
contains six membrane spanning domains (S1-6), including a voltage
sensing domain (S4) and an ion-conduction pore between S5 and S6,
as well as a putative cyclic nucleotide binding domain region that
has a conserved amino acid sequence. This entire region is located
at approximately amino acids 53 to 554. Furthermore, hHAC3 contains
an N-terminal domain located at amino acids 1 to 50, which provides
a means for identifying alleles and conservatively modified
variants of hHAC3. Alternatively, hHAC3 can be identified as a
cation channel subunit polypeptide having 90% or more identity to
the region defined by amino acids 640-775 of SEQ ID NO:1.
[0043] The present invention also provides polymorphic variants of
hHAC3. For instance, in variant #1, an aspartate is substituted for
a leucine at position 545. In variant #2, a valine is substituted
for an isoleucine at amino acid position number 37. In variant #3,
a threonine is substituted for an alanine at amino acid position
686. In variant #4, an alanine is substituted for a glycine at
amino acid position 702.
[0044] Specific regions of hHAC3 amino acid and nucleotide
sequences may be used to identify conservatively modified or
polymorphic variants and alleles of hHAC3. This identification can
be made in vitro, e.g., under stringent hybridization conditions
and sequencing, or by using the sequence information in a computer
system for comparison with other nucleotide sequences. Amino acid
identity of approximately at least 96% or above, preferably 98%,
most preferably 99% or above to the entire hHAC3 polypeptide (SEQ
ID NO:1) or a portion thereof, typically demonstrates that a
protein is a polymorphic variant or allele of hHAC3. The first 50
amino acid residues of SEQ ID NO:1 displays considerable variance
relative to the mouse HAC3 N-terminus. Since this region is
significantly different from other known HAC sequences, the first
50 amino acids of SEQ ID NO:1 are preferably used to differentiate
sequences related to human HAC3 from HAC sequences from other
species. Therefore, an amino acid identity of approximately 75% or
above, preferably 80%, and most preferably 90% or above to the
first 50 amino acids of SEQ ID NO:1 peptide demonstrates that a
protein is a conservatively modified or polymorphic variant or
allele of hHAC3. Alternatively, the conserved region of amino acids
640-775 of SEQ ID NO:1 can be used to identify conservatively
modified variants, alleles, and polymorphic variants of hHAC3.
Amino acid sequence identity of 90% or more to this conserved
region demonstrates that a protein is a conservatively modified or
polymorphic variant or allele of hHAC3.
[0045] Nucleotide identity of approximately at least 90%,
preferably 95% and most preferably 98% or above to the entire hHAC3
nucleic acid sequence (SEQ ID NO:2) or portions thereof, typically
demonstrates that a nucleic acid is a conservatively modified or
polymorphic variant or allele of hHAC3. Alternatively, hHAC3 can be
identified as a cation channel subunit polypeptide having 90% or
more identity to the region defined by amino acids 640-775 of SEQ
ID NO:1. Sequence comparison is performed using the sequence
comparison algorithms discussed below, using the default parameters
described below. Antibodies that bind specifically to the HAC3
subunit can also be used to identify alleles, conservatively
modified or polymorphic variants. Finally, analysis of the three
dimensional structure of the hHAC3 polypeptide can be used to
predict alleles of hHAC3 that have conserved function.
[0046] Conservatively modified or polymorphic variants and alleles
of hHAC3 are confirmed by expressing the putative hHAC3 polypeptide
monomer either alone or co-expressed with another cation channel
subunit and examining whether the monomer forms a cation channel.
Functional assays may be used to determine the characteristics of
the cation channels formed in such ways. One assay is to determine
changes in cellular polarization by measuring changes in current
(thereby measuring changes in polarization) with voltage-clamp and
patch-clamp techniques, e.g., "the cell-attached" mode, "the
inside-out" mode, and "the whole cell" mode (see, e.g., Ackerman et
al., New Engl. J. Med. 336:1575-1595 (1997)). This assay is used to
demonstrate that a cation channel comprising a polypeptide monomer
having about 96% or greater, preferably 98% or greater amino acid
identity to the entire sequence of hHAC3 or a portion thereof is a
species of hHAC3 because the subunit shares the same functional
characteristics. Typically, hHAC3 monomers having the amino acid
sequence of SEQ ID NO:1 are used as positive controls in comparison
to the putative hHAC3 protein to demonstrate the identification of
a polymorphic variant or allele of hHAC3.
[0047] Human HAC3 nucleotide and amino acid sequence information
may also be used to construct models of a
hyperpolarization-activated cation channel in a computer system.
These models are subsequently used to identify compounds that can
activate or inhibit a hyperpolarization-activated cation channel
comprising hHAC3. Such compounds that modulate the activity of
channels comprising hHAC3 can be used to investigate the role of
hHAC3 in modulation of channel activity and in channel
diversity.
[0048] The identification and cloning of hHAC3 for the first time
provides a means for assaying for inhibitors and activators of
human hyperpolarization-activated cation channels such as cation
channels comprising hHAC3. Biologically active hHAC3 is useful for
testing inhibitors and activators of cation channels comprising
hHAC3 and other hyperpolarization-activated cation channels using
in vivo and in vitro expression that measure, e.g., changes in
voltage or current. Such activators and inhibitors, identified
using a voltage-gated cation channel comprising at least one hHAC3
monomer, can be used to further study, e.g., regulation of cation
channels activated upon hyperpolarization, channel kinetics, and
conductance properties of such channels. These activators and
inhibitors are also useful as pharmaceutical agents for treating
diseases involving pacemaker dysfunctions such as familial sinus
rhythm diseases, sick sinus syndrome associated with atrial
fibrillation, sinus tachycardias, bradycardias and ventricular
arrhythmias as well as abnormal ion flux, e.g., memory and learning
disorders, sleeping disorders, bipolar disease, schizophrenia, CNS
disorders, as described above.
[0049] Methods of detecting hHAC3 and expression of channels
comprising the hHAC3 monomers are also useful for diagnostic
applications for diseases involving pacemaker dysfunctions such as
familial sinus rhythm diseases, sick sinus syndrome associated with
atrial fibrillation, sinus tachycardias, bradycardias and
ventricular arrhythmias as well as abnormal ion flux, e.g., CNS
disorders and other disorders. For example, chromosome localization
of the gene encoding hHAC3 can be used to identify diseases caused
by and associated with the hHAC3. Methods of detecting hHAC3
polypeptides are also useful for examining the role of the hHAC3
monomers in channel diversity and modulation of channel
activity.
II. Definitions
[0050] As used herein, the following terms have the meanings
ascribed to them unless specified otherwise.
[0051] Cation channels with the characteristic of "activation upon
hyperpolarization" (also referred to as
"hyperpolarization-activated") have a low probability of opening at
cellular resting potentials (from about -50 mV to about -80 mV) and
have an increasing probability of opening at more hyperpolarized
potentials. Thus a cation channel having the characteristic of
activation upon hyperpolarization will have a greater probability
of opening at -100 mV than at -70 mV. Cation channels having the
characteristic of activation upon hyperpolarization also open more
quickly at more hyperpolarized potentials. Thus a cation channel
having the characteristic of activation upon hyperpolarization will
also open more quickly at -100 mV than at -70 mV. A discussion of
activation by hyperpolarization can be found in Luthi &
McCormick, Neuron 21(1):9-12 (1998).
[0052] "Cation channels" are a diverse group of proteins that
regulate the flow of cations across cellular membranes. The ability
of a specific cation channel to transport particular cations
typically varies with the valency of the cations, as well as the
specificity of the given channel for a particular cation.
[0053] "Homomeric channel" refers to a cation channel composed of
identical alpha subunits, whereas "heteromeric channel" refers to a
cation channel composed of two or more different types of alpha
subunits. Both homomeric and heteromeric channels can include
auxiliary beta subunits.
[0054] A "beta subunit" is a polypeptide monomer that is an
auxiliary subunit of a cation channel composed of alpha subunits;
however, beta subunits alone cannot form a channel (see, e.g., U.S.
Pat. No. 5,776,734). Beta subunits are known, for example, to
increase the number of channels by helping the alpha subunits reach
the cell surface, change activation kinetics, and change the
sensitivity of natural ligands binding to the channels. Beta
subunits can be outside of the pore region and associated with
alpha subunits comprising the pore region. They can also contribute
to the external mouth of the pore region.
[0055] The term "transmembrane domain" refers to the region of the
cation channel subunit polypeptide that spans across the lipid
bilayer membrane of the cells. Various families of the cation
channels have different numbers of transmembrane domains that
travel across the cellular membrane. Structurally, a transmembrane
domain starts from the first amino acid residue of the subunit
sequence that enters into the cellular membrane and ends with the
last amino acid residue in the subunit sequence that leaves the
cellular membrane.
[0056] The phrase "voltage-gated" activity or "voltage-gating"
refers to a characteristic of a HAC channel composed of individual
polypeptide monomers or subunits. Generally, the probability of a
voltage-gated HAC channel opening increases as a cell is
hyperpolarized. The reversal potential for HAC channels is
primarily determined by the reversal potentials of the two major
permeant cations, sodium and potassium. E.sub.K, or the reversal
potential for potassium, depends on the relative concentrations of
potassium found inside and outside the cell membrane, and is
typically between -60 and -100 mV for mammalian cells. For example,
E.sub.K is the membrane potential at which there is no net flow of
potassium ion because the electrical potential (i.e., membrane
potential) driving potassium influx is balanced by the
concentration gradient directing potassium efflux. This value is
also known as the "reversal potential" or the "Nernst" potential
for potassium. Similarly, E.sub.Na, or the reversal potential for
sodium, depends on the relative concentration of sodium found
inside and outside the cell and is typically near 50 mV. Because
HAC channels pass both sodium and potassium, their reversal
potential lies between E.sub.K and E.sub.Na, and is typically -20
to -40 mV. Hyperpolarization activated cation channels primarily
allow influx of cations because they have greater probabilities of
being open at membrane potentials more negative than this
equilibrium potential.
[0057] Certain hyperpolarization activated channels such as HAC
channels are typically composed of four subunits and the channel
can be heteromeric or homomeric. The characteristic of voltage
gating can be measured by a variety of techniques for measuring
changes in current flow and ion flux through a channel, e.g., by
changing the [K.sup.+] of the external solution and measuring the
activation potential of the channel current (see, e.g., U.S. Pat.
No. 5,670,335), by measuring current with patch clamp techniques or
voltage clamp under different conditions, and by measuring ion flux
with radio-labeled tracers or voltage-sensitive dyes under
different conditions.
[0058] "hHAC3" refers to a polypeptide that is an alpha subunit or
monomer of a hyperpolarization-activated cation channel, a member
of the HAC subfamily, and a member of the voltage-gated cation
channel super family. The term hHAC3 therefore refers to
conservatively modified variants, polymorphic variants, alleles,
mutants that: (1) form cation channels that are voltage-gated and
activated upon hyperpolarization; (2) specifically bind to
polyclonal antibodies raised against an immunogen comprising an
amino acid sequence selected from the group consisting of SEQ ID
NO:1 and conservatively modified variants or portions thereof,
including the N-terminal region (amino acids 1-50 of HAC3); (3)
have at least about 75% identity to the N-terminal region of hHAC3
(amino acids 1-50 of HAC3); or (4) are encoded by nucleic acids
that are amplified by primers that specifically hybridize under
stringent hybridization conditions to the same sequence as a primer
set consisting of SEQ ID NO:3 and SEQ ID NO:4 or SEQ ID NO:5 and
SEQ ID NO:6. Alternatively, hHAC3 can be identified as a cation
channel subunit polypeptide having 90% or more identity to the
region defined by amino acids 640-775 of SEQ ID NO:1.
[0059] The phrase "functional effects" in the context of assays for
testing compounds affecting a channel comprising hHAC3 includes the
determination of any parameter that is indirectly or directly under
the influence of the channel. It includes changes in ion flux and
membrane potential, and also includes other physiologic effects
such increases or decreases of transcription or hormone
release.
[0060] "Determining the functional effect" refers to examining the
effect of a compound that increases or decreases ion flux on a cell
or cell membrane in terms of cell and cell membrane function. The
ion flux can be any ion that passes through a channel and analogues
thereof, e.g., potassium, rubidium, sodium. Preferably, the term
refers to the functional effect of the compound on the channels
comprising hHAC3, e.g., changes in ion flux including
radioisotopes, changes in ion concentration (e.g., Ca.sup.2+,
K.sup.+, Na.sup.+) current amplitude, membrane potential, current
flow, transcription, protein binding, phosphorylation,
dephosphorylation, second messenger concentrations (cAMP, cGMP,
Ca.sup.2+, IP.sub.3), ligand binding, and other physiological
effects such as hormone and neurotransmitter release, as well as
changes in voltage and current. Such functional effects can be
measured by any means known to those skilled in the art, e.g.,
patch clamping, voltage-sensitive dyes, whole cell currents,
radioisotope efflux, inducible markers, and the like.
[0061] "Inhibitors," "activators" or "modulators" of
hyperpolarization-activated voltage-gated cation channels
comprising hHAC3 refer to inhibitory or activating molecules
identified using in vitro and in vivo assays for hHAC3 cation
channel function. Inhibitors are compounds that decrease, block,
prevent, delay activation, inactivate, desensitize, or down
regulate the channel. Activators are compounds that increase, open,
activate, facilitate, enhance activation, sensitize or up regulate
channel activity. Such assays for inhibitors and activators include
e.g., expressing hHAC3 in cells or cell membranes and then
measuring flux of ions through the channel and determining changes
in polarization (i.e., electrical potential). To examine the extent
of inhibition, samples or assays comprising a
hyperpolarization-activated cation channel (e.g., hHAC3) are
treated with a potential activator or inhibitor and are compared to
control samples without the inhibitor. Control samples (untreated
with inhibitors) are assigned a relative hHAC3 activity value of
100%. Inhibition of channels comprising hHAC3 is achieved when the
hHAC3 activity value relative to the control is about 90%,
preferably 50%, more preferably 25-0%. Activation of channels
comprising hHAC3 is achieved when the hHAC3 activity value relative
to the control is 110%, more preferably 150%, most preferably at
least 200-500% higher or 1000% or higher.
[0062] "Biologically active" hHAC3 refers to hHAC3 that comprises a
cation channel having the characteristic of activation upon
hyperpolarization tested as described above.
[0063] The terms "isolated," "purified," or "biologically pure"
refer to material that is substantially or essentially free from
components that normally accompany it as found in its native state.
Purity and homogeneity are typically determined using analytical
chemistry techniques such as polyacrylamide gel electrophoresis or
high performance liquid chromatography. A protein that is the
predominant species present in a preparation is substantially
purified. In particular, an isolated hHAC3 nucleic acid is
separated from open reading frames that flank the hHAC3 gene and
encode proteins other than hHAC3. The term "purified" denotes that
a nucleic acid or protein gives rise to essentially one band in an
electrophoretic gel. Particularly, it means that the nucleic acid
or protein is at least 85% pure, more preferably at least 95% pure,
and most preferably at least 99% pure.
[0064] "Nucleic acid" refers to deoxyribonucleotides or
ribonucleotides and polymers thereof in either single- or
double-stranded form. The term encompasses nucleic acids containing
known nucleotide analogs or modified backbone residues or linkages,
which are synthetic, naturally occurring, and non-naturally
occurring, which have similar binding properties as the reference
nucleic acid, and which are metabolized in a manner similar to the
reference nucleotides. Examples of such analogs include, without
limitation, phosphorothioates, phosphoramidates, methyl
phosphonates, chiral-methyl phosphonates, 2-O-methyl
ribonucleotides, peptide-nucleic acids (PNAs).
[0065] Unless otherwise indicated, a particular nucleic acid
sequence also implicitly encompasses conservatively modified
variants thereof (e.g., degenerate codon substitutions) and
complementary sequences, as well as the sequence explicitly
indicated. Specifically, degenerate codon substitutions may be
achieved by generating sequences in which the third position of one
or more selected (or all) codons is substituted with mixed-base
and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res.
19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608
(1985); Rossolini et al., Mol. Cell. Probes 8:91-98 (1994)). The
term nucleic acid is used interchangeably with gene, cDNA, mRNA,
oligonucleotide, and polynucleotide.
[0066] A particular nucleic acid sequence also implicitly
encompasses "splice variants". Similarly, a particular protein
encoded by a nucleic acid implicitly encompasses any protein
encoded by a splice variant of that nucleic acid. "Splice
variants," as the name suggests, are products of alternative
splicing of a gene. After transcription, an initial nucleic acid
transcript may be spliced such that different (alternate) nucleic
acid splice products encode different polypeptides. Mechanisms for
the production of splice variants vary, but include alternate
splicing of exons. Alternate polypeptides derived from the same
nucleic acid by read-through transcription are also encompassed by
this definition. Any products of a splicing reaction, including
recombinant forms of the splice products, are included in this
definition. An example of cation channel splice variants is
discussed in Leicher, et al., J Biol. Chem. 273(52):35095-35101
(1998).
[0067] The terms "polypeptide," "peptide" and "protein" are used
interchangeably herein to refer to a polymer of amino acid
residues. The terms apply to amino acid polymers in which one or
more amino acid residue is an artificial chemical mimetic of a
corresponding naturally occurring amino acid, as well as to
naturally occurring amino acid polymers and non-naturally occurring
amino acid polymer.
[0068] Macromolecular structures such as polypeptide structures can
be described in terms of various levels of organization. For a
general discussion of this organization, see, e.g., Alberts et al.,
Molecular Biology of the Cell (3.sup.rd ed., 1994) and Cantor and
Schimmel, Biophysical Chemistry Part I: The Conformation of
Biological Macromolecules (1980). "Primary structure" refers to the
amino acid sequence of a particular peptide. "Secondary structure"
refers to locally ordered, three dimensional structures within a
polypeptide. These structures are commonly known as domains.
Domains are portions of a polypeptide that form a compact unit of
the polypeptide and are typically 50 to 350 amino acids long.
Typical domains are made up of sections of lesser organization such
as stretches of .beta.-sheet and .alpha.-helices. "Tertiary
structure" refers to the complete three dimensional structure of a
polypeptide monomer. "Quaternary structure" refers to the three
dimensional structure formed by the noncovalent association of
independent tertiary units.
[0069] The term "amino acid" refers to naturally occurring and
synthetic amino acids, as well as amino acid analogs and amino acid
mimetics that function in a manner similar to the naturally
occurring amino acids. Naturally occurring amino acids are those
encoded by the genetic code, as well as those amino acids that are
later modified, e.g., hydroxyproline, .gamma.-carboxyglutamate, and
O-phosphoserine. Amino acid analogs refers to compounds that have
the same basic chemical structure as a naturally occurring amino
acid, i.e., an .alpha. carbon that is bound to a hydrogen, a
carboxyl group, an amino group, and an R group, e.g., homoserine,
norleucine, methionine sulfoxide, methionine methyl sulfonium. Such
analogs have modified R groups (e.g., norleucine) or modified
peptide backbones, but retain the same basic chemical structure as
a naturally occurring amino acid. Amino acid mimetics refers to
chemical compounds that have a structure that is different from the
general chemical structure of an amino acid, but that functions in
a manner similar to a naturally occurring amino acid.
[0070] Amino acids may be referred to herein by either their
commonly known three letter symbols or by the one-letter symbols
recommended by the IUPAC-IUB Biochemical Nomenclature Commission.
Nucleotides, likewise, may be referred to by their commonly
accepted single-letter codes.
[0071] "Conservatively modified variants" applies to both amino
acid and nucleic acid sequences. With respect to particular nucleic
acid sequences, conservatively modified variants refers to those
nucleic acids which encode identical or essentially identical amino
acid sequences, or where the nucleic acid does not encode an amino
acid sequence, to essentially identical sequences. Because of the
degeneracy of the genetic code, a large number of functionally
identical nucleic acids encode any given protein. For instance, the
codons GCA, GCC, GCG and GCU all encode the amino acid alanine.
Thus, at every position where an alanine is specified by a codon,
the codon can be altered to any of the corresponding codons
described without altering the encoded polypeptide. Such nucleic
acid variations are "silent variations," which are one species of
conservatively modified variations. Every nucleic acid sequence
herein which encodes a polypeptide also describes every possible
silent variation of the nucleic acid. One of skill will recognize
that each codon in a nucleic acid (except AUG, which is ordinarily
the only codon for methionine, and TGG, which is ordinarily the
only codon for tryptophan) can be modified to yield a functionally
identical molecule. Accordingly, each silent variation of a nucleic
acid which encodes a polypeptide is implicit in each described
sequence.
[0072] As to amino acid sequences, one of skill will recognize that
individual substitutions, deletions or additions to a nucleic acid,
peptide, polypeptide, or protein sequence which alters, adds or
deletes a single amino acid or a small percentage of amino acids in
the encoded sequence is a "conservatively modified variant" where
the alteration results in the substitution of an amino acid with a
chemically similar amino acid. Conservative substitution tables
providing functionally similar amino acids are well known in the
art. Such conservatively modified variants are in addition to and
do not exclude polymorphic variants, interspecies homologs, and
alleles of the invention.
[0073] The following eight groups each contain amino acids that are
conservative substitutions for one another: [0074] 1) Alanine (A),
Glycine (G); [0075] 2) Aspartic acid (D), Glutamic acid (E); [0076]
3) Asparagine (N), Glutamine (Q); [0077] 4) Arginine (R), Lysine
(K); [0078] 5) Isoleucine (I), Leucine (L), Methionine (M), Valine
(V); [0079] 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W);
[0080] 7) Serine (S), Threonine (T); and [0081] 8) Cysteine (C),
Methionine (M) [0082] (see, e.g., Creighton, Proteins (1984)).
[0083] A "label" is a composition detectable by spectroscopic,
photochemical, biochemical, immunochemical, or chemical means. For
example, useful labels include .sup.32P, fluorescent dyes,
electron-dense reagents, enzymes (e.g., as commonly used in an
ELISA), biotin, digoxigenin, or haptens and proteins for which
antisera or monoclonal antibodies are available (e.g., the
polypeptide of SEQ ID NO:1 can be made detectable, e.g., by
incorporating a radio-label into the peptide, and used to detect
antibodies specifically reactive with the peptide).
[0084] As used herein a "nucleic acid probe or oligonucleotide" is
defined as a nucleic acid capable of binding to a target nucleic
acid of complementary sequence through one or more types of
chemical bonds, usually through complementary base pairing, usually
through hydrogen bond formation. As used herein, a probe may
include natural (i.e., A, G, C, or T) or modified bases
(7-deazaguanosine, inosine, etc.). In addition, the bases in a
probe may be joined by a linkage other than a phosphodiester bond,
so long as it does not interfere with hybridization. Thus, for
example, probes may be peptide nucleic acids in which the
constituent bases are joined by peptide bonds rather than
phosphodiester linkages. It will be understood by one of skill in
the art that probes may bind target sequences lacking complete
complementarity with the probe sequence depending upon the
stringency of the hybridization conditions. The probes are
preferably directly labeled as with isotopes, chromophores,
lumiphores, chromogens, or indirectly labeled such as with biotin
to which a streptavidin complex may later bind. By assaying for the
presence or absence of the probe, one can detect the presence or
absence of the select sequence or subsequence.
[0085] A "labeled nucleic acid probe or oligonucleotide" is one
that is bound, either covalently, through a linker or a chemical
bond, or noncovalently, through ionic, van der Waals,
electrostatic, or hydrogen bonds to a label such that the presence
of the probe may be detected by detecting the presence of the label
bound to the probe.
[0086] The term "recombinant" when used with reference, e.g., to a
cell, or nucleic acid, protein, or vector, indicates that the cell,
nucleic acid, protein or vector, has been modified by the
introduction of a heterologous nucleic acid or protein or the
alteration of a native nucleic acid or protein, or that the cell is
derived from a cell so modified. Thus, for example, recombinant
cells express genes that are not found within the native
(non-recombinant) form of the cell or express native genes that are
otherwise abnormally expressed, under expressed or not expressed at
all.
[0087] A "promoter" is defined as an array of nucleic acid control
sequences that direct transcription of a nucleic acid. As used
herein, a promoter includes necessary nucleic acid sequences near
the start site of transcription, such as, in the case of a
polymerase II type promoter, a TATA element. A promoter also
optionally includes distal enhancer or repressor elements, which
can be located as much as several thousand base pairs from the
start site of transcription. A "constitutive" promoter is a
promoter that is active under most environmental and developmental
conditions. An "inducible" promoter is a promoter that is active
under environmental or developmental regulation. The term "operably
linked" refers to a functional linkage between a nucleic acid
expression control sequence (such as a promoter, or array of
transcription factor binding sites) and a second nucleic acid
sequence, wherein the expression control sequence directs
transcription of the nucleic acid corresponding to the second
sequence.
[0088] The term "heterologous" when used with reference to portions
of a nucleic acid indicates that the nucleic acid comprises two or
more subsequences that are not found in the same relationship to
each other in nature. For instance, the nucleic acid is typically
recombinantly produced, having two or more sequences from unrelated
genes arranged to make a new functional nucleic acid, e.g., a
promoter from one source and a coding region from another source.
Similarly, a heterologous protein indicates that the protein
comprises two or more subsequences that are not found in the same
relationship to each other in nature (e.g., a fusion protein).
[0089] An "expression vector" is a nucleic acid construct,
generated recombinantly or synthetically, with a series of
specified nucleic acid elements that permit transcription of a
particular nucleic acid in a host cell. The expression vector can
be part of a plasmid, virus, or nucleic acid fragment. Typically,
the expression vector includes a nucleic acid to be transcribed
operably linked to a promoter.
[0090] The terms "identical" or percent "identity," in the context
of two or more nucleic acids or polypeptide sequences, refer to two
or more sequences or subsequences that are the same or have a
specified percentage of amino acid residues or nucleotides that are
the same, when compared and aligned for maximum correspondence over
a comparison window, or designated conserved region such as the
N-terminal region, as measured using one of the following sequence
comparison algorithms with the default parameters described below
or by manual alignment and visual inspection. Such sequences are
then said to be "substantially identical." This definition also
refers to the compliment of a test sequence. Preferably, the
identity exists over a region that is at least about 25 amino acids
or nucleotides in length, or more preferably over a region that is
50-100 amino acids or nucleotides in length, more preferably over
the length of the reference amino acid sequence or nucleotide
sequence.
[0091] For sequence comparison, typically one sequence acts as a
reference sequence, to which test sequences are compared. When
using a sequence comparison algorithm, test and reference sequences
are entered into a computer, subsequence coordinates are
designated, if necessary, and sequence algorithm program parameters
are designated. Default program parameters can be used, or
alternative parameters can be designated. The sequence comparison
algorithm then calculates the percent sequence identities for the
test sequences relative to the reference sequence, based on the
program parameters. For sequence comparison of nucleic acids and
proteins to human HAC3 nucleic acids and proteins, the BLAST and
BLAST 2.0 algorithms and the default parameters discussed below are
used.
[0092] A "comparison window", as used herein, includes reference to
a segment of any one of the number of contiguous positions selected
from the group consisting of from 20 to 600, usually about 50 to
about 200, more usually about 100 to about 150 in which a sequence
may be compared to a reference sequence of the same number of
contiguous positions after the two sequences are optimally aligned.
Methods of alignment of sequences for comparison are well-known in
the art. Optimal alignment of sequences for comparison can be
conducted, e.g., by the local homology algorithm of Smith &
Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment
algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970),
by the search for similarity method of Pearson & Lipman, Proc.
Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized
implementations of these algorithms (GAP, BESTFIT, FASTA, and
TFASTA in the Wisconsin Genetics Software Package, Genetics
Computer Group, 575 Science Dr., Madison, Wis.), or by manual
alignment and visual inspection (see, e.g., Current Protocols in
Molecular Biology (Ausubel et al., eds. 1995 supplement)).
[0093] A preferred example of algorithm that is suitable for
determining percent sequence identity and sequence similarity are
the BLAST and BLAST 2.0 algorithms, which are described in Altschul
et al., Nuc. Acids Res. 25:3389-3402 (1977) and Altschul et al., J.
Mol. Biol. 215:403-410 (1990), respectively. BLAST and BLAST 2.0
are used, with the parameters described herein, to determine
percent sequence identity for the nucleic acids and proteins of the
invention. Software for performing BLAST analyses is publicly
available through the National Center for Biotechnology Information
(http://www.ncbi.nlm.nih.gov/). This algorithm involves first
identifying high scoring sequence pairs (HSPs) by identifying short
words of length W in the query sequence, which either match or
satisfy some positive-valued threshold score T when aligned with a
word of the same length in a database sequence. T is referred to as
the neighborhood word score threshold (Altschul et al., supra).
These initial neighborhood word hits act as seeds for initiating
searches to find longer HSPs containing them. The word hits are
extended in both directions along each sequence for as far as the
cumulative alignment score can be increased. Cumulative scores are
calculated using, for nucleotide sequences, the parameters M
(reward score for a pair of matching residues; always >0) and N
(penalty score for mismatching residues; always <0). For amino
acid sequences, a scoring matrix is used to calculate the
cumulative score. Extension of the word hits in each direction are
halted when: the cumulative alignment score falls off by the
quantity X from its maximum achieved value; the cumulative score
goes to zero or below, due to the accumulation of one or more
negative-scoring residue alignments; or the end of either sequence
is reached. The BLAST algorithm parameters W, T, and X determine
the sensitivity and speed of the alignment. The BLASTN program (for
nucleotide sequences) uses as defaults a wordlength (W) of 11, an
expectation (E) of 10, M=5, N=-4 and a comparison of both strands.
For amino acid sequences, the BLASTP program uses as defaults a
wordlength of 3, and expectation (E) of 10, and the BLOSUM62
scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci.
USA 89:10915 (1989)) alignments (B) of 50, expectation (E) of 10,
M=5, N=-4, and a comparison of both strands.
[0094] The BLAST algorithm also performs a statistical analysis of
the similarity between two sequences (see, e.g., Karlin &
Altschul, Proc. Nat'l. Acad. Sci. USA 90:5873-5787 (1993)). One
measure of similarity provided by the BLAST algorithm is the
smallest sum probability (P(N)), which provides an indication of
the probability by which a match between two nucleotide or amino
acid sequences would occur by chance. For example, a nucleic acid
is considered similar to a reference sequence if the smallest sum
probability in a comparison of the test nucleic acid to the
reference nucleic acid is less than about 0.2, more preferably less
than about 0.01, and most preferably less than about 0.001.
[0095] An indication that two nucleic acid sequences or
polypeptides are substantially identical is that the polypeptide
encoded by the first nucleic acid is immunologically cross reactive
with the antibodies raised against the polypeptide encoded by the
second nucleic acid, as described below. Thus, a polypeptide is
typically substantially identical to a second polypeptide, for
example, where the two peptides differ only by conservative
substitutions. Another indication that two nucleic acid sequences
are substantially identical is that the two molecules or their
complements hybridize to each other under stringent conditions, as
described below. Yet another indication that two nucleic acid
sequences are substantially identical is that the same primers can
be used to amplify the sequence.
[0096] The phrase "selectively (or specifically) hybridizes to"
refers to the binding, duplexing, or hybridizing of a molecule only
to a particular nucleotide sequence under stringent hybridization
conditions when that sequence is present in a complex mixture
(e.g., total cellular or library DNA or RNA).
[0097] The phrase "stringent hybridization conditions" refers to
conditions under which a probe will hybridize to its target
subsequence, typically in a complex mixture of nucleic acid, but to
no other sequences. Stringent conditions are sequence-dependent and
will be different in different circumstances. Longer sequences
hybridize specifically at higher temperatures. An extensive guide
to the hybridization of nucleic acids is found in Tijssen,
Techniques in Biochemistry and Molecular Biology--Hybridization
with Nucleic Probes, "Overview of principles of hybridization and
the strategy of nucleic acid assays" (1993). Generally, stringent
conditions are selected to be about 5-10.degree. C. lower than the
thermal melting point (T.sub.m) for the specific sequence at a
defined ionic strength pH. The T.sub.m is the temperature (under
defined ionic strength, pH, and nucleic concentration) at which 50%
of the probes complementary to the target hybridize to the target
sequence at equilibrium (as the target sequences are present in
excess, at T.sub.m, 50% of the probes are occupied at equilibrium).
Stringent conditions will be those in which the salt concentration
is less than about 1.0 M sodium ion, typically about 0.01 to 1.0 M
sodium ion concentration (or other salts) at pH 7.0 to 8.3 and the
temperature is at least about 30.degree. C. for short probes (e.g.,
10 to 50 nucleotides) and at least about 60.degree. C. for long
probes (e.g., greater than 50 nucleotides). Stringent conditions
may also be achieved with the addition of destabilizing agents such
as formamide. For high stringency hybridization, a positive signal
is at least two times background, preferably 10 times background
hybridization. Exemplary high stringency hybridization conditions
include: 50% formamide, 5.times.SSC and 1% SDS incubated at
42.degree. C. or 5.times.SSC and 1% SDS incubated at 65.degree. C.,
with a wash in 0.2.times.SSC and 0.1% SDS at 65.degree. C.
[0098] Nucleic acids that do not hybridize to each other under
stringent conditions are still substantially identical if the
polypeptides that they encode are substantially identical. This
occurs, for example, when a copy of a nucleic acid is created using
the maximum codon degeneracy permitted by the genetic code. In such
cases, the nucleic acids typically hybridize under moderately
stringent hybridization conditions. Exemplary "moderately stringent
hybridization conditions" include a hybridization in a buffer of
40% formamide, 1 M NaCl, 1% SDS at 37.degree. C., and a wash in
1.times.SSC at 45.degree. C. A positive hybridization is at least
twice background. Those of ordinary skill will readily recognize
that alternative hybridization and wash conditions can be utilized
to provide conditions of similar stringency.
[0099] "Antibody" refers to a polypeptide comprising a framework
region from an immunoglobulin gene or fragments thereof that
specifically binds and recognizes an antigen. The recognized
immunoglobulin genes include the kappa, lambda, alpha, gamma,
delta, epsilon, and mu constant region genes, as well as the myriad
immunoglobulin variable region genes. Light chains are classified
as either kappa or lambda. Heavy chains are classified as gamma,
mu, alpha, delta, or epsilon, which in turn define the
immunoglobulin classes, IgG, IgM, IgA, IgD and IgE,
respectively.
[0100] An exemplary immunoglobulin (antibody) structural unit
comprises a tetramer. Each tetramer is composed of two identical
pairs of polypeptide chains, each pair having one "light" (about 25
kDa) and one "heavy" chain (about 50-70 kDa). The N-terminus of
each chain defines a variable region of about 100 to 110 or more
amino acids primarily responsible for antigen recognition. The
terms variable light chain (V.sub.L) and variable heavy chain
(V.sub.H) refer to these light and heavy chains respectively.
[0101] Antibodies exist, e.g., as intact immunoglobulins or as a
number of well-characterized fragments produced by digestion with
various peptidases. Thus, for example, pepsin digests an antibody
below the disulfide linkages in the hinge region to produce
F(ab)'.sub.2, a dimer of Fab which itself is a light chain joined
to V.sub.H--C.sub.H1 by a disulfide bond. The F(ab)'.sub.2 may be
reduced under mild conditions to break the disulfide linkage in the
hinge region, thereby converting the F(ab)'.sub.2 dimer into an
Fab' monomer. The Fab' monomer is essentially Fab with part of the
hinge region (see Fundamental Immunology (Paul ed., 3d ed. 1993).
While various antibody fragments are defined in terms of the
digestion of an intact antibody, one of skill will appreciate that
such fragments may be synthesized de novo either chemically or by
using recombinant DNA methodology. Thus, the term antibody, as used
herein, also includes antibody fragments either produced by the
modification of whole antibodies, or those synthesized de novo
using recombinant DNA methodologies (e.g., single chain Fv) or
those identified using phage display libraries (see, e.g.,
McCafferty et al., Nature 348:552-554 (1990)).
[0102] For preparation of monoclonal or polyclonal antibodies, any
technique known in the art can be used (see, e.g., Kohler &
Milstein, Nature 256:495-497 (1975); Kozbor et al., Immunology
Today 4: 72 (1983); Cole et al., pp. 77-96 in Monoclonal Antibodies
and Cancer Therapy (1985)). Techniques for the production of single
chain antibodies (U.S. Pat. No. 4,946,778) can be adapted to
produce antibodies to polypeptides of this invention. Also,
transgenic mice, or other organisms such as other mammals, may be
used to express humanized antibodies. Alternatively, phage display
technology can be used to identify antibodies and heteromeric Fab
fragments that specifically bind to selected antigens (see, e.g.,
McCafferty et al., Nature 348:552-554 (1990); Marks et al.,
Biotechnology 10:779-783 (1992)).
[0103] An "anti-hHAC3" antibody is an antibody or antibody fragment
that specifically binds a polypeptide encoded by the hHAC3 gene,
cDNA, or a subsequence thereof.
[0104] A "chimeric antibody" is an antibody molecule in which (a)
the constant region, or a portion thereof, is altered, replaced or
exchanged so that the antigen binding site (variable region) is
linked to a constant region of a different or altered class,
effector function and/or species, or an entirely different molecule
which confers new properties to the chimeric antibody, e.g., an
enzyme, toxin, hormone, growth factor, drug, etc.; or (b) the
variable region, or a portion thereof, is altered, replaced or
exchanged with a variable region having a different or altered
antigen specificity.
[0105] The term "immunoassay" is an assay that uses an antibody to
specifically bind an antigen. The immunoassay is characterized by
the use of specific binding properties of a particular antibody to
isolate, target, and/or quantify the antigen.
[0106] The phrase "specifically (or selectively) binds" to an
antibody or "specifically (or selectively) immunoreactive with,"
when referring to a protein or peptide, refers to a binding
reaction that is determinative of the presence of the protein in a
heterogeneous population of proteins and other biologics. Thus,
under designated immunoassay conditions, the specified antibodies
bind to a particular protein at least two times the background and
do not substantially bind in a significant amount to other proteins
present in the sample. Specific binding to an antibody under such
conditions may require an antibody that is selected for its
specificity for a particular protein. For example, polyclonal
antibodies raised to hHAC3, encoded in SEQ ID NO:1, splice
variants, or portions thereof, can be selected to obtain only those
polyclonal antibodies that are specifically immunoreactive with
hHAC3 and not with other proteins, except for polymorphic variants
and alleles of hHAC3. This selection may be achieved by subtracting
out antibodies that cross-react with molecules such as mouse HAC3
and other HAC3 orthologs. Other human members of the HAC family,
such as human HAC1 and 2 can also be used to select for antibodies
that recognize only human HAC3. A variety of immunoassay formats
may be used to select antibodies specifically immunoreactive with a
particular protein. For example, solid-phase ELISA immunoassays are
routinely used to select antibodies specifically immunoreactive
with a protein (see, e.g., Harlow & Lane, Antibodies, A
Laboratory Manual (1988) for a description of immunoassay formats
and conditions that can be used to determine specific
immunoreactivity). Typically a specific or selective reaction will
be at least twice background signal or noise and more typically
more than 10 to 100 times background.
[0107] The phrase "selectively associates with" refers to the
ability of a nucleic acid to "selectively hybridize" with another
as defined above, or the ability of an antibody to "selectively (or
specifically) bind to a protein, as defined above.
[0108] By "host cell" is meant a cell that contains an expression
vector and supports the replication or expression of the expression
vector. Host cells may be prokaryotic cells such as E. coli, or
eukaryotic cells such as yeast (e.g., Pichia), insect, amphibian,
or mammalian cells such as CHO, HeLa and the like, e.g., cultured
cells, explants, and cells in vivo.
[0109] "Biological sample" as used herein is a sample of biological
tissue or fluid that contains hHAC3 or nucleic acid encoding hHAC3
protein. Such samples include, but are not limited to, tissue
isolated from humans. Biological samples may also include sections
of tissues such as frozen sections taken for histological purposes.
A biological sample is typically obtained from a eukaryotic
organism, preferably eukaryotes such as fungi, plants, insects,
protozoa, birds, fish, reptiles, and preferably a mammal such as
rat, mice, cow, dog, guinea pig, or rabbit, and most preferably a
primate such as chimpanzees or humans.
III. Isolating the Gene Encoding hHAC3
[0110] A. General Recombinant DNA Methods
[0111] This invention relies on routine techniques in the field of
recombinant genetics. Basic texts disclosing the general methods of
use in this invention include Sambrook et al., Molecular Cloning, A
Laboratory Manual (2nd ed. 1989); Kriegler, Gene Transfer and
Expression: A Laboratory Manual (1990); and Current Protocols in
Molecular Biology (Ausubel et al., eds., 1994)).
[0112] For nucleic acids, sizes are given in either kilobases (kb)
or base pairs (bp). These are estimates derived from agarose or
acrylamide gel electrophoresis, from sequenced nucleic acids, or
from published DNA sequences. For proteins, sizes are given in
kilodaltons (kDa) or amino acid residue numbers. Proteins sizes are
estimated from gel electrophoresis, from sequenced proteins, from
derived amino acid sequences, or from published protein
sequences.
[0113] Oligonucleotides that are not commercially available can be
chemically synthesized according to the solid phase phosphoramidite
triester method first described by Beaucage & Caruthers,
Tetrahedron Letts. 22:1859-1862 (1981), using an automated
synthesizer, as described in Van Devanter et. al., Nucleic Acids
Res. 12:6159-6168 (1984). Purification of oligonucleotides is by
either native acrylamide gel electrophoresis or by anion-exchange
HPLC as described in Pearson & Reanier, J. Chrom. 255:137-149
(1983).
[0114] The sequence of the cloned genes and synthetic
oligonucleotides can be verified after cloning using, e.g., the
chain termination method for sequencing double-stranded templates
of Wallace et al., Gene 16:21-26 (1981). [0115] B. Cloning Methods
for the Isolation of Nucleotide Sequences Encoding hHAC3
[0116] In general, the nucleic acid sequences encoding hHAC3 and
related nucleic acid sequence homologs are cloned from cDNA and
genomic DNA libraries or isolated using amplification techniques
with oligonucleotide primers. For example, hHAC3 sequences are
typically isolated from human nucleic acid (genomic or cDNA)
libraries by hybridizing with a nucleic acid probe or
polynucleotide, the sequence of which can be derived from SEQ ID
NO:2.
[0117] A suitable tissue from which hHAC3 RNA and cDNA can be
isolated is the putamen, thalamus, caudate nucleus, medulla,
occipital lobe, substantia nigra, spinal cord, and fetal brain. See
Example 1 for a complete list of the tissues in which hHAC3 is
expressed.
[0118] Amplification techniques using primers can also be used to
amplify and isolate hHAC3 from DNA or RNA. The following primers
can also be used to amplify a sequence of hHAC3: TABLE-US-00001
CAGCCATGGAGGCAGAGCAGCGGC, (SEQ ID NO:3)
GGAGGAGATCTTTCACATGACATACGAC, (SEQ ID NO:4)
AGTAGGATCCATCGGTGAGGCGTG, (SEQ ID NO:5)
TTACATGTTGGCAGAAAGCTGGAGACC. (SEQ ID NO:6)
[0119] These primers can be used, e.g., to amplify either the full
length sequence or a probe of one to several hundred nucleotides,
which is then used to screen a human library for full-length
hHAC3.
[0120] Nucleic acids encoding hHAC3 can also be isolated from
expression libraries using antibodies as probes. Such polyclonal or
monoclonal antibodies can be raised using the sequence of SEQ ID
NO:1.
[0121] Human HAC3 polymorphic variants and alleles that are
substantially identical SEQ ID NO:2 can be isolated using hHAC3
nucleic acid probes and oligonucleotides under stringent
hybridization conditions, by screening libraries. Alternatively,
expression libraries can be used to clone hHAC3 and hHAC3
polymorphic variants and alleles by detecting expressed homologs
immunologically with antisera or purified antibodies made against
hHAC3 or portions thereof (e.g., the N-terminal region, amino acids
1-50 of HAC3), which also recognize and selectively bind to the
hHAC3 homolog.
[0122] To make a cDNA library, one should choose a source that is
rich in hHAC3 mRNA, e.g., tissue such as the thalamus, medulla or
fetal brain. The mRNA is then made into cDNA using reverse
transcriptase, ligated into a recombinant vector, and transfected
into a recombinant host for propagation, screening and cloning.
Methods for making and screening cDNA libraries are well known
(see, e.g., Gubler & Hoffman, Gene 25:263-269 (1983); Sambrook
et al., supra; Ausubel et al., supra).
[0123] For a genomic library, the DNA is extracted from the tissue
and either mechanically sheared or enzymatically digested to yield
fragments of about 12-20 kb. The fragments are then separated by
gradient centrifugation from undesired sizes and are constructed in
bacteriophage lambda vectors. These vectors and phage are packaged
in vitro. Recombinant phage are analyzed by plaque hybridization as
described in Benton & Davis, Science 196:180-182 (1977). Colony
hybridization is carried out as generally described in Grunstein et
al., Proc. Natl. Acad. Sci. USA., 72:3961-3965 (1975).
[0124] An alternative method of isolating hHAC3 nucleic acid and
its homologs combines the use of synthetic oligonucleotide primers
and amplification of an RNA or DNA template (see U.S. Pat. Nos.
4,683,195 and 4,683,202; PCR Protocols: A Guide to Methods and
Applications (Innis et al., eds, 1990)). Methods such as polymerase
chain reaction (PCR) and ligase chain reaction (LCR) can be used to
amplify nucleic acid sequences of hHAC3 directly from mRNA, from
cDNA, from genomic libraries or cDNA libraries. Degenerate
oligonucleotides can be designed to amplify hHAC3 homologs using
the sequences provided herein. Restriction endonuclease sites can
be incorporated into the primers. Polymerase chain reaction or
other in vitro amplification methods may also be useful, for
example, to clone nucleic acid sequences that code for proteins to
be expressed, to make nucleic acids to use as probes for detecting
the presence of hHAC3 encoding mRNA in physiological samples, for
nucleic acid sequencing, or for other purposes. Genes amplified by
the PCR reaction can be purified from agarose gels and cloned into
an appropriate vector.
[0125] Gene expression of hHAC3 can also be analyzed by techniques
known in the art, e.g., reverse transcription and amplification of
mRNA, isolation of total RNA or poly A.sup.+ RNA, northern
blotting, dot blotting, in situ hybridization, RNase protection,
high density polynucleotide array technology and the like.
[0126] Synthetic oligonucleotides can be used to construct
recombinant hHAC3 genes for use as probes or for expression of
protein. This method is performed using a series of overlapping
oligonucleotides usually 40-120 bp in length, representing both the
sense and nonsense strands of the gene. These DNA fragments are
then annealed, ligated and cloned. Alternatively, amplification
techniques can be used with precise primers to amplify a specific
subsequence of the hHAC3 gene. The specific subsequence is then
ligated into an expression vector.
[0127] The gene for hHAC3 is typically cloned into intermediate
vectors before transformation into prokaryotic or eukaryotic cells
for replication and/or expression. These intermediate vectors are
typically prokaryote vectors, e.g., plasmids, or shuttle vectors.
[0128] C. Expression in Prokaryotes and Eukaryotes
[0129] To obtain high level expression of a cloned gene, such as
those cDNAs encoding hHAC3, one typically subclones hHAC3 into an
expression vector that contains a strong promoter to direct
transcription, a transcription/translation terminator, and if for a
nucleic acid encoding a protein, a ribosome binding site for
translational initiation. Suitable bacterial promoters are well
known in the art and described, e.g., in Sambrook et al. and
Ausubel et al. Bacterial expression systems for expressing the
hHAC3 protein are available in, e.g., E. coli, Bacillus sp., and
Salmonella (Palva et al., Gene 22:229-235 (1983); Mosbach et al.,
Nature 302:543-545 (1983). Kits for such expression systems are
commercially available. Eukaryotic expression systems for mammalian
cells, yeast, and insect cells are well known in the art and are
also commercially available.
[0130] Selection of the promoter used to direct expression of a
heterologous nucleic acid depends on the particular application.
The promoter is preferably positioned about the same distance from
the heterologous transcription start site as it is from the
transcription start site in its natural setting. As is known in the
art, however, some variation in this distance can be accommodated
without loss of promoter function.
[0131] In addition to the promoter, the expression vector typically
contains a transcription unit or expression cassette that contains
all the additional elements required for the expression of the
hHAC3 encoding nucleic acid in host cells. A typical expression
cassette thus contains a promoter operably linked to the nucleic
acid sequence encoding hHAC3 and signals required for efficient
polyadenylation of the transcript, ribosome binding sites, and
translation termination. Additional elements of the cassette may
include enhancers and, if genomic DNA is used as the structural
gene, introns with functional splice donor and acceptor sites.
[0132] In addition to a promoter sequence, the expression cassette
should also contain a transcription termination region downstream
of the structural gene to provide for efficient termination. The
termination region may be obtained from the same gene as the
promoter sequence or may be obtained from different genes.
[0133] The particular expression vector used to transport the
genetic information into the cell is not particularly critical. Any
of the conventional vectors used for expression in eukaryotic or
prokaryotic cells may be used. Standard bacterial expression
vectors include plasmids such as pBR322 based plasmids, pSKF,
pET23D, and fusion expression systems such as GST and LacZ. Epitope
tags can also be added to recombinant proteins to provide
convenient methods of isolation, e.g., c-myc.
[0134] Expression vectors containing regulatory elements from
eukaryotic viruses are typically used in eukaryotic expression
vectors, e.g., SV40 vectors, papilloma virus vectors, and vectors
derived from Epstein-Barr virus. Other exemplary eukaryotic vectors
include pMSG, pAV009/A.sup.+, pMTO10/A.sup.+, pMAMneo-5,
baculovirus pDSVE, and any other vector allowing expression of
proteins under the direction of the CMV promoter, SV40 early
promoter, SV40 later promoter, metallothionein promoter, murine
mammary tumor virus promoter, Rous sarcoma virus promoter,
polyhedrin promoter, or other promoters shown effective for
expression in eukaryotic cells.
[0135] Expression of proteins from eukaryotic vectors can be also
be regulated using inducible promoters. With inducible promoters,
expression levels are tied to the concentration of inducing agents,
such as tetracycline or ecdysone, by the incorporation of response
elements for these agents into the promoter. Generally, high level
expression is obtained from inducible promoters only in the
presence of the inducing agent; basal expression levels are
minimal. Inducible expression vectors are often chosen if
expression of the protein of interest is detrimental to eukaryotic
cells.
[0136] Some expression systems have markers that provide gene
amplification such as thymidine kinase and dihydrofolate reductase.
Alternatively, high yield expression systems not involving gene
amplification are also suitable, such as using a baculovirus vector
in insect cells, with a hHAC3 encoding sequence under the direction
of the polyhedrin promoter or other strong baculovirus
promoters.
[0137] The elements that are typically included in expression
vectors also include a replicon that functions in E. coli, a gene
encoding antibiotic resistance to permit selection of bacteria that
harbor recombinant plasmids, and unique restriction sites in
nonessential regions of the plasmid to allow insertion of
eukaryotic sequences. The particular antibiotic resistance gene
chosen is not critical, any of the many resistance genes known in
the art are suitable. The prokaryotic sequences are preferably
chosen such that they do not interfere with the replication of the
DNA in eukaryotic cells, if necessary.
[0138] Standard transfection methods are used to produce bacterial,
mammalian, yeast or insect cell lines that express large quantities
of hHAC3 protein, which are then purified using standard techniques
(see, e.g., Colley et al., J. Biol. Chem. 264:17619-17622 (1989);
Guide to Protein Purification, in Methods in Enzymology, vol. 182
(Deutscher, ed., 1990)). Transformation of eukaryotic and
prokaryotic cells are performed according to standard techniques
(see, e.g., Morrison, J. Bact. 132:349-351 (1977); Clark-Curtiss
& Curtiss, Methods in Enzymology 101:347-362 (Wu et al., eds,
1983).
[0139] Any of the well-known procedures for introducing foreign
nucleotide sequences into host cells may be used. These include the
use of calcium phosphate transfection, polybrene, protoplast
fusion, electroporation, liposomes, microinjection, plasma vectors,
viral vectors and any of the other well known methods for
introducing cloned genomic DNA, cDNA, synthetic DNA or other
foreign genetic material into a host cell (see, e.g., Sambrook et
al., supra). It is only necessary that the particular genetic
engineering procedure used be capable of successfully introducing
at least one gene into the host cell capable of expressing
hHAC3.
[0140] After the expression vector is introduced into the cells,
the transfected cells are cultured under conditions favoring
expression of hHAC3, which is recovered from the culture using
standard techniques identified below.
IV. Purification of hHAC3 Polypeptides
[0141] Either naturally occurring or recombinant hHAC3 can be
purified for use in functional assays. Naturally occurring hHAC3
monomers can be purified, e.g., from mouse or human tissue such as
thalamus, medulla or fetal brain tissue and any other source of a
hHAC3 homolog. Recombinant hHAC3 monomers can be purified from any
suitable expression system.
[0142] The hHAC3 monomers may be purified to substantial purity by
standard techniques, including selective precipitation with such
substances as ammonium sulfate; column chromatography,
immunopurification methods, and others (see, e.g., Scopes, Protein
Purification: Principles and Practice (1982); U.S. Pat. No.
4,673,641; Ausubel et al., supra; and Sambrook et al., supra).
[0143] A number of procedures can be employed when recombinant
hHAC3 monomers are being purified. For example, proteins having
established molecular adhesion properties can be reversible fused
to the hHAC3 monomers. With the appropriate ligand, the hHAC3
monomers can be selectively adsorbed to a purification column and
then freed from the column in a relatively pure form. The fused
protein is then removed by enzymatic activity. Finally the hHAC3
monomers could be purified using immunoaffinity columns. [0144] A.
Purification of hHAC3 Monomers from Recombinant Bacteria
[0145] Recombinant proteins are expressed by transformed bacteria
in large amounts, typically after promoter induction; but
expression can be constitutive. Promoter induction with IPTG is a
one example of an inducible promoter system. Bacteria are grown
according to standard procedures in the art. Fresh or frozen
bacteria cells are used for isolation of protein.
[0146] Proteins expressed in bacteria may form insoluble aggregates
("inclusion bodies"). Several protocols are suitable for
purification of the hHAC3 monomers inclusion bodies. For example,
purification of inclusion bodies typically involves the extraction,
separation and/or purification of inclusion bodies by disruption of
bacterial cells, e.g., by incubation in a buffer of 50 mM TRIS/HCL
pH 7.5, 50 mM NaCl, 5 mM MgCl.sub.2, 1 mM DTT, 0.1 mM ATP, and 1 mM
PMSF. The cell suspension can be lysed using 2-3 passages through a
French Press, homogenized using a Polytron (Brinkman Instruments)
or sonicated on ice. Alternate methods of lysing bacteria are
apparent to those of skill in the art (see, e.g., Sambrook et al.,
supra; Ausubel et al., supra).
[0147] If necessary, the inclusion bodies are solubilized, and the
lysed cell suspension is typically centrifuged to remove unwanted
insoluble matter. Proteins that formed the inclusion bodies may be
renatured by dilution or dialysis with a compatible buffer.
Suitable solvents include, but are not limited to urea (from about
4 M to about 8 M), formamide (at least about 80%, volume/volume
basis), and guanidine hydrochloride (from about 4 M to about 8 M).
Some solvents which are capable of solubilizing aggregate-forming
proteins, for example SDS (sodium dodecyl sulfate), 70% formic
acid, are inappropriate for use in this procedure due to the
possibility of irreversible denaturation of the proteins,
accompanied by a lack of immunogenicity and/or activity. Although
guanidine hydrochloride and similar agents are denaturants, this
denaturation is not irreversible and renaturation may occur upon
removal (by dialysis, for example) or dilution of the denaturant,
allowing re-formation of immunologically and/or biologically active
protein. Other suitable buffers are known to those skilled in the
art. Human HAC3 monomers are separated from other bacterial
proteins by standard separation techniques, e.g., with Ni-NTA
agarose resin.
[0148] Alternatively, it is possible to purify the hHAC3 monomers
from bacteria periplasm. After lysis of the bacteria, when the
hHAC3 monomers are exported into the periplasm of the bacteria, the
periplasmic fraction of the bacteria can be isolated by cold
osmotic shock in addition to other methods known to skill in the
art. To isolate recombinant proteins from the periplasm, the
bacterial cells are centrifuged to form a pellet. The pellet is
resuspended in a buffer containing 20% sucrose. To lyse the cells,
the bacteria are centrifuged and the pellet is resuspended in
ice-cold 5 mM MgSO.sub.4 and kept in an ice bath for approximately
10 minutes. The cell suspension is centrifuged and the supernatant
decanted and saved. The recombinant proteins present in the
supernatant can be separated from the host proteins by standard
separation techniques well known to those of skill in the art.
[0149] B. Standard Protein Separation Techniques for Purifying the
hHAC3 Monomers
[0150] Solubility Fractionation
[0151] Often as an initial step, particularly if the protein
mixture is complex, an initial salt fractionation can separate many
of the unwanted host cell proteins (or proteins derived from the
cell culture media) from the recombinant protein of interest. The
preferred salt is ammonium sulfate. Ammonium sulfate precipitates
proteins by effectively reducing the amount of water in the protein
mixture. Proteins then precipitate on the basis of their
solubility. The more hydrophobic a protein is, the more likely it
is to precipitate at lower ammonium sulfate concentrations. A
typical protocol includes adding saturated ammonium sulfate to a
protein solution so that the resultant ammonium sulfate
concentration is between 20-30%. This concentration will
precipitate the most hydrophobic of proteins. The precipitate is
then discarded (unless the protein of interest is hydrophobic) and
ammonium sulfate is added to the supernatant to a concentration
known to precipitate the protein of interest. The precipitate is
then solubilized in buffer and the excess salt removed if
necessary, either through dialysis or diafiltration. Other methods
that rely on solubility of proteins, such as cold ethanol
precipitation, are well known to those of skill in the art and can
be used to fractionate complex protein mixtures.
[0152] Size Differential Filtration
[0153] The molecular weight of the hHAC3 monomers can be used to
isolated it from proteins of greater and lesser size using
ultrafiltration through membranes of different pore size (for
example, Amicon or Millipore membranes). As a first step, the
protein mixture is ultrafiltered through a membrane with a pore
size that has a lower molecular weight cut-off than the molecular
weight of the protein of interest. The retentate of the
ultrafiltration is then ultrafiltered against a membrane with a
molecular cut off greater than the molecular weight of the protein
of interest. The recombinant protein will pass through the membrane
into the filtrate. The filtrate can then be chromatographed as
described below.
[0154] Column Chromatography
[0155] The hHAC3 monomers can also be separated from other proteins
on the basis of its size, net surface charge, hydrophobicity, and
affinity for ligands. In addition, antibodies raised against
proteins can be conjugated to column matrices and the proteins
immunopurified. All of these methods are well known in the art. It
will be apparent to one of skill that chromatographic techniques
can be performed at any scale and using equipment from many
different manufacturers (e.g., Pharmacia Biotech).
V. Immunological Detection of hHAC3
[0156] In addition to the detection of hHAC3 genes and gene
expression using nucleic acid hybridization technology, one can
also use immunoassays to detect the hHAC3 monomers. Immunoassays
can be used to qualitatively or quantitatively analyze the hHAC3
monomers. A general overview of the applicable technology can be
found in Harlow & Lane, Antibodies: A Laboratory Manual (1988).
[0157] A. Antibodies to hHAC3 Monomers
[0158] Methods of producing polyclonal and monoclonal antibodies
that react specifically with the hHAC3 monomers are known to those
of skill in the art (see, e.g., Coligan, Current Protocols in
Immunology (1991); Harlow & Lane, supra; Goding, Monoclonal
Antibodies: Principles and Practice (2d ed. 1986); and Kohler &
Milstein, Nature 256:495-497 (1975). Such techniques include
antibody preparation by selection of antibodies from libraries of
recombinant antibodies in phage or similar vectors, as well as
preparation of polyclonal and monoclonal antibodies by immunizing
rabbits or mice (see, e.g., Huse et al., Science 246:1275-1281
(1989); Ward et al., Nature 341:544-546 (1989)).
[0159] A number of immunogens comprising portions of hHAC3 monomers
may be used to produce antibodies specifically reactive with hHAC3
monomers. For example, recombinant hHAC3 monomers or an antigenic
fragment thereof such as amino acids 1-50 or amino acids 640-775 of
SEQ ID NO:1, can be isolated as described herein. Recombinant
protein can be expressed in eukaryotic or prokaryotic cells as
described above, and purified as generally described above.
Recombinant protein is the preferred immunogen for the production
of monoclonal or polyclonal antibodies. Alternatively, a synthetic
peptide derived from the sequences disclosed herein and conjugated
to a carrier protein can be used an immunogen. Naturally occurring
protein may also be used either in pure or impure form. The product
is then injected into an animal capable of producing antibodies.
Either monoclonal or polyclonal antibodies may be generated, for
subsequent use in immunoassays to measure the protein.
[0160] Methods of production of polyclonal antibodies are known to
those of skill in the art. An inbred strain of mice (e.g., BALB/C
mice) or rabbits is immunized with the protein using a standard
adjuvant, such as Freund's adjuvant, and a standard immunization
protocol. The animal's immune response to the immunogen preparation
is monitored by taking test bleeds and determining the titer of
reactivity to the beta subunits. When appropriately high titers of
antibody to the immunogen are obtained, blood is collected from the
animal and antisera are prepared. Further fractionation of the
antisera to enrich for antibodies reactive to the protein can be
done if desired (see Harlow & Lane, supra).
[0161] Monoclonal antibodies may be obtained by various techniques
familiar to those skilled in the art. Briefly, spleen cells from an
animal immunized with a desired antigen are immortalized, commonly
by fusion with a myeloma cell (see Kohler & Milstein, Eur. J.
Immunol. 6:511-519 (1976)). Alternative methods of immortalization
include transformation with Epstein Barr Virus, oncogenes, or
retroviruses, or other methods well known in the art. Colonies
arising from single immortalized cells are screened for production
of antibodies of the desired specificity and affinity for the
antigen, and yield of the monoclonal antibodies produced by such
cells may be enhanced by various techniques, including injection
into the peritoneal cavity of a vertebrate host. Alternatively, one
may isolate DNA sequences which encode a monoclonal antibody or a
binding fragment thereof by screening a DNA library from human B
cells according to the general protocol outlined by Huse et al.,
Science 246:1275-1281 (1989).
[0162] Monoclonal antibodies and polyclonal sera are collected and
titered against the immunogen protein in an immunoassay, for
example, a solid phase immunoassay with the immunogen immobilized
on a solid support. Typically, polyclonal antisera with a titer of
10.sup.4 or greater are selected and tested for their cross
reactivity against non-hHAC3 proteins or even other related
proteins from other organisms (e.g., other HAC family members),
using a competitive binding immunoassay. Specific polyclonal
antisera and monoclonal antibodies will usually bind with a K.sub.D
of at least about 0.1 mM, more usually at least about 1 .mu.M,
preferably at least about 0.1 .mu.M or better, and most preferably,
0.01 .mu.M or better.
[0163] Once the specific antibodies against a hHAC3 are available,
the hHAC3 can be detected by a variety of immunoassay methods. For
a review of immunological and immunoassay procedures, see Basic and
Clinical Immunology (Stites & Terr eds., 7.sup.th ed. 1991).
Moreover, the immunoassays of the present invention can be
performed in any of several configurations, which are reviewed
extensively in Enzyme Immunoassay (Maggio, ed., 1980); and Harlow
& Lane, supra. [0164] B. Immunological Binding Assays
[0165] The hHAC3 can be detected and/or quantified using any of a
number of well recognized immunological binding assays (see, e.g.,
U.S. Pat. Nos. 4,366,241; 4,376,110; 4,517,288; and 4,837,168). For
a review of the general immunoassays, see also Methods in Cell
Biology: Antibodies in Cell Biology, volume 37 (Asai, ed. 1993);
Basic and Clinical Immunology (Stites & Terr, eds., 7.sup.th
ed. 1991). Immunological binding assays (or immunoassays) typically
use an antibody that specifically binds to a protein or antigen of
choice (in this case the hHAC3 or an antigenic subsequence
thereof). The antibody (e.g., anti-hHAC3) may be produced by any of
a number of means well known to those of skill in the art and as
described above.
[0166] Immunoassays also often use a labeling agent to specifically
bind to and label the complex formed by the antibody and antigen.
The labeling agent may itself be one of the moieties comprising the
antibody/antigen complex. Thus, the labeling agent may be a labeled
hHAC3 polypeptide or a labeled anti-hHAC3 antibody. Alternatively,
the labeling agent may be a third moiety, such a secondary
antibody, which specifically binds to the antibody/hHAC3 complex (a
secondary antibody is typically specific to antibodies of the
species from which the first antibody is derived). Other proteins
capable of specifically binding immunoglobulin constant regions,
such as protein A or protein G may also be used as the label agent.
These proteins exhibit a strong non-immunogenic reactivity with
immunoglobulin constant regions from a variety of species (see,
e.g., Kronval et al., J. Immunol. 111:1401-1406 (1973); Akerstrom
et al., J. Immunol. 135:2589-2542 (1985)). The labeling agent can
be modified with a detectable moiety, such as biotin, to which
another molecule can specifically bind, such as streptavidin. A
variety of detectable moieties are well known to those skilled in
the art.
[0167] Throughout the assays, incubation and/or washing steps may
be required after each combination of reagents. Incubation steps
can vary from about 5 seconds to several hours, preferably from
about 5 minutes to about 24 hours. However, the incubation time
will depend upon the assay format, antigen, volume of solution,
concentrations, and the like. Usually, the assays will be carried
out at ambient temperature, although they can be conducted over a
range of temperatures, such as 10.degree. C. to 40.degree. C.
[0168] Non-competitive Assay Formats
[0169] Immunoassays for detecting the hHAC3 in samples may be
either competitive or noncompetitive. Noncompetitive immunoassays
are assays in which the amount of antigen is directly measured. In
one preferred "sandwich" assay, for example, the anti-hHAC3 subunit
antibodies can be bound directly to a solid substrate on which they
are immobilized. These immobilized antibodies then capture hHAC3
present in the test sample. The hHAC3 monomers are thus immobilized
and then bound by a labeling agent, such as a second hHAC3 antibody
bearing a label. Alternatively, the second antibody may lack a
label, but it may, in turn, be bound by a labeled third antibody
specific to antibodies of the species from which the second
antibody is derived. The second or third antibody is typically
modified with a detectable moiety, such as biotin, to which another
molecule specifically binds, e.g., streptavidin, to provide a
detectable moiety.
[0170] Competitive Assay Formats
[0171] In competitive assays, the amount of the hHAC3 present in
the sample is measured indirectly by measuring the amount of known,
added (exogenous) hHAC3 displaced (competed away) from an
anti-hHAC3 antibody by the unknown hHAC3 present in a sample. In
one competitive assay, a known amount of the hHAC3 is added to a
sample and the sample is then contacted with an antibody that
specifically binds to the hHAC3. The amount of exogenous hHAC3
bound to the antibody is inversely proportional to the
concentration of the hHAC3 present in the sample. In a particularly
preferred embodiment, the antibody is immobilized on a solid
substrate. The amount of hHAC3 bound to the antibody may be
determined either by measuring the amount of hHAC3 present in a
hHAC3/antibody complex, or alternatively by measuring the amount of
remaining uncomplexed protein. The amount of hHAC3 may be detected
by providing a labeled hHAC3 molecule.
[0172] A hapten inhibition assay is another preferred competitive
assay. In this assay the known hHAC3 is immobilized on a solid
substrate. A known amount of anti-hHAC3 antibody is added to the
sample, and the sample is then contacted with the immobilized
hHAC3. The amount of anti-hHAC3 antibody bound to the known
immobilized hHAC3 is inversely proportional to the amount of hHAC3
present in the sample. Again, the amount of immobilized antibody
may be detected by detecting either the immobilized fraction of
antibody or the fraction of the antibody that remains in solution.
Detection may be direct where the antibody is labeled or indirect
by the subsequent addition of a labeled moiety that specifically
binds to the antibody as described above.
[0173] Cross-reactivity Determinations
[0174] Immunoassays in the competitive binding format can also be
used for crossreactivity determinations for hHAC3. For example, a
protein at least partially encoded by SEQ ID NO:2 or an immunogenic
region thereof, such as the N-terminal region (amino acids 1-50),
can be immobilized to a solid support. Other proteins such as other
HAC family members, e.g., mouse HAC3 or human HAC1 or HAC2, are
added to the assay so as to compete for binding of the antisera to
the immobilized antigen. The ability of the added proteins to
compete for binding of the antisera to the immobilized protein is
compared to the ability of the hHAC3 encoded by SEQ ID NO:1 to
compete with itself. The percent crossreactivity for the above
proteins is calculated, using standard calculations. Those antisera
with less than 10% crossreactivity with each of the added proteins
listed above are selected and pooled. The cross-reacting antibodies
are optionally removed from the pooled antisera by immunoabsorption
with the added considered proteins, e.g., distantly related
homologs.
[0175] The immunoabsorbed and pooled antisera are then used in a
competitive binding immunoassay as described above to compare a
second protein, thought to be perhaps an allele or polymorphic
variant of hHAC3, to the immunogen protein. In order to make this
comparison, the two proteins are each assayed at a wide range of
concentrations and the amount of each protein required to inhibit
50% of the binding of the antisera to the immobilized protein is
determined. If the amount of the second protein required to inhibit
50% of binding is less than 10 times the amount of the protein
encoded by hHAC3 that is required to inhibit 50% of binding, then
the second protein is said to specifically bind to the polyclonal
antibodies generated to the respective hHAC3 immunogen.
[0176] Other Assay Formats
[0177] Western blot (immunoblot) analysis is used to detect and
quantify the presence of the hHAC3 in the sample. The technique
generally comprises separating sample proteins by gel
electrophoresis on the basis of molecular weight, transferring the
separated proteins to a suitable solid support, (such as a
nitrocellulose filter, a nylon filter, or derivatized nylon
filter), and incubating the sample with the antibodies that
specifically bind hHAC3. The anti-hHAC3 antibodies specifically
bind to hHAC3 on the solid support. These antibodies may be
directly labeled or alternatively may be subsequently detected
using labeled antibodies (e.g., labeled sheep anti-mouse
antibodies) that specifically bind to the anti-hHAC3
antibodies.
[0178] Other assay formats include liposome immunoassays (LIA),
which use liposomes designed to bind specific molecules (e.g.,
antibodies) and release encapsulated reagents or markers. The
released chemicals are then detected according to standard
techniques (see Monroe et al., Amer. Clin. Prod. Rev. 5:34-41
(1986)).
[0179] Reduction of Non-specific Binding
[0180] One of skill in the art will appreciate that it is often
desirable to minimize non-specific binding in immunoassays.
Particularly, where the assay involves an antigen or antibody
immobilized on a solid substrate it is desirable to minimize the
amount of non-specific binding to the substrate. Means of reducing
such non-specific binding are well known to those of skill in the
art. Typically, this technique involves coating the substrate with
a proteinaceous composition. In particular, protein compositions
such as bovine serum albumin (BSA), nonfat powdered milk, and
gelatin are widely used with powdered milk being most
preferred.
[0181] Labels
[0182] The particular label or detectable group used in the assay
is not a critical aspect of the invention, as long as it does not
significantly interfere with the specific binding of the antibody
used in the assay. The detectable group can be any material having
a detectable physical or chemical property. Such detectable labels
have been well-developed in the field of immunoassays and, in
general, most any label useful in such methods can be applied to
the present invention. Thus, a label is any composition detectable
by spectroscopic, photochemical, biochemical, immunochemical,
electrical, optical or chemical means. Useful labels in the present
invention include magnetic beads (e.g., DYNABEADS.TM.), fluorescent
dyes (e.g., fluorescein isothiocyanate, Texas red, rhodamine, and
the like), radiolabels (e.g., .sup.3H, .sup.125I, .sup.35S,
.sup.14C, or .sup.32P), enzymes (e.g., horse radish peroxidase,
alkaline phosphatase and others commonly used in an ELISA), and
colorimetric labels such as colloidal gold or colored glass or
plastic beads (e.g., polystyrene, polypropylene, latex, etc.).
[0183] The label may be coupled directly or indirectly to the
desired component of the assay according to methods well known in
the art. As indicated above, a wide variety of labels may be used,
with the choice of label depending on sensitivity required, ease of
conjugation with the compound, stability requirements, available
instrumentation, and disposal provisions.
[0184] Non-radioactive labels are often attached by indirect means.
Generally, a ligand molecule (e.g., biotin) is covalently bound to
the molecule. The ligand then binds to another molecules (e.g.,
streptavidin) molecule, which is either inherently detectable or
covalently bound to a signal system, such as a detectable enzyme, a
fluorescent compound, or a chemiluminescent compound. The ligands
and their targets can be used in any suitable combination with
antibodies that recognize hHAC3, or secondary antibodies that
recognize anti-hHAC3 antibodies.
[0185] The molecules can also be conjugated directly to signal
generating compounds, e.g., by conjugation with an enzyme or
fluorophore. Enzymes of interest as labels will primarily be
hydrolases, particularly phosphatases, esterases and glycosidases,
or oxidotases, particularly peroxidases. Fluorescent compounds
include fluorescein and its derivatives, rhodamine and its
derivatives, dansyl, umbelliferone, etc. Chemiluminescent compounds
include luciferin, and 2,3-dihydrophthalazinediones, e.g., luminol.
For a review of various labeling or signal producing systems that
may be used, see U.S. Pat. No. 4,391,904.
[0186] Means of detecting labels are well known to those of skill
in the art. Thus, for example, where the label is a radioactive
label, means for detection include a scintillation counter or
photographic film as in autoradiography. Where the label is a
fluorescent label, it may be detected by exciting the fluorochrome
with the appropriate wavelength of light and detecting the
resulting fluorescence. The fluorescence may be detected visually,
by means of photographic film, by the use of electronic detectors
such as charge coupled devices (CCDs) or photomultipliers and the
like. Similarly, enzymatic labels may be detected by providing the
appropriate substrates for the enzyme and detecting the resulting
reaction product. Finally simple calorimetric labels may be
detected simply by observing the color associated with the label.
Thus, in various dipstick assays, conjugated gold often appears
pink, while various conjugated beads appear the color of the
bead.
[0187] Some assay formats do not require the use of labeled
components. For instance, agglutination assays can be used to
detect the presence of the target antibodies. In this case,
antigen-coated particles are agglutinated by samples comprising the
target antibodies. In this format, none of the components need be
labeled and the presence of the target antibody is detected by
simple visual inspection.
VI. Assays for Modulators of hHAC3
[0188] A. Assays
[0189] Human HAC3 monomers and hHAC3 alleles and polymorphic
variants are subunits of hyperpolarization-activated cation
channels. The activity of a cation channel comprising hHAC3 can be
assessed using a variety of in vitro and in vivo assays, e.g.,
measuring current, measuring membrane potential, measuring ion
flux, e.g., potassium, sodium, guanidinium, and rubidium, measuring
potassium or other cation concentration, measuring second
messengers and transcription levels, using potassium-dependent
yeast growth assays, measuring ligand binding, and using e.g.,
voltage-sensitive dyes, radioactive tracers, and patch-clamp
electrophysiology. hHAC polypeptides and channels can be attached
to a solid substrate, in solution, or expressed in a cell or cell
membrane that is attached to a solid substrate or in solution.
Channels made of HAC family members are typically blocked by about
2 mM cesium.
[0190] Furthermore, such assays can be used to test for inhibitors
and activators of channels comprising hHAC3. Such modulators of a
hyperpolarization-activated cation channel are useful for treating
various disorders involving cation channels. Treatment of
dysfunctions include pacemaker dysfunctions such as familial sinus
rhythm diseases, sick sinus syndrome associated with atrial
fibrillation, and ventricular arrhythmias, memory and learning
disorders, sleeping disorders, bipolar disease, schizophrenia, as
well as CNS disorders such as migraines, hearing and vision
problems, seizures, and as neuroprotective agents (e.g., to prevent
stroke). Such modulators are also useful for investigation of the
channel diversity provided by hHAC3 and the regulation/modulation
of cation channel activity provided by hHAC3.
[0191] Modulators of the hyperpolarization-activated cation
channels are tested using biologically active hHAC3, either
recombinant or naturally occurring. Human HAC3 can be isolated,
expressed in a cell, or expressed in a membrane derived from a
cell. In such assays, hHAC3 is expressed alone to form a homomeric
cation channel or is co-expressed with a second alpha subunit
(e.g., HAC1 or HAC2) so as to form a heteromeric cation channel.
HAC can also be expressed with additional beta subunits. Modulation
is tested using one of the in vitro or in vivo assays described
above. Samples or assays that are treated with a potential cation
channel inhibitor or activator are compared to control samples
without the test compound, to examine the extent of modulation.
Control samples (untreated with activators or inhibitors) are
assigned a relative cation channel activity value of 100.
Inhibition of channels comprising hHAC3 is achieved when the cation
channel activity value relative to the control is about 90%,
preferably 50%, more preferably 25-0%. Activation of channels
comprising hHAC3 is achieved when the cation channel activity value
relative to the control is 110%, more preferably 150%, more
preferable 200% higher. Compounds that increase the flux of ions
will cause a detectable increase in the ion current density by
increasing the probability of a channel comprising hHAC3 being
open, by decreasing the probability of it being closed, by
increasing conductance through the channel, and/or by allowing the
passage of ions.
[0192] Changes in ion flux may be assessed by determining changes
in polarization (i.e., electrical potential) of the cell or
membrane expressing the cation channel comprising hHAC3. A
preferred means to determine changes in cellular polarization is by
measuring changes in current (thereby measuring changes in
polarization) with voltage-clamp and patch-clamp techniques, e.g.,
the "cell-attached" mode, the "inside-out" mode, and the "whole
cell" mode (see, e.g., Ackerman et al., New Engl. J. Med.
336:1575-1595 (1997)). Whole cell currents are conveniently
determined using the standard methodology (see, e.g., Hamil et al.,
PFlugers. Archiv. 391:85 (1981). Other known assays include:
radiolabeled rubidium, sodium, or guanidinium flux assays and
fluorescence assays using voltage-sensitive dyes or ion-sensitive
dyes (see, e.g., Vestergarrd-Bogind et al., J. Membrane Biol.
88:67-75 (1988); Daniel et al., J. Pharmacol. Meth. 25:185-193
(1991); Holevinsky et al., J. Membrane Biology 137:59-70 (1994)).
Assays for compounds capable of inhibiting or increasing potassium
flux through the channel proteins comprising hHAC3 can be performed
by application of the compounds to a bath solution in contact with
and comprising cells having a channel of the present invention
(see, e.g., Blatz et al., Nature 323:718-720 (1986); Park, J.
Physiol. 481:555-570 (1994)). Generally, the compounds to be tested
are present in the range from 1 pM to 100 mM.
[0193] The effects of the test compounds upon the function of the
channels can be measured by changes in the electrical currents or
ionic flux or by the consequences of changes in currents and flux.
Changes in electrical current or ionic flux are measured by either
increases or decreases in flux of cations such as potassium,
sodium, guanidinium, or rubidium ions. The cations can be measured
in a variety of standard ways. They can be measured directly by
concentration changes of the ions or indirectly by membrane
potential or by radio-labeling of the ions. Ligand binding to the
channel or polypeptide can be measured by standard assays known to
those of skill in the art. Consequences of the test compound on ion
flux can be quite varied. Accordingly, any suitable physical,
chemical or physiological change can be used to assess the
influence of a test compound on the channels of this invention. The
effects of a test compound can be measured by a toxin binding
assay. When the functional consequences are determined using intact
cells or animals, one can also measure a variety of effects such as
transmitter release (e.g., dopamine), hormone release (e.g.,
insulin), transcriptional changes to both known and uncharacterized
genetic markers (e.g., northern blots), cell volume changes (e.g.,
in red blood cells), immunoresponses (e.g., T cell activation),
changes in cell metabolism such as cell growth or pH changes, and
changes in intracellular second messengers such as Ca2.sup.+, or
cyclic nucleotides.
[0194] Preferably, the HAC3 that is a part of the
hyperpolarization-activated cation channel used in the assay will
have the sequence displayed in SEQ ID NO:1 or a conservatively
modified variant thereof. Alternatively, the HAC3 of the assay will
be derived from a eukaryote and include an amino acid subsequence
having amino acid sequence identity to hHAC3. Generally, the amino
acid sequence identity will be at least 96%, preferably at least
98%, most preferably at least 99%.
[0195] Human HAC3 orthologs will generally confer substantially
similar properties on a channel comprising such hHAC3, as described
above. In a preferred embodiment, the cell placed in contact with a
compound that is suspected to be a hHAC3 homolog is assayed for
increasing or decreasing ion flux in a eukaryotic cell, e.g., an
oocyte of Xenopus (e.g., Xenopus laevis) or a mammalian cell such
as a CHO or HeLa cell. Channels that are affected by compounds in
ways similar to hHAC3 are considered homologs or orthologs of
hHAC3. [0196] B. Modulators
[0197] The compounds tested as modulators of HAC channels
comprising a human HAC3 subunit can be any small chemical compound,
or a biological entity, such as a protein, sugar, nucleic acid or
lipid. Alternatively, modulators can be genetically altered
versions of a human HAC3 subunit. Typically, test compounds will be
small chemical molecules and peptides. Essentially any chemical
compound can be used as a potential modulator or ligand in the
assays of the invention, although most often compounds can be
dissolved in aqueous or organic (especially DMSO-based) solutions
are used. The assays are designed to screen large chemical
libraries by automating the assay steps and providing compounds
from any convenient source to assays, which are typically run in
parallel (e.g., in microtiter formats on microtiter plates in
robotic assays). It will be appreciated that there are many
suppliers of chemical compounds, including Sigma (St. Louis, Mo.),
Aldrich (St. Louis, Mo.), Sigma-Aldrich (St. Louis, Mo.), Fluka
Chemika-Biochemica Analytika (Buchs Switzerland) and the like.
[0198] In one preferred embodiment, high throughput screening
methods involve providing a combinatorial chemical or peptide
library containing a large number of potential therapeutic
compounds (potential modulator or ligand compounds). Such
"combinatorial chemical libraries" or "ligand libraries" are then
screened in one or more assays, as described herein, to identify
those library members (particular chemical species or subclasses)
that display a desired characteristic activity. The compounds thus
identified can serve as conventional "lead compounds" or can
themselves be used as potential or actual therapeutics.
[0199] A combinatorial chemical library is a collection of diverse
chemical compounds generated by either chemical synthesis or
biological synthesis, by combining a number of chemical "building
blocks" such as reagents. For example, a linear combinatorial
chemical library such as a polypeptide library is formed by
combining a set of chemical building blocks (amino acids) in every
possible way for a given compound length (i.e., the number of amino
acids in a polypeptide compound). Millions of chemical compounds
can be synthesized through such combinatorial mixing of chemical
building blocks.
[0200] Preparation and screening of combinatorial chemical
libraries is well known to those of skill in the art. Such
combinatorial chemical libraries include, but are not limited to,
peptide libraries (see, e.g., U.S. Pat. No. 5,010,175, Furka, Int.
J. Pept. Prot. Res. 37:487-493 (1991) and Houghton et al., Nature
354:84-88 (1991)). Other chemistries for generating chemical
diversity libraries can also be used. Such chemistries include, but
are not limited to: peptoids (e.g., PCT Publication No. WO
91/19735), encoded peptides (e.g., PCT Publication No. WO
93/20242), random bio-oligomers (e.g., PCT Publication No. WO
92/00091), benzodiazepines (e.g., U.S. Pat. No. 5,288,514),
diversomers such as hydantoins, benzodiazepines and dipeptides
(Hobbs et al., Proc. Nat. Acad. Sci. USA 90:6909-6913 (1993)),
vinylogous polypeptides (Hagihara et al., J. Amer. Chem. Soc.
114:6568 (1992)), nonpeptidal peptidomimetics with glucose
scaffolding (Hirschmann et al., J. Amer. Chem. Soc. 114:9217-9218
(1992)), analogous organic syntheses of small compound libraries
(Chen et al., J. Amer. Chem. Soc. 116:2661 (1994)), oligocarbamates
(Cho et al., Science 261:1303 (1993)), and/or peptidyl phosphonates
(Campbell et al., J. Org. Chem. 59:658 (1994)), nucleic acid
libraries (see Ausubel, Berger and Sambrook, all supra), peptide
nucleic acid libraries (see, e.g., U.S. Pat. No. 5,539,083),
antibody libraries (see, e.g., Vaughn et al., Nature Biotechnology,
14(3):309-314 (1996) and PCT/US96/10287), carbohydrate libraries
(see, e.g., Liang et al., Science, 274:1520-1522 (1996) and U.S.
Pat. No. 5,593,853), small organic molecule libraries (see, e.g.,
benzodiazepines, Baum C&EN, Jan. 18, page 33 (1993);
isoprenoids, U.S. Pat. No. 5,569,588; thiazolidinones and
metathiazanones, U.S. Pat. No. 5,549,974; pyrrolidines, U.S. Pat.
Nos. 5,525,735 and 5,519,134; morpholino compounds, U.S. Pat. No.
5,506,337; benzodiazepines, U.S. Pat. No. 5,288,514, and the
like).
[0201] Devices for the preparation of combinatorial libraries are
commercially available (see, e.g., 357 MPS, 390 MPS, Advanced Chem
Tech, Louisville Ky., Symphony, Rainin, Woburn, Mass., 433A Applied
Biosystems, Foster City, Calif., 9050 Plus, Millipore, Bedford,
Mass.). In addition, numerous combinatorial libraries are
themselves commercially available (see, e.g., ComGenex, Princeton,
N.J., Asinex, Moscow, Ru, Tripos, Inc., St. Louis, Mo., ChemStar,
Ltd, Moscow, RU, 3D Pharmaceuticals, Exton, Pa., Martek
Biosciences, Columbia, Md., etc.).
[0202] In one embodiment, the invention provides solid phase based
in vitro assays in a high throughput format, where the cell or
tissue expressing a HAC3 channel comprising a human HAC3 subunit is
attached to a solid phase substrate. In the high throughput assays
of the invention, it is possible to screen up to several thousand
different modulators or ligands in a single day. In particular,
each well of a microtiter plate can be used to run a separate assay
against a selected potential modulator, or, if concentration or
incubation time effects are to be observed, every 5-10 wells can
test a single modulator. Thus, a single standard microtiter plate
can assay about 100 (e.g., 96) modulators. If 1536 well plates are
used, then a single plate can easily assay from about 100- about
1500 different compounds. It is possible to assay several different
plates per day; assay screens for up to about 6,000-20,000
different compounds is possible using the integrated systems of the
invention. More recently, microfluidic approaches to reagent
manipulation have been developed. [0203] C. Solid State and Soluble
High Throughput Assays
[0204] In one embodiment the invention provide soluble assays using
potassium channels comprising hHAC3; a membrane comprising a
channel comprising hHAC3, or a cell or tissue expressing channels
comprising hHAC3, either naturally occurring or recombinant. In
another embodiment, the invention provides solid phase based in
vitro assays in a high throughput format, where hHAC3 channel
attached to a solid phase substrate.
[0205] In the high throughput assays of the invention, it is
possible to screen up to several thousand different modulators or
ligands in a single day. In particular, each well of a microtiter
plate can be used to run a separate assay against a selected
potential modulator, or, if concentration or incubation time
effects are to be observed, every 5-10 wells can test a single
modulator. Thus, a single standard microtiter plate can assay about
100 (e.g., 96) modulators. If 1536 well plates are used, then a
single plate can easily assay from about 100- about 1500 different
compounds. It is possible to assay many plates per day; assay
screens for up to about 6,000, 20,000, 50,000, or more than 100,000
different compounds is possible using the integrated systems of the
invention.
[0206] The channel of interest, or a cell or membrane comprising
the channel of interest can be bound to the solid state component,
directly or indirectly, via covalent or non covalent linkage e.g.,
via a tag. The tag can be any of a variety of components. In
general, a molecule which binds the tag (a tag binder) is fixed to
a solid support, and the tagged molecule of interest (e.g., the
taste transduction molecule of interest) is attached to the solid
support by interaction of the tag and the tag binder.
[0207] A number of tags and tag binders can be used, based upon
known molecular interactions well described in the literature. For
example, where a tag has a natural binder, for example, biotin,
protein A, or protein G, it can be used in conjunction with
appropriate tag binders (avidin, streptavidin, neutravidin, the Fc
region of an immunoglobulin, etc.) Antibodies to molecules with
natural binders such as biotin are also widely available and
appropriate tag binders; see, SIGMA Immunochemicals 1998 catalogue
SIGMA, St. Louis Mo.).
[0208] Similarly, any haptenic or antigenic compound can be used in
combination with an appropriate antibody to form a tag/tag binder
pair. Thousands of specific antibodies are commercially available
and many additional antibodies are described in the literature. For
example, in one common configuration, the tag is a first antibody
and the tag binder is a second antibody which recognizes the first
antibody. In addition to antibody-antigen interactions,
receptor-ligand interactions are also appropriate as tag and
tag-binder pairs. For example, agonists and antagonists of cell
membrane receptors (e.g., cell receptor-ligand interactions such as
transferrin, c-kit, viral receptor ligands, cytokine receptors,
chemokine receptors, interleukin receptors, immunoglobulin
receptors and antibodies, the cadherein family, the integrin
family, the selectin family, and the like; see, e.g., Pigott &
Power, The Adhesion Molecule Facts Book I (1993). Similarly, toxins
and venoms, viral epitopes, hormones (e.g., opiates, steroids,
etc.), intracellular receptors (e.g. which mediate the effects of
various small ligands, including steroids, thyroid hormone,
retinoids and vitamin D; peptides), drugs, lectins, sugars, nucleic
acids (both linear and cyclic polymer configurations),
oligosaccharides, proteins, phospholipids and antibodies can all
interact with various cell receptors.
[0209] Synthetic polymers, such as polyurethanes, polyesters,
polycarbonates, polyureas, polyamides, polyethyleneimines,
polyarylene sulfides, polysiloxanes, polyimides, and polyacetates
can also form an appropriate tag or tag binder. Many other tag/tag
binder pairs are also useful in assay systems described herein, as
would be apparent to one of skill upon review of this
disclosure.
[0210] Common linkers such as peptides, polyethers, and the like
can also serve as tags, and include polypeptide sequences, such as
poly gly sequences of between about 5 and 200 amino acids. Such
flexible linkers are known to persons of skill in the art. For
example, poly(ethelyne glycol) linkers are available from
Shearwater Polymers, Inc. Huntsville, Ala. These linkers optionally
have amide linkages, sulfhydryl linkages, or heterofunctional
linkages.
[0211] Tag binders are fixed to solid substrates using any of a
variety of methods currently available. Solid substrates are
commonly derivatized or functionalized by exposing all or a portion
of the substrate to a chemical reagent which fixes a chemical group
to the surface which is reactive with a portion of the tag binder.
For example, groups which are suitable for attachment to a longer
chain portion would include amines, hydroxyl, thiol, and carboxyl
groups. Aminoalkylsilanes and hydroxyalkylsilanes can be used to
functionalize a variety of surfaces, such as glass surfaces. The
construction of such solid phase biopolymer arrays is well
described in the literature. See, e.g., Merrifield, J. Am. Chem.
Soc. 85:2149-2154 (1963) (describing solid phase synthesis of,
e.g., peptides); Geysen et al., J. Immun. Meth. 102:259-274 (1987)
(describing synthesis of solid phase components on pins); Frank
& Doring, Tetrahedron 44:60316040 (1988) (describing synthesis
of various peptide sequences on cellulose disks); Fodor et al.,
Science, 251:767-777 (1991); Sheldon et al., Clinical Chemistry
39(4):718-719 (1993); and Kozal et al., Nature Medicine 2(7):753759
(1996) (all describing arrays of biopolymers fixed to solid
substrates). Non-chemical approaches for fixing tag binders to
substrates include other common methods, such as heat,
cross-linking by UV radiation, and the like.
VII. Computer Assisted Drug Design Using hHAC3
[0212] Yet another assay for compounds that modulate the activities
of hHAC3 involves computer assisted drug design, in which a
computer system is used to generate a three-dimensional structure
of hHAC3 based on the structural information encoded by the amino
acid sequence. The input amino acid sequence interacts directly and
actively with a pre-established algorithm in a computer program to
yield secondary, tertiary, and quaternary structural models of the
protein. The models of the protein structure are then examined to
identify regions of the structure that have the ability to bind,
e.g., ligands or other cation channel subunits. These regions are
then used to identify ligands that bind to the protein or region
where hHAC3 interacts with other cation channel subunits.
[0213] The three-dimensional structural model of the protein is
generated by entering channel protein amino acid sequences of at
least 25-75 amino acid residues or corresponding nucleic acid
sequences encoding a hHAC3 monomer into the computer system. The
amino acid sequence of each of the monomers is selected from the
group consisting of SEQ ID NO:1 and a conservatively modified
versions thereof. The amino acid sequence represents the primary
sequence or subsequence of each of the proteins, which encodes the
structural information of the protein. At least 25-75 residues of
the amino acid sequence (or a nucleotide sequence encoding 25-75
amino acids) are entered into the computer system from computer
keyboards, computer readable substrates that include, but are not
limited to, electronic storage media (e.g., magnetic diskettes,
tapes, cartridges, and chips), optical media (e.g., CD ROM),
information distributed by internet sites, and by RAM. The
three-dimensional structural model of the channel protein is then
generated by the interaction of the amino acid sequence and the
computer system, using software known to those of skill in the art.
The resulting three-dimensional computer model can then be saved on
a computer readable substrate.
[0214] The amino acid sequence represents a primary structure that
encodes the information necessary to form the secondary, tertiary
and quaternary structure of the monomer and the heteromeric
potassium channel protein comprising four monomers. The software
looks at certain parameters encoded by the primary sequence to
generate the structural model. These parameters are referred to as
"energy terms," or anisotropic terms and primarily include
electrostatic potentials, hydrophobic potentials, solvent
accessible surfaces, and hydrogen bonding. Secondary energy terms
include van der Waals potentials. Biological molecules form the
structures that minimize the energy terms in a cumulative fashion.
The computer program is therefore using these terms encoded by the
primary structure or amino acid sequence to create the secondary
structural model.
[0215] The tertiary structure of the protein encoded by the
secondary structure is then formed on the basis of the energy terms
of the secondary structure. The user at this point can enter
additional variables such as whether the protein is membrane bound
or soluble, its location in the body, and its cellular location,
e.g., cytoplasmic, surface, or nuclear. These variables along with
the energy terms of the secondary structure are used to form the
model of the tertiary structure. In modeling the tertiary
structure, the computer program matches hydrophobic faces of
secondary structure with like, and hydrophilic faces of secondary
structure with like.
[0216] Once the structure has been generated, potential ligand
binding regions are identified by the computer system.
Three-dimensional structures for potential ligands are generated by
entering amino acid or nucleotide sequences or chemical formulas of
compounds, as described above. The three-dimensional structure of
the potential ligand is then compared to that of hHAC3 protein to
identify ligands that bind to hHAC3. Binding affinity between the
protein and ligands is determined using energy terms to determine
which ligands have an enhanced probability of binding to the
protein.
[0217] Computer systems are also used to screen for mutations,
polymorphic variants, alleles and interspecies homologs of hHAC3
genes. Such mutations can be associated with disease states. Once
the variants are identified, diagnostic assays can be used to
identify patients having such mutated genes associated with disease
states. Identification of the mutated hHAC3 genes involves
receiving input of a first nucleic acid, e.g., SEQ ID NO:2, or an
amino acid sequence encoding hHAC3, selected from the group
consisting of SEQ ID NO:1, and a conservatively modified versions
thereof. The sequence is entered into the computer system as
described above. The first nucleic acid or amino acid sequence is
then compared to a second nucleic acid or amino acid sequence that
has substantial identity to the first sequence. The second sequence
is entered into the computer system in the manner described above.
Once the first and second sequences are compared, nucleotide or
amino acid differences between the sequences are identified. Such
sequences can represent allelic differences in hHAC3 genes, and
mutations associated with disease states. The first and second
sequences described above can be saved on a computer readable
substrate.
[0218] Human HAC3 monomers and the hyperpolarization-activated
cation channels containing these hHAC3 monomers can be used with
high density oligonucleotide array technology (e.g., GeneChip.TM.)
to identify homologs and polymorphic variants of hHAC3 in this
invention. In the case where the homologs being identified are
linked to a known disease, they can be used with GeneChip.TM. as a
diagnostic tool in detecting the disease in a biological sample,
see, e.g., Gunthand et al., AIDS Res. Hum. Retroviruses 14: 869-876
(1998); Kozal et al., Nat. Med. 2:753-759 (1996); Matson et al.,
Anal. Biochem. 224:110-106 (1995); Lockhart et al., Nat.
Biotechnol. 14:1675-1680 (1996); Gingeras et al., Genome Res.
8:435-448 (1998); Hacia et al., Nucleic Acids Res. 26:3865-3866
(1998).
VIII. Cellular Transfection and Gene Therapy
[0219] The present invention provides the nucleic acids of hHAC3
for the transfection of cells in vitro and in vivo. These nucleic
acids can be inserted into any of a number of well-known vectors
for the transfection of target cells and organisms as described
below. The nucleic acids are transfected into cells, ex vivo or in
vivo, through the interaction of the vector and the target cell.
The nucleic acid for hHAC3, under the control of a promoter, then
expresses a hHAC3 monomer of the present invention, thereby
mitigating the effects of absent, partial inactivation, or abnormal
expression of the hHAC3 gene. The compositions are administered to
a patient in an amount sufficient to elicit a therapeutic response
in the patient. An amount adequate to accomplish this is defined as
"therapeutically effective dose or amount."
[0220] Such gene therapy procedures have been used to correct
acquired and inherited genetic defects, cancer, and viral infection
in a number of contexts. The ability to express artificial genes in
humans facilitates the prevention and/or cure of many important
human diseases, including many diseases which are not amenable to
treatment by other therapies (for a review of gene therapy
procedures, see Anderson, Science 256:808-813 (1992); Nabel &
Felgner, TIBTECH 11:211-217 (1993); Mitani & Caskey, TIBTECH
11:162-166 (1993); Mulligan, Science 926-932 (1993); Dillon,
TIBTECH 11:167-175 (1993); Miller, Nature 357:455-460 (1992); Van
Brunt, Biotechnology 6(10):1149-1154 (1998); Vigne, Restorative
Neurology and Neuroscience 8:35-36 (1995); Kremer &
Perricaudet, British Medical Bulletin 51(1):31-44 (1995); Haddada
et al., in Current Topics in Microbiology and Immunology (Doerfler
& Bohm eds., 1995); and Yu et al., Gene Therapy 1: 13-26
(1994)).
[0221] Delivery of the gene or genetic material into the cell is
the first critical step in gene therapy treatment of disease. A
large number of delivery methods are well known to those of skill
in the art. Preferably, the nucleic acids are administered for in
vivo or ex vivo gene therapy uses. Non-viral vector delivery
systems include DNA plasmids, naked nucleic acid, and nucleic acid
complexed with a delivery vehicle such as a liposome. Viral vector
delivery systems include DNA and RNA viruses, which have either
episomal or integrated genomes after delivery to the cell. For a
review of gene therapy procedures, see Anderson, Science
256:808-813 (1992); Nabel & Felgner, TIBTECH 11:211-217 (1993);
Mitani & Caskey, TIBTECH 11:162-166 (1993); Dillon, TIBTECH
11:167-175 (1993); Miller, Nature 357:455-460 (1992); Van Brunt,
Biotechnology 6(10):1149-1154 (1988); Vigne, Restorative Neurology
and Neuroscience 8:35-36 (1995); Kremer & Perricaudet, British
Medical Bulletin 51(1):31-44 (1995); Haddada et al., in Current
Topics in Microbiology and Immunology Doerfler and Bohm (eds)
(1995); and Yu et al., Gene Therapy 1:13-26 (1994).
[0222] Methods of non-viral delivery of nucleic acids include
lipofection, microinjection, biolistics, virosomes, liposomes,
immunoliposomes, polycation or lipid:nucleic acid conjugates, naked
DNA, artificial virions, and agent-enhanced uptake of DNA.
Lipofection is described in, e.g., U.S. Pat. No. 5,049,386, U.S.
Pat. No. 4,946,787; and U.S. Pat. No. 4,897,355) and lipofection
reagents are sold commercially (e.g., Transfectam.TM. and
Lipofectin.TM.. Cationic and neutral lipids that are suitable for
efficient receptor-recognition lipofection of polynucleotides
include those of Felgner, WO 91/17424, WO 91/16024. Delivery can be
to cells (ex vivo administration) or target tissues (in vivo
administration).
[0223] The preparation of lipid:nucleic acid complexes, including
targeted liposomes such as immunolipid complexes, is well known to
one of skill in the art (see, e.g., Crystal, Science 270:404-410
(1995); Blaese et al., Cancer Gene Ther. 2:291-297 (1995); Behr et
al., Bioconjugate Chem. 5:382-389 (1994); Remy et al., Bioconjugate
Chem. 5:647-654 (1994); Gao et al., Gene Therapy 2:710-722 (1995);
Ahmad et al., Cancer Res. 52:4817-4820 (1992); U.S. Pat. Nos.
4,186,183, 4,217,344, 4,235,871, 4,261,975, 4,485,054, 4,501,728,
4,774,085, 4,837,028, and 4,946,787).
[0224] The use of RNA or DNA viral based systems for the delivery
of nucleic acids take advantage of highly evolved processes for
targeting a virus to specific cells in the body and trafficking the
viral payload to the nucleus. Viral vectors can be administered
directly to patients (in vivo) or they can be used to treat cells
in vitro and the modified cells are administered to patients (ex
vivo). Conventional viral based systems for the delivery of nucleic
acids could include retroviral, lentivirus, adenoviral,
adeno-associated and herpes simplex virus vectors for gene
transfer. Viral vectors are currently the most efficient and
versatile method of gene transfer in target cells and tissues.
Integration in the host genome is possible with the retrovirus,
lentivirus, and adeno-associated virus gene transfer methods, often
resulting in long term expression of the inserted transgene.
Additionally, high transduction efficiencies have been observed in
many different cell types and target tissues.
[0225] The tropism of a retrovirus can be altered by incorporating
foreign envelope proteins, expanding the potential target
population of target cells. Lentiviral vectors are retroviral
vector that are able to transduce or infect non-dividing cells and
typically produce high viral titers. Selection of a retroviral gene
transfer system would therefore depend on the target tissue.
Retroviral vectors are comprised of cis-acting long terminal
repeats with packaging capacity for up to 6-10 kb of foreign
sequence. The minimum cis-acting LTRs are sufficient for
replication and packaging of the vectors, which are then used to
integrate the therapeutic gene into the target cell to provide
permanent transgene expression. Widely used retroviral vectors
include those based upon murine leukemia virus (MuLV), gibbon ape
leukemia virus (GaLV), Simian Immuno deficiency virus (SIV), human
immuno deficiency virus (HIV), and combinations thereof (see, e.g.,
Buchscher et al., J. Virol. 66:2731-2739 (1992); Johann et al., J.
Virol. 66:1635-1640 (1992); Sommerfelt et al., Virol. 176:58-59
(1990); Wilson et al., J. Virol. 63:2374-2378 (1989); Miller et
al., J. Virol. 65:2220-2224 (1991); PCT/US94/05700).
[0226] In applications where transient expression of the nucleic
acid is preferred, adenoviral based systems are typically used.
Adenoviral based vectors are capable of very high transduction
efficiency in many cell types and do not require cell division.
With such vectors, high titer and levels of expression have been
obtained. This vector can be produced in large quantities in a
relatively simple system. Adeno-associated virus ("AAV") vectors
are also used to transduce cells with target nucleic acids, e.g.,
in the in vitro production of nucleic acids and peptides, and for
in vivo and ex vivo gene therapy procedures (see, e.g., West et
al., Virology 160:38-47 (1987); U.S. Pat. No. 4,797,368; WO
93/24641; Kotin, Human Gene Therapy 5:793-801(1994); Muzyczka, J.
Clin. Invest. 94:1351 (1994)). Construction of recombinant AAV
vectors are described in a number of publications, including U.S.
Pat. No. 5,173,414; Tratschin et al., Mol. Cell. Biol. 5:3251-3260
(1985); Tratschin, et al., Mol. Cell. Biol. 4:2072-2081 (1984);
Hermonat & Muzyczka, Proc. Natl. Acad. Sci. U.S.A. 81:6466-6470
(1984); and Samulski et al., J. Virol. 63:03822-3828 (1989).
[0227] In particular, at least six viral vector approaches are
currently available for gene transfer in clinical trials, with
retroviral vectors by far the most frequently used system. All of
these viral vectors utilize approaches that involve complementation
of defective vectors by genes inserted into helper cell lines to
generate the transducing agent.
[0228] pLASN and MFG-S are examples are retroviral vectors that
have been used in clinical trials (Dunbar et al., Blood 85:3048-305
(1995); Kohn et al., Nat. Med. 1:1017-102 (1995); Malech et al.,
Proc. Natl. Acad. Sci. U.S.A. 94:22 12133-12138 (1997)).
PA317/pLASN was the first therapeutic vector used in a gene therapy
trial. (Blaese et al., Science 270:475-480 (1995)). Transduction
efficiencies of 50% or greater have been observed for MFG-S
packaged vectors. (Ellem et al., Immunol Immunother. 44(1):10-20
(1997); Dranoff et al., Hum. Gene Ther. 1:111-2 (1997).
[0229] Recombinant adeno-associated virus vectors (rAAV) are a
promising alternative gene delivery systems based on the defective
and nonpathogenic parvovirus adeno-associated type 2 virus. All
vectors are derived from a plasmid that retains only the AAV 145 bp
inverted terminal repeats flanking the transgene expression
cassette. Efficient gene transfer and stable transgene delivery due
to integration into the genomes of the transduced cell are key
features for this vector system. (Wagner et al., Lancet 351:9117
1702-3 (1998), Kearns et al., Gene Ther. 9:748-55 (1996)).
[0230] Replication-deficient recombinant adenoviral vectors (Ad)
are predominantly used transient expression gene therapy, because
they can be produced at high titer and they readily infect a number
of different cell types. Most adenovirus vectors are engineered
such that a transgene replaces the Ad E1a, E1b, and E3 genes;
subsequently the replication defector vector is propagated in human
293 cells that supply deleted gene function in trans. Ad vectors
can transduce multiple types of tissues in vivo, including
nondividing, differentiated cells such as those found in the liver,
kidney and muscle system tissues. Conventional Ad vectors have a
large carrying capacity. An example of the use of an Ad vector in a
clinical trial involved polynucleotide therapy for antitumor
immunization with intramuscular injection (Sterman et al., Hum.
Gene Ther. 7:1083-9 (1998)). Additional examples of the use of
adenovirus vectors for gene transfer in clinical trials include
Rosenecker et al., Infection 241:5-10 (1996); Sterman et al., Hum.
Gene Ther. 9:7 1083-1089 (1998); Welsh et al., Hum. Gene Ther.
2:205-18 (1995); Alvarez et al., Hum. Gene Ther. 5:597-613 (1997);
Topf et al., Gene Ther. 5:507-513 (1998); Sterman et al., Hum. Gene
Ther. 7:1083-1089 (1998).
[0231] In many gene therapy applications, it is desirable that the
gene therapy vector be delivered with a high degree of specificity
to a particular tissue type. A viral vector is typically modified
to have specificity for a given cell type by expressing a ligand as
a fusion protein with a viral coat protein on the viruses outer
surface. The ligand is chosen to have affinity for a receptor known
to be present on the cell type of interest. For example, Han et
al., Proc. Natl. Acad. Sci. U.S.A. 92:9747-9751 (1995), reported
that Moloney murine leukemia virus can be modified to express human
heregulin fused to gp70, and the recombinant virus infects certain
human breast cancer cells expressing human epidermal growth factor
receptor. This principle can be extended to other pairs of virus
expressing a ligand fusion protein and target cell expressing a
receptor. For example, filamentous phage can be engineered to
display antibody fragments (e.g., FAB or Fv) having specific
binding affinity for virtually any chosen cellular receptor.
Although the above description applies primarily to viral vectors,
the same principles can be applied to nonviral vectors. Such
vectors can be engineered to contain specific uptake sequences
thought to favor uptake by specific target cells.
[0232] Gene therapy vectors can be delivered in vivo by
administration to an individual patient, typically by systemic
administration (e.g., intravenous, intraperitoneal, intramuscular,
subdermal, or intracranial infusion) or topical application, as
described below. Alternatively, vectors can be delivered to cells
ex vivo, such as cells explanted from an individual patient (e.g.,
lymphocytes, bone marrow aspirates, tissue biopsy) or universal
donor hematopoietic stem cells, followed by reimplantation of the
cells into a patient, usually after selection for cells which have
incorporated the vector.
[0233] Ex vivo cell transfection for diagnostics, research, or for
gene therapy (e.g., via re-infusion of the transfected cells into
the host organism) is well known to those of skill in the art. In a
preferred embodiment, cells are isolated from the subject organism,
transfected with a nucleic acid (gene or cDNA), and re-infused back
into the subject organism (e.g., patient). Various cell types
suitable for ex vivo transfection are well known to those of skill
in the art (see, e.g., Freshney et al., Culture of Animal Cells, A
Manual of Basic Technique (3rd ed. 1994)) and the references cited
therein for a discussion of how to isolate and culture cells from
patients).
[0234] Vectors (e.g., retroviruses, adenoviruses, liposomes, etc.)
containing therapeutic nucleic acids can be also administered
directly to the organism for transduction of cells in vivo.
Alternatively, naked DNA can be administered. Administration is by
any of the routes normally used for introducing a molecule into
ultimate contact with blood or tissue cells. Suitable methods of
administering such nucleic acids are available and well known to
those of skill in the art, and, although more than one route can be
used to administer a particular composition, a particular route can
often provide a more immediate and more effective reaction than
another route.
[0235] Administration is by any of the routes normally used for
introducing a molecule into ultimate contact with blood or tissue
cells. The nucleic acids are administered in any suitable manner,
preferably with pharmaceutically acceptable carriers. Suitable
methods of administering such nucleic acids are available and well
known to those of skill in the art, and, although more than one
route can be used to administer a particular composition, a
particular route can often provide a more immediate and more
effective reaction than another route.
IX. Pharmaceutical Compositions
[0236] Pharmaceutically acceptable carriers are determined in part
by the particular composition being administered (e.g., nucleic
acid, protein, modulatory compounds or transduced cell), as well as
by the particular method used to administer the composition.
Accordingly, there are a wide variety of suitable formulations of
pharmaceutical compositions of the present invention (see, e.g.,
Remington's Pharmaceutical Sciences, 17.sup.th ed., 1989).
Administration can be in any convenient manner, e.g., by injection,
oral administration, inhalation, transdermal application, or rectal
administration.
[0237] Formulations suitable for oral administration can consist of
(a) liquid solutions, such as an effective amount of the packaged
nucleic acid suspended in diluents, such as water, saline or PEG
400; (b) capsules, sachets or tablets, each containing a
predetermined amount of the active ingredient, as liquids, solids,
granules or gelatin; (c) suspensions in an appropriate liquid; and
(d) suitable emulsions. Tablet forms can include one or more of
lactose, sucrose, mannitol, sorbitol, calcium phosphates, corn
starch, potato starch, microcrystalline cellulose, gelatin,
colloidal silicon dioxide, talc, magnesium stearate, stearic acid,
and other excipients, colorants, fillers, binders, diluents,
buffering agents, moistening agents, preservatives, flavoring
agents, dyes, disintegrating agents, and pharmaceutically
compatible carriers. Lozenge forms can comprise the active
ingredient in a flavor, usually sucrose and acacia or tragacanth,
as well as pastilles comprising the active ingredient in an inert
base, such as gelatin and glycerin or sucrose and acacia emulsions,
gels, and the like containing, in addition to the active
ingredient, carriers known in the art.
[0238] The compound of choice, alone or in combination with other
suitable components, can be made into aerosol formulations (i.e.,
they can be "nebulized") to be administered via inhalation. Aerosol
formulations can be placed into pressurized acceptable propellants,
such as dichlorodifluoromethane, propane, nitrogen, and the
like.
[0239] Formulations suitable for parenteral administration, such
as, for example, by intraarticular (in the joints), intravenous,
intramuscular, intradermal, intraperitoneal, and subcutaneous
routes, include aqueous and non-aqueous, isotonic sterile injection
solutions, which can contain antioxidants, buffers, bacteriostats,
and solutes that render the formulation isotonic with the blood of
the intended recipient, and aqueous and non-aqueous sterile
suspensions that can include suspending agents, solubilizers,
thickening agents, stabilizers, and preservatives. In the practice
of this invention, compositions can be administered, for example,
by intravenous infusion, orally, topically, intraperitoneally,
intravesically or intrathecally. Parenteral administration and
intravenous administration are the preferred methods of
administration. The formulations of commends can be presented in
unit-dose or multi-dose sealed containers, such as ampules and
vials.
[0240] Injection solutions and suspensions can be prepared from
sterile powders, granules, and tablets of the kind previously
described. Cells transduced by nucleic acids for ex vivo therapy
can also be administered intravenously or parenterally as described
above.
[0241] The dose administered to a patient, in the context of the
present invention should be sufficient to effect a beneficial
therapeutic response in the patient over time. The dose will be
determined by the efficacy of the particular vector employed and
the condition of the patient, as well as the body weight or surface
area of the patient to be treated. The size of the dose also will
be determined by the existence, nature, and extent of any adverse
side-effects that accompany the administration of a particular
vector, or transduced cell type in a particular patient.
[0242] In determining the effective amount of the vector to be
administered in the treatment or prophylaxis of conditions owing to
diminished or aberrant expression of the HAC3 channels comprising a
human HAC3 alpha subunit, the physician evaluates circulating
plasma levels of the vector, vector toxicities, progression of the
disease, and the production of anti-vector antibodies. In general,
the dose equivalent of a naked nucleic acid from a vector is from
about 1 .mu.g to 100 .mu.g for a typical 70 kilogram patient, and
doses of vectors which include a retroviral particle are calculated
to yield an equivalent amount of therapeutic nucleic acid.
[0243] For administration, compounds and transduced cells of the
present invention can be administered at a rate determined by the
LD-50 of the inhibitor, vector, or transduced cell type, and the
side-effects of the inhibitor, vector or cell type at various
concentrations, as applied to the mass and overall health of the
patient. Administration can be accomplished via single or divided
doses.
[0244] Transduced cells are prepared for reinfusion according to
established methods (see Abrahamsen et al., J Clin. Apheresis
6:48-53 (1991); Carter et al., J. Clin. Apheresis 4:113-117 (1998);
Aebersold et al., J. Immunol. Meth. 112:1-7 (1998); Muul et al., J.
Immunol. Methods 101:171-181 (1987); and Carter et al., Transfusion
27:362-365 (1987)). After a period of about 2-4 weeks in culture,
the cells should number between 1.times.10.sup.8 and
1.times.10.sup.12. In this regard, the growth characteristics of
cells vary from patient to patient and from cell type to cell type.
About 72 hours prior to reinfusion of the transduced cells, an
aliquot is taken for analysis of phenotype, and percentage of cells
expressing the therapeutic agent.
X. Kits
[0245] Human HAC3 and its homologs are useful tools for examining
expression and regulation of hyperpolarization-activated cation
channels. Human HAC3-specific reagents that specifically hybridize
to hHAC3 nucleic acid, such as hHAC3 probes and primers, and
hHAC3-specific reagents that specifically bind to the hHAC3
protein, e.g., hHAC3 antibodies are used to examine expression and
regulation.
[0246] Nucleic acid assays for the presence of hHAC3 DNA and RNA in
a sample include numerous techniques are known to those skilled in
the art, such as Southern analysis, northern analysis, dot blots,
RNase protection, S1 analysis, amplification techniques such as PCR
and LCR, and in situ hybridization. In in situ hybridization, for
example, the target nucleic acid is liberated from its cellular
surroundings in such as to be available for hybridization within
the cell while preserving the cellular morphology for subsequent
interpretation and analysis. The following articles provide an
overview of the art of in situ hybridization: Singer et al.,
Biotechniques 4:230-250 (1986); Haase et al., Methods in Virology,
vol. VII, pp. 189-226 (1984); and Nucleic Acid Hybridization: A
Practical Approach (Hames et al., eds. 1987). In addition, hHAC3
protein can be detected with the various immunoassay techniques
described above. The test sample is typically compared to both a
positive control (e.g., a sample expressing recombinant hHAC3
monomers) and a negative control.
[0247] The present invention also provides for kits for screening
modulators of the heteromeric potassium channels. Such kits can be
prepared from readily available materials and reagents. For
example, such kits can comprise any one or more of the following
materials: hHAC3 monomers, reaction tubes, and instructions for
testing the activities of hyperpolarization-activated cation
channels containing hHAC3. A wide variety of kits and components
can be prepared according to the present invention, depending upon
the intended user of the kit and the particular needs of the user.
For example, the kit can be tailored for in vitro or in vivo assays
for measuring the activity of a hyperpolarization-activated cation
channel comprising a hHAC3 monomer.
[0248] All publications and patent applications cited in this
specification are herein incorporated by reference as if each
individual publication or patent application were specifically and
individually indicated to be incorporated by reference.
[0249] Although the foregoing invention has been described in some
detail by way of illustration and example for purposes of clarity
of understanding, it will be readily apparent to one of ordinary
skill in the art in light of the teachings of this invention that
certain changes and modifications may be made thereto without
departing from the spirit or scope of the appended claims.
EXAMPLE
[0250] The following example is provided by way of illustration
only and not by way of limitation. Those of skill in the art will
readily recognize a variety of noncritical parameters that could be
changed or modified to yield essentially similar results.
Example I
Isolation of Nucleic Acids Encoding hHAC3 and Functional Analysis
of Hyperpolarization-activated Cation Channels Containing hHAC3
[0251] Using PCR and primers, according to standard conditions,
hHAC3 was amplified from a human hippocampus cDNA library. The
following degenerate primers were used for amplification of hHAC3:
TABLE-US-00002 (1) 5'-TGGGAGGAGATCTTYCAYATGACNTAYGA-3 (SEQ ID NO:
7) (2) 5'-CGTCTCGAATGCCCKNCKCATCATNGG-3 (SEQ ID NO: 8)
[0252] Primers (1) and (2) were used together to amplify portions
of the region that encode the S4 and putative cyclic-nucleotide
binding domains of hyperpolarization-activated cation channels. PCR
conditions were as follows: 95 degrees for 15 seconds, 60-40
degrees for 15 seconds, 72 degrees for 45 seconds. The reaction was
run for 40 cycles.
[0253] 5' and 3' RACE PCR was subsequently used to clone the
complete ends of the hHAC3 gene from hippocampal cDNA. The Clontech
Marathon RACE kit was used for this procedure. A gene specific
oligo is used in combination with a non-selective oligo tagged to
the cDNA end. Two rounds of 5' RACE were performed. In the first
round, the gene specific primer was CCTGCTGCCCATAGCCAATGCACAGC (SEQ
ID NO:9). In the second round, the first reaction was reamplified
with the nested gene-specific primer GCACCACGAACTGCAGACAGCCATC (SEQ
ID NO:10). For the 3' RACE, four nested rounds were performed with
the following gene specific primers: TABLE-US-00003
GTTCTCACCAAGCTGCGCTTTGAGGTC (SEQ ID NO:11)
CCAGCATGGGCTGCTCAGTGTGCTG (SEQ ID NO:12) GCCCACTCTCAGCCTCCCAACCCTC
(SEQ ID NO:13) CCCAACCAAGCTTGCCTCAGCGGGCAACAGGCGAT (SEQ ID NO:14)
GG
[0254] The sequence of the degernerate PCR product and the 5' and
3' RACE product were overlapped to produce a contiguous HAC3
sequence spanning the entire coding region. The entire coding
region can be amplified in a single fragment using primers SEQ ID
NO:3 and 6. The nucleotide and amino acid sequences of hHAC3 are
provided, respectively, in SEQ ID NO: 2 and SEQ ID NO: 1.
[0255] Human HAC3 monomer was expressed according to standard
methodology in oocytes to demonstrate its ability to form cation
channels. HAC3 expresses a cation channel that opens upon
hyperpolarization when expressed in Xenopus oocytes. The current
activates over several seconds at voltage steps more hyperpolarized
than -80 mV, with little or nor inactivation. The reversal
potential of the current lies between -30 and -40 mV, indicating
that HAC3 is a classic I.sub.h channel that passes both sodium and
potassium. HAC3 is distinct from other I.sub.h channels in that its
activation is particularly slow and occurs at more hyperpolarized
potentials.
[0256] Human HAC3 expression patterns were analyzed using northern
blots and mRNA dot blots. Human HAC3 expression was especially high
in the putamen, thalamus, caudate nucleus, medulla, occipital lobe,
substantia nigra, spinal cord and fetal brain.
[0257] Human HAC3 was also expressed at moderate levels in several
tissues, such as the amygdala, cerebellum, cerebral cortex, frontal
lobe, hippocampus, temporal lobe, nucleus accumbens, heart,
stomach, pancreas, pituitary gland, liver and appendix. The colon
and small intestine displayed much higher expression when measured
with mRNA dot blots than with northern blots. Low to trace levels
of expression were found in tissues such as prostate, testis,
adrenal, thyroid gland, salivary gland, kidney, spleen, thymus,
bone marrow, lung trachea, placenta, aorta, skeletal muscles,
bladder, uterus, ovary, mammary glands, peripheral leukocytes and
many fetal tissues. TABLE-US-00004 Sequence Listing SEQ ID NO:
1--human HAC amino acid sequence
MEAEQRPAAGASEGATPGLEAVPPVAPPPATAASGPIPKSGPEPKRRHLGTLLQPTVNKFSLRVFGSHKAVE
IEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFFKEENSPPWIVFNVLSDTFFLLDLVLN
FRTGIVVEEGAEILLAPRAIRTRYLRTWFLVDLISSIPVDYIFLVVELEPRLDAEVYKTARALRIVRFTKIL
SLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPPDCWVSINH
MVNHSWGRQYSHALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQY
QEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFDEESILGELSEPLREEIINFTCRGLVAHMPLFAHA
DPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLARGARDTRLTDGSYFGEICLLTRGRRTA
SVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFETVAMDRLLRIGKKNSILQRKRSEPSPGSSGGIMEQHLVQ
HDRDMARGVRGRAPSTGAQLSGKPVLWEPLVHAPLQAAAVTSNVAIALTHQRGPLPLSPDSPATLLARSAWR
SAGSPASPLVPVRAGPWASTSRLPAPPARTLHASLSRAGRSQVSLLGPPPGGGGRRLGPRGRPLSASQPSLP
QRATGDGSPGRKGSGSERLPPSGLLAKPPRTAQPPRPPVPEPATPRGLQLSANM SEQ ID
NO:2--human HAC3 nucleotide sequence
ATGGAGGCAGAGCAGCGGCCGGCGGCGGGGGCCAGCGAAGGGGCGACCCCTGGACTGGAGGCGGTGCCTCCC
GTTGCTCCCCCGCCTGCGACCGCGGCCTCAGGTCCGATCCCCAAATCTGGGCCTGAGCCTAAGAGGAGGCAC
CTTGGGACGCTGCTCCAGCCTACGGTCAACAAGTTCTCCCTTCGGGTGTTCGGCAGCCACAAAGCAGTGGAA
ATCGAGCAGGAGCGGGTGAAGTCAGCGGGGGCCTGGATCATCCACCCCTACAGCGACTTCCGGTTTTACTGG
GACCTGATCATGCTGCTGCTGATGGTGGGGAACCTCATCGTCCTGCCTGTGGGCATCACCTTCTTCAAGGAG
GAGAACTCCCCGCCTTGGATCGTCTTCAACGTATTGTCTGATACTTTCTTCCTACTGGATCTGGTGCTCAAC
TTCCGAACGGGCATCGTGGTGGAGGAGGGTGCTGAGATCCTGCTGGCACCGCGGGCCATCCGCACGCGCTAC
CTGCGCACATGGTTCCTGGTTGACCTCATCTCTTCTATCCCTGTGGATTACATCTTCCTAGTGGTGGAGCTG
GAGCCACGGTTGGACGCTGAGGTCTACAAAACGGCACGGGCCCTACGCATCGTTCGCTTCACCAAGATCCTA
AGCCTGCTGAGGCTGCTCCGCCTCTCCCGCCTCATCCGCTACATACACCAGTGGGAGGAGATCTTTCACATG
ACCTATGACCTGGCCAGTGCTGTGGTTCGCATCTTCAACCTCATTGGGATGATGCTGCTGCTATGTCACTGG
GATGGCTGTCTGCAGTTCCTGGTGCCCATGCTGCAGGACTTCCCTCCCGACTGCTGGGTCTCCATCAACCAC
ATGGTGAACCACTCGTGGGGCCGCCAGTATTCCCATGCCCTGTTCAAGGCCATGAGCCACATGCTGTGCATT
GGCTATGGGCAGCAGGCACCTGTAGGCATGCCCGACGTCTGGCTCACCATGCTCAGCATGATCGTAGGTGCC
ACATGCTACGCCATGTTCATCGGCCATGCCACGGCACTCATCCAGTCCCTGGACTCTTCCCGGCGTCAGTAC
CAGGAGAAGTACAAGCAGGTGGAGCAGTACATGTCCTTCCACAAGCTGCCAGCAGACACGCGGCAGCGCATC
CACGAGTACTATGAGCACCGCTACCAGGGCAAGATGTTCGATGAGGAAAGCATCCTGGGCGAGCTGAGCGAG
CCGCTTCGCGAGGAGATCATTAACTTCACCTGTCGGGGCCTGGTGGCCCACATGCCGCTGTTTGCCCATGCC
GACCCCAGCTTCGTCACTGCAGTTCTCACCAAGCTGCGCTTTGAGGTCTTCCAGCCGGGGGATCTCGTGGTG
CGTGAGGGCTCCGTGGGGAGGAAGATGTACTTCATCCAGCATGGGCTGCTCAGTGTGCTGGCCCGCGGCGCC
CGGGACACACGCCTCACCGATGGATCCTACTTTGGGGAGATCTGCCTGCTAACTAGGGGCCGGCGCACAGCC
AGTGTTCGGGCTGACACCTACTGCCGCCTTTACTCACTCAGCGTGGACCATTTCAATGCTGTGCTTGAGGAG
TTCCCCATGATGCGCCGGGCCTTTGAGACTGTGGCCATGGATCGGCTGCTCCGCATCGGCAAGAAGAATTCC
ATACTGCAGCGGAAGCGCTCCGAGCCAAGTCCAGGCAGCAGTGGTGGCATCATGGAGCAGCACTTGGTGCAA
CATGACAGAGACATGGCTCGGGGTGTTCGGGGTCGGGCCCCGAGCACAGGAGCTCAGCTTAGTGGAAAGCCA
GTACTGTGGGAGCCACTGGTACATGCGCCCCTTCAGGCAGCTGCTGTGACCTCCAATGTGGCCATTGCCCTG
ACTCATCAGCGGGGCCCTCTGCCCCTCTCCCCTGACTCTCCAGCCACCCTCCTTGCTCGCTCTGCTTGGCGC
TCAGCAGGCTCTCCAGCTTCCCCGCTGGTGCCCGTCCGAGCTGGCCCATGGGCATCCACCTCCCGCCTGCCC
GCCCCACCTGCCCGAACCCTGCACGCCAGCCTATCCCGGGCAGGGCGCTCCCAGGTCTCCCTGCTGGGTCCC
CCTCCAGGAGGAGGTGGACGGCGGCTAGGACCTCGGGGCCGCCCACTCTCAGCCTCCCAACCCTCTCTGCCT
CAGCGGGCAACAGGCGATGGCTCTCCTGGGCGTAAGGGATCAGGAAGTGAGCGGCTGCCTCCCTCAGGGCTC
CTGGCCAAACCTCCAAGGACAGCCCAGCCCCCCAGGCCACCAGTGCCTGAGCCAGCCACACCCCGGGGTCTC
CAGCTTTCTGCCAACATGTAA
[0258]
Sequence CWU 1
1
16 1 774 PRT Homo sapiens human hyperpolarization-activated
voltage-gated cation channel 3 (HAC3) 1 Met Glu Ala Glu Gln Arg Pro
Ala Ala Gly Ala Ser Glu Gly Ala Thr 1 5 10 15 Pro Gly Leu Glu Ala
Val Pro Pro Val Ala Pro Pro Pro Ala Thr Ala 20 25 30 Ala Ser Gly
Pro Ile Pro Lys Ser Gly Pro Glu Pro Lys Arg Arg His 35 40 45 Leu
Gly Thr Leu Leu Gln Pro Thr Val Asn Lys Phe Ser Leu Arg Val 50 55
60 Phe Gly Ser His Lys Ala Val Glu Ile Glu Gln Glu Arg Val Lys Ser
65 70 75 80 Ala Gly Ala Trp Ile Ile His Pro Tyr Ser Asp Phe Arg Phe
Tyr Trp 85 90 95 Asp Leu Ile Met Leu Leu Leu Met Val Gly Asn Leu
Ile Val Leu Pro 100 105 110 Val Gly Ile Thr Phe Phe Lys Glu Glu Asn
Ser Pro Pro Trp Ile Val 115 120 125 Phe Asn Val Leu Ser Asp Thr Phe
Phe Leu Leu Asp Leu Val Leu Asn 130 135 140 Phe Arg Thr Gly Ile Val
Val Glu Glu Gly Ala Glu Ile Leu Leu Ala 145 150 155 160 Pro Arg Ala
Ile Arg Thr Arg Tyr Leu Arg Thr Trp Phe Leu Val Asp 165 170 175 Leu
Ile Ser Ser Ile Pro Val Asp Tyr Ile Phe Leu Val Val Glu Leu 180 185
190 Glu Pro Arg Leu Asp Ala Glu Val Tyr Lys Thr Ala Arg Ala Leu Arg
195 200 205 Ile Val Arg Phe Thr Lys Ile Leu Ser Leu Leu Arg Leu Leu
Arg Leu 210 215 220 Ser Arg Leu Ile Arg Tyr Ile His Gln Trp Glu Glu
Ile Phe His Met 225 230 235 240 Thr Tyr Asp Leu Ala Ser Ala Val Val
Arg Ile Phe Asn Leu Ile Gly 245 250 255 Met Met Leu Leu Leu Cys His
Trp Asp Gly Cys Leu Gln Phe Leu Val 260 265 270 Pro Met Leu Gln Asp
Phe Pro Pro Asp Cys Trp Val Ser Ile Asn His 275 280 285 Met Val Asn
His Ser Trp Gly Arg Gln Tyr Ser His Ala Leu Phe Lys 290 295 300 Ala
Met Ser His Met Leu Cys Ile Gly Tyr Gly Gln Gln Ala Pro Val 305 310
315 320 Gly Met Pro Asp Val Trp Leu Thr Met Leu Ser Met Ile Val Gly
Ala 325 330 335 Thr Cys Tyr Ala Met Phe Ile Gly His Ala Thr Ala Leu
Ile Gln Ser 340 345 350 Leu Asp Ser Ser Arg Arg Gln Tyr Gln Glu Lys
Tyr Lys Gln Val Glu 355 360 365 Gln Tyr Met Ser Phe His Lys Leu Pro
Ala Asp Thr Arg Gln Arg Ile 370 375 380 His Glu Tyr Tyr Glu His Arg
Tyr Gln Gly Lys Met Phe Asp Glu Glu 385 390 395 400 Ser Ile Leu Gly
Glu Leu Ser Glu Pro Leu Arg Glu Glu Ile Ile Asn 405 410 415 Phe Thr
Cys Arg Gly Leu Val Ala His Met Pro Leu Phe Ala His Ala 420 425 430
Asp Pro Ser Phe Val Thr Ala Val Leu Thr Lys Leu Arg Phe Glu Val 435
440 445 Phe Gln Pro Gly Asp Leu Val Val Arg Glu Gly Ser Val Gly Arg
Lys 450 455 460 Met Tyr Phe Ile Gln His Gly Leu Leu Ser Val Leu Ala
Arg Gly Ala 465 470 475 480 Arg Asp Thr Arg Leu Thr Asp Gly Ser Tyr
Phe Gly Glu Ile Cys Leu 485 490 495 Leu Thr Arg Gly Arg Arg Thr Ala
Ser Val Arg Ala Asp Thr Tyr Cys 500 505 510 Arg Leu Tyr Ser Leu Ser
Val Asp His Phe Asn Ala Val Leu Glu Glu 515 520 525 Phe Pro Met Met
Arg Arg Ala Phe Glu Thr Val Ala Met Asp Arg Leu 530 535 540 Leu Arg
Ile Gly Lys Lys Asn Ser Ile Leu Gln Arg Lys Arg Ser Glu 545 550 555
560 Pro Ser Pro Gly Ser Ser Gly Gly Ile Met Glu Gln His Leu Val Gln
565 570 575 His Asp Arg Asp Met Ala Arg Gly Val Arg Gly Arg Ala Pro
Ser Thr 580 585 590 Gly Ala Gln Leu Ser Gly Lys Pro Val Leu Trp Glu
Pro Leu Val His 595 600 605 Ala Pro Leu Gln Ala Ala Ala Val Thr Ser
Asn Val Ala Ile Ala Leu 610 615 620 Thr His Gln Arg Gly Pro Leu Pro
Leu Ser Pro Asp Ser Pro Ala Thr 625 630 635 640 Leu Leu Ala Arg Ser
Ala Trp Arg Ser Ala Gly Ser Pro Ala Ser Pro 645 650 655 Leu Val Pro
Val Arg Ala Gly Pro Trp Ala Ser Thr Ser Arg Leu Pro 660 665 670 Ala
Pro Pro Ala Arg Thr Leu His Ala Ser Leu Ser Arg Ala Gly Arg 675 680
685 Ser Gln Val Ser Leu Leu Gly Pro Pro Pro Gly Gly Gly Gly Arg Arg
690 695 700 Leu Gly Pro Arg Gly Arg Pro Leu Ser Ala Ser Gln Pro Ser
Leu Pro 705 710 715 720 Gln Arg Ala Thr Gly Asp Gly Ser Pro Gly Arg
Lys Gly Ser Gly Ser 725 730 735 Glu Arg Leu Pro Pro Ser Gly Leu Leu
Ala Lys Pro Pro Arg Thr Ala 740 745 750 Gln Pro Pro Arg Pro Pro Val
Pro Glu Pro Ala Thr Pro Arg Gly Leu 755 760 765 Gln Leu Ser Ala Asn
Met 770 2 2325 DNA Homo sapiens human hyperpolarization-activated
voltage-gated cation channel 3 (HAC3) 2 atggaggcag agcagcggcc
ggcggcgggg gccagcgaag gggcgacccc tggactggag 60 gcggtgcctc
ccgttgctcc cccgcctgcg accgcggcct caggtccgat ccccaaatct 120
gggcctgagc ctaagaggag gcaccttggg acgctgctcc agcctacggt caacaagttc
180 tcccttcggg tgttcggcag ccacaaagca gtggaaatcg agcaggagcg
ggtgaagtca 240 gcgggggcct ggatcatcca cccctacagc gacttccggt
tttactggga cctgatcatg 300 ctgctgctga tggtggggaa cctcatcgtc
ctgcctgtgg gcatcacctt cttcaaggag 360 gagaactccc cgccttggat
cgtcttcaac gtattgtctg atactttctt cctactggat 420 ctggtgctca
acttccgaac gggcatcgtg gtggaggagg gtgctgagat cctgctggca 480
ccgcgggcca tccgcacgcg ctacctgcgc acatggttcc tggttgacct catctcttct
540 atccctgtgg attacatctt cctagtggtg gagctggagc cacggttgga
cgctgaggtc 600 tacaaaacgg cacgggccct acgcatcgtt cgcttcacca
agatcctaag cctgctgagg 660 ctgctccgcc tctcccgcct catccgctac
atacaccagt gggaggagat ctttcacatg 720 acctatgacc tggccagtgc
tgtggttcgc atcttcaacc tcattgggat gatgctgctg 780 ctatgtcact
gggatggctg tctgcagttc ctggtgccca tgctgcagga cttccctccc 840
gactgctggg tctccatcaa ccacatggtg aaccactcgt ggggccgcca gtattcccat
900 gccctgttca aggccatgag ccacatgctg tgcattggct atgggcagca
ggcacctgta 960 ggcatgcccg acgtctggct caccatgctc agcatgatcg
taggtgccac atgctacgcc 1020 atgttcatcg gccatgccac ggcactcatc
cagtccctgg actcttcccg gcgtcagtac 1080 caggagaagt acaagcaggt
ggagcagtac atgtccttcc acaagctgcc agcagacacg 1140 cggcagcgca
tccacgagta ctatgagcac cgctaccagg gcaagatgtt cgatgaggaa 1200
agcatcctgg gcgagctgag cgagccgctt cgcgaggaga tcattaactt cacctgtcgg
1260 ggcctggtgg cccacatgcc gctgtttgcc catgccgacc ccagcttcgt
cactgcagtt 1320 ctcaccaagc tgcgctttga ggtcttccag ccgggggatc
tcgtggtgcg tgagggctcc 1380 gtggggagga agatgtactt catccagcat
gggctgctca gtgtgctggc ccgcggcgcc 1440 cgggacacac gcctcaccga
tggatcctac tttggggaga tctgcctgct aactaggggc 1500 cggcgcacag
ccagtgttcg ggctgacacc tactgccgcc tttactcact cagcgtggac 1560
catttcaatg ctgtgcttga ggagttcccc atgatgcgcc gggcctttga gactgtggcc
1620 atggatcggc tgctccgcat cggcaagaag aattccatac tgcagcggaa
gcgctccgag 1680 ccaagtccag gcagcagtgg tggcatcatg gagcagcact
tggtgcaaca tgacagagac 1740 atggctcggg gtgttcgggg tcgggccccg
agcacaggag ctcagcttag tggaaagcca 1800 gtactgtggg agccactggt
acatgcgccc cttcaggcag ctgctgtgac ctccaatgtg 1860 gccattgccc
tgactcatca gcggggccct ctgcccctct cccctgactc tccagccacc 1920
ctccttgctc gctctgcttg gcgctcagca ggctctccag cttccccgct ggtgcccgtc
1980 cgagctggcc catgggcatc cacctcccgc ctgcccgccc cacctgcccg
aaccctgcac 2040 gccagcctat cccgggcagg gcgctcccag gtctccctgc
tgggtccccc tccaggagga 2100 ggtggacggc ggctaggacc tcggggccgc
ccactctcag cctcccaacc ctctctgcct 2160 cagcgggcaa caggcgatgg
ctctcctggg cgtaagggat caggaagtga gcggctgcct 2220 ccctcagggc
tcctggccaa acctccaagg acagcccagc cccccaggcc accagtgcct 2280
gagccagcca caccccgggg tctccagctt tctgccaaca tgtaa 2325 3 24 DNA
Artificial Sequence Description of Artificial Sequence
amplification primer 3 cagccatgga ggcagagcag cggc 24 4 28 DNA
Artificial Sequence Description of Artificial Sequence
amplification primer 4 ggaggagatc tttcacatga catacgac 28 5 24 DNA
Artificial Sequence Description of Artificial Sequence
amplification primer 5 agtaggatcc atcggtgagg cgtg 24 6 27 DNA
Artificial Sequence Description of Artificial Sequence
amplification primer 6 ttacatgttg gcagaaagct ggagacc 27 7 29 DNA
Artificial Sequence Description of Artificial Sequencedegenerate
amplification primer modified_base (24) n = g, a, c or t 7
tgggaggaga tcttycayat gacntayga 29 8 27 DNA Artificial Sequence
Description of Artificial Sequencedegenerate amplification primer
modified_base (16) n = g, a, c or t modified_base (25) n = g, a, c
or t 8 cgtctcgaat gcccknckca tcatngg 27 9 26 DNA Artificial
Sequence Description of Artificial Sequencefirst round 5' RACE gene
specific primer 9 cctgctgccc atagccaatg cacagc 26 10 25 DNA
Artificial Sequence Description of Artificial Sequencesecond round
nested 5' RACE gene specific primer 10 gcaccacgaa ctgcagacag ccatc
25 11 27 DNA Artificial Sequence Description of Artificial
Sequencenested 3' RACE gene specific reamplification primer 11
gttctcacca agctgcgctt tgaggtc 27 12 25 DNA Artificial Sequence
Description of Artificial Sequencenested 3' RACE gene specific
primer 12 ccagcatggg ctgctcagtg tgctg 25 13 25 DNA Artificial
Sequence Description of Artificial Sequencenested 3' RACE gene
specific primer 13 gcccactctc agcctcccaa ccctc 25 14 37 DNA
Artificial Sequence Description of Artificial Sequencenested 3'
RACE gene specific primer 14 cccaaccaag cttgcctcag cgggcaacag
gcgatgg 37 15 875 PRT Homo sapiens human
hyperpolarization-activated voltage-gated cation channel 1 (HAC1)
15 Met Asp Ala Arg Gly Gly Gly Gly Arg Pro Gly Glu Ser Pro Gly Ala
1 5 10 15 Thr Pro Ala Pro Gly Pro Pro Pro Pro Pro Pro Ala Pro Pro
Pro Gly 20 25 30 Pro Gly Pro Ala Pro Pro Gln His Pro Pro Arg Ala
Glu Ala Leu Pro 35 40 45 Pro Glu Ala Ala Asp Glu Gly Gly Pro Arg
Gly Arg Leu Arg Ser Arg 50 55 60 Asp Ser Ser Cys Gly Arg Pro Gly
Thr Pro Gly Ala Ala Ser Thr Ala 65 70 75 80 Lys Gly Ser Pro Asn Gly
Glu Cys Gly Arg Gly Glu Pro Gln Cys Ser 85 90 95 Pro Ala Gly Pro
Glu Gly Pro Ala Arg Gly Pro Lys Val Ser Phe Ser 100 105 110 Cys Arg
Gly Ala Ala Ser Gly Pro Ala Pro Gly Pro Gly Pro Ala Glu 115 120 125
Glu Ala Gly Ser Glu Glu Ala Gly Pro Ala Gly Glu Pro Arg Gly Ser 130
135 140 Gln Ala Ser Phe Met Gln Arg Gln Phe Gly Ala Leu Leu Gln Pro
Gly 145 150 155 160 Val Asn Lys Phe Ser Leu Arg Met Phe Gly Ser Gln
Lys Ala Val Glu 165 170 175 Arg Glu Gln Glu Arg Val Lys Ser Ala Gly
Ala Trp Ile Ile His Pro 180 185 190 Tyr Ser Asp Phe Arg Phe Tyr Trp
Asp Phe Thr Met Leu Leu Phe Met 195 200 205 Val Gly Asn Leu Ile Ile
Ile Pro Val Gly Ile Thr Phe Phe Lys Asp 210 215 220 Glu Thr Thr Ala
Pro Trp Ile Val Phe Asn Val Val Ser Asp Thr Phe 225 230 235 240 Phe
Leu Met Asp Leu Val Leu Asn Phe Arg Thr Gly Ile Val Ile Glu 245 250
255 Asp Asn Thr Glu Ile Ile Leu Asp Pro Glu Lys Ile Lys Lys Lys Tyr
260 265 270 Leu Arg Thr Trp Phe Val Val Asp Phe Val Ser Ser Ile Pro
Val Asp 275 280 285 Tyr Ile Phe Leu Ile Val Glu Lys Gly Ile Asp Ser
Glu Val Tyr Lys 290 295 300 Thr Ala Arg Ala Leu Arg Ile Val Arg Phe
Thr Lys Ile Leu Ser Leu 305 310 315 320 Leu Arg Leu Leu Arg Leu Ser
Arg Leu Ile Arg Tyr Ile His Gln Trp 325 330 335 Glu Glu Ile Phe His
Met Thr Tyr Asp Leu Ala Ser Ala Val Met Arg 340 345 350 Ile Cys Asn
Leu Ile Ser Met Met Leu Leu Leu Cys His Trp Asp Phe 355 360 365 Cys
Leu Gln Phe Leu Val Pro Met Leu Gln Asp Phe Pro Arg Asn Cys 370 375
380 Trp Val Ser Ile Asn Gly Met Val Asn His Ser Trp Ser Glu Leu Tyr
385 390 395 400 Ser Phe Ala Leu Phe Lys Ala Met Ser His Met Leu Cys
Ile Gly Tyr 405 410 415 Gly Arg Gln Ala Pro Glu Ser Met Thr Asp Ile
Trp Leu Thr Met Leu 420 425 430 Ser Met Ile Val Gly Ala Thr Cys Tyr
Ala Met Phe Ile Gly His Ala 435 440 445 Thr Ala Leu Ile Gln Ser Leu
Asp Ser Ser Arg Arg Gln Tyr Gln Glu 450 455 460 Lys Tyr Lys Gln Val
Glu Gln Tyr Met Ser Phe His Lys Leu Pro Ala 465 470 475 480 Asp Phe
Arg Gln Lys Ile His Asp Tyr Tyr Glu His Arg Tyr Gln Gly 485 490 495
Lys Met Phe Asp Glu Asp Ser Ile Leu Gly Glu Leu Asn Gly Pro Leu 500
505 510 Arg Glu Glu Ile Val Asn Phe Asn Cys Arg Lys Leu Val Ala Ser
Met 515 520 525 Pro Leu Phe Ala Asn Ala Asp Pro Asn Phe Val Thr Ala
Met Leu Thr 530 535 540 Lys Leu Lys Phe Glu Val Phe Gln Pro Gly Asp
Tyr Ile Ile Arg Glu 545 550 555 560 Gly Thr Ile Gly Lys Lys Met Tyr
Phe Ile Glx His Gly Val Val Ser 565 570 575 Val Leu Thr Lys Gly Asn
Lys Glu Met Lys Leu Ser Asp Gly Ser Tyr 580 585 590 Phe Gly Glu Ile
Cys Leu Leu Thr Arg Gly Arg Arg Thr Ala Ser Val 595 600 605 Arg Ala
Asp Thr Tyr Cys Arg Leu Tyr Ser Leu Ser Val Asp Asn Phe 610 615 620
Asn Glu Val Leu Glu Glu Tyr Pro Met Met Arg Arg Ala Phe Glu Thr 625
630 635 640 Val Ala Ile Asp Arg Leu Asp Arg Ile Gly Lys Lys Asn Ser
Ile Leu 645 650 655 Leu His Lys Val Gln His Asp Leu Asn Ser Gly Val
Phe Asn Asn Gln 660 665 670 Glu Asn Ala Ile Ile Gln Glu Ile Val Lys
Tyr Asp Arg Glu Met Val 675 680 685 Gln Gln Ala Glu Leu Gly Gln Arg
Val Gly Leu Phe Pro Pro Pro Pro 690 695 700 Pro Pro Pro Gln Val Thr
Ser Ala Ile Ala Thr Leu Gln Gln Ala Ala 705 710 715 720 Ala Met Ser
Phe Cys Pro Gln Val Ala Arg Pro Leu Val Gly Pro Leu 725 730 735 Ala
Leu Gly Ser Pro Arg Leu Val Arg Arg Pro Pro Pro Gly Pro Ala 740 745
750 Pro Ala Ala Ala Ser Pro Gly Pro Pro Pro Pro Ala Ser Pro Pro Gly
755 760 765 Ala Pro Ala Ser Pro Arg Ala Pro Arg Thr Ser Pro Tyr Gly
Gly Leu 770 775 780 Pro Ala Ala Pro Leu Ala Gly Pro Ala Leu Pro Ala
Arg Arg Leu Ser 785 790 795 800 Arg Ala Ser Arg Pro Leu Ser Ala Ser
Gln Pro Ser Leu Pro His Gly 805 810 815 Ala Pro Gly Pro Ala Ala Ser
Thr Arg Pro Ala Ser Ser Ser Thr Pro 820 825 830 Arg Leu Gly Pro Thr
Pro Ala Ala Arg Ala Ala Ala Pro Ser Pro Asp 835 840 845 Arg Arg Asp
Ser Ala Ser Pro Gly Ala Ala Gly Gly Leu Asp Pro Gln 850 855 860 Asp
Ser Ala Arg Ser Arg Leu Ser Ser Asn Leu 865 870 875 16 749 PRT Homo
sapiens human hyperpolarization-activated voltage-gated cation
channel 2 (HAC2) missing amino terminus 16 Lys Glu Gln Glu Arg Val
Lys Thr Ala Gly Phe Trp Ile Ile His Pro 1 5 10 15 Tyr Ser Asp Phe
Arg Phe Tyr Trp Asp Leu Ile Met Leu Ile Met Met 20 25 30 Val Gly
Asn Leu Val Ile Ile Pro Val Gly Ile Thr Phe Phe Thr Glu 35
40 45 Gln Thr Thr Thr Pro Trp Ile Ile Phe Asn Val Ala Ser Asp Thr
Val 50 55 60 Phe Leu Leu Asp Leu Ile Met Asn Phe Arg Thr Gly Thr
Val Asn Glu 65 70 75 80 Asp Ser Ser Glu Ile Ile Leu Asp Pro Lys Val
Ile Lys Met Asn Tyr 85 90 95 Leu Lys Ser Trp Phe Val Val Asp Phe
Ile Ser Ser Ile Pro Val Asp 100 105 110 Tyr Ile Phe Leu Ile Val Glu
Lys Gly Met Asp Ser Glu Val Tyr Lys 115 120 125 Thr Ala Arg Ala Leu
Arg Ile Val Arg Phe Thr Lys Ile Leu Ser Leu 130 135 140 Leu Arg Leu
Leu Arg Leu Ser Arg Leu Ile Arg Tyr Ile His Gln Trp 145 150 155 160
Glu Glu Ile Phe His Met Thr Tyr Asp Leu Ala Ser Ala Val Val Arg 165
170 175 Ile Phe Asn Leu Ile Gly Met Met Leu Leu Leu Cys His Trp Asp
Phe 180 185 190 Cys Leu Gln Phe Leu Val Pro Leu Leu Gln Asp Phe Pro
Pro Asp Cys 195 200 205 Trp Val Ser Leu Asn Glu Met Val Asn Asp Ser
Trp Gly Lys Gln Tyr 210 215 220 Ser Tyr Ala Leu Phe Lys Ala Met Ser
His Met Leu Cys Ile Gly Tyr 225 230 235 240 Gly Ala Gln Ala Pro Val
Ser Met Ser Asp Leu Trp Ile Thr Met Leu 245 250 255 Ser Met Ile Val
Gly Ala Thr Cys Tyr Ala Met Phe Val Gly His Ala 260 265 270 Thr Ala
Leu Ile Gln Ser Leu Asp Ser Ser Arg Arg Gln Tyr Gln Glu 275 280 285
Lys Tyr Lys Gln Val Glu Gln Tyr Met Ser Phe His Lys Leu Pro Ala 290
295 300 Asp Met Arg Gln Lys Ile His Asp Tyr Tyr Glu His Arg Tyr Gln
Gly 305 310 315 320 Lys Ile Phe Asp Glu Glu Asn Ile Leu Asn Glu Leu
Asn Asp Pro Leu 325 330 335 Arg Glu Glu Ile Val Asn Phe Asn Cys Arg
Lys Leu Val Ala Thr Met 340 345 350 Pro Leu Phe Ala Asn Ala Asp Pro
Asn Phe Val Thr Ala Met Leu Ser 355 360 365 Lys Leu Arg Phe Glu Val
Phe Gln Pro Gly Asp Tyr Ile Ile Arg Glu 370 375 380 Gly Ala Val Gly
Lys Lys Met Tyr Phe Ile Glx His Gly Val Ala Gly 385 390 395 400 Val
Ile Thr Lys Ser Ser Lys Glu Met Lys Leu Thr Asp Gly Ser Tyr 405 410
415 Phe Gly Glu Ile Cys Leu Leu Thr Lys Gly Arg Arg Thr Ala Ser Val
420 425 430 Arg Ala Asp Thr Tyr Cys Arg Leu Tyr Ser Leu Ser Val Asp
Asn Phe 435 440 445 Asn Glu Val Leu Glu Glu Tyr Pro Met Met Arg Arg
Ala Phe Glu Thr 450 455 460 Val Ala Ile Asp Arg Leu Asp Arg Ile Gly
Lys Lys Asn Ser Ile Leu 465 470 475 480 Leu Gln Lys Phe Gln Lys Asp
Leu Asn Thr Gly Val Phe Asn Asn Gln 485 490 495 Glu Asn Glu Ile Leu
Lys Gln Ile Val Lys His Asp Arg Glu Met Val 500 505 510 Gln Ala Ile
Ala Pro Ile Asn Tyr Pro Gln Met Thr Thr Leu Asn Ser 515 520 525 Thr
Ser Ser Thr Thr Thr Pro Thr Ser Arg Met Arg Thr Gln Ser Pro 530 535
540 Pro Val Tyr Thr Ala Thr Ser Leu Ser His Ser Asn Leu His Ser Pro
545 550 555 560 Ser Pro Ser Thr Gln Thr Pro Gln Pro Ser Ala Ile Leu
Ser Pro Cys 565 570 575 Ser Tyr Thr Thr Ala Val Cys Ser Pro Pro Val
Gln Ser Pro Leu Ala 580 585 590 Ala Arg Thr Phe His Tyr Ala Ser Pro
Thr Ala Ser Gln Leu Ser Leu 595 600 605 Met Gln Gln Gln Pro Gln Gln
Gln Val Gln Gln Ser Gln Pro Pro Gln 610 615 620 Arg Gln Pro Gln Gln
Pro Ser Pro Gln Pro Gln Thr Pro Gly Ser Ser 625 630 635 640 Thr Pro
Lys Asn Glu Val His Lys Ser Thr Gln Ala Leu His Asn Thr 645 650 655
Asn Leu Thr Arg Glu Val Arg Pro Phe Ser Ala Trp Gln Pro Ser Leu 660
665 670 Pro His Glu Val Ser Thr Leu Ile Ser Arg Pro His Pro Thr Val
Gly 675 680 685 Glu Ser Leu Ala Ser Ile Pro Gln Pro Val Thr Ala Val
Pro Gly Thr 690 695 700 Gly Leu Gln Ala Gly Gly Arg Ser Thr Val Pro
Gln Arg Val Thr Phe 705 710 715 720 Phe Arg Gln Met Ser Ser Gly Ala
Ile Pro Pro Asn Arg Gly Val Leu 725 730 735 Pro Ala Pro Leu Pro Leu
Ile Thr Pro His Pro Lys Lys 740 745
* * * * *
References